1KK4A

Crystal structure of vat(d) in complex with acetyl-coa
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
205
structure length
205
Chain Sequence
MGPNPMKMYPIEGNKSVQFIKPILEKLENVEVGEYSYYDSKNGETFDKQILYHYPILNDKLKIGKFCSIGPGVTIIMNGANHRMDGSTYPFNLFGNGWEKHMPKLDQLPIKGDTIIGNDVWIGKDVVIMPGVKIGDGAIVAANSVVVKDIAPYMLAGGNPANEIKQRFDQDTINQLLDIKWWNWPIDIINENIDKILDNSIIREV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Vat(D): an acetyltransferase that inactivates streptogramin group A antibiotics.
pubmed doi rcsb
source organism Enterococcus faecium
molecule tags Transferase
molecule keywords STREPTOGRAMIN A ACETYLTRANSFERASE
total genus 60
structure length 205
sequence length 205
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.-:
pdb deposition date 2001-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 1kk4A00
1V3WA 4K6RA 1T3DA 3JQYA 1MR7A 4J18A 2P2OA 5E3RA 2V0KA 4KNRA 1QRFA 3SPTA 1KQAA 3R5CA 4E79A 2OI6A 4E1KA 4MZUA 5U2KA 1YP2A 1HV9A 1SSTA 1SSMA 1QRLA 4IHHA 5DEPA 2AQ9A 2QIAA 1QRMA 4KQLA 4M99A 3F1XA 3HJJA 3ECTA 2NPOA 4M2AA 1S80A 3VNPA 3VBMA 2TDTA 3FS8A 4MYOA 3P47A 2VD4A 2WLEA 3P1BA 2ICYA 1OCXA 4HURA 4AAWA 2WLCA 3D98A 3MQGA 3R5BA 3VBKA 5E3PA 5ADXU 3FOQA 3VBLA 4H7OA 1QRGA 2OI7A 4EGGA 5DEMA 4EA8A 3R0SA 3IGJA 3R8YA 3BSSA 3BRKX 3VBNA 4J09A 2W0WA 5E3QA 2IUAA 3OU9A 3C8VA 4N27A 3TK8A 1HM9A 1KRVA 1QQ0A 1YP3A 3OW5A 4IHGA 3R5AA 5AFUU 2W0VA 1KHRA 3BFPA 3MC4A 4R36A 1YP4A 3FSBA 3T57A 1XATA 4HZDA 5AFUV 4HZCA 2V0HA 1KGTA 1G95A 3ST8A 5F42A 3BSYA 3R1WA 3KWDA 3TISA 3FSXA 1Z90A 4M98A 1KRUA 3Q1XA 3KWEA 4EQYA 4R7PA 4ISXA 1HM0A 3OUPA 5L6SA 1V67A 1KRRA 4N69A 3R5DA 4EA9A 3R3RA 4E6TA 3OTZA 4G3SA 3IXCA 2WLDA 4M9CA 3TIOA 2I5KA 3GOSA 2V0IA 4G87A 4EAAA 1G97A 1KK6A 3TV0A 2Q4JA 3EH0A 4KPXA 2RIJA 3FSCA 1KK5A 4E6UA 3DK5A 2IU9A 2OEGA 1XHDA 4FCEA 4EABA 2OEFA 2GGQA 2IC7A 3DJ4A 4M28A 3GUEA 2WLGA 4G3QA 4KNXA 2V0JA 3FSYA 1KK4A 2QIVX 1FWYA 3I3XA 4R37A 4AC3A 4HUSA 4EA7A 4KPZA 2JF2A 3D8VA 5L6VA 4N6BA 2XATA 4E75A 2VHEA 3EG4A 3V4EA 4DCLA 5ADXV 2WLFA 3VBIA 3TDTA 3FWWA 5DG3A 1MRLA 1QREA 1THJA 3BXYA 3HSQA 3TWDA 3I3AA 1FXJA 4MFGA 2IU8A 3VBJA 2GGOA 1LXAA 1J2ZA 1HM8A 3KWCA 3R2WA 4M2BA 3PMOA 4N6AA 3FTTA 2FKOA 2JF3A 3GVDA 3EEVA 2OI5A 4HCQA 4G3PA 1TDTA 1SSQA 2ICXA 2QKXA 4IHFA 3MQHA 3CJ8A 3OTMA 4AA7A 3SRTA 1MR9A 3R3IA 3DHOA 3BSWA 3VBPA 3NZ2A 1KGQA 2V0LA
chains in the Genus database with same CATH superfamily
1V3WA 4K6RA 1T3DA 3JQYA 1MR7A 4J18A 2P2OA 5E3RA 2V0KA 4KNRA 1QRFA 3SPTA 1KQAA 3R5CA 4E79A 2OI6A 4E1KA 4MZUA 5U2KA 1YP2A 1HV9A 1SSTA 1SSMA 1QRLA 1M8NA 4IHHA 5DEPA 2AQ9A 2QIAA 1QRMA 4KQLA 4M99A 3F1XA 3HJJA 3ECTA 2NPOA 4M2AA 1S80A 3VNPA 3VBMA 2TDTA 3FS8A 4MYOA 3P47A 2VD4A 2WLEA 3P1BA 2ICYA 1OCXA 4HURA 4AAWA 2WLCA 3D98A 3MQGA 3R5BA 3VBKA 5E3PA 5ADXU 3FOQA 3VBLA 4H7OA 1QRGA 2OI7A 4EGGA 5DEMA 4EA8A 3R0SA 3IGJA 3R8YA 3SUCA 3BSSA 3BRKX 3GQAA 3VBNA 4J09A 2W0WA 5E3QA 2IUAA 3OU9A 3C8VA 4N27A 3TK8A 1HM9A 1KRVA 1QQ0A 1YP3A 3OW5A 4IHGA 3R5AA 3OGZA 5AFUU 2W0VA 1KHRA 3BFPA 3MC4A 4R36A 1YP4A 3FSBA 3OH0A 1XATA 4HZDA 3T57A 5AFUV 4HZCA 2V0HA 1KGTA 1G95A 3ST8A 1EWWA 5F42A 3BSYA 3R1WA 3KWDA 3TISA 3FSXA 1Z90A 4M98A 1KRUA 3Q1XA 3GQ7A 3KWEA 4EQYA 4R7PA 3OH1A 1HM0A 3OUPA 4ISXA 5L6SA 1V67A 1KRRA 4N69A 3R5DA 1L0SA 3R3RA 4EA9A 3OTZA 4E6TA 1N4IA 4G3SA 3IXCA 2WLDA 4M9CA 3TIOA 1Z2FA 2I5KA 3GOSA 2V0IA 4G87A 4EAAA 1G97A 1KK6A 3OH4A 3TV0A 2Q4JA 3EH0A 4KPXA 2RIJA 3FSCA 1KK5A 4E6UA 3DK5A 2IU9A 2OEGA 1XHDA 4FCEA 4EABA 2OEFA 2GGQA 2IC7A 3DJ4A 4M28A 3GUEA 2WLGA 4G3QA 4KNXA 2V0JA 3FSYA 1KK4A 2QIVX 1FWYA 3I3XA 4R37A 4AC3A 4HUSA 4EA7A 4KPZA 2JF2A 3D8VA 5L6VA 4N6BA 2XATA 4E75A 2VHEA 3EG4A 3V4EA 4DCLA 5ADXV 2WLFA 3VBIA 3TDTA 3FWWA 5DG3A 1MRLA 1QREA 3OH3A 1THJA 3BXYA 3HSQA 3TWDA 3I3AA 1FXJA 4MFGA 2IU8A 3VBJA 2GGOA 1LXAA 1J2ZA 1HM8A 3KWCA 3R2WA 4M2BA 3PMOA 4N6AA 3FTTA 2FKOA 2JF3A 3GVDA 3EEVA 2OI5A 4HCQA 4G3PA 1TDTA 1SSQA 2ICXA 3GQ8A 2QKXA 4IHFA 3MQHA 3CJ8A 3OTMA 4AA7A 3SRTA 1MR9A 3R3IA 3DHOA 3OH2A 3BSWA 3GQ9A 3VBPA 3NZ2A 1KGQA 2V0LA
chains in the Genus database with same CATH topology
1V3WA 4K6RA 1T3DA 3JQYA 1MR7A 4J18A 2P2OA 5E3RA 2V0KA 4KNRA 1QRFA 3SPTA 1KQAA 3R5CA 4E79A 2OI6A 4E1KA 4MZUA 5U2KA 1YP2A 1HV9A 1SSTA 1SSMA 1QRLA 4IHHA 5DEPA 2AQ9A 2QIAA 1QRMA 4KQLA 4M99A 3F1XA 3HJJA 3ECTA 2NPOA 4M2AA 1S80A 3VNPA 3VBMA 2TDTA 3FS8A 4MYOA 3P47A 2VD4A 2WLEA 3P1BA 2ICYA 1OCXA 4HURA 4AAWA 2WLCA 3D98A 3MQGA 3R5BA 3VBKA 5E3PA 5ADXU 3FOQA 3VBLA 4H7OA 1QRGA 2OI7A 4EGGA 5DEMA 4EA8A 3R0SA 3IGJA 3R8YA 3BSSA 3BRKX 3VBNA 4J09A 2W0WA 5E3QA 2IUAA 3OU9A 3C8VA 4N27A 3TK8A 1HM9A 1KRVA 1QQ0A 1YP3A 3OW5A 4IHGA 3R5AA 5AFUU 2W0VA 1KHRA 3BFPA 3MC4A 4R36A 1YP4A 3FSBA 3T57A 1XATA 4HZDA 5AFUV 4HZCA 2V0HA 1KGTA 1G95A 3ST8A 5F42A 3BSYA 3R1WA 3KWDA 3TISA 3FSXA 1Z90A 4M98A 1KRUA 3Q1XA 3KWEA 4EQYA 4R7PA 4ISXA 1HM0A 3OUPA 5L6SA 1V67A 1KRRA 4N69A 3R5DA 4EA9A 3R3RA 4E6TA 3OTZA 4G3SA 3IXCA 2WLDA 4M9CA 3TIOA 2I5KA 3GOSA 2V0IA 4G87A 4EAAA 1G97A 1KK6A 3TV0A 2Q4JA 3EH0A 4KPXA 2RIJA 3FSCA 1KK5A 4E6UA 3DK5A 2IU9A 2OEGA 1XHDA 4FCEA 4EABA 2OEFA 2GGQA 2IC7A 3DJ4A 4M28A 3GUEA 2WLGA 4G3QA 4KNXA 2V0JA 3FSYA 1KK4A 2QIVX 1FWYA 3I3XA 4R37A 4AC3A 4HUSA 4EA7A 4KPZA 2JF2A 3D8VA 5L6VA 4N6BA 2XATA 4E75A 2VHEA 3EG4A 3V4EA 4DCLA 5ADXV 2WLFA 3VBIA 3TDTA 3FWWA 5DG3A 1MRLA 1QREA 1THJA 3BXYA 3HSQA 3TWDA 3I3AA 1FXJA 4MFGA 2IU8A 3VBJA 2GGOA 1LXAA 1J2ZA 1HM8A 3KWCA 3R2WA 4M2BA 3PMOA 4N6AA 3FTTA 2FKOA 2JF3A 3GVDA 3EEVA 2OI5A 4HCQA 4G3PA 1TDTA 1SSQA 2ICXA 2QKXA 4IHFA 3MQHA 3CJ8A 3OTMA 4AA7A 3SRTA 1MR9A 3R3IA 3DHOA 3BSWA 3VBPA 3NZ2A 1KGQA 2V0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V3W A;  4K6R A;  1T3D A;  3JQY A;  1MR7 A;  4J18 A;  2P2O A;  5E3R A;  2V0K A;  4KNR A;  1QRF A;  3SPT A;  1KQA A;  3R5C A;  4E79 A;  2OI6 A;  4E1K A;  4MZU A;  5U2K A;  1YP2 A;  1HV9 A;  1SST A;  1SSM A;  1QRL A;  4IHH A;  5DEP A;  2AQ9 A;  2QIA A;  1QRM A;  4KQL A;  4M99 A;  3F1X A;  3HJJ A;  3ECT A;  2NPO A;  4M2A A;  1S80 A;  3VNP A;  3VBM A;  2TDT A;  3FS8 A;  4MYO A;  3P47 A;  2VD4 A;  2WLE A;  3P1B A;  2ICY A;  1OCX A;  4HUR A;  4AAW A;  2WLC A;  3D98 A;  3MQG A;  3R5B A;  3VBK A;  5E3P A;  5ADX U;  3FOQ A;  3VBL A;  4H7O A;  1QRG A;  2OI7 A;  4EGG A;  5DEM A;  4EA8 A;  3R0S A;  3IGJ A;  3R8Y A;  3BSS A;  3BRK X;  3VBN A;  4J09 A;  2W0W A;  5E3Q A;  2IUA A;  3OU9 A;  3C8V A;  4N27 A;  3TK8 A;  1HM9 A;  1KRV A;  1QQ0 A;  1YP3 A;  3OW5 A;  4IHG A;  3R5A A;  5AFU U;  2W0V A;  1KHR A;  3BFP A;  3MC4 A;  4R36 A;  1YP4 A;  3FSB A;  3T57 A;  1XAT A;  4HZD A;  5AFU V;  4HZC A;  2V0H A;  1KGT A;  1G95 A;  3ST8 A;  5F42 A;  3BSY A;  3R1W A;  3KWD A;  3TIS A;  3FSX A;  1Z90 A;  4M98 A;  1KRU A;  3Q1X A;  3KWE A;  4EQY A;  4R7P A;  4ISX A;  1HM0 A;  3OUP A;  5L6S A;  1V67 A;  1KRR A;  4N69 A;  3R5D A;  4EA9 A;  3R3R A;  4E6T A;  3OTZ A;  4G3S A;  3IXC A;  2WLD A;  4M9C A;  3TIO A;  2I5K A;  3GOS A;  2V0I A;  4G87 A;  4EAA A;  1G97 A;  1KK6 A;  3TV0 A;  2Q4J A;  3EH0 A;  4KPX A;  2RIJ A;  3FSC A;  1KK5 A;  4E6U A;  3DK5 A;  2IU9 A;  2OEG A;  1XHD A;  4FCE A;  4EAB A;  2OEF A;  2GGQ A;  2IC7 A;  3DJ4 A;  4M28 A;  3GUE A;  2WLG A;  4G3Q A;  4KNX A;  2V0J A;  3FSY A;  1KK4 A;  2QIV X;  1FWY A;  3I3X A;  4R37 A;  4AC3 A;  4HUS A;  4EA7 A;  4KPZ A;  2JF2 A;  3D8V A;  5L6V A;  4N6B A;  2XAT A;  4E75 A;  2VHE A;  3EG4 A;  3V4E A;  4DCL A;  5ADX V;  2WLF A;  3VBI A;  3TDT A;  3FWW A;  5DG3 A;  1MRL A;  1QRE A;  1THJ A;  3BXY A;  3HSQ A;  3TWD A;  3I3A A;  1FXJ A;  4MFG A;  2IU8 A;  3VBJ A;  2GGO A;  1LXA A;  1J2Z A;  1HM8 A;  3KWC A;  3R2W A;  4M2B A;  3PMO A;  4N6A A;  3FTT A;  2FKO A;  2JF3 A;  3GVD A;  3EEV A;  2OI5 A;  4HCQ A;  4G3P A;  1TDT A;  1SSQ A;  2ICX A;  2QKX A;  4IHF A;  3MQH A;  3CJ8 A;  3OTM A;  4AA7 A;  3SRT A;  1MR9 A;  3R3I A;  3DHO A;  3BSW A;  3VBP A;  3NZ2 A;  1KGQ A;  2V0L A; 
#chains in the Genus database with same CATH topology
 1V3W A;  4K6R A;  1T3D A;  3JQY A;  1MR7 A;  4J18 A;  2P2O A;  5E3R A;  2V0K A;  4KNR A;  1QRF A;  3SPT A;  1KQA A;  3R5C A;  4E79 A;  2OI6 A;  4E1K A;  4MZU A;  5U2K A;  1YP2 A;  1HV9 A;  1SST A;  1SSM A;  1QRL A;  1M8N A;  4IHH A;  5DEP A;  2AQ9 A;  2QIA A;  1QRM A;  4KQL A;  4M99 A;  3F1X A;  3HJJ A;  3ECT A;  2NPO A;  4M2A A;  1S80 A;  3VNP A;  3VBM A;  2TDT A;  3FS8 A;  4MYO A;  3P47 A;  2VD4 A;  2WLE A;  3P1B A;  2ICY A;  1OCX A;  4HUR A;  4AAW A;  2WLC A;  3D98 A;  3MQG A;  3R5B A;  3VBK A;  5E3P A;  5ADX U;  3FOQ A;  3VBL A;  4H7O A;  1QRG A;  2OI7 A;  4EGG A;  5DEM A;  4EA8 A;  3R0S A;  3IGJ A;  3R8Y A;  3SUC A;  3BSS A;  3BRK X;  3GQA A;  3VBN A;  4J09 A;  2W0W A;  5E3Q A;  2IUA A;  3OU9 A;  3C8V A;  4N27 A;  3TK8 A;  1HM9 A;  1KRV A;  1QQ0 A;  1YP3 A;  3OW5 A;  4IHG A;  3R5A A;  3OGZ A;  5AFU U;  2W0V A;  1KHR A;  3BFP A;  3MC4 A;  4R36 A;  1YP4 A;  3FSB A;  3OH0 A;  1XAT A;  4HZD A;  3T57 A;  5AFU V;  4HZC A;  2V0H A;  1KGT A;  1G95 A;  3ST8 A;  1EWW A;  5F42 A;  3BSY A;  3R1W A;  3KWD A;  3TIS A;  3FSX A;  1Z90 A;  4M98 A;  1KRU A;  3Q1X A;  3GQ7 A;  3KWE A;  4EQY A;  4R7P A;  3OH1 A;  1HM0 A;  3OUP A;  4ISX A;  5L6S A;  1V67 A;  1KRR A;  4N69 A;  3R5D A;  1L0S A;  3R3R A;  4EA9 A;  3OTZ A;  4E6T A;  1N4I A;  4G3S A;  3IXC A;  2WLD A;  4M9C A;  3TIO A;  1Z2F A;  2I5K A;  3GOS A;  2V0I A;  4G87 A;  4EAA A;  1G97 A;  1KK6 A;  3OH4 A;  3TV0 A;  2Q4J A;  3EH0 A;  4KPX A;  2RIJ A;  3FSC A;  1KK5 A;  4E6U A;  3DK5 A;  2IU9 A;  2OEG A;  1XHD A;  4FCE A;  4EAB A;  2OEF A;  2GGQ A;  2IC7 A;  3DJ4 A;  4M28 A;  3GUE A;  2WLG A;  4G3Q A;  4KNX A;  2V0J A;  3FSY A;  1KK4 A;  2QIV X;  1FWY A;  3I3X A;  4R37 A;  4AC3 A;  4HUS A;  4EA7 A;  4KPZ A;  2JF2 A;  3D8V A;  5L6V A;  4N6B A;  2XAT A;  4E75 A;  2VHE A;  3EG4 A;  3V4E A;  4DCL A;  5ADX V;  2WLF A;  3VBI A;  3TDT A;  3FWW A;  5DG3 A;  1MRL A;  1QRE A;  3OH3 A;  1THJ A;  3BXY A;  3HSQ A;  3TWD A;  3I3A A;  1FXJ A;  4MFG A;  2IU8 A;  3VBJ A;  2GGO A;  1LXA A;  1J2Z A;  1HM8 A;  3KWC A;  3R2W A;  4M2B A;  3PMO A;  4N6A A;  3FTT A;  2FKO A;  2JF3 A;  3GVD A;  3EEV A;  2OI5 A;  4HCQ A;  4G3P A;  1TDT A;  1SSQ A;  2ICX A;  3GQ8 A;  2QKX A;  4IHF A;  3MQH A;  3CJ8 A;  3OTM A;  4AA7 A;  3SRT A;  1MR9 A;  3R3I A;  3DHO A;  3OH2 A;  3BSW A;  3GQ9 A;  3VBP A;  3NZ2 A;  1KGQ A;  2V0L A; 
#chains in the Genus database with same CATH homology
 1V3W A;  4K6R A;  1T3D A;  3JQY A;  1MR7 A;  4J18 A;  2P2O A;  5E3R A;  2V0K A;  4KNR A;  1QRF A;  3SPT A;  1KQA A;  3R5C A;  4E79 A;  2OI6 A;  4E1K A;  4MZU A;  5U2K A;  1YP2 A;  1HV9 A;  1SST A;  1SSM A;  1QRL A;  4IHH A;  5DEP A;  2AQ9 A;  2QIA A;  1QRM A;  4KQL A;  4M99 A;  3F1X A;  3HJJ A;  3ECT A;  2NPO A;  4M2A A;  1S80 A;  3VNP A;  3VBM A;  2TDT A;  3FS8 A;  4MYO A;  3P47 A;  2VD4 A;  2WLE A;  3P1B A;  2ICY A;  1OCX A;  4HUR A;  4AAW A;  2WLC A;  3D98 A;  3MQG A;  3R5B A;  3VBK A;  5E3P A;  5ADX U;  3FOQ A;  3VBL A;  4H7O A;  1QRG A;  2OI7 A;  4EGG A;  5DEM A;  4EA8 A;  3R0S A;  3IGJ A;  3R8Y A;  3BSS A;  3BRK X;  3VBN A;  4J09 A;  2W0W A;  5E3Q A;  2IUA A;  3OU9 A;  3C8V A;  4N27 A;  3TK8 A;  1HM9 A;  1KRV A;  1QQ0 A;  1YP3 A;  3OW5 A;  4IHG A;  3R5A A;  5AFU U;  2W0V A;  1KHR A;  3BFP A;  3MC4 A;  4R36 A;  1YP4 A;  3FSB A;  3T57 A;  1XAT A;  4HZD A;  5AFU V;  4HZC A;  2V0H A;  1KGT A;  1G95 A;  3ST8 A;  5F42 A;  3BSY A;  3R1W A;  3KWD A;  3TIS A;  3FSX A;  1Z90 A;  4M98 A;  1KRU A;  3Q1X A;  3KWE A;  4EQY A;  4R7P A;  4ISX A;  1HM0 A;  3OUP A;  5L6S A;  1V67 A;  1KRR A;  4N69 A;  3R5D A;  4EA9 A;  3R3R A;  4E6T A;  3OTZ A;  4G3S A;  3IXC A;  2WLD A;  4M9C A;  3TIO A;  2I5K A;  3GOS A;  2V0I A;  4G87 A;  4EAA A;  1G97 A;  1KK6 A;  3TV0 A;  2Q4J A;  3EH0 A;  4KPX A;  2RIJ A;  3FSC A;  1KK5 A;  4E6U A;  3DK5 A;  2IU9 A;  2OEG A;  1XHD A;  4FCE A;  4EAB A;  2OEF A;  2GGQ A;  2IC7 A;  3DJ4 A;  4M28 A;  3GUE A;  2WLG A;  4G3Q A;  4KNX A;  2V0J A;  3FSY A;  1KK4 A;  2QIV X;  1FWY A;  3I3X A;  4R37 A;  4AC3 A;  4HUS A;  4EA7 A;  4KPZ A;  2JF2 A;  3D8V A;  5L6V A;  4N6B A;  2XAT A;  4E75 A;  2VHE A;  3EG4 A;  3V4E A;  4DCL A;  5ADX V;  2WLF A;  3VBI A;  3TDT A;  3FWW A;  5DG3 A;  1MRL A;  1QRE A;  1THJ A;  3BXY A;  3HSQ A;  3TWD A;  3I3A A;  1FXJ A;  4MFG A;  2IU8 A;  3VBJ A;  2GGO A;  1LXA A;  1J2Z A;  1HM8 A;  3KWC A;  3R2W A;  4M2B A;  3PMO A;  4N6A A;  3FTT A;  2FKO A;  2JF3 A;  3GVD A;  3EEV A;  2OI5 A;  4HCQ A;  4G3P A;  1TDT A;  1SSQ A;  2ICX A;  2QKX A;  4IHF A;  3MQH A;  3CJ8 A;  3OTM A;  4AA7 A;  3SRT A;  1MR9 A;  3R3I A;  3DHO A;  3BSW A;  3VBP A;  3NZ2 A;  1KGQ A;  2V0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...