1KK6A

Crystal structure of vat(d) (form i)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
207
structure length
207
Chain Sequence
MGPNPMKMYPIEGNKSVQFIKPILEKLENVEVGEYSYYDSKNGETFDKQILYHYPILNDKLKIGKFCSIGPGVTIIMNGANHRMDGSTYPFNLFGNGWEKHMPKLDQLPIKGDTIIGNDVWIGKDVVIMPGVKIGDGAIVAANSVVVKDIAPYMLAGGNPANEIKQRFDQDTINQLLDIKWWNWPIDIINENIDKILDNSIIREVIW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTOGRAMIN A ACETYLTRANSFERASE
publication title Crystal structure of Vat(D): an acetyltransferase that inactivates streptogramin group A antibiotics.
pubmed doi rcsb
source organism Enterococcus faecium
molecule tags Transferase
total genus 55
structure length 207
sequence length 207
chains with identical sequence B, C
ec nomenclature ec 2.3.1.-:
pdb deposition date 2001-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 1kk6A00
4M2BA 4MZUA 4EA9A 1OCXA 1SSMA 3MQGA 1YP4A 3TDTA 5E3PA 2ICYA 1Z90A 2OEGA 3EG4A 3FSYA 3VBKA 1KRVA 3D98A 4G3PA 1KRUA 2JF2A 3GOSA 4N6BA 1YP2A 3R8YA 4E79A 4DCLA 4G3QA 3R5BA 5L6SA 3TK8A 1G97A 4KPZA 3BXYA 4FCEA 4AAWA 4AA7A 3VBPA 2V0HA 4KQLA 4HUSA 3HSQA 3I3AA 5E3RA 2IU9A 1KQAA 4MYOA 3FS8A 3ECTA 4EQYA 4EAAA 2IUAA 1S80A 2W0VA 2XATA 3CJ8A 3V4EA 1T3DA 3SRTA 3VBMA 1THJA 3FSXA 2TDTA 2P2OA 3MQHA 3KWEA 3VBIA 3TIOA 4R36A 3D8VA 4J18A 4M98A 4EGGA 3R3RA 4IHGA 1YP3A 4KNRA 2VHEA 3BFPA 3Q1XA 1QREA 4E6TA 1V67A 3GVDA 3I3XA 4M99A 3R5DA 1G95A 2OI6A 3C8VA 4HZDA 4K6RA 4AC3A 5AFUU 2OI7A 3P1BA 3R5CA 1KK4A 1KK5A 2JF3A 1QRLA 2IC7A 3FOQA 4N27A 3VBJA 1QRGA 2IU8A 4R37A 3PMOA 2ICXA 4IHHA 2QIVX 4HURA 5L6VA 3HJJA 2QIAA 1FWYA 1MR9A 4EA8A 3R3IA 4M28A 4EABA 1HV9A 1HM0A 3VBLA 3GUEA 2WLDA 3KWCA 5AFUV 3R0SA 3R2WA 4ISXA 3OUPA 3TWDA 3BSWA 4R7PA 1XHDA 2RIJA 3BSYA 2WLFA 3OTMA 4N6AA 5ADXU 1KK6A 1QQ0A 2NPOA 4E1KA 2OEFA 3TISA 3DK5A 1SSTA 3TV0A 5DEMA 1QRMA 1LXAA 5E3QA 3SPTA 2V0JA 2AQ9A 5F42A 3VBNA 2W0WA 2FKOA 3FSCA 4H7OA 2V0KA 2WLEA 4M9CA 1KGTA 3EEVA 3R5AA 4J09A 3P47A 1HM9A 2GGOA 2I5KA 3DJ4A 3FTTA 5ADXV 1QRFA 1J2ZA 3JQYA 1KRRA 4G3SA 3OTZA 1SSQA 1MRLA 4M2AA 4E75A 3FSBA 4G87A 3OW5A 3OU9A 4KNXA 1XATA 3R1WA 4EA7A 3FWWA 3EH0A 3KWDA 3VNPA 1TDTA 3F1XA 4HZCA 5DEPA 3DHOA 3MC4A 1V3WA 3BRKX 2GGQA 3IGJA 1HM8A 2VD4A 4MFGA 2WLGA 4IHFA 2V0LA 4KPXA 1FXJA 2WLCA 3BSSA 2Q4JA 4N69A 5DG3A 5U2KA 2QKXA 2OI5A 3ST8A 3IXCA 1KGQA 1MR7A 1KHRA 2V0IA 4E6UA 3NZ2A 4HCQA 3T57A
chains in the Genus database with same CATH superfamily
4M2BA 4MZUA 4EA9A 1OCXA 1SSMA 3MQGA 1YP4A 3TDTA 5E3PA 2ICYA 1Z90A 2OEGA 3EG4A 3FSYA 3VBKA 1KRVA 3D98A 4G3PA 1KRUA 2JF2A 3GOSA 4N6BA 1YP2A 3R8YA 4E79A 4DCLA 4G3QA 3R5BA 5L6SA 3TK8A 1G97A 4KPZA 3BXYA 4FCEA 4AAWA 3GQ9A 4AA7A 1N4IA 3VBPA 2V0HA 3OH1A 4KQLA 4HUSA 3HSQA 3I3AA 5E3RA 2IU9A 1KQAA 4MYOA 3FS8A 3ECTA 4EQYA 4EAAA 2IUAA 1S80A 3GQ8A 2W0VA 2XATA 3CJ8A 3V4EA 1T3DA 3SRTA 3VBMA 1THJA 3FSXA 2TDTA 2P2OA 3MQHA 3KWEA 3VBIA 3TIOA 4R36A 3D8VA 4J18A 4M98A 4EGGA 3R3RA 4IHGA 1YP3A 4KNRA 2VHEA 3BFPA 3Q1XA 1QREA 4E6TA 1V67A 3GVDA 3I3XA 4M99A 3R5DA 1G95A 2OI6A 3C8VA 4HZDA 4K6RA 3SUCA 4AC3A 2OI7A 3P1BA 3R5CA 1KK4A 5AFUU 1KK5A 2JF3A 1QRLA 2IC7A 3FOQA 1M8NA 4N27A 3VBJA 1QRGA 2IU8A 4R37A 3PMOA 2ICXA 4IHHA 2QIVX 4HURA 5L6VA 3HJJA 2QIAA 1FWYA 1MR9A 4EA8A 3R3IA 4M28A 4EABA 1HV9A 1HM0A 3VBLA 3GUEA 2WLDA 3KWCA 5AFUV 3R0SA 1Z2FA 3R2WA 4ISXA 3OUPA 3TWDA 3BSWA 4R7PA 1XHDA 2RIJA 3BSYA 2WLFA 3OTMA 4N6AA 5ADXU 1KK6A 1QQ0A 2NPOA 4E1KA 2OEFA 3TISA 3DK5A 1SSTA 3TV0A 5DEMA 1QRMA 1LXAA 3OH4A 5E3QA 2V0JA 2AQ9A 3SPTA 5F42A 3VBNA 2W0WA 2FKOA 3FSCA 4H7OA 2V0KA 2WLEA 4M9CA 1L0SA 1KGTA 3EEVA 3R5AA 4J09A 3P47A 1HM9A 2GGOA 2I5KA 3DJ4A 3FTTA 3OGZA 5ADXV 1QRFA 1J2ZA 3JQYA 1KRRA 4G3SA 3OTZA 1SSQA 1MRLA 4M2AA 4E75A 3FSBA 4G87A 3OW5A 3OU9A 3OH3A 1XATA 4KNXA 3R1WA 4EA7A 3FWWA 3EH0A 3GQAA 3KWDA 3VNPA 1TDTA 3F1XA 4HZCA 5DEPA 3DHOA 3MC4A 1V3WA 3BRKX 2GGQA 3IGJA 3OH0A 1EWWA 1HM8A 2VD4A 4MFGA 2WLGA 4IHFA 2V0LA 4KPXA 1FXJA 2WLCA 3BSSA 2Q4JA 3GQ7A 4N69A 5DG3A 5U2KA 2QKXA 2OI5A 3ST8A 3IXCA 1KGQA 1MR7A 1KHRA 2V0IA 4E6UA 3OH2A 3NZ2A 4HCQA 3T57A
chains in the Genus database with same CATH topology
4M2BA 4MZUA 4EA9A 1OCXA 1SSMA 3MQGA 1YP4A 3TDTA 5E3PA 2ICYA 1Z90A 2OEGA 3EG4A 3FSYA 3VBKA 1KRVA 3D98A 4G3PA 1KRUA 2JF2A 3GOSA 4N6BA 1YP2A 3R8YA 4E79A 4DCLA 4G3QA 3R5BA 5L6SA 3TK8A 1G97A 4KPZA 3BXYA 4FCEA 4AAWA 4AA7A 3VBPA 2V0HA 4KQLA 4HUSA 3HSQA 3I3AA 5E3RA 2IU9A 1KQAA 4MYOA 3FS8A 3ECTA 4EQYA 4EAAA 2IUAA 1S80A 2W0VA 2XATA 3CJ8A 3V4EA 1T3DA 3SRTA 3VBMA 1THJA 3FSXA 2TDTA 2P2OA 3MQHA 3KWEA 3VBIA 3TIOA 4R36A 3D8VA 4J18A 4M98A 4EGGA 3R3RA 4IHGA 1YP3A 4KNRA 2VHEA 3BFPA 3Q1XA 1QREA 4E6TA 1V67A 3GVDA 3I3XA 4M99A 3R5DA 1G95A 2OI6A 3C8VA 4HZDA 4K6RA 4AC3A 5AFUU 2OI7A 3P1BA 3R5CA 1KK4A 1KK5A 2JF3A 1QRLA 2IC7A 3FOQA 4N27A 3VBJA 1QRGA 2IU8A 4R37A 3PMOA 2ICXA 4IHHA 2QIVX 4HURA 5L6VA 3HJJA 2QIAA 1FWYA 1MR9A 4EA8A 3R3IA 4M28A 4EABA 1HV9A 1HM0A 3VBLA 3GUEA 2WLDA 3KWCA 5AFUV 3R0SA 3R2WA 4ISXA 3OUPA 3TWDA 3BSWA 4R7PA 1XHDA 2RIJA 3BSYA 2WLFA 3OTMA 4N6AA 5ADXU 1KK6A 1QQ0A 2NPOA 4E1KA 2OEFA 3TISA 3DK5A 1SSTA 3TV0A 5DEMA 1QRMA 1LXAA 5E3QA 3SPTA 2V0JA 2AQ9A 5F42A 3VBNA 2W0WA 2FKOA 3FSCA 4H7OA 2V0KA 2WLEA 4M9CA 1KGTA 3EEVA 3R5AA 4J09A 3P47A 1HM9A 2GGOA 2I5KA 3DJ4A 3FTTA 5ADXV 1QRFA 1J2ZA 3JQYA 1KRRA 4G3SA 3OTZA 1SSQA 1MRLA 4M2AA 4E75A 3FSBA 4G87A 3OW5A 3OU9A 4KNXA 1XATA 3R1WA 4EA7A 3FWWA 3EH0A 3KWDA 3VNPA 1TDTA 3F1XA 4HZCA 5DEPA 3DHOA 3MC4A 1V3WA 3BRKX 2GGQA 3IGJA 1HM8A 2VD4A 4MFGA 2WLGA 4IHFA 2V0LA 4KPXA 1FXJA 2WLCA 3BSSA 2Q4JA 4N69A 5DG3A 5U2KA 2QKXA 2OI5A 3ST8A 3IXCA 1KGQA 1MR7A 1KHRA 2V0IA 4E6UA 3NZ2A 4HCQA 3T57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M2B A;  4MZU A;  4EA9 A;  1OCX A;  1SSM A;  3MQG A;  1YP4 A;  3TDT A;  5E3P A;  2ICY A;  1Z90 A;  2OEG A;  3EG4 A;  3FSY A;  3VBK A;  1KRV A;  3D98 A;  4G3P A;  1KRU A;  2JF2 A;  3GOS A;  4N6B A;  1YP2 A;  3R8Y A;  4E79 A;  4DCL A;  4G3Q A;  3R5B A;  5L6S A;  3TK8 A;  1G97 A;  4KPZ A;  3BXY A;  4FCE A;  4AAW A;  4AA7 A;  3VBP A;  2V0H A;  4KQL A;  4HUS A;  3HSQ A;  3I3A A;  5E3R A;  2IU9 A;  1KQA A;  4MYO A;  3FS8 A;  3ECT A;  4EQY A;  4EAA A;  2IUA A;  1S80 A;  2W0V A;  2XAT A;  3CJ8 A;  3V4E A;  1T3D A;  3SRT A;  3VBM A;  1THJ A;  3FSX A;  2TDT A;  2P2O A;  3MQH A;  3KWE A;  3VBI A;  3TIO A;  4R36 A;  3D8V A;  4J18 A;  4M98 A;  4EGG A;  3R3R A;  4IHG A;  1YP3 A;  4KNR A;  2VHE A;  3BFP A;  3Q1X A;  1QRE A;  4E6T A;  1V67 A;  3GVD A;  3I3X A;  4M99 A;  3R5D A;  1G95 A;  2OI6 A;  3C8V A;  4HZD A;  4K6R A;  4AC3 A;  5AFU U;  2OI7 A;  3P1B A;  3R5C A;  1KK4 A;  1KK5 A;  2JF3 A;  1QRL A;  2IC7 A;  3FOQ A;  4N27 A;  3VBJ A;  1QRG A;  2IU8 A;  4R37 A;  3PMO A;  2ICX A;  4IHH A;  2QIV X;  4HUR A;  5L6V A;  3HJJ A;  2QIA A;  1FWY A;  1MR9 A;  4EA8 A;  3R3I A;  4M28 A;  4EAB A;  1HV9 A;  1HM0 A;  3VBL A;  3GUE A;  2WLD A;  3KWC A;  5AFU V;  3R0S A;  3R2W A;  4ISX A;  3OUP A;  3TWD A;  3BSW A;  4R7P A;  1XHD A;  2RIJ A;  3BSY A;  2WLF A;  3OTM A;  4N6A A;  5ADX U;  1KK6 A;  1QQ0 A;  2NPO A;  4E1K A;  2OEF A;  3TIS A;  3DK5 A;  1SST A;  3TV0 A;  5DEM A;  1QRM A;  1LXA A;  5E3Q A;  3SPT A;  2V0J A;  2AQ9 A;  5F42 A;  3VBN A;  2W0W A;  2FKO A;  3FSC A;  4H7O A;  2V0K A;  2WLE A;  4M9C A;  1KGT A;  3EEV A;  3R5A A;  4J09 A;  3P47 A;  1HM9 A;  2GGO A;  2I5K A;  3DJ4 A;  3FTT A;  5ADX V;  1QRF A;  1J2Z A;  3JQY A;  1KRR A;  4G3S A;  3OTZ A;  1SSQ A;  1MRL A;  4M2A A;  4E75 A;  3FSB A;  4G87 A;  3OW5 A;  3OU9 A;  4KNX A;  1XAT A;  3R1W A;  4EA7 A;  3FWW A;  3EH0 A;  3KWD A;  3VNP A;  1TDT A;  3F1X A;  4HZC A;  5DEP A;  3DHO A;  3MC4 A;  1V3W A;  3BRK X;  2GGQ A;  3IGJ A;  1HM8 A;  2VD4 A;  4MFG A;  2WLG A;  4IHF A;  2V0L A;  4KPX A;  1FXJ A;  2WLC A;  3BSS A;  2Q4J A;  4N69 A;  5DG3 A;  5U2K A;  2QKX A;  2OI5 A;  3ST8 A;  3IXC A;  1KGQ A;  1MR7 A;  1KHR A;  2V0I A;  4E6U A;  3NZ2 A;  4HCQ A;  3T57 A; 
#chains in the Genus database with same CATH topology
 4M2B A;  4MZU A;  4EA9 A;  1OCX A;  1SSM A;  3MQG A;  1YP4 A;  3TDT A;  5E3P A;  2ICY A;  1Z90 A;  2OEG A;  3EG4 A;  3FSY A;  3VBK A;  1KRV A;  3D98 A;  4G3P A;  1KRU A;  2JF2 A;  3GOS A;  4N6B A;  1YP2 A;  3R8Y A;  4E79 A;  4DCL A;  4G3Q A;  3R5B A;  5L6S A;  3TK8 A;  1G97 A;  4KPZ A;  3BXY A;  4FCE A;  4AAW A;  3GQ9 A;  4AA7 A;  1N4I A;  3VBP A;  2V0H A;  3OH1 A;  4KQL A;  4HUS A;  3HSQ A;  3I3A A;  5E3R A;  2IU9 A;  1KQA A;  4MYO A;  3FS8 A;  3ECT A;  4EQY A;  4EAA A;  2IUA A;  1S80 A;  3GQ8 A;  2W0V A;  2XAT A;  3CJ8 A;  3V4E A;  1T3D A;  3SRT A;  3VBM A;  1THJ A;  3FSX A;  2TDT A;  2P2O A;  3MQH A;  3KWE A;  3VBI A;  3TIO A;  4R36 A;  3D8V A;  4J18 A;  4M98 A;  4EGG A;  3R3R A;  4IHG A;  1YP3 A;  4KNR A;  2VHE A;  3BFP A;  3Q1X A;  1QRE A;  4E6T A;  1V67 A;  3GVD A;  3I3X A;  4M99 A;  3R5D A;  1G95 A;  2OI6 A;  3C8V A;  4HZD A;  4K6R A;  3SUC A;  4AC3 A;  2OI7 A;  3P1B A;  3R5C A;  1KK4 A;  5AFU U;  1KK5 A;  2JF3 A;  1QRL A;  2IC7 A;  3FOQ A;  1M8N A;  4N27 A;  3VBJ A;  1QRG A;  2IU8 A;  4R37 A;  3PMO A;  2ICX A;  4IHH A;  2QIV X;  4HUR A;  5L6V A;  3HJJ A;  2QIA A;  1FWY A;  1MR9 A;  4EA8 A;  3R3I A;  4M28 A;  4EAB A;  1HV9 A;  1HM0 A;  3VBL A;  3GUE A;  2WLD A;  3KWC A;  5AFU V;  3R0S A;  1Z2F A;  3R2W A;  4ISX A;  3OUP A;  3TWD A;  3BSW A;  4R7P A;  1XHD A;  2RIJ A;  3BSY A;  2WLF A;  3OTM A;  4N6A A;  5ADX U;  1KK6 A;  1QQ0 A;  2NPO A;  4E1K A;  2OEF A;  3TIS A;  3DK5 A;  1SST A;  3TV0 A;  5DEM A;  1QRM A;  1LXA A;  3OH4 A;  5E3Q A;  2V0J A;  2AQ9 A;  3SPT A;  5F42 A;  3VBN A;  2W0W A;  2FKO A;  3FSC A;  4H7O A;  2V0K A;  2WLE A;  4M9C A;  1L0S A;  1KGT A;  3EEV A;  3R5A A;  4J09 A;  3P47 A;  1HM9 A;  2GGO A;  2I5K A;  3DJ4 A;  3FTT A;  3OGZ A;  5ADX V;  1QRF A;  1J2Z A;  3JQY A;  1KRR A;  4G3S A;  3OTZ A;  1SSQ A;  1MRL A;  4M2A A;  4E75 A;  3FSB A;  4G87 A;  3OW5 A;  3OU9 A;  3OH3 A;  1XAT A;  4KNX A;  3R1W A;  4EA7 A;  3FWW A;  3EH0 A;  3GQA A;  3KWD A;  3VNP A;  1TDT A;  3F1X A;  4HZC A;  5DEP A;  3DHO A;  3MC4 A;  1V3W A;  3BRK X;  2GGQ A;  3IGJ A;  3OH0 A;  1EWW A;  1HM8 A;  2VD4 A;  4MFG A;  2WLG A;  4IHF A;  2V0L A;  4KPX A;  1FXJ A;  2WLC A;  3BSS A;  2Q4J A;  3GQ7 A;  4N69 A;  5DG3 A;  5U2K A;  2QKX A;  2OI5 A;  3ST8 A;  3IXC A;  1KGQ A;  1MR7 A;  1KHR A;  2V0I A;  4E6U A;  3OH2 A;  3NZ2 A;  4HCQ A;  3T57 A; 
#chains in the Genus database with same CATH homology
 4M2B A;  4MZU A;  4EA9 A;  1OCX A;  1SSM A;  3MQG A;  1YP4 A;  3TDT A;  5E3P A;  2ICY A;  1Z90 A;  2OEG A;  3EG4 A;  3FSY A;  3VBK A;  1KRV A;  3D98 A;  4G3P A;  1KRU A;  2JF2 A;  3GOS A;  4N6B A;  1YP2 A;  3R8Y A;  4E79 A;  4DCL A;  4G3Q A;  3R5B A;  5L6S A;  3TK8 A;  1G97 A;  4KPZ A;  3BXY A;  4FCE A;  4AAW A;  4AA7 A;  3VBP A;  2V0H A;  4KQL A;  4HUS A;  3HSQ A;  3I3A A;  5E3R A;  2IU9 A;  1KQA A;  4MYO A;  3FS8 A;  3ECT A;  4EQY A;  4EAA A;  2IUA A;  1S80 A;  2W0V A;  2XAT A;  3CJ8 A;  3V4E A;  1T3D A;  3SRT A;  3VBM A;  1THJ A;  3FSX A;  2TDT A;  2P2O A;  3MQH A;  3KWE A;  3VBI A;  3TIO A;  4R36 A;  3D8V A;  4J18 A;  4M98 A;  4EGG A;  3R3R A;  4IHG A;  1YP3 A;  4KNR A;  2VHE A;  3BFP A;  3Q1X A;  1QRE A;  4E6T A;  1V67 A;  3GVD A;  3I3X A;  4M99 A;  3R5D A;  1G95 A;  2OI6 A;  3C8V A;  4HZD A;  4K6R A;  4AC3 A;  5AFU U;  2OI7 A;  3P1B A;  3R5C A;  1KK4 A;  1KK5 A;  2JF3 A;  1QRL A;  2IC7 A;  3FOQ A;  4N27 A;  3VBJ A;  1QRG A;  2IU8 A;  4R37 A;  3PMO A;  2ICX A;  4IHH A;  2QIV X;  4HUR A;  5L6V A;  3HJJ A;  2QIA A;  1FWY A;  1MR9 A;  4EA8 A;  3R3I A;  4M28 A;  4EAB A;  1HV9 A;  1HM0 A;  3VBL A;  3GUE A;  2WLD A;  3KWC A;  5AFU V;  3R0S A;  3R2W A;  4ISX A;  3OUP A;  3TWD A;  3BSW A;  4R7P A;  1XHD A;  2RIJ A;  3BSY A;  2WLF A;  3OTM A;  4N6A A;  5ADX U;  1KK6 A;  1QQ0 A;  2NPO A;  4E1K A;  2OEF A;  3TIS A;  3DK5 A;  1SST A;  3TV0 A;  5DEM A;  1QRM A;  1LXA A;  5E3Q A;  3SPT A;  2V0J A;  2AQ9 A;  5F42 A;  3VBN A;  2W0W A;  2FKO A;  3FSC A;  4H7O A;  2V0K A;  2WLE A;  4M9C A;  1KGT A;  3EEV A;  3R5A A;  4J09 A;  3P47 A;  1HM9 A;  2GGO A;  2I5K A;  3DJ4 A;  3FTT A;  5ADX V;  1QRF A;  1J2Z A;  3JQY A;  1KRR A;  4G3S A;  3OTZ A;  1SSQ A;  1MRL A;  4M2A A;  4E75 A;  3FSB A;  4G87 A;  3OW5 A;  3OU9 A;  4KNX A;  1XAT A;  3R1W A;  4EA7 A;  3FWW A;  3EH0 A;  3KWD A;  3VNP A;  1TDT A;  3F1X A;  4HZC A;  5DEP A;  3DHO A;  3MC4 A;  1V3W A;  3BRK X;  2GGQ A;  3IGJ A;  1HM8 A;  2VD4 A;  4MFG A;  2WLG A;  4IHF A;  2V0L A;  4KPX A;  1FXJ A;  2WLC A;  3BSS A;  2Q4J A;  4N69 A;  5DG3 A;  5U2K A;  2QKX A;  2OI5 A;  3ST8 A;  3IXC A;  1KGQ A;  1MR7 A;  1KHR A;  2V0I A;  4E6U A;  3NZ2 A;  4HCQ A;  3T57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...