1KK1A

Structure of the large gamma subunit of initiation factor eif2 from pyrococcus abyssi-g235d mutant complexed with gdpnp-mg2+
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
405
structure length
397
Chain Sequence
SRQAEVNIGMVGHVDHGKTTLTKALTGVWTDSEELRRGITIKIGFADAEIRRCPNCGRYSTSPVCPYCGHETEFVRRVSFIDAPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIEGTVAENAPIIPISALHGANIDVLVKAIEDFIPTPKRDPNKPPKMLVLRSFDVNKPGKLVGGVLDGSIVQGKLKVGDEIEIRPGVPYEEHGRIKYEPITTEIVSLQAGGQFVEEAYPGGLVGVGTKLDPYLTKGDLMAGNVVGKPGKLPPVWDSLRLEVHLLERVVEQELKVEPIKRKEVLLLNVGTARTMGLVTGLGKDEIEVKLQIPVCAEPGDRVAISRQIGSRWRLIGYGIIKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords eIF2gamma
publication title The large subunit of initiation factor aIF2 is a close structural homologue of elongation factors.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Translation
total genus 99
structure length 397
sequence length 405
ec nomenclature
pdb deposition date 2001-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1kk1A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1kk1A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kk1A01
4ITRC 3VKGA 1HYQA 5LBIA 1FW6A 4Y0AA 4ABYA 1I2DA 2FH5B 2SHKA 3GLFB 2RC5A 3CF6R 4L16A 4OK3A 4DDVA 3ZDQA 5KSZA 2XNDA 3GLIA 1EGAA 3TNFA 2PBRA 1P73A 4FI3C 1XJ0A 1EWQA 4Q1DA 3QE0A 4LRWA 3KJEA 2ODEA 1EP2B 4PXAA 1JA1A 3FTQA 5KDLA 4LJ5A 2WOOA 2CVFA 2HXYA 4QNMA 1FNBA 3R8FA 4CEHB 1EFHA 3KTAB 2IHYA 3EC1A 1P2SA 4BASA 3DHWC 1D2NA 1VHLA 2ODWA 2RMKA 2GEUA 3ZBTA 1DDGA 5TY0A 4A2QA 4NU0A 2PL3A 3BWDD 1CJTC 3ZIAA 1CRQA 4M1WA 4DLYA 2DCUA 2ZRHA 1XFAA 4B6FA 4A36A 4N3NA 1M8PA 1JQLB 5IF9A 3MLEA 2IXGA 4IHQA 1Z2AA 2QM8A 3TGPA 3QPUA 3O8DA 5AUQA 4M1TA 4GL2A 2C96A 3LX5A 4AK9A 3AEZA 3K1JA 3M6AA 2JDIA 1SVIA 2GILA 3C5CA 1YU9A 3W3AA 3TRFA 3VFDA 4BFTA 5JWHA 4CYMA 2X2EA 3THOA 3UMFA 3EZFA 2ZE6A 4YXWD 2J7PA 4E03A 1UEIA 5EXTA 2W2XA 3QF4A 4UQOA 421PA 5IT5A 5CYOA 1OH5A 1SKQA 1Q1QA 2D74A 3N2IA 3CCUB 4Q1BA 3ND8A 3VR1A 3R9XA 4M2LA 3F3YA 2FSGA 3SYNA 4HUQB 1H85A 3EW9A 4HYYA 4TSFA 3VR3A 4C0HA 3FJOA 1SVKA 5EUQB 4BFYA 2PJRA 3HU3A 4M1KA 2QP3A 4BE7B 2KSQA 4LHWA 2DWOA 3T5GA 2JJ2D 1MABA 1ZNWA 3CC4B 2D2FA 3IILA 4TQUS 2G83A 4Y7CA 1Z29A 3I73A 3DEFA 4PHGA 2CNWA 2VSOA 5HE9A 4BRWA 4CGZA 1II8A 3X1XA 5GV7A 1EG7A 1MT0A 2PZFA 2HT1A 5FTNA 1OB5A 4LHZA 4OQMA 2EFCB 2OFXA 1FNMA 4Q4HA 4Z51A 4ZPXA 4YONB 2CCKA 4Q1CA 4M9XA 1Z6GA 2YINC 2VHQA 1T4GA 1NLYA 3CPEA 4B2PA 1KMQA 2VP6A 3VR2A 4JLBA 4A9AA 4DCUA 1ZYUA 1TUEA 3REGA 1GZSA 2XSZD 4ACBA 1R8QA 3T12A 2NPIA 1G6OA 1E9AA 2RAPA 3RRYA 3PEYA 2BDTA 5B57C 1P7CA 2F9LA 2OT3B 3QKRB 1NBMD 1LW7A 5KPDA 2HDNB 2R65A 3CRRA 5KNBA 2MSCB 2VEDA 1DAFA 1E32A 3LD9A 1IXZA 4EAQA 2CHVA 5KU1A 1Q22A 1HURA 5FUYA 1N5IA 1S4QA 3KJGA 2JIZA 3WRXC 2UVQA 2FA9A 2JAQA 2BBOA 3QBVA 3SJAA 1JEEA 4WZ6A 3KXKA 4QBFA 3CO5A 3RAPR 1W7AA 2QAJA 5F9FA 2GZDA 3A6PC 1XJCA 1VTKA 3CRW1 2HLDA 4JJKA 4C0KA 1ZD8A 3OAAD 2Q9AA 2GF9A 2IYZA 1W0KD 2GK7A 2O0KA 4X8OA 2ZVQX 2C9CA 2XTNA 1SVOA 1P2VA 1YZKA 4URXR 1JBKA 2ZI4A 2YVUA 3TR5A 4CW7A 2V8OA 3BK7A 3MGCA 3Q85A 1FX0B 1A2BA 1U9IC 3TSOA 1EESA 3HPRA 5DYIA 1SKYE 3VNVA 2VNHA 1EWRA 1FQJA 2FPLA 2VIIA 1G3MA 3BS4A 4JLJA 3LW7A 5K8TA 2C95A 3NBZC 4QOSA 3A1WA 4PFSA 1OIVA 1G19A 4AWXA 3IEVA 4XD7A 5E3HA 1QHXA 1GKIA 1UF9A 1KRHA 1ZP6A 1GNQA 4P4TA 5EZ6B 1B23P 1KOFA 4JYCA 4ZDIA 5F2EA 2ERXA 2QDXA 2ZEJA 4GMDA 4M21A 2PZEA 3UMSA 1VCNA 3K70B 2N1BA 1NSTA 2IYLD 3IUYA 5G3ZA 1U94A 1RYFA 1KZ7B 4TWZA 1E9CA 2OXCA 5SZJA 4IW3B 4TMTA 1Z28A 4NYIR 2PEZA 1TLLA 2JGNA 1Z2CA 4JBXA 4M9SA 4NE2A 5JS8A 5K8IA 4K1XA 1IN8A 2A3RA 2RH5A 4M53A 1MR3F 4TYPA 3CR8A 5JECA 5DISB 4BFZA 2W2VA 4Q4AB 3KXLA 1TF2A 5IDVA 2PX3A 4C0AC 4LC1A 4O3MA 3OFNA 4JBYA 1NMYA 3KX2A 4QGHA 5J4HA 3U6KA 1S3GA 4A82A 1TF7A 3T1TA 4IRUB 4RZXA 4Z8XA 4Z1MA 2O0JA 2JA1A 1GWNA 3HU1A 1IN5A 2J7KA 1KI4A 4Q1FA 2W83A 3AKDA 2FPKA 3EIEA 3CZQA 3RDPA 3DMDA 1XMIA 2J0QA 3UATA 3K0FA 1F2TA 4OHWA 3JQQA 1AN0A 2C03A 3TVDA 1Q44A 1JR6A 4OHZA 2EYUA 2JATA 3NDPA 4XVRA 1E69A 2V6IA 3AQ4A 2B21A 4JLKA 4B3BA 2F1IA 5EE1A 2FZ4A 4V0LA 1CXZA 1GL6A 1T9HA 3SQXA 3OEED 4HLUC 5FTLA 2D62A 1KI6B 5D3MA 4TTPA 3A1UA 4LJAA 1SXJA 4Q9JA 2P2LA 4MKIA 4MH0R 1XCMA 3KKPA 2BJVA 3SE0A 4EQ6A 3EPLA 5TMPA 1E62A 3AF1A 1N6IA 1ZIPA 2FFHA 2RGBA 3A4LA 3OEHA 4F92B 2QTFA 2QORA 5HE8A 1GP2A 2ZRDA 3LRPA 2ZI7A 4A6XA 1DDIA 1SVSA 2OSBA 1QF9A 1UM8A 3TMKA 1T5IA 3GLGE 4LBYA 1T5LA 4KO8A 5CJ2A 3AVUA 2F3RA 4HEJA 2O8FB 4HZUA 1ZM9A 4TT3D 3TK1A 1P2UA 2H17A 3L8YA 2XX3A 5HCIA 3NH9A 3FHOA 1W5TA 4PPQA 5BQ5A 4IXMA 2HYDA 3FMIA 4P32A 3AP2A 1KI2A 4A0RA 4BGDA 2QAGA 3HYRA 1XEWY 5KDOA 1KO4A 2AR7A 1G16A 2WKPA 5FOTA 1BMFA 5C46F 1SVLA 3EIQA 5J4VA 1COWD 1QHIA 2F6RA 2X2FA 1O3YA 4PAQA 4QHSA 4QBIA 1VDZA 4A0HA 2VRWA 3B6EA 4G3XA 2EFHB 2OEPA 1W87A 3JZAA 3G4SB 1J7KA 1G5RA 1XNJA 3HU2A 1AIPA 1KO5A 1OIWA 3PV0A 3AGQA 4RD3A 4I1SA 4F38A 2BMEA 4OHYA 3G71B 1EFRA 2ZUCA 4LOAA 1W0JA 1KK1A 4TMVA 2IXEA 1P75A 4HAWA 1OFIA 1P60A 4A92A 1HE1C 3GEIA 4UKDA 4EJSA 5G40A 1XX6A 2QENA 1D1NA 1S9HA 1E9FA 4QGAA 2L0XA 2ODBA 1CJUC 2XOKA 3K0AA 5FL7A 4LY6A 4Z8YA 4TTQA 1NNEA 1OKKD 5ANRB 1E6CA 1D8TA 1UKYA 2Q9BA 3X1YA 2XTMA 3RS0A 2IYSA 4ZDKA 1VCMA 2O8CB 3ZQ6A 4EFNA 2LKDA 2YV5A 5J4KA 4DHEA 5DHFA 2WPDD 4DVGA 2ZRLA 1CR1A 4FIDA 1UJ2A 3OZVA 4JKYA 2WWFA 4N0DA 4URVR 4DUGD 3NC1C 4A2WA 3M4YA 4F4JA 1NVVQ 8OHMA 4JKIA 5FBWB 2G0NA 4W5HA 5EXPA 1EP3B 1UMKA 4MUAA 4QG7A 1E2FA 1NN1A 3CR7A 1NSFA 4MYTA 4OJQA 1YJWB 1Z0JA 3K09A 2WWWA 2O8DA 4ZCLA 3BFXA 2ZI5A 2WM9B 3BB1A 4KLZA 1QX4A 3K8YA 4XWAA 2GBLC 1ZUNB 3N2EA 3QFCA 1KHTA 2FOLA 1EFTA 2QMOA 1TQDA 1MV5A 2QUZA 1EK0A 4MYCA 3QEJA 1KC8D 4NCIA 1Z6XA 1G291 1XTSA 4Q5IA 5FI1B 1E0AA 2QSZA 1S72B 1KAGA 3EA0A 4HDOB 2P6UA 1CIPA 2DETA 1VG0B 4GP7A 2EQBA 4FMBB 4UNQA 1P6XA 4M0LA 4PANA 1JR3D 3I61A 4B47A 3K70D 2ZI6A 4ARZB 4PO9A 3B1YA 5L3RA 4KITB 4AKIA 2BGJA 5KSYA 2RB4A 3R20A 4D0GA 1G3QA 3BH0A 1KSHA 5P21A 1E0KA 4LI0A 4A15A 3ZZ0A 1G5PA 3E1YE 1WE2A 2N46A 4RSGA 2QQEA 2K5UA 1N8RD 1JPJA 4NYIQ 2NQ2C 1BX0A 1N25A 3SC3A 1QFZA 2NO6A 4Q18A 1B2RA 4KBGA 1N5LA 2HEIA 4W5WA 3U3KA 1E4VA 1Y3AA 2EFGA 3JVVA 3TLXA 2G77B 2ZE7A 3KFXA 3FKSD 1KJZA 4C0SA 1VYVA 3H2YA 5EUMA 4OYHA 4KBFA 4GZMA 5F9HA 1US8B 5EE3A 2OAP1 4IDNA 1XZPA 4IDPA 3EPJA 1ZM3A 4F91B 3VKHA 2DEUA 2IWHA 3ZVNA 1UAAA 1OF1A 3FGNA 1QRAA 2HXSA 2GEVA 2OHFA 2OK8A 5F3WB 2FG5A 1KNXA 4DIDA 4BLQA 2ZI9A 1VG8A 4AD8A 3RC8A 4LV5B 1S1CA 5FOVA 3EWAA 1K5DA 5DE3A 2EWWA 3QFSA 4NPHA 3W6NA 2CBZA 4U02A 3FOZA 1DO0A 2BSAA 1IAQA 3AKCA 1UKVY 2QE7D 1N6RA 1GKUB 2QTVB 3I4LA 2CLSA 5FR2A 3U44A 2OUKA 3NBYC 4GNKA 1MO5A 3OJWA 4BZPA 1CKEA 1OJLA 1OFUX 4Q9KA 2F7SA 4LK2A 4BLTA 2Y8EA 1TF5A 1N6KA 4TL8A 1E2GA 2A2ZA 3IBGA 1IB0A 4HAZA 4IFEA 3GJ0A 2JEOA 3GJ6A 5IRCD 2Z4SA 1ELOA 1SZPA 2HUPA 4JYBA 3IPYA 4DSUA 1NVWQ 1L7VC 5AUOB 4LYHA 4RFSB 1U0JA 2XAUA 2YWHA 1OH6A 2IT1A 3KKMA 1SXJC 3CKLA 3CIOA 1WP9A 1BH2A 2WWIA 1YE8A 1NLZA 3BORA 3SJZA 5AK0A 3TJZA 1LF0A 3RRZA 4BECA 2I1QA 4MYHA 3MAAC 2XXAA 1SKYB 1NG1A 1BKDR 1XTQA 3B1WA 3BB4A 4PC1A 1R10A 3DKVA 3PEVA 2QEQA 3CCSB 5B30A 1MH1A 1PJRA 4RJLA 2H5EA 5CDFE 4H1UA 2CCGA 1OHHD 5FPYA 3CPJB 4I1VA 3SS8A 4ZCMA 1E2HA 3AF4A 3SYLA 2WOJA 3I3SR 3IBYA 4XOIA 5DIFA 1PVOA 1CR2A 1OXXK 4RD1A 1G8PA 2CE2X 2F43B 4JLMA 1S9DA 1LTQA 2ONJA 4M1SA 4F4IA 4ACAA 2AD1A 3TUJC 2DR3A 1YHQB 1NMZA 4JVMA 3B9PA 2OZEA 4XTCS 3QEOA 4CEJA 5FFMA 2C78A 2FFBA 4URUR 3CLVA 3W2FA 2Z0MA 5L3SA 2UZ3A 1SM4A 3CB4A 4C7OA 2IW3A 2WWYA 1ZJ6A 1KGDA 3MSXA 3DZ8A 1FRQA 1G5TA 2MSDB 1VPLA 3L0PA 3VO2A 2FPMA 3DO6A 1PUIA 3H84A 4BFWA 4G5OA 3W5IA 4D26A 2AK3A 5FUWA 3CH4B 1CEEA 1XEXB 4DLSA 2PMDA 3H4MA 4EJSC 1DAGA 2DFLA 4OQNA 3EPKA 1XPRA 1Q12A 2EFEB 3AKYA 2ZRKA 4TLEA 4Y9UA 1GDDA 3LNCA 5B58C 1GITA 3QF7A 2XEXA 1BJKA 4D6PA 2ZRGA 1D5CA 4GOXA 2J0VA 4JZKA 4Q03A 2WVJA 3AVOA 3MRSA 5DO9A 4A6PA 1W36B 3WNBA 1EX7A 4G5SA 3WP0A 4CRWB 3U60B 1NY5A 4YLGA 1E2JA 2QL6A 3VU9B 5FUVA 1DG3A 1FNDA 4JLNA 4AYXA 2GCOA 1IY1A 2B5OA 1EFUA 1G21E 3MWLA 4B34A 2ZJAA 1ZC3A 4Q4JB 4AYWA 4V0ME 3CRQA 2FEOA 1JAIA 3EXAA 3NC0C 3X2SA 2GF0A 2H16A 4YC7A 1SXJE 3GLGB 3GMTA 1H8HD 4MKFA 2ZSAA 5F98A 4WA7A 3X1ZA 4GT1A 3GEHA 1U8AA 3K09C 2VTKA 2VP0A 2GETA 1XE1A 3AF3A 3ND9A 1L4UA 2WKQA 4A8JA 1AMOA 2ZREA 3D31A 3GJXC 2IX3A 1QBKC 4NCJA 4X8LA 2AHOA 1BOFA 2A5DA 2ZIAA 5IK2D 1KAOA 3R7WB 1V5WA 4KODA 1W47A 1VCIA 2OAQ1 4QC2A 3CRMA 3QG1A 1F2UA 2AD5A 4EKDA 3KUDA 4H1VA 4PSKA 4N3GA 4PZZA 1U8ZA 5FPSA 4TYYA 3MUFA 3IIKA 4FN5A 1X1RA 5KSOA 4JLAA 2ERYA 4NYMQ 1E9SA 4JL6A 4K81B 1KYIA 5BYJA 4YMUA 2ZYTX 1KI1A 2DYKA 4KYUA 1IN4A 1P72A 4Q47A 4E22A 2E1RA 3NG1A 1DVRA 3ZBUA 3L43A 2FV8A 4NHOA 3OF5A 4B3CA 4URWR 1Q86D 1H8ED 2YYZA 1YIJB 5JFGA 4YXWA 2GZAA 1II9A 1E64A 3PEUA 4BEJA 4YAFA 1NIPA 4UJ3A 4G01B 5FL3A 3W3ZB 2GXAA 2XNCA 1J9ZA 2YOGA 1F6BA 2AN9A 1AKYA 1Q82D 3B13B 3IEUA 2AFIE 2YOFA 2VHUA 1KI3A 2JJ2A 3QKSA 4R2IA 1R0XA 3T5DA 3BIFA 4NYJR 5HR5A 1XPUA 1TQ6A 3KKOA 5GVRA 3ZJYA 3GJ3A 3U7FB 2XJ9A 3QUSA 1CR4A 1GVHA 1NDHA 1JECA 3AP1A 3U3OA 3QQ5A 4LC0A 2YC2C 1Z07A 3LQRA 1KIMA 2AWOA 1LFDB 4IOJA 3TBKA 3D6TB 4P4UA 4U9UA 2FNAA 1UBGA 1L2TA 3BRWD 2YC4C 3CH5A 2OCPA 2GXSA 2NZ8A 2XSZA 4Q48A 3UPUA 2ZJ8A 2GAOA 5DI3B 4NDZA 3G5UA 5M04A 5AR1A 5DN6D 1XD2A 2DFTA 1IY0A 1GAQA 1NBMA 4JT4A 3U7EB 2A30A 1IONA 4HDCA 3Q7QA 4QBHA 4QHYA 2R6HA 4URZR 4DLXA 5EJEA 4U7DA 1VG9B 2CLDX 4KXFB 2KBEA 1M7BA 2CJWA 4XWKA 4ZKDA 1VYUA 2BMFA 4P6VF 1ANKA 2J9RA 4HLUA 4JLOA 4RZ3A 1X6VA 2O52A 2OTLB 4DDTA 4OK5A 2OV2A 4PTLA 4A4DA 5A5GA 3FWYA 3QIAA 4AURA 4KFTA 3QF4B 1Z08A 1OGIA 2EW1A 2NOAA 3MJHA 1HV8A 3OIVA 4P0TA 2ZJYA 3RSOA 3S1AA 4BQSA 4BPRA 1E9EA 4D81A 5AJXA 3W5JA 4ZV4A 3SN6A 4N0EA 3PCRB 3WYGA 3ZGXA 5JMTA 1MABB 2XZLA 2PT5A 3NHAA 1E79D 4PZYA 3QXJA 3AM1A 5BYKA 1T0HB 4DEXA 1KDRA 5TR9A 3W9YA 3UG6A 1FUUA 4B76A 1W5SA 4NTZA 2BM1A 1II8B 1ZNXA 3D7MA 3QFRA 2ZRBA 4I4LA 3LX8A 3PUVA 3K9LA 2HV8A 4MUBA 1KTVA 4US1R 4BFSA 3ADCA 4Q7JB 3U4QA 2VA8A 3U2QA 4B6EA 1ZBDA 3ONWA 1WQ1R 2Q3HA 2ZE5A 3WHLA 1RYHA 2CE7A 3IHWA 3T06B 5E7IA 3DZDA 2RGAA 3P4XA 1U2RA 1TQ4A 4P4SA 1JJ2B 2AKYA 3LXRA 1AJEA 4V03A 4KVAA 3I56B 3C8UA 1W1WA 3BAFA 3EPHA 1T3LA 1II0A 4QGFA 5FTJA 3GLFA 2W6JA 4XVUA 3CNOA 1AQYA 4DWJA 1G7TA 3SBEA 2QGNA 3TW8B 4B3DA 3LA6A 4AIIA 4EFLA 5CB8A 3PXGA 1W2BB 3RC3A 1XMJA 5HKKD 5FPHA 5CK4A 1WDTA 4G1UC 3ZLJA 1NKTA 1AZTA 4C2UA 4KFRA 5JEEA 3OIWA 1Z06A 2GEDA 4MRNA 2Q6TA 1QG4A 4QJ4A 1E96A 1YRAA 2DERA 2H1LA 4JVSB 3BFKA 3I5YA 3FE2A 5FPTA 3PFIA 1A5TA 4EPXA 2REXB 3L8ZA 2RHDA 4OL0A 1OSNA 4B35A 2J45A 1W49A 2VNJA 1QGAA 4NONA 3NWJA 5BN4A 2F3TA 3T1OA 1HT1E 2QP4A 2C9YA 1GVNB 2W2TA 4Q9IA 2ZRIA 3V9PA 1E9DA 5JBQA 1JJ7A 1CJVC 1UPTA 4ZI2A 3QXHA 1CTQA 4A8JC 4ZI3A 2AFHE 4D2IA 2R6CA 1T3SA 2LWIA 2ZANA 4HE5A 3NBFA 4JL8A 3EC2A 2B8WA 2GBLA 3LW8A 3N70A 3NEJA 3RVBA 3TW4A 1DTSA 2FZLA 3CZPA 2WAYA 3MWYW 2BBTA 2XNSA 4X8HA 3FHTA 1C9KA 5KYKA 1XEWX 4C3ZA 3SZRA 2KBFA 5A0FA 1W4RA 1PUJA 3BBPA 3G0HA 2C9OA 3GJ8A 3TR0A 3H0KA 4IVRA 2VNIA 4MGZR 3FB4A 4Q21A 4XTRA 4RD0A 4TT3A 4ZGNB 4DCVA 3R9WA 4N1AA 3AV0B 4RVCA 2WHXA 2XJ4A 1GL7A 5CB6A 3MWJA 3T34A 1VQ8B 3TIFA 3Q9LA 1RC8A 5EP4A 3JQPA 2C04A 5DGXA 4BPBA 2IYVA 2ZRMA 1U90A 2Q3MA 1GO2A 1DOAA 1YR8A 1QUEA 1FDRA 4MRRA 3QI2A 3THXB 4FCWA 1COWA 4AI6A 3JQRA 2OM2A 2HT6A 1BYIA 1FNNA 1KY2A 1P2TA 4HLQB 4NYJQ 4C0QC 1YR7A 1J8MF 1N6OA 1T6NA 2OLKA 2ZR7A 3AUXA 4GI7A 2P6RA 4LJ4A 2VF7A 5LD2B 2W00A 3K0EA 3IO5A 1F2TB 1QHHA 2H7VA 3K0FB 3B60A 3F8TA 3AVQA 2WJHA 2R62A 1KKMA 2J1LA 3MHPA 2ZRJA 2V1UA 1HTWA 1O87A 2Z43A 1G7RA 1ZCBA 2WTUA 1OH8A 3B7GA 4JLPA 2GQFA 4RD6A 1RRGA 2GHIA 3NIBA 3QKRA 5A4JA 3P20A 4S2EA 4UXIA 1S0UA 4C2TA 3I62A 1SXJB 3ICEA 1E3MA 2O0HA 3ADBA 3RS2A 2BJWA 2OFOA 5CITA 1VQ4B 2FWRA 4EQ6B 4A0GA 4B3FX 1GIAA 2BMDA 3W2EA 4F93B 3KQLA 1GAJA 2XB2A 1HE8B 4A2PA 1UBFA 2FJUA 2WPDA 3BE4A 3IO3A 2WBLC 1RRFA 4LWZA 5CIQA 5C2JB 3W2IA 4DUGA 1OYWA 1XU4A 2IYTA 3KKQA 4GOKA 2ATXA 2D06A 4CEIB 4LUCA 2ZM5A 2CNDA 1LB1B 4Y0VA 1KJYA 3E70C 1VQ9B 3ASZA 3FFAA 5DH9A 1GRNA 5AWFC 1QVAA 5LDDC 5G41A 2GJAA 4E5UA 721PA 3LBIA 5J4LA 4JL5A 2Q9CA 5SZIA 5C18A 1OIXA 4MA4A 1RRPA 2QAGB 1L8QA 1FX0A 2JLQA 3SHWA 2FGJA 2JJ1D 1D9ZA 2BKEA 1RJ9B 2QA5A 5AUNB 3GFPA 1AA9A 4Q00A 4PO8A 3W6OA 1GL9B 3LH5A 2GXUA 3GEEA 3GQBA 4DIEA 1JXOA 2NGRA 2OILA 1WB9A 2C98A 3ECCA 2YNMA 1UDWA 4RKFA 3R8CA 2VHJA 3SOPA 5B64A 2OK7A 4UAJA 2IEZA 2IXFA 2IYYA 1JR3A 3QXXA 1E2QA 1FNCA 3H86A 1Z0KA 3HDTA 4IDHA 2JLSA 4O25A 4D4KA 1YJ9B 4C4PA 2WIBA 1KMHA 2D3WA 4DXAA 4BRUA 4WAUA 3WY9A 5C4MA 4BWYA 4L5BA 3K0AB 1CJMA 1GUAA 4OK6A 1M7HA 1M34E 4MKGA 1G3RA 4JS0A 3GLHA 1ZINA 4BFXA 4NMMA 1VQLB 3WNCA 2BMWA 2V3CC 2UZIR 1Q21A 2GJSA 3FVQA 3QVVA 1LNZA 1BS1A 4UNRA 2Z5FA 1RE0A 3SR0A 3SHFA 2HJVA 3AVPA 4R98A 4QJ5A 2B6HA 2QSYA 3IIMA 4NZYA 4LBZA 3A58B 4V0OA 1LS6A 2CL0X 3FFBA 4CDGA 2BOVA 4PX9A 3O47A 4DSNA 3FKSA 5THXA 1JALA 3BERA 3CCQB 3UG7A 2P5SA 2ZJ2A 3NBXX 1T8TA 4DSTA 2A5GA 5TB5A 3ZVRA 4I81A 2ODNA 5HZKA 1MKYA 3LLUA 3I8XA 3M1IA 4TYWA 3LBNA 1Q1ZA 2G6BA 1ONBA 3WBKA 1KY3A 4LPSA 1GR1A 1TEVA 3W8RA 4KFUA 1J70A 2GESA 2GTPA 1R0YA 3UXMA 3VQTA 1DARA 2O8EA 4GOJA 2IYWA 1QHGA 5CYPA 5JS7A 1N0VC 1N5KA 3FDIA 2JLUA 1ESMA 5FTMA 1GM5A 2QE7A 2GPJA 4DLWA 3WNDA 1S1MA 3LFUA 1A8PA 1E98A 1G6HA 4PSVA 2VP2A 2BCGY 4XJXA 1QG0A 4PC3A 4AYTA 4BLRA 1R0WA 4LZZA 3ZYCA 1KI8A 1YVDA 3VO1A 4MRSA 3GLIE 1G41A 5CLQA 1HH4A 1VG1A 4G1VA 2BCJQ 4JSTA 3RSLA 3ZC3A 1VIAA 2F1RA 3P26A 2QBYA 2P3SA 4XIGS 5FH9A 2DB3A 3TUIC 2F55A 1FZQA 4FD2A 4RZ2A 1IBRA 1P62B 4MGKR 4F7WA 2IS1A 4DB4A 1Q1EA 1YKSA 5FI0B 1IJFA 3T1QA 5KDDA 4TLAA 1FQKA 4KCGA 3V00A 1XEFA 1XP8A 3BOSA 1NP6A 3O8CA 1JQJC 2Q0HA 2WIAA 1FTSA 4E09A 1KK0A 1BO6A 2ECKA 2GDJA 2ZU6A 5H8WA 2CRVA 1OHHA 3THWB 1G1MA 2I1VB 2PT7A 1QUFA 3L82B 1HQCA 3SBDA 3TH5A 3CCLB 4D80A 1M6NA 4DRZA 3SEAA 1IHUA 4HB2A 2OBMA 3PUZA 1Q0UA 2XZOA 2ZSDA 4XH9B 3PITA 5CM8B 1D6JA 2IYXA 1P5ZB 3MWKA 1CQXA 1Z83A 1SGWA 2GWHA 1N6LA 4DSOA 1QHYA 2BEKA 4LJ7A 2KWIA 3A36A 1TMKA 1AQUA 1YZGA 4EUNA 4DCTA 2OE2A 1OXVA 2QTLA 4TMZA 3IDQA 4B48A 4OHXA 4DT1A 3U44B 2PCJA 4HAYA 2O8CA 2PCLA 4PHTA 4DZZA 1NI3A 3KKNA 2F1HA 2LCFA 3Q5EA 3CNNA 5SZHB 3BXZA 1GTVA 1ZRHA 4PC2A 2DWPA 4U00A 4TZ0A 4YALA 1OLOA 3B82A 2QMEA 5DSZA 4IFBA 1N5JA 3ASYA 1IQPA 5DYGA 1NMXA 1OH7A 1CRPA 2ZI3A 5UKDA 1JI0A 1GJRA 1E9RA 5FBVB 2XGJA 1R8SA 3PENA 1SVMA 3TUZC 5EE0A 3CPWB 2NG1A 1SVWA 1DS6A 1E1QD 1KDOA 1YZQA 4AG6A 2XXAB 5CK5A 1BMFD 4O2LA 4B75A 5JHHB 5CLLA 3RABA 1NG9A 2V4ZA 4M9ZA 1TL7C 3W90A 5CJPA 4ASUD 5KNDA 4DJTA 1WA5A 3BGWA 4KHZA 2CHQA 3U3RA 3FHCB 1I4DD 3CNLA 4DLRA 5L3QB 3FPKA 2GA8A 2BC9A 3FYHA 2YOHA 1TX4B 1DAHA 1Z5ZA 4ZIRA 3C4JA 4OJKA 2AXNA 3PUXA 3THYA 3K9GA 2VNKA 2JASA 3SU8A 2QMUA 1IOZA 5KSWB 4LX0A 3SJBA 1Z0AA 1UKZA 2V7QD 4W9MC 1H8HA 1QG2A 1ZVQA 3G82C 4ARZA 2NO1A 2DWQA 1VHTA 2ZU0C 3KUCA 2VHCA 5G3YA 3RWOA 2CK3D 4CEJB 1CLUA 3VX3A 2VQSA 2YJTD 3IQWA 4UNSA 4US0R 2VP9A 1KDPA 4Q9HA 5L3SB 1FMJA 4C7OB 4W7SA 1WBBA 4CF7A 5JWOA 5IK2A 2X77A 4YQFA 3U61B 4M22A 1A1VA 2HYIC 2WJYA 5BXQC 3DM5A 2E9SA 2PMKA 3T1VA 2ONKA 2JLYA 4DLZA 4NCHA 3K70C 1CF4A 5EZ5A 3B1XA 1A82A 2IYUA 3A1VA 4Q66C 1XJQA 1C4OA 3P32A 3KFVA 3KB2A 1VMAA 1PLJA 1IJEA 4DDUA 2IYQA 1ZUHA 4WZAE 2NTYC 1RPZA 2G1KA 2QMHA 1H65A 2W6ID 3WYFA 2GVZC 4NL4H 3CPHA 4HB0A 4ON9A 5GJCA 4BEBA 1M1KD 2NO0A 2Z4RA 1EFCA 4EPWA 1K5GA 3AB3A 5H5JA 4M8NE 1E94E 1H8EA 2Q21A 1OW3B 3D8BA 1CNEA 4UNPA 1WXQA 1ZU4A 2KE5A 3M0EA 3LO8A 2VLIA 2WAXA 5G53C 1OB2A 2P0EA 2R44A 1OXSC 2GCOB 1XMSA 3U3JA 2C77A 2FN4A 4BLSA 1KI9A 1LS1A 1S8FA 5E95A 1QVFB 2OESA 5HXBA 4M1OA 3MFYA 2ZSEA 3B1ZA 5CIWA 4ILEA 1OV4A 2QRZA 3QKUA 4G1BA 1P4SA 3ADDA 2FSFA 5J47A 2YZ2A 2AWNA 2IBMA 5JSZA 3CCJB 3UIEA 2LKCA 4QBGB 3KJIA 4EPYA 1NJID 2C5LA 4MDFA 3ZS8A 4HB4A 1JXMA 1WRBA 5FR1A 1ZM4A 1E2MA 2WSSD 2P6NA 2J0UA 1S96A 4PC6A 2RGDA 3B78A 1UDXA 1TU3A 3PR1A 3WMEA 2DFNA 1F2UB 4IOKA 5J4YA 1D2EA 4JLDA 1NJFA 1ESNA 2GCPA 4LHVA 4CZ2A 3AUYA 3ZZTA 1E2EA 1Q57A 4IVPA 5DN6A 1XD9A 2WMNB 4R2HA 5DI9A 3C41J 5C4GB 2G9NA 3GFTA 1NLFA 4M1MA 2BF4A 4JBWA 1Z6YA 2QN6A 1MO6A 2VSFA 1G3IA 1T91A 2RGGA 5IHPA 2XB4A 1XD8A 5AJVB 2F43A 3B5JA 3WP1B 1DG1G 4C9BA 1OFHA 4KYIB 3QXSA 2ZR0A 3KB1A 5JHGB 4DBLC 1JR3E 1TAGA 1QFYA 1FP7A 1W2HA 2JCSA 2PLRA 2EVWX 3ETLA 2NMVA 1X86B 5SZKB 3LV8A 5BN3A 1CR0A 4Z54A 2B7CA 4LJYA 3W5UA 1Q81D 1J2JA 4B4DA 1QH0A 3HR8A 3PIRA 3NKVA 2QPAA 4A0FA 4LSGA 2ZAMA 3W2HA 3GLHE 1T8UA 4TLDA 4IXNA 2O8BA 3W34A 2J5XA 1DE0A 1E79A 4HDQB 1XEXA 4P31A 3PUYA 4GMXA 1R5BA 2RGCA 3RS5A 5FTKA 4QM6A 5ELXA 3HPQA 4UXJA 3TSZA 1AK2A 2FMXA 2GXQA 3QXCA 1S2MA 4K8OA 4IOMA 4DQLA 1W46A 2AL7A 5JRZA 5EMNA 1U0LA 3W5VA 3AF2A 3DMNA 5EE9A 2W0MA 4YMTA 3OE7D 1X8KA 4ESHA 3AP3A 2EU8A 3B8HA 1X1SA 4MGIR 4MYUA 1AS0A 3QOFA 4HSEA 3WHKA 3VU9A 3WYAA 1E0SA 1XD2B 3PJRA 4BLPA 1M2OB 1BX1A 2KB0A 3LO5A 2VP4A 4TZ6A 4LJ8A 2OFWA 5JJKA 2QZ4A 4KVGA 1IN6A 2ZSFA 4IKEA 4RD2A 1OYYA 2X3UA 1F20A 3K9NA 1CNFA 2V6JA 3I8SA 5DHAA 4OI1A 5C1BA 4XVQA 1DAIA 1OFTA 3GLIB 4IEIA 5GJBA 2CJWB 1YJNB 5HKKA 2VH5R 4CIDA 2GK6A 2IS4A 1G4AE 1KQSB 2GJ8A 3BJIC 2ORIA 3CWQA 2ZRNA 3LBHA 521PA 2Z6VA 4LJ6A 4B2LA 5KOYA 4P33A 4D0LB 3QG5A 3L0SA 3VMFA 4L9SA 3ES9A 2QPOA 4U5XA 2GRJA 1E1RD 3QPWA 4L15A 1X3SA 2VPPA 3R7WA 1QDEA 1XXHA 1XWIA 4MQBA 1AS3A 4L4UA 3GPLA 1E4YA 1Z0IA 1ZAKA 2KI5A 2Q3FA 2HF9A 1Z63A 1GNRA 3L2OB 3MCAA 3PUWA 5L8VA 3DL0A 1D2MA 1Z8FA 2QT0A 5BW8A 2BBWA 4TQ9A 5JWRA 1I4TD 3U4QB 2VZLA 3CUEF 4DLVA 1XTRA 821PA 1RIFA 4LBWA 2BEJA 2PEYA 3LXXA 1XRJA 3VX4A 3W5HA 1I4LD 4WBSA 3IIJA 1AZSC 4YAOA 3TAHA 1SQ5A 3UWOA 2ZJOA 1EX6A 3FMFA 3C5HA 2ANCA 4LBVA 4R71A 2QA4B 3BC1A 3QJYA 1J90A 1DBSA 2ZTSA 4Y9RA 4P4SB 4B3XA 2AKAB 2OCAA 3SYKA 2N42A 2P67A 3T15A 4B33A 3OAAA 3IKJA 1W0KA 4TN1A 1L4YA 2NIPA 5KO2A 4FINA 3CMAB 1QHNA 1JA0A 3PVSA 1F48A 1U99A 4G0NA 1A2KC 1R5OA 2B7BA 3D3QA 2GJKA 3OZWA 1FTNA 4K46A 3U7HB 3RS3A 1FUKA 1KNQA 4PQRA 4QKQA 2A5JA 3VR5A 2NPFA 4B2IA 2QT1A 3TAUA 2RC6A 4HLCA 1LVGA 1NN3A 1HUQA 2ZSBA 4C0JA 1V43A 3QVUA 2D4HA 5EP1A 4FMDB 4Q4HB 3Q72A 4DCSA 1UEJA 5GV8A 1QHSA 3WXMA 4GZLA 4S35A 1W36D 2QRNA 1R5NA 2PX0A 3GFOA 4LYFA 4TL6A 4Q02A 2XITA 1GRRA 2XZPA 3QENA 5DI3A 4BLOA 4FMCF 3EZ7A 1J8YF 3IQXA 4POAA 1FP6A 2ZVPX 121PA 4PZLA 4QJ3A 5H59A 2WJIA 3PG5A 1DAKA 2WJVA 3MJRA 4HAVA 3CMEB 5JCZA 5FOWA 4URYR 3CBQA 1U81A 1Q7YD 3I5XA 2OCYC 2ORVA 4BZXA 5KTYA 3H1TA 3OESA 3WRYC 1XBTA 4LJ9A 2HJGA 4D4MA 2ZUBA 4TMKA 3LDAA 1R0ZA 3TQFA 3UKDA 1Q1BA 1C1YA 3ZVMA 1U0HC 2D2EA 1CS4C 1VKJA 3MG9A 5KPJA 3GD7A 1E2NA 1G8HA 2ZQ5A 4CEHA 5FBLB 1Q3TA 5TV2A 2QTZA 3KTAA 1N0WA 1YZTA 4CVNA 4DC9A 1DO2A 1IN7A 2C99A 4TYNA 2IYRA 2GZHA 1VQ7B 2ZITA 2O5VA 1W34A 1RKBA 3JZMA 1IY2A 2H57A 2D7CA 2JJ1A 5K8LA 3OEEA 2E87A 1SHKA 3SDZA 2HF8A 3CW2A 2FF7A 2IUSA 2QPTA 2R9VA 4GP6A 4OBEA 5H70A 4V02A 2G1JA 3E20A 5DLQC 3AGPA 1VQPB 5KHOC 2D7DA 1CP2A 1XMVA 1ZNZA 2IF2A 5GJWC 3A1TA 4FMCB 1G7CA 1QHHB 3I92A 2ANBA 2TMKA 3VR4A 4BFUA 1TPZA 1Z0DA 1CULC 2QQ0A 1XCGB 4HI0E 1D9XA 4Q01A 1E99A 3SFVA 2IF0A 4DEYA 1U8YA 2AX4A 2PZGA 3DOEA 4PPGA 2JLRA 2B8TA 4WQMA 2W0SA 3IPXA 3RNLA 2QG6A 5E4FA 4HUQA 4B3GA 3QNUA 3KQHA 2REOA 5DNYB 2XNDD 5LB2A 3GJ4A 4LGMA 3ADKA 3SFZA 1NVVR 2HCJB 2WZQA 2VHTA 2ZRPA 1ZU5A 2YHSA 1N6NA 3VR6A 2X1VA 1YITB 1W36C 5FOXA 3X1WA 3O8BA 4MRPA 3DDCA 1P3JA 1UADA 4OI0A 5FOUA 4LDJA 5FA6A 3FMOB 3K0CA 3VKWA 1KD1D 2J0SA 4OI2A 2MMCA 2OXRA 4GRAA 3CRZA 4Q19A 3W2GA 2CLCX 2GAAA 4KLNA 3CCMB 4PAOA 4IVQA 4WVFA 1DEKA 1KSFX 2V9PA 4XSHA 1TEXA 2IEYA 5CDFA 1G4UR 3ZIAD 5JI2E 3KL4A 1KDTA 3Q3JB 1GFIA 4QM7A 5EP3A 3U7GA 4GFDA 3EG5A 4EH1A 1Z47A 2UKDA 5D3MB 5AN9A 1QZXA 4QHTA 4ZCIA 1ZC4A 2PH1A 1OKKA 4GDFA 5GJVC 4KSCA 4D4JA 2P5TB 2ZJZA 5CM9C 3REFA 2JLWA 1JB1A 4H9GA 4IDQA 2A7QA 2JDID 4W5JA 2FSHA 2DBYA 4J0QA 1DAEA 4LHXA 5TXGA 2BPOA 1N2CE 1FPMA 1YR6A 2J7PD 4ZO4A 4YAUA 2RGNA 1KMHB 2GCNA 3KQUA 2R6DA 3Q8XB 4FW9A 4B73A 1XB2A 1E2KA 2FEMA 3B85A 3FKQA 3EAQA 4HZUB 2HCBA 5FUXA 2BHRA 2VP5A 3LWNA 3GLHB 4TSFD 1KO7A 2W6JD 2RHMA 4R9UC 2R6GA 2BM0A 2R2AA 1G8YA 1Z6TA 4XSGA 2OBLA 3BB3A 4JIMA 2C8VA 1YI2B 1JAHA 3AVXA 1DADA 4RKEA 4M4SA 2CNWD 3THXA 2WJGA 1GSIA 3OIUA 4AKEA 3E2IA 3IHLA 3UWKA 1G9XA 1F5NA 3EZ6A 3KDSE 5GADl 2ZYUX 4ESVA 2XNJA 1OE0A 2PLFA 2FDCA 1BYUA 2FSIA 5EE5B 1I7PA 4FCTA 3TE6A 3GJ5A 4EIWA 5JJLA 2JLVA 4LCBA 4M9QA 1EWYA 1EP1B 1AKEA 1NF3A 5HCNA 3A37A 1OT3A 5TVKA 2OTJB 1K73D 2DPXA 5D3QA 1W44A 3A4NA 4LPKA 4EJSB 4FWTA 2HMAA 1ZMXA 1G8GA 4V0MA 2OBNA 3CF0A 4OI4A 4Q7MB 3SJCA 3RS7A 4UJ5A 2O8EB 2X8AA 1YZLA 2A5FA 2FU5C 4Q4LA 1GILA 3P1JA 3GCGA 4Q4AA 4NBSA 2CL6X 2P65A 4PPFA 2IS2A 1T3HA 2OCBA 4Q1AA 2JIZD 3F5FA 5B2ZA 4CT5A 3EX7C 3NH6A 1YZNA 4AG5A 4XWOA 1ZD1A 1N3BA 2ZROA 2CMKA 4QL3A 1ZUIA 6Q21A 4OHVA 2OLJA 1UKEA 4KSBA 5KUTA 4TLCA 1S3SA 4CEIA 1Z22A 2HLDD 1KSJA 2JJ8A 3KQKA 4YMVA 3ZD7A 2RGEA 4O2RA 3I1FA 4DLUA 4UXHA 5AJWA 3EARA 5KSPA 4ZDJA 2OO7A 1XPOA 3C14C 1HEIA 1W4CA 2IC5A 4PR0A 5BWMA 2QBYB 3RRNA 1WBDA 1EXMA 3I55B 3WMFA 1E1QA 2O8DB 4FCVA 1OGJA 1K9MD 1GRQA 1HA3A 2J59A 1XXHE 3CX7A 3K53A 3KQNA 3OZXA 4ZGQB 2MMGA 2X19A 5AJZA 4ASUA 1KI6A 1RJ9A 1W48A 4GBMA 4RFVA 3VHXA 2B92A 3OIYA 4XD7D 4AF6A 4EPRA 3AH8A 1NBME 2QEXB 1KO8A 2CEAA 3OZUA 2R6FA 1VQOB 1K8AD 3L0IB 3TKLA 1QGZA 5TARA 3HP1A 2WKRA 2XTZA 4FWIB 2V7QA 2CCJA 1PV4A 4TYQA 1J99A 4D25A 4NCKA 4I1OA 1M74A 3TQCA 4O0MA 4NP6A 1IXRC 1NVXQ 1RW4A 2O8FA 3QSYA 2CK3A 3WMGA 1K8RA 2VF8A 1P9NA 1F3OA 1NIJA 4F7DA 4QFMA 3W6PA 2VSXA 2YWGA 3OJXA 1BIFA 3OFND 4V0KA 1NN5A 3CX8A 1FL9A 2DY1A 4DT1B 1A4RA 4MITA 2FFAA 4JSYA 1VECA 4TL9A 3PEWA 1YRBA 1T0JB 2ASEA 1G17A 4DQKA 4DCNA 4Z1MD 2NO9A 4L8GA 4PSAA 4HATA 1JB9A 3T61A 2H92A 3B1VA 1F60A 2IWRA 2FE4A 1NY6A 2MSEB 1IM2A 2J41A 2ZRFA 2ZE8A 2ATVA 4RCZA 4PQFA 2VBCA 3RLFA 4HLDA 4ZDWA 3QFTA 3R9IA 4B71A 1R4AA 3Q5DA 1X8JA 4EPVA 1KK3A 2W6IA 4GPTA 1OPXA 3A1SA 2REBA 1UBEA 2PJZA 3CRVA 3FPAA 3BFVA 3QKTA 1YJ5A 3I32A 4LYJA 2CDNA 2VL7A 4RCYA 1P61B 1JNYA 2KJQA 3TSWA 1SXJD 2QNRA 1P9WA 4ZIRB 3AVWA 1M1YE 3KXIA 1AM4D 3VAAA 1ZM2A 3AVYA 5EXXA 3OEHD 3QY0A 4HAUA 3RYTC 3THYB 1LF5A 3ZS9A 1GNPA 1GG2A 3K0CC 2J46A 1XTKA 1DAMA 2YWEA 1TNDA 3A4MA 4JJZA 5KNCA 3GLFE 5FBRB 2ZR9A 3U3MA 4WOPA 2CVHA 3NVAA 1LY1A 2QM7A 2DHRA 4QXAA 2ZAOA 3ZVLA 4JMPA 4JLVA 3VTKA 4AY2A 3V4RA 3E5HA 4R7ZA 2FGKA 3A8TA 1XCPA 3U5ZB 3CONA 4EPTA 4DDWA 4LHYA 4D0NA 3KZ1E 1E2LA 2WMOB 3NXSA 3LVQE 2WSSA 3HR7A 4KI0A 4PO1A 1DPFA 3V76A 3AVVA 1MO3A 2BMJA 4NYMR 5H1YA 1VQ6B 1W35A 3UMRA 2PIAA 1BQEA 2RCNA 1M7GA 1G18A 1N0UA 1I2MA 2IL1A 4DLTA 2FFQA 4MRVA 2RGNC 5EXSA 3CX6A 1KI7A 3L0OA 3THWA 3DOFA 4Q7LA 4F4CA 4Q1EA 4MGYR 1OXTA 1EFRD 1VQ5B 1FMLA 1W0JD 2QP9X 2WV9A 3HJNA 3KJHA 3BH7A 4YDHB 2BGIA 4YHBA 4E07A 5JLJA 4NCNA 4L9WA 3C7KA 2A9KA 3ZQJA 4HE6A 2W58A 2XOKD 1IXSB 3C16C 5FL7D 1RZ3A 5H68A 1OXUA 2IK8A 3CC2B 1MO4A 3U6BA 4IDOA 1ZCAA 2ZRCA 3QPVA 1NN0A 1VQMB 2IHBA 1UBCA 4QRHA 4C30A 4KAXA 4TMXA 1W4AA 4TL7A 5LD2C 3Q7PA 1KJWA 4G5QA 4TLBA 1G8FA 2EFDB 3SI7A 3NEYA 1MOZA 3P27A 1P9RA 5JSZB 2J3EA 3LAWA 2ZETA 1US8A 1X8LA 3EWSA 3RRMA 1PZNA 1VQNB 1HT2E 1KZGB 2QROA 4B44A 5HTKA 1TADA 1TTTA 4JVLA 3OHMA 1PLKA 1NRJB 2J0UB 1W2GA 1ODFA 4UNNA 5J40A 3DKPA 5JCPA 1YHNA 5LB4A 1JEDA 3OE7A 1KO1A 1TQ2A 2GNOA 5AUPB 2EWVA 3X1DA 1VQKB 5L3QA 2ZJ5A 2ZXUA 1AGPA 4GSYA 2BWJA 1GAWA 1GOTA 2ORWA 4YMWA 2BV3A 3QE2A 1KKLA 1YR9A 3PQCA 4QGGA 4IJMA 4I99A 4EFMA 4C0BA 3DPUA 2WICA 1W4BA 2ZUDA 4BUJA 3WBJA 2WJJA 1CBUA 1RFLA 1TVCA 3CCEB 2CL7X 3VNUA 2BVNA 3CXCB 1E2IA 2QAGC 3K9HA 3ZZUA 4HUTA 4TTRA 2ZYVX 4PGOA 2GKSA 1Z0FA 3DM9B 3ZH9B 4WZBE 3NTUA 4QNRA 4A8JB 1A7JA 1MRSA 1MRNA 4DKXA 1QVGB 3CM0A 4RFSA 1NL3A 4A1FA 4BFVA 1XTIA 2AK2A 2Z83A 4RZUA 3RS4A 3CWZA 221PA 4I1UA 1E1RA 4IEEA 3RWMB 4B74A 1HQYE 4LV8B 4IOLA 4PHHA 1AS2A 3CCVB 1NVUQ 1Y63A 3CC7B 1N6HA 3C15C 5JZVA 1QVRA 2NO7A 2YKGA 4AKGA 3LVRE 1XTJA 1U98A 3SNHA 2O8BB 4TMWA 2BBSA 2F1JA 1VYTA 1XZQA 1KSGA 4KU4A 2R8RA 2V1XA 2WSMA 1R7RA 5E7JA 2ZS7A 2CXXA 2RGXA 2ZRAA 2ZS8A 5FPKA 4PC7A 5EP2A 1ETUA 1ZIOA 1FFHA 2QY9A 4HB3A 4B32A 2ZPTX 2RKOA 2V54A 3FMPB 2BIFA 5E7MA 1R2QA 3NHBA 1G3UA 5EQTA 1TUIA 1YQTA 3HWSA 2A78A 1TU4A 1LV7A 3EIHA 5L3VA 1GKYA 1HY3A 3CCRB 3P4YA 3GP8A 3ICQB 2IS6A 5FBQB 1XF9A 1WF3A 1Q3HA 4RD4A 4OQLA 2GJ9A 3IGFA 2VYQA 3QBTA 4D82A 3LQQA 4Q7KA 3BD9A 1Q20A 1XDBA 2IA5A 4WW0A 3K0SA 1N6PA 2J87A 1E63A 3V4FA 2YWFA 1ZNYA 3CD6B 4KFSA 4X8MA 3QKSB 4YMSA 3RANA 3O8RA 4P3YA 5JRJA 3J81k 4ERNA 1G64A 621PA 1ZW6A 2DFKB 3BH6A 5AJYA 4V0NA 5HPYB 2IUUA 1NKSA 5K8UA 1WMSA 2I4IA 1JJVA 1G7SA 4AKHA 2QU8A 3DVLA 2WWGA 2QI9C 3MMPA 4C43A 2G0TA 5HZHA 1NJGA 4OQXA 1DELA 4FK8A 2CHGA 1XXHB 1QFJA 3CF2A 1KK2A 5GVSA 2H8KA 3E1SA 4KV9A 3F0TA 3EZ2A 2QGZA 1FOEB 2OG2A 3G6EB 5TDHA 4US2R 1RRCA 4RY2A 2FX3A 2VYFA 4G5RA 4DB2A 3VHLB 3GJ7A 3LVBA 5LPNA 4LYAA 1M90D 3RHFA 4PQYA 1YZUA 4Q4JA 5BN5A 2R6AA 4FXPA 4D4LA 4BZQA 1UFQA 2G3YA 3LY5A 3LLMA 5JI3E 2WWXA 3EZ9A 3EA5A 4WIAA 1ZD9A 2AXPA 3GLGA 4WXRA 1E9BA 1SULA 1U9IA 4AF7A 2H18A 2V55B 3N5CA 2JLZA 1R6BX 3SQWA 3ZD6A 2BKUA 1E2PA 1CJKC 1Z3IX 4II7A 3EASA 4EDHA 2QTHA 3HYTA 1G20E 4G5GA 4PPNA 4YAWA 4MDEA 1FRNA 5FOSA 3UK6A 3NDBB 4Q9LA 1RVDA 2ZS9A 3S1AB 2WWHA 5JJIA 1CU1A 2NZJA 3JVUA 4TQAA 3I72A 2GVDC 2IUTA 4FMDF 4HAXA 3TVTA 3UANA 4KJZA 1WCV1 4JVNA 4WXPA 3AKEA 1K6MA 2BN4A 4AC9A 2I3BA 1B0UA 1Z6AA 4ZKEA 1E0JA 2C2HA 4HZIA 1ZM7A 4PHFA 4M1YA 4LV6A 4PAMA 3W8NA 4C0LA 3B9QA 2A5YB 2F9MA 4JT2A 5J5CA 2EIXA 1VIYA 2G88A 4CT4B 4YDSA 4NH0A 2ZJBA 3AVTA 1PLLA 1VCOA 4MKHA 5JEDA 2EYQA 2VO1A 1AGRA 3B2EA 3T35A 1E2DA 2JLXA 3OW2B 4OKSA 1SHZA 1QGYA 4NKRA 4B43A 1H42A 2ZYWX 3AF0A 4OQFA 3MD0A 1JPNA
chains in the Genus database with same CATH superfamily
4X7DA 2F4NA 3TIIA 3T5PA 4Y0AA 3RO7A 4ABYA 4XLEA 4I9NA 2DQYA 5F2NA 2IHZA 3O7MA 2ZXIA 5KYGA 2IBTA 1QCCA 1ULUA 1XVUA 3AU8A 2BYTA 2OZKA 2YTZA 3BE8A 2G67A 4OHFA 3UMBA 4DDVA 2JHFA 1UMCA 3IE1A 1EX9A 2VF5X 3G2QA 4P38A 3HUDA 1WZEA 5LQAA 1SCBA 1SU7A 3LC7O 4L7QA 4FI3C 4F3CA 1A7UA 1XJ0A 1PS9A 5TJHA 2FR8C 2BGNA 2WD9A 4PXAA 1GKKA 1VMKA 3A9UA 4ZQHA 3T54A 1JA1A 2P0YA 3FTQA 1QJ4A 4MO2A 2OQVA 1IFXA 1F7UA 2CVFA 5H82A 3ME5A 2IQIA 5DXFA 1K9VF 4GAEA 5J1SB 4CEHB 3HFJA 5GZ1A 1P2SA 1M83A 2WW8A 5JH7F 1BC5A 2ON6A 2FZKA 3EVZA 2HPHA 4L9AA 5CT6A 2FMTA 2Y27A 5TY0A 2GPYA 3VKFA 3IT2A 3ZIAA 1CJTC 1NPTO 4EWLA 3H4VA 1JUDA 3DPSA 2ZRHA 3SIRA 4B6FA 4N3NA 3EAFA 2AEJA 5HDQA 3QRWA 1H9AA 3QLUA 3U7QB 4AO6A 3NKLA 4XM1A 3PGA1 1ZZEA 2IPMA 4R1QA 4X24A 3ZEAA 3V8QA 2X8JB 1LWNA 4O4HF 1YCDA 3TGPA 4F4HA 4E1AA 2Q0SA 3O8DA 4BLVA 4MHTA 1VKHA 3BCSA 2C96A 3AEZA 1IEQA 1BN7A 1GYRA 2EKBA 4QUIA 4DJDC 3OTOB 3W3AA 1SVIA 2X9VA 1YQWA 1B3RA 2YXDA 1K4YA 1NOKA 4R8LA 3UMFA 4X93A 1F6WA 3EZFA 5B37A 5JJCA 5LYJA 4AS2A 421PA 4EUEA 2XT9A 5CYOA 3OE4A 2PNJA 2VOEA 3Q9SA 4JLWA 1VE6A 1OH5A 3N2IA 3CCUB 3I9JA 1A4XA 4DJJA 2QR3A 2Z2KA 2PQ0A 5EPOA 4BB0A 4C0HA 2OHVA 4DQXA 1KC1A 2HJHA 5JS1A 4KNWA 5DX0A 1B73A 2JJ2D 2Q2NA 1ECGA 1KGSA 3K9QO 2JRLA 2BY4A 2VSNA 3NTVA 4YCAA 2ODPA 3LBFA 1ORHA 3IILA 3PQ5A 4OH7A 1IDOA 5AOBA 3V6MA 3D4IA 5DHRA 5JC8A 1O96A 4TGLA 3KJXA 1DJNA 5C31A 1II8A 4ZVLA 3WC4A 2M6KA 4EB0A 4FKMA 5FTNA 1K0FA 1MFPA 2OBRA 4ES6A 4L8YA 5HWSA 4KE8A 2G4VA 3DE2X 4P5DA 4Q1CA 3NDJA 3WKBA 3UWMA 1DUIA 2YINC 2VHQA 2F00A 3A4YA 2HMYB 4AY6A 1NLYA 2CHUA 2CDCA 2WYWA 1SY7A 1KMQA 1NRXA 2J31A 4B2PA 1NQ5A 3DDZX 4JLBA 5EZQA 1ZYUA 3OQNA 3REGA 1D1TA 1GZSA 1O8BA 1UOEA 5JARA 1IG0A 3T7KA 3ACBA 3PEYA 1G6OA 1E9AA 3FHLA 1SUPA 5IM4A 3OU2A 5KTRA 2OT3B 4N18A 3N2ZB 4K9NA 3QKRB 1DLJA 1NBMD 4TZTA 4WLEA 2BHSA 2AB0A 4L76A 4OB6A 3L0DA 3TQOA 3UJ3X 4Y6RA 5K4GA 1PWHA 4ZZ2A 5CXUA 1KR5A 3OT1B 4M86A 3TLBA 2GTHA 4XN3A 3LS2A 1YJ8A 4YJFB 5C4IA 3UJ6A 1KDVA 1S4QA 3KVRA 2FR1A 3WRXC 2GFHA 4U8GA 3I0ZA 2BBOA 2P6MA 4F71A 3PPYA 1JFFA 3VI4B 2R85A 3P0JA 4WZBB 4IGEA 4KACA 2F59A 3WISA 1NI5A 1X1QA 4CCSA 4Z7QB 5IKXA 2X8BA 1IC6A 1W7AA 5LBUA 3A6PC 5JG7A 1Y3CE 5FWDA 4JJKA 1UPFA 1ZD8A 1DMRA 3HBFA 3HY3A 4NPCA 4G65A 3UUEA 2BGLA 4DDKA 2ZZFA 2J09A 2ZVQX 4HNAA 4IHJB 4AMVA 1Z5NA 1SVOA 3FOWA 2BHLA 3Q3IA 1RHUA 3DTYA 3EDCA 4G89A 3ROTA 3SZMA 4CKBA 5A4AA 4CW7A 4HDKB 4UFPA 3Q85A 3CPXA 4LF4B 1T0BA 1B7GO 1XU9A 3TKYA 2NU7B 1ILEA 1N8TA 2CLLB 4BO6A 1Y1RA 5DYIA 4CKWA 1EWRA 2YFKA 2VIIA 3AM5A 1G3MA 1EX1A 2DU8A 1UJ4A 3ESXA 2C95A 3M6MD 2WZBA 3NBZC 4QOSA 1IEWA 2ZUTA 1DT3A 1ESEA 1UD5A 4PFSA 1OIVA 5T8KA 3TSYA 1WR8A 5K0ZA 1O89A 4LF6B 2DCMA 1JEAA 1M2GA 3FNBA 1QGUB 1NW6A 4LXGA 4P4TA 1E7RA 3HK2A 3N7AA 1R4NA 2IXTA 1BS9A 1SU4A 1VCNA 4M21A 1IRXA 3K70B 1N8KA 3LF2A 1TEZA 2X7JA 3UMCA 3PJEA 2D5LA 4C0AC 2RB5A 4FZRA 2PH3A 1X70A 1SIWA 4HGNA 1J2UA 4DUYB 1IN8A 1UD4A 1Z8DA 4M53A 1Y4UA 3AJEA 3PZRA 1UKBA 2VJJA 2W2VA 1DIBA 4Q4AB 2OKCA 4M0PA 1NULA 1W85B 3LDGA 5C8ZA 3MBOA 2GBFA 1U7HA 3K35A 3HXQA 3KX2A 2WE8A 3MIIA 2C4UA 2F1LA 3U6KA 1EBFA 1S3GA 3I2KA 4Q3BA 3R6JA 1TF7A 5JDCC 3C3JA 3QMPA 5EQJB 2JA1A 4JA2A 2GJPA 1D1SA 4J0HA 2J7KA 2IYPA 2VYND 2VHWA 4Q1FA 4B8ZA 4NC9A 3DQQA 4UEQA 3RFCA 5AW0A 3ISXA 3DMDA 4IIGA 3USES 4LZPA 4MPRA 1Y6RA 3KEQA 4JC8A 4RE5A 3UATA 2C4NA 4DR1B 2FLKA 2J0QA 2GPNA 4IO1A 1UDAA 3ZWPA 4KLCA 4G7XA 1VL1A 3ZLUA 1QOPB 2BFMA 1X38A 2EYUA 3NDPA 1FDWA 1E69A 5ER9A 1XQVA 4R1OA 4UHFA 3GDFA 2VDUE 4OHBA 1W6UA 2FZ4A 4AWAA 4D46A 1UT6A 1K8YB 1GL6A 1T9HA 2AZMA 3AILA 4NU6A 4ZYXA 4HLUC 4DYVA 1QPZA 3OC0A 1TIPA 2I1WA 3A1UA 4KPFC 3RIGA 2J6CA 2GPTA 2P2LA 3SLDA 4QU0A 4DIUA 3SM3A 4MB2A 2JBAB 1RRMA 2FHPA 3OOHA 2BLNA 4BCDA 4F92B 1U11A 2RGBA 4WDQA 3BJZA 3GBSA 4CF5A 5HE8A 5TQ2B 3CLKA 2OAGA 2J9FB 3QKWA 1GHTA 2WFLB 2PBFA 4KO3S 1N05A 1ZSVA 2OGTA 1QF9A 1U0NA 3CEPB 3GFQA 1T5IA 3PDUA 4LBYA 4OBWA 1LLFA 4EBBA 2DBZA 3JSAA 3TZEA 4WH0A 4KO8A 4LSWA 3MPOA 4FM9A 2XF2A 1Z16A 4F12A 2F3RA 1HT0A 3E7WA 2WMYA 4LXUA 4HZUA 1ZM9A 3TK1A 1RPAA 3RB8A 1Z39A 3NH9A 2VA9A 2Y1LA 4BDTA 4I55B 3ESYA 2AZ4A 2D8AA 2HYDA 2X9QA 4NHEA 3H6GA 1X92A 1KI2A 2AS0A 3CW8X 3TPZA 4BGDA 1XCLA 2YJGA 1JE1A 3OWXA 1A5ZA 1COWD 5AHWA 1O3YA 2EKQA 4QHSA 4TVKA 1KOGA 2X6WA 3WGLA 4KMRA 2EFHB 2OEPA 3N05A 4RIEA 1WSDA 3G4SB 1J7KA 2GM5A 3DV9A 3UB4A 4E70A 2IH2A 2BLLA 4O3FA 3HS3A 3NKFA 1OIWA 2JFPA 3PV0A 2XQVA 1Y9ZA 3AGQA 2OVFA 3AUJB 4I1SA 3HGTA 1YRLA 4MUXA 1DX6A 3GVJA 2Y93A 1KK1A 5C3UA 2RGUA 1LDGA 3RHSA 4PQEA 1OFIA 4A92A 1DOHA 1HE1C 2WD7B 3ZDRA 2ET6A 3R3XA 2XKJE 2QENA 3OUZA 1O77A 1QYDA 2X5JO 4QGAA 3K0AA 2J9ZB 2JI4A 2PMEA 3T3HA 4Z8YA 1NNEA 3GWGA 3I1IA 1CVIA 4CQLB 1E6CA 3FUCA 5A4FS 2XTMA 4MR8B 2IYSA 4DMKA 2E85A 4ZDKA 4E2WA 2LKDA 3VNSA 4EFNA 2NU6B 4XCXA 5HHTA 1PJTA 1VP9A 4L6CA 3OZVA 4CMKA 2WWFA 4URVR 4LOIA 3RPEA 4RWEA 2GFQA 4N7JA 3PKIA 2DUJA 4WN3A 1GZDA 1NUHA 2GX6A 4KIJA 5JQGF 1JEJA 1RNLA 2VKTA 1HFWA 2WF7A 3PICA 2G0NA 2XUGA 3ZK8A 5JY1A 5M7EA 3TOXA 1I94B 3ELDA 1MIHA 1A98A 1QMGA 1RTTA 2J5QA 4IDEA 3DO8A 1RBYA 1L5KA 5EJ9A 3HSSA 2QRQA 5HGJA 4G0XA 1LFAA 2WWWA 5HW0A 1P4JA 4Q9AA 1V8DA 1JW9B 3BFXA 1WXHA 3S6JA 1GZ6A 1NXWA 3AEYA 4LOKA 3K8YA 4J0JA 2Z09A 3P0HA 2GBLC 2HO4A 5E1MA 3RJ5A 4F72A 3ZGZA 1JKJB 2FOLA 4K9QA 3EH1A 1WD5A 5JD6A 3WGYA 1MH9A 2PD4A 1IPFA 3VH4A 1T8YA 4JNKA 4G0QA 3H4TA 3WLIA 2ATIA 1Z6XA 1XTSA 4Q5IA 3ICCA 5FXMA 1E0AA 1QQ5A 1C3XA 3DC7A 1KAGA 3EA0A 1JEYB 2GUGA 2EQBA 4JX9A 1WCWA 1KA9H 2ZTUA 4XD2A 3VBEA 1LNSA 3HKBA 3AHGA 3QU7A 3I61A 2XUDA 3B6MA 3I9LA 4N0PA 5B36A 4DIOA 5ICGA 4ARZB 2O0MA 2QVCA 5IYQA 3B1YA 4KOAA 5CLIA 3QPBA 2RB4A 4ZXPA 4WOCA 5L3RA 1L6RA 4O8CA 2WB2A 4FFPA 1PVDA 4DTIA 4EB6A 2IEBA 1N34B 3DEIA 4XFJA 5CFNA 3E1YE 1D1QA 5DHUA 4EY7A 4RSGA 2PLWA 1SHTX 4AY3A 1UDRA 1UXKA 2H2GA 1TFUA 4WACA 3HO6A 4EVIA 4CIWA 3U9TA 2P8JA 2WTBA 4NICA 4PTYA 5CB0A 1BX0A 1MC1A 1QFZA 4U2CA 2Z58A 4PN3A 1QIIA 5L9AA 1XHFA 1E4VA 2C4TA 1Y3AA 4U2DA 4CN8A 4PBTA 1Z7WA 2EFGA 2R0QC 1MDFA 3QMWA 1MTOA 2QTBA 1C9NA 3MZ0A 3WGMA 4QVAA 2PX4A 1KJZA 1UDBA 2J6BA 5CYFA 5JE8A 3H2YA 5FUBA 1KE2A 4Z3OA 1XTBA 2JZCA 2R8EA 4OYHA 1X7GA 3E2PA 2PUWA 4GZMA 5JZOA 1MJFA 5F9HA 5EE3A 2IIPA 4IDNA 2J0EA 1RHMA 1YI1A 2ILVA 5ISMA 1H93A 4M8SA 5F64A 5SY9A 3ZVNA 2BGMA 3FGNA 5KTOA 5ADHA 3ZBQA 3INNA 3DFIA 4DIDA 5C80A 1VA4A 2ZI9A 1K86A 3TN7A 3MWFA 4BCCA 1A2QA 2R48A 3VUEA 4LRQA 4LV5B 3GROA 5FOVA 1PL7A 2IU4A 1K5DA 4W1SA 3IP6A 4QREA 4UEWA 3Q3AA 3FPCA 3QFSA 5CITA 5KJ1A 3FSGD 4YECA 2PR7A 3ZD9A 1DO0A 2BSAA 1IAQA 2C1ZA 4B17A 4IDGA 2QE7D 2F1KA 2QTVB 3U44A 1SUAA 2X9NA 4JODA 4MUMA 2EIHA 4GNKA 3TLMA 3OJWA 2TMYA 4BO1A 2VQEB 4C14A 2X85A 3DD5A 3FNEA 1OFUX 2OBXA 2EJWA 4BLTA 1F8FA 1GZHB 1USIA 3SKXA 3AW9A 3JTEA 4HAZA 1IB0A 3T1YB 1OWLA 2PYZA 1XNHA 3O3NB 1WF6A 3S2FA 1H5NA 2Z4SA 3D3EA 1E5LA 3D6UA 3EXHA 5M2QA 1SZPA 1PBTA 1RQPA 5HVNA 5EJ6A 3IPYA 4DSUA 3LDFA 4UCWA 4EY4A 2ZIFA 1HLFA 5L40A 1HVXA 5F2KA 3EOBI 2CXQA 4YP6A 1BH2A 5IP5A 5JCZA 1NLZA 1YE8A 5CH3A 3SJZA 4BECA 3QZUA 2XVXA 1F51E 4O59O 2I1QA 1FJHA 3SXUA 1YAHA 4AZ3A 2R47A 2YNMC 1V47A 3BIWA 3W1EA 4F9TA 2M32A 3T7CA 1HETA 3BB4A 3O2JA 1H2FA 2H2AA 5L7WA 1Z74A 2HA7A 1Q16A 2GYWA 1F2VA 4BVKA 2AFHA 3D2CA 1H2BA 2H5EA 2JVIA 3UEOA 3PFKA 4ICIA 4H1UA 2CCGA 1IEVA 2QZZA 3DR5A 4C4RA 2NO5A 2VZEA 3KWJA 4OB7A 4ZCMA 4C06A 2WOJA 2HU5A 1R0CA 3P5SA 5EESA 3HBMA 1VF7A 1CR2A 1OXXK 4G8DA 3S8YA 1JN0A 1NMEA 4JLMA 1R6UA 4JD5A 4M0EA 1E5DA 1FFGA 1LTQA 4WCFC 4W9RA 5EN4A 1K5PA 6ABPA 3K6SA 2PSEA 4ACAA 1F7VA 4JVMA 1KEWA 3B9PA 2O1EA 5FFMA 2C78A 2DLNA 2A9QA 4K6MA 3NBQA 1P2BA 4S2UA 2CMHA 4NK4A 3BSFA 3DBHA 4FFMA 2Q0QA 3KWMA 4C7OA 1YVEI 2WWYA 2JGDB 2E3JA 2VHZA 3HB1A 1KOLA 2Z9BA 3T7SA 3ZI0A 1QDLB 3RC7A 3WDKA 1S6YA 2A92A 1L5WA 1KHHA 2DKOA 3LUPA 4IJWA 4MW0A 3TM4A 3JWGA 2J5BA 5JROA 3RFUA 2B3TA 3W5IA 5GINE 2AK3A 2CUNA 2J3LA 3CH4B 1PHPA 1Y5RA 2CFCA 3PDWA 1MB2A 4DMCA 1EAYA 3NDIA 1X7ZB 5JAIA 3WWEA 4EJSC 2EERA 2XKAA 4OQNA 3EPKA 1XPRA 1Q12A 3UXHA 4JI0B 4JIGA 4Y9UA 2WUGA 4CFYA 5SYAA 1GDDA 3D3JA 3TQQA 1LI7A 1GITA 3QF7A 5IYZF 2J33A 1WXWA 4R8SA 3T5TA 3AZQA 2AZXA 4QD3A 1E43A 1KFCB 4Q03A 3HRKA 1ZMRA 2VOJA 3EGEA 1U8TA 3AVOA 3O8QA 3T1NA 4MQ5A 1FYXA 1EUDA 2C3YA 1XUOA 2X4GA 3O0DA 4G5SA 3E9CA 4E30A 4UBJA 3R1IA 3U60B 2KQUA 4YLGA 4FU0A 5JNUA 3SQOA 2H85A 1DG3A 4B34A 2B5OA 2XEDA 4KYTA 3A06A 3A1CA 1Y9JA 2CY0A 2LDBA 1UCFA 3D4NA 3NUQA 4Q4JB 3BMQB 4GF5A 2FEOA 1JAIA 2P4SA 3FYTA 4NFSA 3H5WA 4BE9A 1C1DA 3OKPA 5IF3A 1K4KA 1SBZA 1FTQA 2VF4X 3L9XA 3UHJA 2H65A 1XRMA 3N6VA 3TB6A 2ZWOA 3PIDA 1ZOLA 2IIQA 3F4KA 4RVOA 4BP9A 1EEHA 5F98A 2XAAA 1U0TA 2R3SA 1ECPA 2F62A 2VP0A 5JCOC 4IGIA 4FC6A 1BLIA 3BCUA 3EIXA 3KTFA 4UMFA 1XE1A 2HMVA 1DBPA 2P79A 1L4UA 2WKQA 3AF3A 3ND9A 1PR5A 3OQ6A 4MWDA 2ZREA 1Q5PA 3WKAA 2YHBA 1QBKC 4INOA 4NCJA 1E1CA 3T5CA 3VGPA 1XO1A 2AHOA 3HA3A 3ED1A 3OFJA 1ZJZA 1AURA 1U2ZA 2NU9B 5CBKA 4YCNA 1V5WA 2EF0A 4KODA 1VCIA 4QPPA 3SEZA 3QG1A 3RR2A 3UB3A 1F2UA 2AD5A 3V8VA 3RTCA 1D0SA 2FPUA 1Y7TA 3ZKWA 4PSKA 4R31A 1V11B 4MVJA 4N3GA 5D1NA 6NULA 2J85A 3WDLA 1IBLB 3WGTA 3FTFA 4FN5A 3OTHA 4HFRA 1M5RA 4JLAA 2ERYA 4NYMQ 4DE5A 4EW2A 5BV1A 4HBGA 4R6WA 3Q39A 1RXSA 1T8PA 1V1RB 2DX7A 2Q41A 3O26A 1LEHA 3HV0A 4JYPA 5FBHA 5C81A 1ZH8A 2W2MA 2JH9A 2AG1A 2MT9A 3IP5A 4KYUA 2H4XA 3WGQA 2LRHA 4Q47A 2E1RA 3RYHA 2VJMB 4U9IS 1NP3A 4WXMA 4IIYA 4MV4A 3ZBUA 4NHOA 1C7QA 3V7WA 4URWR 3LOUA 1UUFA 1H8ED 4EOGA 4GW3A 3T7TA 5JFGA 2VC2B 5KYUA 4N40A 3RIYA 3VU3A 4DIFA 2EBHX 3BSWA 1XTUA 2Y0CA 3EVNA 3HKDB 1YRQA 1NIPA 4UJ3A 4WXEA 1U1FA 5FL3A 5DOZA 2AN9A 1PFYA 1Q82D 1CR6A 1N2JA 4TS4A 3ZX4A 3UJNA 2HJWA 4ZHQB 2VHUA 5IT0A 1R8JA 2B61A 2XVAA 5FEUA 3WR5A 1C5KA 4R2IA 1CHDA 1R0XA 3BIFA 3I6YA 2YYYA 1OI3A 4UBLA 4AY4A 3QUQA 4F11A 1QAQA 3JYLA 3U7FB 1NBAA 2JI9A 2XJ9A 1NHGA 5A88A 1NDHA 2PE3A 1PP4A 1TI7A 1A5AB 3QUSA 5ECDA 1L4EA 3QQ5A 2L2QA 2YC2C 1Z07A 3DVRX 3KLPX 4JXXA 1VRVA 3NAQA 3GDWA 1EA5A 1D0IA 3FCXA 4JJFA 1JDUA 4C4TA 5GONB 2AWOA 3NWPA 2ZB3A 5TMEA 4ERXA 2O2EA 3KZVA 4UM8B 4W7IA 1WLSA 4D45A 2XUFA 5IMSA 4HIZA 1YS2X 1QMPA 2ATEA 3GVKA 1EE1A 2WJWA 1HRDA 4KZPA 4MCIA 3PUHA 5INTA 2GAOA 2EKPA 2X5XA 3F3KA 3DE1X 3MTIA 5E9WA 4EVRA 5GOZA 1W0CA 5DN6D 1XD2A 1IY0A 4Y9TA 4MDYA 4XORA 2GPSA 4BFCA 4OOEA 1RDFA 3S2GA 4DAEA 4DAOA 3VM6A 3Q7QA 3UCXA 4W5TA 1KP2A 1OBHA 1JDSA 5EL0A 3ICOA 3E82A 2A33A 2CFOA 3G8DA 5FAXA 1G55A 1HDOA 3JWIA 3U4AA 4DLXA 5LR6A 4U7DA 3ZJTA 4MUNA 1XLTA 3ILXA 4IDCA 2FG7C 4FMPA 1M7BA 3GMIA 2FMUA 3HCWA 1SUIA 3EVTA 3ZDXB 4ZKDA 4R2KA 5EHIA 5HQ3A 3IJ5A 4NSNA 4C6RA 2O52A 1R6VA 2FP3A 2QYTA 4EHHA 4DSAA 5GVSA 1KEEB 1M10A 2OV2A 3OY7A 4QZVA 2C3UA 2VHEA 4II2A 4Y2QA 3AFOA 4Q34A 3U19A 5JXWA 3SEFA 2LIVA 4H6VA 1V2HE 3DHYA 2ZJYA 4DJFC 5K0SA 3IB3A 1ENYA 3QH4A 3QLJA 4IGKA 5AQEA 4ZV4A 4EMUA 1NLUA 1WXFA 4DUZB 3JZIA 2XOEA 3EEYA 3HLKA 3KR9A 4N0EA 5TVGA 3WYGA 3L4KA 2QN9A 1CUHA 2F3QA 3WQQA 5JMTA 2XZLA 2MOKA 2WR8A 1KVRA 2ZZQA 1WMAA 2PT5A 4UASA 4XM0A 3X2EA 3AM1A 3HZZA 4J3JA 1Z4OA 5TR9A 2XE7A 1FUUA 5JBIA 1W5SA 3BQJA 2COKA 1GFZA 3IR6A 4RNCA 3ONUA 1ZKDA 1P2DA 2IODA 3D7MA 1UXOA 3GPDG 4AJ4A 4MUBA 4BFSA 3LX8A 3ADCA 4OO3A 1ZK4A 4XFKA 5L7YA 2ODQA 2ZT6A 5PNTA 5LOVA 2R79A 5DFAA 4BRZA 4EKGA 3TTXA 2XKBA 3EF3A 2ZE5A 3ITKA 3NOVA 3P0RA 1Q0TA 4Z5XA 4M99A 1E7SA 4BMZA 2QRMA 3PXDA 2QLMA 5LKRA 3ETCA 3VSCA 3PE6A 1O6ZA 5JDIC 2BMAA 1J07A 4C6HA 1EBUA 4KVAA 1W25A 1DT5A 3KZOA 1W1WA 4U7PB 3TW6A 1G6KA 4QGFA 1NDQA 4GLJA 3NHJA 4E4RA 4YAGA 2TRSB 1RM3A 2H3EA 4PZ0A 5JS2A 1TYEB 3VGJA 3TW8B 1GUZA 3OJOA 4AIIA 4EFLA 3DLIA 1UOOA 5CK4A 3UAXA 1Y37A 2HWUA 3HSKA 3O1IC 2B78A 4JJ4A 2GD2A 1UK6A 3I45A 5AI0A 3ITDA 4RENA 4AXXA 5A5EA 5JBNA 4D6XA 4ZEWA 1PR4A 5JEEA 3OIWA 5LM3A 4OGFA 1Z06A 2YYSA 4G9BA 4YTEA 3ZV7A 4FDTA 4PCUA 3ZWOA 5AD1A 1GTSA 3SEQA 2DERA 3AL0C 5L7TA 3I5YA 3CP8A 1NYQA 2ZWIA 3VNBA 1JHAA 1SHLA 3N3BC 3HCAA 5ALXA 4FT4A 2YUTA 3H4IA 5ALUA 1UJMA 2VNJA 4CUKA 2OO5C 2X0IA 1P1KA 3CNBA 4J4HA 2JVJA 3G02A 1VPDA 1RAEA 2F3TA 4EZIA 4W5QA 2IX9A 2EGHA 1P6UA 2QP4A 3S44A 3LPAA 3DGFC 3ZTWA 5KQRA 1FLVA 3V9PA 4EABA 5JBQA 1ND5A 2JFBA 1JJ7A 2FXVA 2Q3LA 4TUYB 5TE9A 1UPTA 1C0LA 3R3YA 4A8JC 3I37X 3JQ9C 4FQ5A 1U2GC 3SD7A 4D2IA 2KLHA 2WU1A 1VP3A 3N2YA 4HOYA 1QZTA 3ACDA 3NBFA 4N5LA 4BNYA 3A31A 3NEJA 4BBZA 3RVBA 1UBLS 1QGOA 1QP8A 4XARA 5IASA 2H9AA 3ZY2A 2XNSA 3ZE8A 1PT5A 1P45A 4QODA 3VTAA 4ZCQA 3DBLB 2KBFA 1R00A 2AJLI 3BBPA 4JJ8A 3H0KA 4IVRA 2VNIA 1QV6A 4OGLA 3CTMA 1DUSA 2FPOA 2LTAA 2GNAA 4GX1A 5AW3A 3R9WA 1JHYA 1Y81A 2P5UA 1GL7A 4X5OA 3MWJA 5IUJC 3WQZA 4IZIA 3TIFA 5EWJB 1Q1NA 4FVTA 3JQPA 2C04A 2IYVA 1AGXA 2IVZA 4IXTA 3B5EA 1TYZA 1WOMA 1QUEA 1ZCZA 3LCMA 3RVDA 3WLHA 1RAIA 4QE3A 1EJBA 2B8JA 4BQIA 4AI6A 3FUXA 4BZWA 1RXIA 2H0AA 1A7AA 1P2TA 2LCQA 4DLNA 2FPGB 1LPNA 1B3BA 2W5UA 4KPUB 4WXYB 1FMTA 3ZI4A 1G2PA 3K5IA 5ITWA 1JHQA 1L3BA 2FEAA 4LVUA 4LJ4A 2VF7A 3RODA 2W00A 2C88A 1C2TA 2WYUA 5B12A 3QEBZ 3K0FB 1QHHA 1I4EB 2GHQA 3B60A 3F8TA 1E7MA 1H0HA 3PDCA 4AZ0B 4E6PA 5JOQA 5DT2A 2FAXA 3A3NA 1ZCBA 4QFDA 3TCXB 1U80A 1T9DA 3ZGLA 5DM0A 5AJTA 1RRGA 3QKRA 4OXYA 1POXA 3RTGA 4Z6KA 5KYWA 5A3RA 4EECA 3KTDA 5M5BA 4BVBA 3I62A 1DC3A 3GMDA 1SXJB 1E3MA 3DXFA 1YULA 3L5OA 4H0FA 4IUYA 3OT1A 5LQCA 3ADBA 1ZIXA 1B0AA 2QXUA 4KN5A 4XCVA 4U2GA 2WF6A 1H9BA 4HUJA 4H0NA 4B3FX 1BXGB 2Q3DA 2BMDA 1B42A 1OLXA 3NVKI 5KCMA 4F93B 3KQLA 4D56A 1B8VA 4KQWA 4UNIA 2XB2A 4MKZA 1P7PA 3W3AD 1LC0A 1X1BA 1YR3A 2A84A 1M72A 3QOYA 4FT2A 1NUAA 2IDJA 4IG9A 4YBZA 3T9CA 2IRWA 2D0IA 4LWZA 4OSOA 1OYWA 5DBEX 3A8IA 2IYTA 3FMVA 4QUBA 2ATXA 3ETDA 4AO7A 4B4UA 5I7SA 2G28A 2WJPA 1DMSA 4MW4A 1KJYA 3E70C 1VQ9B 2V0NA 1JQAA 3L7BA 4EK9A 5AWFC 1HE2A 5I6DA 5ITZB 4KN6A 2QD4A 5LDDC 1JU3A 2GJAA 4IHJA 2BEWA 4E5UA 2H1SA 2YIJA 3LBIA 5J4LA 1SXGA 4KO1S 2I99A 2AEMA 4XDGA 1MAVA 4CR6A 1OIXA 3BSSA 4MA4A 4BN0A 4GMHA 4XLFA 3KETA 3UQYS 1L8QA 3I4FA 4GI3A 2JLQA 2NU7A 3EVFA 4FN4A 5J5AA 1UDCA 1DBRA 4IH9A 5K3EA 3IP9A 4C07A 1YAJA 1D9ZA 1XWWA 1HT3A 1KZLA 2OTCA 4YUWA 2QA5A 3NDRA 1AA9A 1J25A 3D7SA 4Y1RB 2ENWA 3LH5A 4FKBA 4BMOB 1JXOA 1WCXA 2NGRA 3BEDA 1RAAA 3O4IA 1XZIA 2D00A 3OH8A 4GKAA 3RUFA 2GDZA 3N59A 5CA1A 1NSYA 3PXAA 4BNZA 3QX3A 1GPYA 1Z3CA 2VHJA 3SOPA 3ZTYA 3H2JA 4C03A 4O4JB 4PCVA 4UOEA 2IXFA 2XVZA 3QXXA 1JR3A 1V37A 3OCVA 4LRSB 1YASA 3SZUA 4D8VA 3RYCB 3D8UA 2HNBA 3G0CA 5DEIA 1KMMA 2WIBA 3F6CA 4HKTA 4KR0A 4RA9B 1KMHA 2B0JA 2DLDA 2BSQA 1NVDA 5I5EA 1QIMA 4L5BA 3UHAA 1CJMA 1GUAA 5IM5A 4CMAA 1I0ZA 2DOKA 1VB5A 4IIVA 3T99A 1ZINA 1WU7A 4K2AA 5T6BA 4AU1A 1JKXA 1IOWA 2BMWA 4ND6A 2HIHA 4PLVA 3VYWA 4BNIA 1Q21A 2GJSA 1R64A 2UYCA 2V3CC 3IODA 1W85A 2YZKA 2Z5FA 1F1JA 3NO4A 1TPYA 3AVPA 3ZWBA 1Z68A 1BE8A 3NFYA 4BQRA 4M0CA 4V0OA 1L7OA 1LS6A 4GMFA 1A8IA 2BOVA 5K3SA 4PX9A 2QVZX 4OHPA 1UFRA 1FFCA 3FKSA 4D3YA 3BERA 1JALA 1U2TA 4MROA 2RGWA 4X20A 1Q91A 2P5SA 2B34A 4EKIA 4NENB 5B7PA 4C4AA 3JQAB 4NFYA 2QN8A 4HNHA 2ZCVA 2I4OA 4F84A 4TYWA 5K01A 1MX3A 1VB3A 3LOQA 1Q1ZA 4ND3A 1KY3A 3MK31 1NURA 2EWMA 3EFHA 1GR1A 4LPSA 3AF5A 3COVA 3T3MB 4H2DA 4DDMA 2QD1A 1UD2A 8ATCA 1R0YA 3MOGA 1A04A 5CUQA 2DWUA 2QN1A 4A5SA 1RMYA 3BGDA 2XYQA 3BCDA 1HRKA 2WSIA 1CZOA 1ESMA 2JBAA 1X2BA 3FNHA 5KBYA 3OPXA 4O29A 2QJTA 3EGWA 2GPJA 2RAFA 1B6SA 4NBTA 3GVXA 4ZGBA 4LDNA 5TQ2A 2VP2A 3GIRA 2I76A 1ODIA 3A35A 2XMSA 4LQ4A 1XVVA 2J9XB 3RSSA 4BLRA 4CLOB 2Y1FA 5F52A 4GYWA 1RMQA 4E21A 4IDFA 4CV2A 2JJMA 4L5AA 1V3TA 2LDXA 5BSRA 1X80A 1G41A 5CLQA 1HH4A 2PXXA 2UZ0A 4ARUA 3U4CA 3RAJA 2AOWA 3D43A 3MGBA 3RSLA 3ZC3A 3MWDA 1MP0A 4UEOA 5SYNA 4I55A 3W5AA 2H1RA 2AR0A 2P3SA 5FH9A 2DB3A 4P12A 4LXTA 1ZH6A 2X23A 4DG9A 4FD2A 4RZ2A 1IBRA 3ZDAA 4TPKA 4BV3A 2P2ZA 2G9VA 3S70A 3URMA 2DRIA 4L74A 4M8LA 1WL8A 2WSYB 3SLNA 3KCQA 2DQKA 3F96A 5E0OA 2O8VA 3GW8A 2FVYA 3O3OB 2QQFA 1NBWB 3K1TA 1VMIA 3FLEA 1S01A 1EB8A 4JLUA 3V00A 3BQ9A 4YQEA 4DANA 1JAXA 1NP6A 1KEUA 2Q0HA 2B37A 1J9EA 4CE6A 4AUEA 4Z4FA 3THWB 4IIHA 2I1VB 4LYYA 1HQCA 4RS4A 3I12A 3CCLB 1WKBA 2P9YA 2Y0DA 3TH5A 2GK3A 1M6NA 4U2BA 1MIOB 4DRZA 4EG5A 4YRBA 5CTJA 4KXWA 2OORC 4KKTA 2NXWA 3UC9A 1QZZA 3AEQA 1T4DA 2BP7B 2OBMA 3PUZA 2HJRA 1Z2PX 2WD7A 3BTUA 2IYXA 1HSZA 1P5ZB 2JFFA 2JFVA 1MEOA 3M4NA 1N6LA 4P5EA 1M1UA 5EJ5A 4LJ7A 2V7TA 1T6XA 1IIBA 3E18A 3KT8A 4K0KB 1HMYA 4OA5A 4EUNA 1PYDA 2IEAA 4P08A 4DCTA 3DTTA 1ABEA 4HN2A 4OHXA 1DX9A 2HIMA 4HAYA 1TK3A 3K94A 3KKNA 4TN5A 2I80A 1GCAA 1H0KA 1U31A 5SZHB 3RJMA 3X1JA 4CTOA 4RVFA 2O2JA 2PGIA 2DWPA 1FP4B 1ETHA 1VI6A 1JA9A 5EKXA 2Y2UA 1SIBE 3B82A 1P4GA 7YASA 1EG2A 4IFBA 4UBKA 1WUIS 5LQRA