1KK5A

Crystal structure of vat(d) (form ii)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
206
structure length
206
Chain Sequence
b'MGPNPMKMYPIEGNKSVQFIKPILEKLENVEVGEYSYYDSKNGETFDKQILYHYPILNDKLKIGKFCSIGPGVTIIMNGANHRMDGSTYPFNLFGNGWEKHMPKLDQLPIKGDTIIGNDVWIGKDVVIMPGVKIGDGAIVAANSVVVKDIAPYMLAGGNPANEIKQRFDQDTINQLLDIKWWNWPIDIINENIDKILDNSIIREVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTOGRAMIN A ACETYLTRANSFERASE
publication title Crystal structure of Vat(D): an acetyltransferase that inactivates streptogramin group A antibiotics.
pubmed doi rcsb
source organism Enterococcus faecium
molecule tags Transferase
total genus 60
structure length 206
sequence length 206
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.-:
pdb deposition date 2001-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 1kk5A00
2ICYA 2V0LA 4EAAA 3R1WA 4ISXA 5E3PA 5U2KA 1S80A 1THJA 3EEVA 1QREA 4G87A 3VBNA 2IC7A 3FWWA 3R2WA 4M9CA 3P47A 3HSQA 4AAWA 1FWYA 1KQAA 3DK5A 1SSTA 1QRGA 3R3IA 4M2AA 2V0KA 1SSQA 2TDTA 2OI7A 3EH0A 4R7PA 1OCXA 2JF2A 2P2OA 2WLGA 3BSYA 3GOSA 3OTZA 4K6RA 3TISA 3TV0A 1MR7A 3V4EA 4N69A 4N6AA 4EABA 3R3RA 3VBKA 1QRLA 3PMOA 4M28A 1V67A 3C8VA 3R8YA 4H7OA 1KK5A 2XATA 2FKOA 1MRLA 3FTTA 3R5CA 2QIVX 1YP3A 2VHEA 1HM9A 1HM8A 1KK6A 1MR9A 1HM0A 4G3PA 3T57A 3TDTA 3BFPA 2Q4JA 4M98A 4MYOA 4KNXA 1V3WA 1QRMA 4HZCA 4IHFA 1HV9A 3D8VA 1G97A 3R5AA 5E3RA 4HZDA 2VD4A 3SRTA 3IGJA 3ECTA 4E79A 1TDTA 2IU8A 4EA8A 2WLFA 4KQLA 2RIJA 3FSCA 4N6BA 3IXCA 3TIOA 2GGOA 2GGQA 2OI6A 3FOQA 3KWEA 2OEFA 1J2ZA 2I5KA 4KNRA 4EA9A 3TWDA 4EA7A 5ADXV 3DHOA 3GVDA 1Z90A 3FSBA 3I3AA 1YP2A 3VBPA 1KRRA 1KGQA 4J18A 4MZUA 4R36A 1KHRA 2OI5A 2W0VA 3ST8A 4G3SA 5L6VA 3DJ4A 3FSYA 3BXYA 3MQHA 3VBJA 2IUAA 5ADXU 4HUSA 2WLDA 3FS8A 4J09A 4AA7A 2QIAA 5L6SA 3GUEA 4FCEA 4R37A 5AFUV 3BSWA 3I3XA 4N27A 3MC4A 4EGGA 3Q1XA 2W0WA 5DEPA 3BSSA 3KWDA 3OTMA 3CJ8A 5F42A 2WLEA 3VNPA 1QQ0A 3NZ2A 2IU9A 2WLCA 2JF3A 3BRKX 4IHGA 5AFUU 3FSXA 3R5DA 1SSMA 3VBIA 1G95A 1KGTA 5DEMA 3VBMA 3OU9A 2V0HA 4IHHA 4AC3A 4DCLA 3D98A 4KPXA 1KK4A 1XATA 3OUPA 3JQYA 5E3QA 4MFGA 3OW5A 1LXAA 4M99A 1KRVA 1T3DA 1KRUA 4KPZA 4EQYA 2ICXA 3MQGA 1QRFA 4E75A 5DG3A 1XHDA 3F1XA 3P1BA 4HCQA 4HURA 4M2BA 4E6UA 3R0SA 3HJJA 4E6TA 3R5BA 2V0JA 3KWCA 3EG4A 3SPTA 1YP4A 2AQ9A 3TK8A 2QKXA 3VBLA 2V0IA 1FXJA 4G3QA 2NPOA 4E1KA 2OEGA
chains in the Genus database with same CATH superfamily
2ICYA 2V0LA 4EAAA 3R1WA 4ISXA 5E3PA 5U2KA 1S80A 1THJA 3EEVA 1QREA 3OH2A 4G87A 2IC7A 3VBNA 3FWWA 3R2WA 4M9CA 3P47A 3HSQA 4AAWA 1FWYA 1KQAA 3DK5A 1SSTA 1QRGA 3R3IA 4M2AA 2V0KA 1SSQA 2TDTA 2OI7A 3EH0A 4R7PA 1OCXA 2JF2A 2P2OA 2WLGA 3BSYA 3GOSA 3OGZA 3OTZA 4K6RA 3TISA 3TV0A 1MR7A 3V4EA 4N69A 4N6AA 4EABA 1Z2FA 3R3RA 3VBKA 1QRLA 3GQ8A 3PMOA 4M28A 1V67A 3C8VA 3R8YA 4H7OA 1EWWA 1KK5A 2XATA 2FKOA 1MRLA 3FTTA 3R5CA 2QIVX 1YP3A 1KK6A 1HM9A 1HM8A 1MR9A 1HM0A 2VHEA 4G3PA 3OH3A 3SUCA 3BFPA 3T57A 2Q4JA 4M98A 4MYOA 3GQ7A 3OH0A 4KNXA 3OH4A 1V3WA 1QRMA 4HZCA 4IHFA 1HV9A 3D8VA 1G97A 3GQAA 1M8NA 3R5AA 5E3RA 4HZDA 2VD4A 3SRTA 3IGJA 3ECTA 4E79A 1TDTA 2IU8A 4EA8A 3TDTA 2WLFA 4KQLA 2RIJA 3FSCA 3GQ9A 3IXCA 4N6BA 3TIOA 2GGOA 2GGQA 2OI6A 3FOQA 3KWEA 2OEFA 1J2ZA 2I5KA 4KNRA 4EA9A 3TWDA 4EA7A 5ADXV 3DHOA 3GVDA 1Z90A 3FSBA 3I3AA 1YP2A 3OH1A 3VBPA 1KRRA 1KGQA 4J18A 4MZUA 4R36A 1KHRA 2OI5A 2W0VA 3ST8A 4G3SA 5L6VA 3DJ4A 3FSYA 3BXYA 3MQHA 3VBJA 2IUAA 5ADXU 4HUSA 2WLDA 3FS8A 4J09A 4AA7A 2QIAA 5L6SA 3GUEA 4FCEA 4R37A 5AFUV 3BSWA 3I3XA 4N27A 3MC4A 4EGGA 3Q1XA 2W0WA 5DEPA 3BSSA 3KWDA 3OTMA 3CJ8A 5F42A 2WLEA 3VNPA 1QQ0A 3NZ2A 2IU9A 2WLCA 2JF3A 3BRKX 4IHGA 5AFUU 3FSXA 3R5DA 1SSMA 3VBIA 1G95A 1KGTA 5DEMA 3VBMA 3OU9A 2V0HA 4IHHA 4AC3A 4DCLA 3D98A 4KPXA 1KK4A 1XATA 3OUPA 3JQYA 5E3QA 4MFGA 3OW5A 1LXAA 4M99A 1KRVA 1T3DA 1KRUA 4KPZA 4EQYA 2ICXA 3MQGA 1QRFA 4E75A 5DG3A 1XHDA 3F1XA 3P1BA 4HCQA 4HURA 4M2BA 4E6UA 3R0SA 3HJJA 4E6TA 3R5BA 2V0JA 3KWCA 3EG4A 3SPTA 1YP4A 2AQ9A 1N4IA 3TK8A 2QKXA 3VBLA 2V0IA 1FXJA 4G3QA 2NPOA 1L0SA 4E1KA 2OEGA
chains in the Genus database with same CATH topology
2ICYA 2V0LA 4EAAA 3R1WA 4ISXA 5E3PA 5U2KA 1S80A 1THJA 3EEVA 1QREA 4G87A 3VBNA 2IC7A 3FWWA 3R2WA 4M9CA 3P47A 3HSQA 4AAWA 1FWYA 1KQAA 3DK5A 1SSTA 1QRGA 3R3IA 4M2AA 2V0KA 1SSQA 2TDTA 2OI7A 3EH0A 4R7PA 1OCXA 2JF2A 2P2OA 2WLGA 3BSYA 3GOSA 3OTZA 4K6RA 3TISA 3TV0A 1MR7A 3V4EA 4N69A 4N6AA 4EABA 3R3RA 3VBKA 1QRLA 3PMOA 4M28A 1V67A 3C8VA 3R8YA 4H7OA 1KK5A 2XATA 2FKOA 1MRLA 3FTTA 3R5CA 2QIVX 1YP3A 2VHEA 1HM9A 1HM8A 1KK6A 1MR9A 1HM0A 4G3PA 3T57A 3TDTA 3BFPA 2Q4JA 4M98A 4MYOA 4KNXA 1V3WA 1QRMA 4HZCA 4IHFA 1HV9A 3D8VA 1G97A 3R5AA 5E3RA 4HZDA 2VD4A 3SRTA 3IGJA 3ECTA 4E79A 1TDTA 2IU8A 4EA8A 2WLFA 4KQLA 2RIJA 3FSCA 4N6BA 3IXCA 3TIOA 2GGOA 2GGQA 2OI6A 3FOQA 3KWEA 2OEFA 1J2ZA 2I5KA 4KNRA 4EA9A 3TWDA 4EA7A 5ADXV 3DHOA 3GVDA 1Z90A 3FSBA 3I3AA 1YP2A 3VBPA 1KRRA 1KGQA 4J18A 4MZUA 4R36A 1KHRA 2OI5A 2W0VA 3ST8A 4G3SA 5L6VA 3DJ4A 3FSYA 3BXYA 3MQHA 3VBJA 2IUAA 5ADXU 4HUSA 2WLDA 3FS8A 4J09A 4AA7A 2QIAA 5L6SA 3GUEA 4FCEA 4R37A 5AFUV 3BSWA 3I3XA 4N27A 3MC4A 4EGGA 3Q1XA 2W0WA 5DEPA 3BSSA 3KWDA 3OTMA 3CJ8A 5F42A 2WLEA 3VNPA 1QQ0A 3NZ2A 2IU9A 2WLCA 2JF3A 3BRKX 4IHGA 5AFUU 3FSXA 3R5DA 1SSMA 3VBIA 1G95A 1KGTA 5DEMA 3VBMA 3OU9A 2V0HA 4IHHA 4AC3A 4DCLA 3D98A 4KPXA 1KK4A 1XATA 3OUPA 3JQYA 5E3QA 4MFGA 3OW5A 1LXAA 4M99A 1KRVA 1T3DA 1KRUA 4KPZA 4EQYA 2ICXA 3MQGA 1QRFA 4E75A 5DG3A 1XHDA 3F1XA 3P1BA 4HCQA 4HURA 4M2BA 4E6UA 3R0SA 3HJJA 4E6TA 3R5BA 2V0JA 3KWCA 3EG4A 3SPTA 1YP4A 2AQ9A 3TK8A 2QKXA 3VBLA 2V0IA 1FXJA 4G3QA 2NPOA 4E1KA 2OEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ICY A;  2V0L A;  4EAA A;  3R1W A;  4ISX A;  5E3P A;  5U2K A;  1S80 A;  1THJ A;  3EEV A;  1QRE A;  4G87 A;  3VBN A;  2IC7 A;  3FWW A;  3R2W A;  4M9C A;  3P47 A;  3HSQ A;  4AAW A;  1FWY A;  1KQA A;  3DK5 A;  1SST A;  1QRG A;  3R3I A;  4M2A A;  2V0K A;  1SSQ A;  2TDT A;  2OI7 A;  3EH0 A;  4R7P A;  1OCX A;  2JF2 A;  2P2O A;  2WLG A;  3BSY A;  3GOS A;  3OTZ A;  4K6R A;  3TIS A;  3TV0 A;  1MR7 A;  3V4E A;  4N69 A;  4N6A A;  4EAB A;  3R3R A;  3VBK A;  1QRL A;  3PMO A;  4M28 A;  1V67 A;  3C8V A;  3R8Y A;  4H7O A;  1KK5 A;  2XAT A;  2FKO A;  1MRL A;  3FTT A;  3R5C A;  2QIV X;  1YP3 A;  2VHE A;  1HM9 A;  1HM8 A;  1KK6 A;  1MR9 A;  1HM0 A;  4G3P A;  3T57 A;  3TDT A;  3BFP A;  2Q4J A;  4M98 A;  4MYO A;  4KNX A;  1V3W A;  1QRM A;  4HZC A;  4IHF A;  1HV9 A;  3D8V A;  1G97 A;  3R5A A;  5E3R A;  4HZD A;  2VD4 A;  3SRT A;  3IGJ A;  3ECT A;  4E79 A;  1TDT A;  2IU8 A;  4EA8 A;  2WLF A;  4KQL A;  2RIJ A;  3FSC A;  4N6B A;  3IXC A;  3TIO A;  2GGO A;  2GGQ A;  2OI6 A;  3FOQ A;  3KWE A;  2OEF A;  1J2Z A;  2I5K A;  4KNR A;  4EA9 A;  3TWD A;  4EA7 A;  5ADX V;  3DHO A;  3GVD A;  1Z90 A;  3FSB A;  3I3A A;  1YP2 A;  3VBP A;  1KRR A;  1KGQ A;  4J18 A;  4MZU A;  4R36 A;  1KHR A;  2OI5 A;  2W0V A;  3ST8 A;  4G3S A;  5L6V A;  3DJ4 A;  3FSY A;  3BXY A;  3MQH A;  3VBJ A;  2IUA A;  5ADX U;  4HUS A;  2WLD A;  3FS8 A;  4J09 A;  4AA7 A;  2QIA A;  5L6S A;  3GUE A;  4FCE A;  4R37 A;  5AFU V;  3BSW A;  3I3X A;  4N27 A;  3MC4 A;  4EGG A;  3Q1X A;  2W0W A;  5DEP A;  3BSS A;  3KWD A;  3OTM A;  3CJ8 A;  5F42 A;  2WLE A;  3VNP A;  1QQ0 A;  3NZ2 A;  2IU9 A;  2WLC A;  2JF3 A;  3BRK X;  4IHG A;  5AFU U;  3FSX A;  3R5D A;  1SSM A;  3VBI A;  1G95 A;  1KGT A;  5DEM A;  3VBM A;  3OU9 A;  2V0H A;  4IHH A;  4AC3 A;  4DCL A;  3D98 A;  4KPX A;  1KK4 A;  1XAT A;  3OUP A;  3JQY A;  5E3Q A;  4MFG A;  3OW5 A;  1LXA A;  4M99 A;  1KRV A;  1T3D A;  1KRU A;  4KPZ A;  4EQY A;  2ICX A;  3MQG A;  1QRF A;  4E75 A;  5DG3 A;  1XHD A;  3F1X A;  3P1B A;  4HCQ A;  4HUR A;  4M2B A;  4E6U A;  3R0S A;  3HJJ A;  4E6T A;  3R5B A;  2V0J A;  3KWC A;  3EG4 A;  3SPT A;  1YP4 A;  2AQ9 A;  3TK8 A;  2QKX A;  3VBL A;  2V0I A;  1FXJ A;  4G3Q A;  2NPO A;  4E1K A;  2OEG A; 
#chains in the Genus database with same CATH topology
 2ICY A;  2V0L A;  4EAA A;  3R1W A;  4ISX A;  5E3P A;  5U2K A;  1S80 A;  1THJ A;  3EEV A;  1QRE A;  3OH2 A;  4G87 A;  2IC7 A;  3VBN A;  3FWW A;  3R2W A;  4M9C A;  3P47 A;  3HSQ A;  4AAW A;  1FWY A;  1KQA A;  3DK5 A;  1SST A;  1QRG A;  3R3I A;  4M2A A;  2V0K A;  1SSQ A;  2TDT A;  2OI7 A;  3EH0 A;  4R7P A;  1OCX A;  2JF2 A;  2P2O A;  2WLG A;  3BSY A;  3GOS A;  3OGZ A;  3OTZ A;  4K6R A;  3TIS A;  3TV0 A;  1MR7 A;  3V4E A;  4N69 A;  4N6A A;  4EAB A;  1Z2F A;  3R3R A;  3VBK A;  1QRL A;  3GQ8 A;  3PMO A;  4M28 A;  1V67 A;  3C8V A;  3R8Y A;  4H7O A;  1EWW A;  1KK5 A;  2XAT A;  2FKO A;  1MRL A;  3FTT A;  3R5C A;  2QIV X;  1YP3 A;  1KK6 A;  1HM9 A;  1HM8 A;  1MR9 A;  1HM0 A;  2VHE A;  4G3P A;  3OH3 A;  3SUC A;  3BFP A;  3T57 A;  2Q4J A;  4M98 A;  4MYO A;  3GQ7 A;  3OH0 A;  4KNX A;  3OH4 A;  1V3W A;  1QRM A;  4HZC A;  4IHF A;  1HV9 A;  3D8V A;  1G97 A;  3GQA A;  1M8N A;  3R5A A;  5E3R A;  4HZD A;  2VD4 A;  3SRT A;  3IGJ A;  3ECT A;  4E79 A;  1TDT A;  2IU8 A;  4EA8 A;  3TDT A;  2WLF A;  4KQL A;  2RIJ A;  3FSC A;  3GQ9 A;  3IXC A;  4N6B A;  3TIO A;  2GGO A;  2GGQ A;  2OI6 A;  3FOQ A;  3KWE A;  2OEF A;  1J2Z A;  2I5K A;  4KNR A;  4EA9 A;  3TWD A;  4EA7 A;  5ADX V;  3DHO A;  3GVD A;  1Z90 A;  3FSB A;  3I3A A;  1YP2 A;  3OH1 A;  3VBP A;  1KRR A;  1KGQ A;  4J18 A;  4MZU A;  4R36 A;  1KHR A;  2OI5 A;  2W0V A;  3ST8 A;  4G3S A;  5L6V A;  3DJ4 A;  3FSY A;  3BXY A;  3MQH A;  3VBJ A;  2IUA A;  5ADX U;  4HUS A;  2WLD A;  3FS8 A;  4J09 A;  4AA7 A;  2QIA A;  5L6S A;  3GUE A;  4FCE A;  4R37 A;  5AFU V;  3BSW A;  3I3X A;  4N27 A;  3MC4 A;  4EGG A;  3Q1X A;  2W0W A;  5DEP A;  3BSS A;  3KWD A;  3OTM A;  3CJ8 A;  5F42 A;  2WLE A;  3VNP A;  1QQ0 A;  3NZ2 A;  2IU9 A;  2WLC A;  2JF3 A;  3BRK X;  4IHG A;  5AFU U;  3FSX A;  3R5D A;  1SSM A;  3VBI A;  1G95 A;  1KGT A;  5DEM A;  3VBM A;  3OU9 A;  2V0H A;  4IHH A;  4AC3 A;  4DCL A;  3D98 A;  4KPX A;  1KK4 A;  1XAT A;  3OUP A;  3JQY A;  5E3Q A;  4MFG A;  3OW5 A;  1LXA A;  4M99 A;  1KRV A;  1T3D A;  1KRU A;  4KPZ A;  4EQY A;  2ICX A;  3MQG A;  1QRF A;  4E75 A;  5DG3 A;  1XHD A;  3F1X A;  3P1B A;  4HCQ A;  4HUR A;  4M2B A;  4E6U A;  3R0S A;  3HJJ A;  4E6T A;  3R5B A;  2V0J A;  3KWC A;  3EG4 A;  3SPT A;  1YP4 A;  2AQ9 A;  1N4I A;  3TK8 A;  2QKX A;  3VBL A;  2V0I A;  1FXJ A;  4G3Q A;  2NPO A;  1L0S A;  4E1K A;  2OEG A; 
#chains in the Genus database with same CATH homology
 2ICY A;  2V0L A;  4EAA A;  3R1W A;  4ISX A;  5E3P A;  5U2K A;  1S80 A;  1THJ A;  3EEV A;  1QRE A;  4G87 A;  3VBN A;  2IC7 A;  3FWW A;  3R2W A;  4M9C A;  3P47 A;  3HSQ A;  4AAW A;  1FWY A;  1KQA A;  3DK5 A;  1SST A;  1QRG A;  3R3I A;  4M2A A;  2V0K A;  1SSQ A;  2TDT A;  2OI7 A;  3EH0 A;  4R7P A;  1OCX A;  2JF2 A;  2P2O A;  2WLG A;  3BSY A;  3GOS A;  3OTZ A;  4K6R A;  3TIS A;  3TV0 A;  1MR7 A;  3V4E A;  4N69 A;  4N6A A;  4EAB A;  3R3R A;  3VBK A;  1QRL A;  3PMO A;  4M28 A;  1V67 A;  3C8V A;  3R8Y A;  4H7O A;  1KK5 A;  2XAT A;  2FKO A;  1MRL A;  3FTT A;  3R5C A;  2QIV X;  1YP3 A;  2VHE A;  1HM9 A;  1HM8 A;  1KK6 A;  1MR9 A;  1HM0 A;  4G3P A;  3T57 A;  3TDT A;  3BFP A;  2Q4J A;  4M98 A;  4MYO A;  4KNX A;  1V3W A;  1QRM A;  4HZC A;  4IHF A;  1HV9 A;  3D8V A;  1G97 A;  3R5A A;  5E3R A;  4HZD A;  2VD4 A;  3SRT A;  3IGJ A;  3ECT A;  4E79 A;  1TDT A;  2IU8 A;  4EA8 A;  2WLF A;  4KQL A;  2RIJ A;  3FSC A;  4N6B A;  3IXC A;  3TIO A;  2GGO A;  2GGQ A;  2OI6 A;  3FOQ A;  3KWE A;  2OEF A;  1J2Z A;  2I5K A;  4KNR A;  4EA9 A;  3TWD A;  4EA7 A;  5ADX V;  3DHO A;  3GVD A;  1Z90 A;  3FSB A;  3I3A A;  1YP2 A;  3VBP A;  1KRR A;  1KGQ A;  4J18 A;  4MZU A;  4R36 A;  1KHR A;  2OI5 A;  2W0V A;  3ST8 A;  4G3S A;  5L6V A;  3DJ4 A;  3FSY A;  3BXY A;  3MQH A;  3VBJ A;  2IUA A;  5ADX U;  4HUS A;  2WLD A;  3FS8 A;  4J09 A;  4AA7 A;  2QIA A;  5L6S A;  3GUE A;  4FCE A;  4R37 A;  5AFU V;  3BSW A;  3I3X A;  4N27 A;  3MC4 A;  4EGG A;  3Q1X A;  2W0W A;  5DEP A;  3BSS A;  3KWD A;  3OTM A;  3CJ8 A;  5F42 A;  2WLE A;  3VNP A;  1QQ0 A;  3NZ2 A;  2IU9 A;  2WLC A;  2JF3 A;  3BRK X;  4IHG A;  5AFU U;  3FSX A;  3R5D A;  1SSM A;  3VBI A;  1G95 A;  1KGT A;  5DEM A;  3VBM A;  3OU9 A;  2V0H A;  4IHH A;  4AC3 A;  4DCL A;  3D98 A;  4KPX A;  1KK4 A;  1XAT A;  3OUP A;  3JQY A;  5E3Q A;  4MFG A;  3OW5 A;  1LXA A;  4M99 A;  1KRV A;  1T3D A;  1KRU A;  4KPZ A;  4EQY A;  2ICX A;  3MQG A;  1QRF A;  4E75 A;  5DG3 A;  1XHD A;  3F1X A;  3P1B A;  4HCQ A;  4HUR A;  4M2B A;  4E6U A;  3R0S A;  3HJJ A;  4E6T A;  3R5B A;  2V0J A;  3KWC A;  3EG4 A;  3SPT A;  1YP4 A;  2AQ9 A;  3TK8 A;  2QKX A;  3VBL A;  2V0I A;  1FXJ A;  4G3Q A;  2NPO A;  4E1K A;  2OEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...