1KKMA

L.casei hprk/p in complex with b.subtilis p-ser-hpr
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
176
structure length
176
Chain Sequence
ERRSMHGVLVDIYGLGVLITGDSGVGKSETALELVQRGHRLIADDRVDVYQQDEQTIVGAAPPILSHLLEIRGLGIIDVMNLFGAGAVREDTTISLIVHLENWTPDKTFDRLGSGEQTQLIFDVPVPKITVPVKVGRNLAIIIEVAAMNFRAKSMGYDATKTFEKNLNHLIEHNEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of a bifunctional protein kinase in complex with its protein substrate HPr.
pubmed doi rcsb
source organism Lactobacillus casei
molecule tags Transferase,hydrolase/transport protein
molecule keywords HprK protein
total genus 48
structure length 176
sequence length 176
chains with identical sequence B, C
ec nomenclature ec 2.7.1.-:
pdb deposition date 2001-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07475 Hpr_kinase_C HPr Serine kinase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kkmA00
1W4BA 1S3GA 3OIYA 3ADBA 2ZSAA 4LPSA 5EE1A 1G17A 1NG1A 3K0CA 3DMNA 4NHOA 2JGNA 4A4DA 1U0JA 3MCAA 5CDFA 121PA 2V6JA 4G5RA 1ZM7A 2WAXA 2XB2A 1G5RA 4QBGB 3BFKA 2B92A 2QY9A 2VP5A 3A1UA 3L0SA 3FE2A 3MG9A 1ZD8A 2ZJ5A 4C2UA 3TBKA 5HKKD 2QAGB 2BKUA 1US8B 4NKRA 1NSFA 2R9VA 4EDHA 4JYBA 3I8SA 4TT3A 4P3YA 3TH5A 1NP6A 2IS2A 4DWJA 4TLAA 2ZE6A 3LAWA 4XIGS 1QHIA 1XNJA 4QBFA 2VLIA 1SXJE 2IYXA 3AVXA 3B1VA 1KHTA 1UKYA 2W0MA 3VKGA 4Q7MB 5FPTA 2AN9A 1S3SA 4W5WA 5CIWA 1DADA 1WDTA 4NMMA 3WP1B 2ZEJA 4CZ2A 3OAAA 1DAGA 1FTSA 1IN4A 4PSVA 3ZDQA 1JALA 1KIMA 1JXMA 1M7GA 2H57A 2V7QD 3TSWA 5EE0A 1KY2A 4LYJA 1DG3A 1F2UB 1KNQA 2ZRKA 3PUXA 2O8CA 3GJXC 1NRJB 3FVQA 4JJZA 4RY2A 2V9PA 1J99A 4E5UA 1IBRA 3OHMA 3PFIA 4KFTA 4D82A 2IF2A 2N42A 2JJ2D 2WM9B 2EFDB 4JS0A 3I1FA 1S8FA 4QGAA 5GJCA 5AUNB 4JSTA 1DBSA 5KSZA 4TSFA 2ODNA 4MUBA 3LVQE 2ZS7A 4BLSA 2ORVA 4QM6A 3VNUA 3I61A 4N0DA 2D06A 4GNKA 2QMUA 4NH0A 4ERNA 1IY0A 1MABB 1MV5A 1YR8A 3WRXC 2PZFA 3PUYA 3SI7A 3THOA 2QN6A 2G0NA 2ZUBA 4PC7A 2D7DA 1JR3A 1KI7A 1TU3A 2ZVQX 3CBQA 3I3SR 1RE0A 2KB0A 3EX7C 2VSXA 1E9FA 2CK3D 2QA5A 4E22A 2RGEA 4ESHA 5JBQA 4EJSA 2WPDD 5CK4A 5FPSA 1W0JA 3ECCA 4DDUA 1WXQA 2GXUA 3KXLA 3W3AA 5KO2A 2O8CB 2KBFA 1TQ4A 1K8RA 1F2TB 2EWWA 1YU9A 3WMFA 3GLFA 3GJ8A 4I1OA 1Y63A 2ZI5A 3CR8A 5A4JA 3K9LA 1HT2E 1W48A 3BWDD 2F1HA 5IRCD 2FNAA 1CJTC 1IHUA 1ZCBA 1N6LA 2GJ8A 2ZI3A 3EPJA 2V6IA 4Z8YA 4B33A 1TQ2A 2JLUA 4Q01A 5AJWA 4B71A 4URZR 4Q9KA 1YVDA 4HLDA 3VQTA 1UBGA 2GJKA 1V43A 1CF4A 2VHQA 4Q1DA 1MABA 1ZNXA 3AVYA 3K0AA 1IXZA 1IJFA 1G19A 2W6ID 3CRVA 4Z1MD 3ZZTA 4BLOA 3VX3A 2MMCA 4LGMA 4ILEA 1Z2AA 1N25A 1P5ZB 2O8DA 5SZHB 4OK6A 4B3BA 1JEEA 1TUEA 2WWFA 1A82A 2ZSDA 2BV3A 3K8YA 4X8LA 1E9EA 2RGNC 5JSZA 3U6BA 1AKEA 3W9YA 4JJKA 3SR0A 5JCPA 3PIRA 5A5GA 4HUQA 4M1OA 4NYJR 3FOZA 2A30A 2IS6A 1NN0A 1WMSA 2BMFA 1BH2A 1C4OA 3Q5EA 1OXSC 2DFKB 5BN3A 5FH9A 1CJKC 5F98A 1JJVA 3E70C 4Q03A 4BQSA 2IA5A 2C95A 4JLVA 5FBWB 3SYLA 1ZC4A 3NVAA 4NL4H 1COWD 4HI0E 3T1QA 1HQCA 1AM4D 2QRNA 4N0EA 1R0ZA 4CYMA 3ZJYA 4TYYA 3C8UA 3VR2A 5CB8A 2I1QA 4ARZA 4QJ5A 4JLPA 5C4GB 5HE8A 4M22A 1NF3A 4DZZA 5JWRA 3I8XA 1OIWA 1E0AA 4PHTA 4LYHA 4C2TA 2BDTA 2AD5A 2GAOA 2PLRA 4QJ4A 2GK7A 3UIEA 4XOIA 1IXRC 1N5JA 5GADl 5L3QB 3CNOA 1KI2A 1U8YA 2J3EA 5K8LA 4DDTA 1AKYA 1L8QA 1VDZA 4UJ3A 2A2ZA 1EFRA 1FP6A 2QORA 1M1YE 2QU8A 5KNBA 1ESMA 4HAUA 1Z0KA 2IX3A 1GL9B 2VRWA 2ZYUX 3PG5A 1E6CA 2F43B 3I62A 3C15C 5FPKA 3LX8A 4G5GA 4QBHA 3VKHA 3KDSE 4UXIA 1QHHB 1OFTA 3U4QB 2F6RA 1JNYA 4YONB 5DN6D 1ZCAA 2XB4A 2QROA 5CYPA 4ZDIA 2YKGA 1Q1BA 4RFSA 3QOFA 2GCOA 4GI7A 3NIBA 4BRUA 2AWOA 2ZU6A 4X8MA 4K8OA 2QBYB 3GJ0A 4FCVA 2CCGA 2J0SA 4MYCA 1P9RA 1OH8A 3TKLA 2W00A 2ZIAA 4QRHA 3X1XA 1E2DA 2CLSA 2IHBA 3EPKA 4DUGD 4LV8B 3CX6A 1BKDR 1XBTA 1Z6GA 4URVR 1JB1A 3CX7A 3B82A 1H65A 5JRJA 221PA 4B44A 1VCNA 2QMHA 4XSGA 1JPNA 2FSGA 4NTZA 3R20A 3RS7A 2C96A 5JLJA 2IBMA 1XD8A 3LO5A 1E79D 2AX4A 3DL0A 3QG1A 5KHOC 3THYB 2ZI9A 1ONBA 1E0SA 1YR7A 3QEOA 1YZTA 4GOKA 2YWEA 4L5BA 3O47A 4QNMA 5DI3A 5EP3A 4WXPA 3LH5A 4L8GA 2OO7A 2WICA 3GCGA 1KSGA 3DM5A 4ZIRB 1SXJC 2ZSBA 1XTKA 5JS8A 2QAGA 4LJ7A 2A9KA 5C18A 4HDOB 5C1BA 3TAUA 4JVMA 4LYFA 2NZ8A 4GPTA 1L4YA 1YRBA 2VQSA 4QHYA 2XZOA 3W3ZB 3SBEA 3SHFA 2VHJA 1SQ5A 3DMDA 3GLFE 1T91A 1BS1A 4DLSA 2G1KA 2ZPTX 3ZD7A 2W6IA 1E2FA 4FMBB 1TADA 3RAPR 4LCBA 4OBEA 1W36D 1KSJA 2OBNA 3NXSA 4DLWA 2XJ9A 2OM2A 1T3HA 3QBTA 2QENA 2PZGA 2Q6TA 4EUNA 2YYZA 2OFWA 4M21A 3SJAA 2AK3A 2BM0A 3Q85A 4LJ8A 4BLRA 4IW3B 2YOGA 2QTVB 4QHSA 2JA1A 2ZRDA 3K0EA 4IHQA 1T5IA 4P4UA 3DZ8A 4EPVA 5BWMA 1DTSA 521PA 4DSTA 2JJ1D 4G5SA 3UMSA 2ATXA 2DFTA 1SXJB 3ZD6A 2R65A 4C4PA 2F1IA 4G01B 2Y8EA 5LB4A 4RZ3A 2ZYWX 1KI6B 2QTFA 3GLIB 3DDCA 1IQPA 3GLGB 2ZXUA 1G3UA 3X1YA 1YZKA 1CR0A 3ZZ0A 1Z0DA 2FSFA 2VP2A 2XTNA 4EKDA 1XMVA 2QP3A 4IDNA 2Z4RA 4RZUA 4A6PA 3KQKA 4PHFA 2ZRBA 4FXPA 4Q02A 4ON9A 2O0HA 2C78A 1TL7C 3P4XA 2XNDD 2HLDD 5FBLB 4ASUD 3RRZA 3IO3A 1VPLA 4Z54A 3W8RA 4FMCF 5IK2A 4U00A 2JAQA 3IBGA 2AFHE 2OAP1 4B74A 1Z3IX 4ACAA 4D2IA 1YZGA 2P3SA 4RD0A 1R5BA 1DG1G 1XMIA 2PZEA 3AEZA 3B8HA 4Q1CA 4DHEA 5AJVB 1NI3A 1G6HA 4LY6A 1ZRHA 3PENA 2RGCA 1VTKA 2FGJA 4PFSA 1XEFA 3N2EA 2ZRFA 4TT3D 2O8BB 1W47A 1SULA 4LV5B 3MUFA 1Z0IA 3AQ4A 2JLVA 4UXHA 1HYQA 1OYWA 5DN6A 4CT5A 5FOTA 1W2HA 1Z29A 2OAQ1 3CWZA 4ZKDA 3Q7QA 1E98A 3HR8A 3EPHA 3NDBB 1QHNA 1SVWA 2OG2A 2G3YA 1XTJA 2FFBA 5HPYB 1NJGA 2XITA 3LRPA 2REXB 5J4HA 2VL7A 4CEHA 1E9AA 5EZ6B 4FWTA 5FUVA 3QKSB 2NTYC 4IOMA 5EXPA 3T06B 2Q9CA 4HDCA 4LK2A 3V4RA 1KI8A 1P62B 3IBYA 3JZAA 3RABA 4WW0A 1W4CA 1L7VC 2RGAA 3SS8A 4C7OB 3HYTA 1MR3F 1DPFA 1KOFA 1W0KD 1AS3A 2AWNA 3GLIE 4DCUA 3ZVNA 3WHKA 1VCOA 4UNQA 5FOWA 5EUMA 1ZD9A 2RGDA 2AL7A 2BBWA 2PEZA 3RRMA 3OEED 4Q4AB 4G5QA 1AN0A 3E1SA 4OQNA 3T5GA 2FPLA 1NVUQ 4TN1A 4L9WA 4IDOA 1XB2A 1K5DA 4JBWA 3KKMA 2WJGA 3RRYA 4UNSA 2E9SA 2GF0A 1XPRA 3BB3A 4XTRA 2PLFA 4QOSA 3GP8A 4JIMA 3UXMA 3IO5A 5J5CA 2PX0A 4DLRA 2X77A 1PVOA 1XCMA 4TTQA 3K53A 1SZPA 1FQJA 2ZSEA 1VYTA 2E87A 4M9ZA 4RFSB 3NH9A 4P4TA 3SZRA 5CM8B 3AP3A 4KFRA 1W0JD 5J4LA 1GAJA 1X8KA 2OLJA 4H1VA 2IYSA 3SDZA 2XEXA 1OXVA 1UEJA 3VR3A 2C99A 3BH0A 4A8JC 2PEYA 3QXSA 4BFVA 1EWRA 4PO1A 1OH6A 2FF7A 4DBLC 1Z6XA 2FN4A 2UKDA 3IQWA 3JVVA 1NLYA 3BH6A 1BMFA 4HLCA 1S96A 2HEIA 1E9SA 1ZU5A 2Q3FA 3L0OA 4OHZA 3E5HA 5HCNA 4C0QC 1YZUA 4HLUC 1E2PA 3QKTA 1KKLA 1GSIA 1R0YA 1E9RA 3FHOA 3A6PC 1SGWA 3K0SA 2BCGY 2R6CA 3CRW1 3PEYA 3GQBA 2WKRA 3UG6A 1U8ZA 4JL6A 1OT3A 4WVFA 3FGNA 2GRJA 1KSFX 3THXB 3BB4A 2F3RA 3U61B 2ZI6A 3DM9B 2ZREA 3KJGA 4CEJA 2LWIA 1LS1A 2O52A 4H9GA 4NYIQ 2IF0A 3FFBA 2NOAA 4NDZA 5LD2C 4MDFA 3QQ5A 4YXWA 3I5YA 4LC1A 1IJEA 2FWRA 4RCZA 1XCPA 1R2QA 3FB4A 3GLHB 1SVOA 3MMPA 3U3MA 3KQNA 5DI9A 2YINC 1N6OA 3R9WA 1VCMA 3I73A 4NCNA 5IK2D 2NO6A 3L0PA 4Q4HA 1Z08A 1OKKA 1AS2A 2NMVA 1JAIA 4FMDB 5HE9A 1G7RA 1LFDB 3P20A 1VHLA 4OQXA 1IONA 5HCIA 3TE6A 1R7RA 3X1ZA 2DFLA 4FMCB 2JIZD 2IXGA 4PXAA 3W90A 4R2HA 1XU4A 1Z0AA 3REGA 4TQ9A 5JMTA 2QEQA 3LNCA 3LQQA 2ZANA 1P2SA 3GFPA 5G53C 1MO6A 5J4VA 2O8FA 4TMXA 1VG0B 1QG2A 5A0FA 3WNBA 2F7SA 2GA8A 4HAYA 2OXRA 4EJSC 1WBBA 1IY2A 1ZAKA 1Q3TA 2CJWB 2VBCA 4TLDA 4V02A 3GLGA 1VYVA 3PQCA 1BO6A 1VYUA 1GRNA 3VR1A 1E1QD 3CKLA 3H4MA 3AKDA 4BEJA 1Z8FA 1KO1A 4EPXA 3U44A 4MYHA 2YWGA 4ZCIA 3IGFA 1B23P 4I1VA 2OFOA 1Q44A 1S0UA 3ZQJA 2RGGA 2EFGA 2W6JA 5LB2A 4TLEA 3S1AA 3AP2A 3B60A 3FFAA 4CIDA 2NPFA 4LRWA 1PJRA 4Q9IA 3IHWA 4BASA 1NVWQ 2HJGA 3QKRA 4E07A 3U6KA 1OSNA 3ASZA 4TTRA 3ZZUA 1KJWA 2REBA 1CU1A 1WA5A 1U90A 3D31A 5JHHB 3ADDA 1X1RA 3QENA 2PL3A 3PITA 3ZS8A 3RDPA 1T0JB 3CPHA 1S9HA 2CHGA 3RLFA 1YR9A 2G0TA 2FZ4A 4YMUA 3B1YA 1E2KA 3NEJA 2WBLC 5FBRB 3ZIAD 4OI4A 4AK9A 2BOVA 1UEIA 3AGPA 1GTVA 1S4QA 2DPXA 4URXR 4DUGA 3D6TB 2AKAB 2J7KA 4NONA 2NO1A 4DLTA 4B2PA 1KK3A 3SOPA 5J4KA 1JR6A 3LV8A 3NBFA 2EQBA 4CT4B 4KSCA 3TR0A 1KMHA 2K5UA 3TRFA 4W5HA 1II0A 3RSOA 5L3SB 2J41A 2Z43A 4GFDA 1VMAA 3U7EB 2OLKA 4XTCS 2CNWD 4JSYA 4PC2A 3WMEA 2QMOA 1QRAA 3I4LA 4QGHA 4OHYA 2P5TB 2FPMA 3TUZC 3EC2A 1ETUA 5JI3E 1G5TA 3LD9A 2RGXA 3MJRA 4QBIA 2F9MA 5KUTA 4RD1A 3HR7A 1ZM9A 3FKSA 3OIUA 4C7OA 5JECA 3SJZA 5BQ5A 1YJ5A 4NZYA 2DB3A 2FSIA 3ETLA 2V1UA 1GUAA 3NHBA 4NP6A 1U99A 1ZP6A 2P67A 3QPVA 4C0BA 3B1ZA 2IT1A 5JWHA 1G20E 1TF7A 1T0HB 3MAAC 1HEIA 1XX6A 3QXCA 2QT0A 5CITA 4CGZA 3B6EA 4TMVA 1QF9A 1ZINA 2AR7A 3EG5A 3M1IA 1PUJA 3ND8A 4PX9A 3W6NA 4R71A 1COWA 1E9DA 1QDEA 2QT1A 3GJ7A 2JJ8A 2X19A 3TVDA 3M0EA 2BJVA 1L2TA 2VIIA 2WWGA 4D26A 1LB1B 2GEDA 8OHMA 1QHXA 3AF2A 4AY2A 4QFMA 2IUSA 3ASYA 2EWVA 2CBZA 3HU3A 2JDID 5IDVA 5JI2E 1KDPA 4KFUA 5E7MA 3KQUA 1OIVA 1AGPA 1IY1A 1DOAA 1X8LA 5TB5A 3BXZA 2F1RA 2HXYA 4NYMQ 1T8UA 1M6NA 4HAVA 3A8TA 5DI3B 2VHUA 1XP8A 3EZ9A 1CTQA 1X6VA 3O8BA 4ZCMA 1U98A 3U2QA 1J8MF 5FTLA 2QQEA 4TL9A 1ZNYA 2EU8A 2QGZA 4LPKA 1G8GA 1E4VA 2ZJ8A 2XZPA 1N6NA 4F4IA 4OQFA 2HLDA 3LY5A 2BWJA 2X2EA 1C1YA 4M1YA 4UQOA 4V0OA 4DDVA 1EFHA 3MSXA 4IOJA 1UJ2A 1N0VC 4JLDA 3HPQA 3NDPA 4II7A 5E4FA 2P6RA 4MRSA 1ZJ6A 4PQFA 3BOSA 5KSPA 3B13B 3T35A 1IAQA 4ARZB 5BXQC 4KXFB 2V7QA 2WSMA 1AS0A 3T5DA 4HB0A 3HDTA 1PZNA 2J46A 5TVKA 1NBMA 5AJZA 1AZSC 4DSOA 1TF5A 1R0WA 1GKYA 5DYIA 421PA 2BVNA 2FDCA 2RGBA 1A2BA 4W7SA 2WHXA 2YV5A 3FMOB 2QAJA 4D0LB 2WWYA 3UK6A 4ZKEA 4TL7A 5JHGB 2CVHA 3NKVA 4IVRA 4NCHA 4OI0A 3LBNA 721PA 4PAOA 4V0MA 4MRRA 1KO7A 3BH7A 3C14C 4MKIA 5FBQB 1TEVA 3U4QA 1NVVR 4JKIA 1UDWA 2J0UA 3H0KA 4EFNA 3VR4A 3DPUA 4DSNA 3FMIA 2GWHA 1RFLA 2PJRA 1JPJA 2IXFA 1DEKA 5BYJA 3KXIA 3VU9A 2XSZA 1XZPA 3GJ3A 5B64A 3R8CA 3NBZC 1X86B 4K46A 3OEHD 4TYQA 4B73A 3I32A 3TGPA 3KFVA 1JXOA 1XMJA 2IYLD 4QNRA 3EIQA 4NYJQ 5CK5A 4WIAA 5KDOA 4HAZA 2KI5A 4TZ6A 1A2KC 4XH9B 2FFQA 3RC3A 1NMYA 2FE4A 2ZR7A 5BYKA 1E1RD 1KSHA 1CRQA 3CONA 5C46F 1U2RA 2CLCX 4B3FX 3L2OB 1XDBA 4AG6A 2NO0A 3TJZA 4Q1AA 3U3JA 1W1WA 4C0AC 1Z6YA 2BIFA 3SFVA 2RMKA 4GDFA 2CCJA 5FUYA 3B1WA 4KJZA 4LDJA 1E9BA 1Z0JA 3B9PA 2J7PA 1GP2A 2VSOA 3EW9A 1NMZA 1Q12A 2FV8A 4TZ0A 3P4YA 4AG5A 1QVRA 3VHXA 4DLVA 1G8PA 4TMZA 4M1KA 2O8FB 3VR5A 1UF9A 4JLOA 1NVVQ 3BK7A 3KKPA 2ATVA 4G5OA 2ZE7A 1N6KA 2C2HA 2QGNA 5EXTA 3ZQ6A 1Y3AA 4EJSB 3VTKA 4L16A 1XEXA 3P26A 1RRGA 4US2R 3I92A 3IIKA 3C16C 4DIDA 3UANA 2ZRNA 1OF1A 2UVQA 2Q21A 4BFXA 3OZXA 3SU8A 1LF0A 5DSZA 1W36C 3LLMA 4TMWA 3OE7D 2QTHA 5EE9A 3PEUA 1TEXA 1ZIPA 2C9CA 2OCYC 4C3ZA 4FD2A 4POAA 1ZIOA 3L43A 3KZ1E 4B3CA 4PHGA 1PV4A 2ZJYA 5KPJA 4ESVA 3QKRB 4UKDA 2GKSA 3I72A 3H86A 4NPHA 4WOPA 3V4FA 4BPBA 3UKDA 1DO0A 2ZRGA 1ZUHA 4URYR 1VECA 4DKXA 2N1BA 4S35A 4FIDA 3T34A 4KODA 3UATA 4OL0A 3M4YA 2IYUA 2NO7A 2UZ3A 4WA7A 1E3MA 4FCWA 2VH5R 2B21A 3TUJC 1Z22A 1SHZA 3BFVA 4ABYA 1W7AA 1JI0A 2QP9X 1ZU4A 4K81B 3PV0A 4P32A 2GVZC 2G9NA 4FCTA 3TIFA 1AA9A 1XXHE 1VHTA 4YMVA 2IYYA 1G6OA 1HH4A 1VCIA 1W2GA 2CCKA 2H17A 821PA 3CWQA 1NNEA 3P1JA 5KSYA 1OH5A 4WZBE 1NIPA 4N3NA 3LDAA 1NLFA 2C77A 4Q4JA 4OQLA 4AKIA 2IYTA 1RW4A 1GWNA 3EAQA 3NC1C 1Z6TA 5SZKB 1JBKA 3N70A 2KBEA 4Y0AA 1P61B 3AUXA 5CDFE 3N5CA 1KTVA 4MGYR 2WIAA 2QM7A 5JWOA 4M8NE 5JSZB 4IXMA 1O3YA 1NY6A 2BEJA 4P4SA 5FBVB 1LS6A 2EFEB 1G9XA 1GITA 1KI9A 3H1TA 5CLQA 2HCBA 4D0GA 1ZBDA 3RS0A 3CNLA 1P6XA 4NCIA 3AKEA 5H1YA 3WHLA 1OE0A 1DELA 3PR1A 2O8BA 4HAWA 4ZO4A 2R6GA 3EIHA 1LVGA 4PZYA 2FZLA 2YNMA 1P60A 2X8AA 3MJHA 2PBRA 2IK8A 2B7CA 2FU5C 4U5XA 2OHFA 4HZUA 2XSZD 3FYHA 3KJHA 2BM1A 4B47A 2OEPA 2GTPA 4RZ2A 1OFUX 2G83A 2CL0X 4H1UA 4V0NA 1TAGA 2J5XA 4I81A 3BB1A 2ZRCA 3BORA 3PVSA 2IYVA 2NIPA 2FMXA 1SVKA 3TNFA 1WF3A 2VA8A 3LXXA 1P2VA 3EIEA 2XZLA 4DLYA 1F5NA 1NIJA 2XOKA 1E0KA 2OESA 1LTQA 1P9WA 3FKQA 5DGXA 4F93B 3B5JA 1OXTA 1Q3HA 1EESA 1OPXA 2CDNA 3VMFA 3ZVMA 2GBLC 2J45A 2WJVA 1GM5A 2J59A 5HKKA 2GJAA 1E2JA 5LD2B 2GILA 4QL3A 2R62A 1Q0UA 4OJQA 4RCYA 1OHHA 4KLZA 2H18A 2ZU0C 1LW7A 3Q7PA 3T15A 4O0MA 3TMKA 1WB9A 2VEDA 1E96A 3HPRA 2BMEA 2ZI7A 3CF6R 1II8B 2WWHA 2WWIA 4HB3A 3W6OA 1KK2A 1Q1QA 4IDQA 5FUWA 3RWOA 2TMKA 621PA 4Q4AA 4RZXA 4A0FA 1GL6A 2GXSA 2HYIC 4MH0R 4Q1EA 1KO4A 1TTTA 3L0IB 2OCAA 1S1CA 1EXMA 5GVRA 3DO6A 1CP2A 1G3MA 3NTUA 4KFSA 1Q1ZA 2XTMA 1BOFA 4ZCLA 2WWWA 2CXXA 1J7KA 2FEMA 4HZUB 4B3DA 3U5ZB 1XEWX 2R6AA 4CEIA 1LNZA 4NYMR 3WNDA 4KYUA 1MKYA 5DO9A 3CRMA 3CPJB 5CB6A 2V8OA 4PQRA 1E2MA 1U9IC 3K0CC 5K8IA 5EXXA 3TW4A 4TQUS 3K70B 2BHRA 2QZ4A 5FOXA 3HWSA 2ZS9A 4BFTA 2IYQA 2H8KA 3B7GA 5FTNA 1G7SA 3IILA 2LKDA 5F2EA 4MGZR 2FPKA 2ZROA 1M2OB 1VG8A 3THXA 2WAYA 3BFXA 1E2QA 1N5KA 4E03A 2IXEA 1IN7A 2GCNA 2DBYA 3VU9B 4DSUA 3KKOA 5B58C 1UKEA 1E0JA 3C5CA 3O8DA 3WYFA 2ORWA 2QUZA 1M34E 4DCSA 1G8FA 1HA3A 2KE5A 3A1TA 5KDDA 2RHDA 4DIEA 1GNRA 1WBDA 3AVWA 1W49A 2GZAA 4GP7A 3GEIA 3OIWA 1W4RA 4LHXA 3SHWA 2WPDA 2XGJA 4Q4HB 2YHSA 4HAXA 1EFCA 2ONKA 3T61A 3WNCA 3THWA 1ZM3A 4LHYA 5TDHA 2WJYA 1R5OA 5SZIA 3M6AA 5EJEA 5F3WB 4ZDJA 2RCNA 1TMKA 2NZJA 3A4NA 4EQ6B 4KHZA 3LX5A 2BJWA 4JT4A 2BMDA 3Q72A 1TU4A 4ZV4A 3WP0A 4EPTA 4IOLA 3X2SA 5JEDA 4OHVA 4PPQA 2QL6A 4U02A 4DRZA 3HP1A 1MO5A 2JLXA 3A1VA 4PQYA 1YE8A 4PAMA 2JLWA 2GCOB 3SFZA 3CW2A 3KQHA 2H5EA 3KJEA 2D2FA 3LLUA 2ZAOA 4JLKA 3SJCA 1IN5A 1NBMD 2ZE8A 2IYZA 4PC1A 1OV4A 4QJ3A 1J8YF 1AIPA 2EYUA 2ZRMA 1GZSA 2W83A 1P75A 4B35A 3U7HB 2GCPA 1ZUNB 1G41A 1ZM2A 2QQ0A 2HV8A 3K9NA 3EZ6A 3K0FB 1UAAA 4V0KA 1CEEA 2H92A 3MWLA 4V03A 3GFOA 3RS4A 4DLZA 3LFUA 1P9NA 4ASUA 1OXUA 1MO4A 3LW8A 1NBME 2GDJA 4N1AA 1NVXQ 1S2MA 2N46A 3LBHA 5K8UA 2IUTA 4QC2A 1SVLA 3SQXA 1N6IA 1AGRA 2QP4A 4BLQA 4LUCA 3QJYA 4AYXA 1P72A 1FMLA 1R8QA 1Z47A 4M4SA 4BRWA 4LJAA 3DEFA 4LI0A 1XD9A 4CDGA 2WOOA 3OESA 2AFIE 3QVVA 4CEHB 4QKQA 2X2FA 2Q9BA 4OI2A 2IWRA 1OH7A 3BGWA 3QEJA 3QXHA 1N6HA 4LBWA 3D7MA 5DLQC 3VFDA 3GJ4A 5AWFC 4AYTA 2JJ2A 1XPOA 2VPPA 1KDOA 4DCVA 1E1RA 5KNCA 2V4ZA 3X1WA 4DT1B 3GFTA 4PO8A 5H70A 2A78A 1NN3A 1FMJA 5B30A 2HDNB 1HUQA 4LYAA 2WV9A 3VAAA 1EFTA 3MLEA 3VKWA 3K9GA 1G8HA 2FGKA 3VHLB 3B78A 1Q21A 1Q1EA 3NH6A 1CR1A 1N6PA 5AUQA 3VR6A 2W58A 2BEKA 4QGGA 1FPMA 4D25A 2RGNA 4AI6A 1NKSA 5LBIA 1QBKC 4GSYA 1VIAA 1M7BA 3QF4B 2DWQA 3DZDA 3ZVRA 1K5GA 3CH5A 3W5IA 4EPWA 2QSZA 1XJCA 2B8TA 1W0KA 2I1VB 4Q19A 3CB4A 1RRFA 3OIVA 1GKUB 1WP9A 1G16A 2ZAMA 3KXKA 1JAHA 1KMQA 3EXAA 3TUIC 2WZQA 2FOLA 4TMTA 2WJIA 3QI2A 3SE0A 5FFMA 4DCTA 2NO9A 2ZJAA 5DHAA 5KYKA 2VF8A 1N6RA 2DCUA 2J9RA 3A37A 4HB4A 1CULC 2HT6A 1YZLA 2QE7A 3B9QA 3TAHA 3JVUA 4Q66C 2Z6VA 2HUPA 1KK0A 2ERXA 5F9FA 4FINA 4B32A 1M8PA 2I4IA 4GRAA 3GLIA 4AKGA 5BN5A 2EW1A 4OHWA 1U81A 3V00A 3RVBA 2Q3HA 1MOZA 3UG7A 2IHYA 2WTUA 4A15A 1FNMA 4DB2A 2O8DB 2GK6A 1R4AA 2A3RA 2G88A 3KKNA 1G3RA 4JLMA 1J2JA 1D8TA 4JKYA 4DXAA 3AVUA 4D4KA 2YC2C 2ERYA 2J0VA 1QHHA 4LBVA 4D6PA 2MSDB 2DR3A 4PHHA 4NCKA 3RRNA 2IL1A 1T9HA 1F6BA 3LQRA 2AHOA 1W5TA 2RKOA 1PLKA 3C41J 3N2IA 2JATA 1US8A 5AJXA 3RS3A 5J47A 2QAGC 3QE0A 1Z0FA 2D3WA 2RAPA 4KU4A 4RD6A 3MFYA 4J0QA 3W34A 4RKEA 1N5IA 3NWJA 4Q9LA 4TMKA 1GDDA 3LW7A 2ODBA 3BRWD 3PEVA 5FI0B 2IS1A 2B6HA 2ZYVX 4Z1MA 2QI9C 1G7TA 5E95A 3T1TA 3CPEA 1EX6A 2HYDA 2F55A 1UBEA 4LJ5A 2F9LA 2WMNB 4OKSA 3SEAA 1R0XA 4BFUA 4OHXA 5FPYA 1JR3E 2NPIA 2F43A 5JRZA 2AK2A 1DO2A 2GEUA 4TQAA 3HU1A 4B43A 4GMDA 1G4UR 2WSSD 2AXNA 4V0LA 3V9PA 5FOSA 2JEOA 3U7GA 4YXWD 2GJSA 4FMDF 5JFGA 3SN6A 4PC3A 3GLHE 1DAKA 1D5CA 4PZLA 1W5SA 4MYUA 3CO5A 2EYQA 5DHFA 4GZMA 1R10A 3VX4A 5IHPA 2CE2X 4B48A 4B6EA 1OKKD 1UM8A 1AJEA 2OFXA 4YQFA 2E1RA 3DHWC 1ZYUA 3GMTA 1KO8A 3QBVA 3EA0A 4WZ6A 1U0HC 4JLNA 1HE1C 1FNNA 4LHZA 2CVFA 1RJ9B 3D3QA 1CBUA 2QPAA 2JIZA 4TLBA 4OI1A 3O8RA 2JLYA 2W0SA 3EZFA 1E2IA 2DFNA 2W2TA 1R6BX 4KSBA 3SNHA 2WVJA 4G0NA 4YMSA 1GL7A 3WMGA 2PT5A 1KAGA 5KU1A 5E7JA 4PPNA 2H16A 2BBSA 3TR5A 5ELXA 4FW9A 4C9BA 1XF9A 1YR6A 4AC9A 3CUEF 3AF3A 3WY9A 4XSHA 2GETA 1FW6A 2GXAA 2O8EB 1Z5ZA 1CRPA 4O25A 4HATA 3RYTC 4A8JA 1GOTA 1I4LD 1RYFA 3IHLA 1M7HA 4S2EA 2FX3A 3THWB 4C0KA 2EVWX 2IWHA 1DAIA 1SXJA 5BN4A 1IXSB 3K0FA 2FFAA 3HJNA 2QM8A 3KTAA 2C98A 1KNXA 1MH1A 5FTMA 4EQ6A 2W6JD 4GL2A 2G77B 4UNNA 3AUYA 3SJBA 1E2HA 4G1UC 1YHNA 2VP9A 4B3XA 1VKJA 1I2MA 1ZNZA 2IEYA 4A9AA 3ZH9B 2QMEA 4D4LA 3RSLA 1KDRA 2UZIR 1IN8A 1LV7A 1G18A 1T5LA 2PH1A 2RB4A 5J4YA 1HT1E 3TK1A 1KI6A 4JVSB 2C04A 1KK1A 2Q0HA 1UDXA 2ODWA 5G3YA 3DOFA 5HR5A 5AK0A 1T8TA 1XRJA 2CEAA 4XJXA 1XEWY 1RKBA 2CK3A 3CM0A 4BGDA 4XD7D 3TW8B 4ACBA 1T4GA 3W8NA 1DAEA 4GZLA 1XJ0A 2NQ2C 3L8ZA 1JECA 3UPUA 5KPDA 2ZTSA 3B1XA 4MRPA 4CEJB 4MDEA 2YJTD 5EP4A 3EZ7A 4HUQB 5SZJA 4D80A 2YOHA 4W5JA 5EUQB 1WCV1 1FL9A 4QXAA 4UXJA 2V55B 4F4JA 1UBCA 1KZ7B 4KITB 1N3BA 1EWQA 1GNQA 1Z2CA 4CF7A 1QG4A 4B6FA 2ZR9A 1L4UA 2XXAA 2VTKA 1GRRA 3B85A 2VP4A 3KX2A 4A8JB 4O3MA 3LXRA 3QXXA 1QHGA 2FEOA 1C9KA 2A5YB 1IM2A 1P2TA 5FL7A 4A6XA 2REOA 2HT1A 1R5NA 3ICQB 1TNDA 1VIYA 2ZITA 4MA4A 3CZQA 1Z06A 4KI0A 1TPZA 3TSOA 3Q5DA 1DAFA 4FWIB 4MQBA 4F4CA 1MT0A 1XWIA 1G3IA 2D4HA 4LWZA 1NN1A 4PTLA 4Q18A 5P21A 1XPUA 4BZQA 3IKJA 3Q8XB 1HTWA 2ZJOA 4NCJA 3CNNA 1KJYA 3QVUA 2XNDA 1DAHA 3NBXX 1FX0A 2L0XA 3MD0A 3NG1A 4LC0A 4Q9HA 2HJVA 2MSEB 5L3VA 3FMFA 2DY1A 3DOEA 3UWOA 4DC9A 4M9QA 1GVNB 2ZS8A 2QNRA 4TTPA 4MGKR 3K70D 2RHMA 4ZDWA 4DJTA 3DVLA 1MRSA 4G3XA 2G6BA 3GLGE 1CS4C 4A0GA 2GXQA 3L82B 4DLUA 4Q5IA 1G1MA 2V3CC 3IIJA 4O2LA 2BKEA 1HURA 4R98A 1N5LA 3KFXA 5IF9A 5FOUA 2XXAB 4KCGA 4IDHA 1AQYA 1D9XA 3IUYA 5LPNA 2ORIA 4M1MA 2JLRA 3KJIA 2AKYA 3QKSA 4QHTA 4RKFA 2J87A 2IW3A 1GKIA 4NE2A 2AXPA 2GVDC 3GJ5A 1JR3D 1U94A 1NSTA 3A1SA 3LVRE 5B2ZA 4EPYA 1CLUA 1ZMXA 2F3TA 1G3QA 3EARA 1KI1A 4FI3C 1RRPA 4Q1BA 1ZD1A 1ELOA 4JBYA 4IJMA 1P73A 5CIQA 3LA6A 4TYPA 3ZVLA 4KV9A 1E69A 1I4DD 4EFMA 1E2GA 1KZGB 2CHQA 1JQJC 4HLUA 4AURA 4O2RA 5CJ2A 3OEEA 2ZR0A 1FTNA 1ZVQA 3CIOA 1KKMA 3KUDA 4AWXA 3AKYA 1H8EA 2FH5B 2IS4A 1Z83A 3AB3A 4A0RA 1KI4A 2P0EA 1E1QA 4Z8XA 3BERA 1U8AA 3WRYC 4BLPA 4NU0A 3ONWA 3IEUA 1KJZA 3PUWA 5E7IA 3QSYA 4BFYA 1QZXA 1KYIA 3SYNA 4BEBA 4ITRC 2Z83A 4LHWA 3EA5A 1KGDA 4AKHA 1UKVY 3K09C 3ICEA 4B34A 4L9SA 3GEEA 3WYAA 3J81k 4A36A 1TUIA 1PUIA 3QIAA 3FPAA 2HF8A 3QPWA 1ESNA 1SKYE 4LBZA 5EXSA 1XTRA 2ZRHA 5FOVA 5GJBA 1OFIA 2FA9A 4Q9JA 1JEDA 2XAUA 3LWNA 2P6NA 3CRRA 4ZI3A 2BMJA 4GBMA 2QE7D 4HEJA 3FDIA 3GJ6A 4US1R 5HZKA 1H8HD 2JCSA 3MGCA 3PXGA 3CR7A 3LBIA 2VHCA 1B0UA 1XCGB 3AF0A 3Q3JB 2EFHB 3RS5A 5DE3A 4OK5A 4HLQB 3K9HA 4OK3A 2ASEA 5FL7D 2B8WA 2XNSA 4Q48A 4EAQA 3KUCA 4TL8A 1NL3A 3B2EA 1UADA 2XTZA 1DS6A 2CMKA 2ZJZA 3QY0A 1E32A 5AUPB 2XJ4A 3OFND 3AVOA 1M74A 1F60A 2GBLA 1XXHA 4PZZA 3TQCA 2OCPA 1OXXK 2OCBA 2F1JA 2ZRJA 4XWAA 3RS2A 1RC8A 2A5GA 1G21E 1WE2A 1Z63A 2WMOB 5KDLA 4A2QA 4A82A 5GVSA 1CR4A 1MRNA 1FQKA 4UNRA 5AUOB 3THYA 4Z51A 4MKHA 3AP1A 1PLJA 1ODFA 2V54A 4C0JA 1CJUC 2J0UB 1EFRD 4ZIRA 5D3QA 4R7ZA 1NMXA 2GAAA 1XMSA 4M9SA 3R7WA 4URUR 4GT1A 4RFVA 3FHTA 2ONJA 1RZ3A 2CNWA 2QG6A 5JCZA 5CM9C 1KMHB 5K8TA 1EK0A 2NGRA 2GNOA 4M1TA 4KBGA 1AQUA 1XTIA 2WKPA 2WSSA 4WZAE 4CW7A 3GEHA 2W2VA 3FTQA 3K70C 1YZNA 2O0JA 3RWMB 3TQFA 4D0NA 3G5UA 2XOKD 5KNDA 1ZUIA 4LSGA 3SC3A 4A2WA 1VG9B 4PSAA 3ZS9A 2ZRAA 4F92B 1FP7A 4M1WA 5FPHA 2JLSA 4X8OA 1KI3A 2I3BA 3SQWA 4UNPA 4TYNA 4WAUA 3I5XA 3ZYCA 3AVTA 2P2LA 1F2TA 2GZHA 6Q21A 1NY5A 4C0HA 1DE0A 5FI1B 2FSHA 2RH5A 2YVUA 4JVNA 4TL6A 4C0SA 4V0ME 2QSYA 1U0LA 1Q20A 4M2LA 3DKPA 4AYWA 1NKTA 1JJ7A 4QGFA 1G64A 1XD2A 4PPGA 1O87A 4DVGA 4JL5A 4B2LA 2LCFA 2ANCA 4TSFD 1SVIA 3UMRA 3FWYA 2WJJA 3FMPB 5FUXA 3QXJA 4IRUB 4AKEA 5KTYA 3R8FA 1DAMA 3BAFA 1A5TA 3ZGXA 2DWPA 4URWR 5CYOA 1N0UA 3ZIAA 1UPTA 4ZDKA 2CHVA 2ZSFA 3X1DA 2OILA 3JZMA 4US0R 1SVMA 3RANA 3E2IA 2H7VA 1UKZA 3IPYA 4KO8A 5G3ZA 3QKUA 3MRSA 4LZZA 3WYGA 4BWYA 2R6FA 4B2IA 1T6NA 3T1VA 1YQTA 4P0TA 4EPRA 3WBKA 1FX0B 2H1LA 2QPOA 4HB2A 2R6DA 1IOZA 1XEXB 4WXRA 4OQMA 4AD8A 5JJIA 4Q4LA 3QF4A 4KVGA 2CL6X 2GZDA 1II8A 4LJYA 2AD1A 4BUJA 3AKCA 1KDTA 3AH8A 1D2NA 4OJKA 3F0TA 1RRCA 4RSGA 4XVRA 3CF0A 5EE3A 4B76A 2JJ1A 4YMTA 1SKYB 3AM1A 2GF9A 1ZW6A 2PX3A 4MUAA 4Q7JB 1SKQA 2HXSA 5GJVC 1NG9A 3AF1A 1CR2A 4KLNA 2PMKA 1D6JA 2Q9AA 1HQYE 5B57C 2ZJ2A 1FUKA 3ADKA 4RJLA 2Z0MA 3CZPA 4PR0A 1XD2B 3C7KA 5DYGA 2Z5FA 3A36A 3EWSA 3DKVA 1G8YA 4FN5A 5BW8A 2GJ9A 2OUKA 1OHHD 3VNVA 4IEEA 3EZ2A 5DIFA 3BIFA 3FHCB 4R9UC 1EX7A 5L3QA 4EIWA 3AVPA 2DYKA 4MGIR 4QG7A 5EZ5A 1FFHA 2QRZA 5TXGA 5JZVA 4YDHB 3QUSA 3IQXA 2OXCA 2PCJA 1GFIA 2YWHA 4WBSA 1MO3A 1CXZA 2A5FA 1TF2A 2MSCB 5TMPA 5JJLA 1HE8B 1Q22A 5KSOA 1XTSA 4JBXA 4BECA 5C2JB 4A0HA 2QBYA 3P32A 4NYIR 2J7PD 4HSEA 2C5LA 4EFLA 3BC1A 1FZQA 1QHSA 1UFQA 4QM7A 4DB4A 3R9XA 1WQ1R 3A58B 1Z28A 5DNYB 1AK2A 4DLXA 3U3KA 4JLJA 2FFHA 1U9IA 2CL7X 4IFBA 4D4MA 4BFWA 2CJWA 4GOXA 4IKEA 2X1VA 1XTQA 2P6UA 4UJ5A 4PC6A 3TVTA 4F38A 2OSBA 3QF7A 4ZPXA 4M0LA 4HYYA 3CLVA 4DDWA 3U44B 1BMFD 5FTKA 3RNLA 2ZM5A 1GILA 4LX0A 2IEZA 1BYIA 2JDIA 3OE7A 4MYTA 3O8CA 4XWOA 2FJUA 2C03A 2D74A 1YKSA 4LHVA 1RPZA 3KB1A 3W5JA 2VP6A 3CRQA 4C0LA 2ECKA 5F9HA 3QG5A 4I1UA 3T12A 3G0HA 1CIPA 2IYRA 4YDSA 2JASA 2VHTA 4JZKA 4ZI2A 4XVUA 2WJHA 2A5JA 4M1SA 4PO9A 2P5SA 2VP0A 1TQ6A 1P2UA 1YZQA 3C4JA 3F8TA 1VG1A 2O0KA 2PCLA 1KAOA 1P3JA 3ADCA 4A1FA 4BFZA 4L4UA 1I2DA 1E2NA 1S1MA 1WRBA 2R8RA 5FTJA 2JLQA 3H84A 3PUZA 4HZIA 4LOAA 3L8YA 3CH4B 4MITA 1SVSA 1J70A 1TX4B 1D9ZA 1V5WA 5DH9A 1W36B 3R7WB 3MWYW 3RHFA 2OE2A 3IPXA 4RD3A 4Y0VA 2FG5A 5L3SA 1UBFA 4JLBA 1F48A 1T3LA 4JT2A 2V1XA 1S9DA 3GD7A 1K6MA 4IDPA 3GLHA 1XXHB 4I4LA 5LDDC 2BBOA 1W4AA 5E3HA 1OW3B 2ZRIA 2EFCB 1CKEA 1Q57A 2Z4SA 4JMPA 4HDQB 1DVRA 3P27A 2ZYTX 3IDQA 2VF7A 2VSFA 4PAQA 3KL4A 1GIAA 1NJFA 3K1JA 3PUVA 4X8HA 5J40A 3GPLA 1G4AE 1GG2A 1N0WA 4YC7A 3AV0B 1H8ED 4Q7KA 4A2PA 2YZ2A 3T1OA 5H8WA 3WBJA 5TV2A 2KJQA 1OFHA 4IFEA 4MKFA 1BIFA 4Q7LA 1LY1A 3PCRB 4TWZA 5G41A 2HF9A 3A1WA 2OBMA 3C5HA 2ZJBA 5C4MA 1JQLB 3BBPA 3BD9A 1OLOA 3EPLA 3R9IA 2O5VA 3KTAB 3A4LA 2ZUCA 2OBLA 3EWAA 4P31A 5M04A 1F2UA 1RYHA 2ZI4A 1OJLA 3NHAA 3U3RA 1RIFA 4GP6A 4IEIA 3EC1A 4JL8A 2LKCA 2ZVPX 1Z6AA 5H68A 5UKDA 4DT1A 5IT5A 2WKQA 5ANRB 4PANA 1J90A 2WOJA 4IOKA 4Q00A 4BZPA 1EG7A 3F3YA 5KOYA 2IUUA 4YMWA 5CLLA 3TSZA 5L8VA 4XVQA 2OT3B 3F5FA 3ZLJA 1FOEB 3SBDA 3FKSD 5DISB 1KY3A 2YC4C 2DWOA 1E99A 5FL3A 4OYHA 1H8HA 3S1AB 2A7QA 2A5DA 3D8BA 4NBSA 3QNUA 4KBFA 4BE7B 1X8JA 2ZRLA 4BFSA 4C30A 2KWIA 5TY0A 1A1VA 1OIXA 2ZE5A 2W2XA 4LBYA 4B3GA 3NEYA 4GOJA 4Q1FA 4P4SB 4Q4JB 1GNPA 4KYIB 4TLCA 3GLFB 1X3SA 2J0QA 1IN6A 4F7WA 2ZUDA 1LF5A 2BBTA 2CE7A 4L15A 3Q9LA 4TYWA 4BLTA 2D62A 4KAXA 1E94E 3H2YA 3CX8A 3OAAD 1SHKA 5D3MB 5EE5B 2IC5A 1CJMA 1HY3A 1II9A 4MRVA 3BS4A 3AGQA 3K09A 2R2AA 3ND9A 2NG1A 4DCNA 1W46A 4Q47A 1ZM4A 3K0AB 4JYCA 3A4MA 1P7CA 2WWXA 4LJ4A 1F3OA 4A92A 1D2MA 1TQDA 1BYUA 4RVCA 3W6PA 1ANKA 2DHRA 2VO1A 3MWKA 5HTKA 2D2EA 3AVQA 4XWKA 3AF4A 3PJRA 3KKQA 4I1SA 5FR1A 1QVAA 1XZQA 4DEXA 3OF5A 3HU2A 4IVPA 2C8VA 1E79A 4U7DA 3SYKA 3BJIC 3KB2A 2JLZA 1E4YA 2YOFA 4CRWB 2Q3MA 2ODEA 1N2CE 3EASA 3KQLA 1G5PA 1PLLA 2GEVA 2CLDX 3RC8A 1G7CA 1G291 1NN5A 5EP2A 4AIIA 4PPFA 3IEVA 2OV2A 1A7JA 1R8SA 2P65A 4MKGA 4M53A 2B7BA 1E9CA 5HZHA 5G40A 4W9MC 2SHKA 5JJKA 2ZETA 2ZRPA 2YWFA 5FR2A 3NC0C 4F91B 3UWKA 1W44A 2D7CA 5JS7A 1KO5A 2IYWA 3U60B 1XJQA 3HYRA 1SXJD 5AJYA 2PT7A 5AR1A 1AZTA 4R2IA 4CEIB 1FUUA 2KSQA 4D4JA 4I99A 4MRNA 1EFUA 2MMGA 4Q21A 2PJZA 4LJ9A 4YLGA 3NBYC 1OYYA 1I4TD 4M9XA 3REFA 1OB2A 2VYFA 2PMDA 5CJPA 5D3MA 5TARA 3TLXA 3U7FB 1E2EA 1GRQA 2J1LA 4E09A 2R44A 1ZNWA 4P33A 2WIBA 5EP1A 3UMFA 1OB5A 1NLZA 3WXMA 4B75A 2GESA 2HCJB 1Z07A 2OZEA 1ZC3A 4IXNA 4PSKA 2C9YA 5L3RA 4DEYA 4HUTA 3PEWA 4JLAA 4GMXA 3CF2A 5EQTA 4CVNA 1T3SA 1P4SA 2BC9A 1E2LA 1YRAA 4XD7A 2G1JA 3MWJA 3OEHA 5GJWC 1RJ9A 1XFAA 3G82C 4LJ6A 4D81A 2XX3A 1EGAA 3IIMA 2ANBA 4JVLA 2BCJQ 4KVAA 1DARA 4RD4A 3AVVA 1D2EA 3U3OA 4IVQA 2O8EA 1CJVC 1HV8A 1RVDA 2QPTA 2C9OA 4RD2A 1QHYA 4BZXA 2ZQ5A 4LV6A 2GHIA 3BE4A 3OFNA 3QPUA 5JEEA 1X1SA 1A4RA
chains in the Genus database with same CATH superfamily
1W4BA 3ADBA 3OIYA 4G37A 4YRCA 3O26A 4QUIA 4RVDA 4JEHA 2C8KA 4XQEA 1G17A 1NG1A 2ZBVA 4Y0NA 4AJKA 2JGNA 3EXG2 1YS6A 1ORIA 5CDFA 121PA 3CY6A 4NR0A 3JASA 3PDCA 3P0EA 4C7VA 4XARA 4E7PA 1ECLA 3KAPA 2B92A 1PR0A 5LQUA 5C80A 2GD6A 3FE2A 3MG9A 2ZJ5A 4OXYA 5TS2A 2XQJA 4I5GA 1XELA 2BKVA 3PFGA 4WK4B 3RJTA 1NSFA 3IC5A 3GT3A 1DT3A 1P7YA 2Y1LA 3NVMB 3E9CA 1DC7A 4RTKA 2RHHA 4P3YA 3PQ8A 3TH5A 2VI5A 1DQPA 3BIXA 3VVCA 1MJHA 1X80A 3JRWA 1BXZA 3LAWA 4MAFA 3ZE0B 3AVXA 2NV6A 2JCGA 2O2DA 4KMRA 4V1CA 2W0MA 5AW1A 1XIVA 2VT2A 3D3JA 1WHTB 3P0IA 3KB8A 4TXMA 3F5SA 5CIWA 1IPEA 1HF3A 1XI2A 1DADA 3A2NA 4QE3A 1AB5A 4D1YA 3AKZA 4TTTS 1RWBA 3PP8A 2HHHB 1E4EA 4PSVA 1E8NA 1H1LA 2Q46A 1JALA 3BF7A 2YR0A 5AXCA 1H94A 1I6MA 2W6CX 1JJBA 5FADA 4IDCA 4GVPA 4N48A 1DG3A 1BE8A 2VFAA 2ZRKA 3OA2A 1TZKA 3GJXC 2HGZA 2WHEA 4JJZA 3UMGA 5DP2A 3WNZA 2FMTA 1G38A 1E3LA 2R7LA 1ODIA 1POXA 3PFCA 1IBRA 4JH0A 5G1PA 4IVNA 4KFTA 3LPNA 1ISHA 1LBIA 5AM4A 5BWBA 5FOQA 4LF4B 1GUYA 2DPMA 1I2AA 2Q5LA 1G2QA 1O5TA 4BX9A 2E5LB 2FZEA 1Q14A 4CIYA 2I65A 4MVWA 2B1RA 1Y3IA 1Q0ZA 2ODPA 4BVEA 3H5AA 5IBPA 1E89A 1OZ0A 2NP7A 3VNUA 1OWLA 4JEIA 3GI1A 3JQBC 8MHTA 1XKTA 1N5RA 2Q3LA 3GMSA 4GNKA 1RQPA 4RSRA 4C6TA 3G9TA 1NBWB 4HH3C 4LKOA 4INOA 3THOA 3RCBA 1S6YA 2ZUBA 1FU7A 1YBHA 2YJ4A 1JQDA 2H11A 4MW4A 4PC7A 3FFTA 3T9CA 3TTYA 4LNUB 2ZVQX 3CBQA 3KE8A 2A4MA 3FYDA 1M34B 2GEKA 2F8LA 2QA5A 3G2PA 4BQPA 4ESHA 1IZ8A 5JBQA 1ZXXA 5FLKA 2BLLA 2I4LA 1W0JA 4DDUA 4XPIB 3A9SA 4BKOA 4ETMA 3AFGA 4HEA6 5ISMA 4ENVA 2RSLA 2VWGA 3O1LA 3U09A 1KEUA 2ZXEA 3VH3A 4JSRA 2Z04A 3IQDB 1FLAA 1D0SA 1NNSA 1QCDA 2LPMA 2WZBA 1SK9A 1HT2E 1VJCA 1QWSA 2UXBB 1JAXA 3HKDB 2FJPA 1JZQA 4TT8A 1IHUA 4GMKA 2E6KA 4JXXA 2ATEA 1RJWA 4Z99A 4N3CA 2DHQA 4RPGA 3VV2A 3GGDA 1XDSA 2V6IA 4Z8YA 3RV3A 4IDFA 2TRSB 5CNIA 4ABTA 1Y4SA 5K3EA 2EFJA 3TM5A 4Q01A 3Q1LA 2XKKA 1SCNE 3GLTA 3CURA 4M60A 2I7VA 4HLDA 5KWIA 1UBGA 1B41A 3I37X 1P5FA 4URHA 1V43A 3RVSA 4BCBA 3FUTA 4Q1DA 5LJLA 1CF4A 3AVYA 4MGHA 3K0AA 3INGA 1WNFA 4Z1MD 2B8JA 1P80A 3ZZTA 1F06A 1FFXB 3RLIA 1KQOA 1RWQA 5F3RA 3ESZA 3VX3A 3LSYA 4JJFA 1K6JA 2VJCA 1G4HA 5AVJA 2RJNA 4AS3A 5TIIA 4MQ5A 4CXMA 4ILEA 1B8NA 3Q9UA 4OU5A 1P5ZB 5B3AA 2R8PA 6LDHA 3WK6A 4XYMA 2AA3A 3JQ6A 1JEEA 3G9ZA 2EJCA 3KLMX 2ZSDA 1MIHA 2VC2B 2X86A 2CW5A 2LV8A 4LZNA 3ST7A 2VUHB 4JJKA 1SG0A 3B9RA 3JSAA 3SQNA 3W9YA 3ZZ1A 1FMFA 2A9RA 1IEWA 4I3HA 2AR9A 4M1OA 1ZJWA 4NYJR 4RK0A 3UJDA 2DLDA 4GYKA 2X9QA 3HNRA 4MVJE 1NN0A 1OILA 1ADJA 3DR3A 2VDQB 2BMFA 1H2ZA 3BWYA 3COVA 4IO0A 2WZDA 1QZ3A 3COYA 3L0CA 1SUSA 3I1IA 3JW8A 2OV1A 4HQRA 5LWQA 3OCUA 5FH9A 2JGRA 1JJVA 3E70C 3MVEA 4I2VA 2VRCD 5FBWB 1SIOA 4WWHA 3WDLA 2PGAA 4J16A 5KVAA 3E05A 1WHSA 1KQ3A 2PSSA 3WA6A 2R00A 1OI3A 3V1TC 2BSAA 1N9KA 4H08A 1YJXA 2NUAA 3DVQX 3R0ZA 3ZJYA 4CYMA 4BWFB 2WJPA 5CB8A 3CZRA 1RMTA 2I1QA 3WTCA 1USUA 3GBPA 4JLPA 4KRYA 4JBNA 4EF6A 1V39A 3E82A 1CDOA 4M22A 1NF3A 3I2FA 3ICWA 3R5FA 3A3NA 4RYDA 3IP6A 3RE1A 1OIWA 5JWRA 4BGEA 5KX5B 1GPNA 1Z8NA 1E0AA 2JIQA 1XVUA 4LKRA 1SOAA 2AD5A 1GZ7A 2PLRA 3NCTA 1L1QA 4WOKA 3UIEA 1FVFA 2IYEA 2XTAA 4RMJA 1ZAYA 4GXNA 3KR2A 4RLHA 3RK4A 3CNOA 4QDZA 1U8YA 2J3EA 2LCQA 1KTIA 3ND7A 3PWZA 4DDTA 5KVVA 1XZNA 2I54A 2ONYA 4DSAA 1RZRA 2Z6UA 3V7FA 3R3SA 1FP6A 2QORA 1M1YE 5TMDA 1ESMA 1QUEA 1C50A 4HAUA 1CYDA 1GL9B 1ZOPA 2F43B 2Z2XA 3Q10A 8ABPA 3IP5A 5CVCA 2FSSA 2HZBA 2P2GA 2JI8A 4FT4A 2PUVA 1Z5UA 4JC4A 3HB0A 4QUHA 4CJXA 3C0KA 4E13A 1CEXA 4CFSA 1VBNA 1OAKA 3JAWA 1OBVA 1A7AA 1LPNA 2GCOA 1H2FA 3QOFA 5LQSA 3RKUA 4IJ5A 4IWXA 2Z8XA 2RJOA 2WYIA 2XR1A 1WMDA 3HBJA 3JYPA 3EW7A 4P82A 5IARA 2FRDC 2DAPA 1OH8A 3TKLA 2CT8A 4C2AA 4QRHA 5AVYA 1Y7IA 5A3JA 2E3JA 2JBAA 1RWOA 1CE8B 2CLSA 3EPKA 4DUGD 4HWRA 1VPTA 4QT0A 3KJZA 1XVLA 1ZIXA 3CX6A 3VR4H 1BKDR 1QB8A 4WHMA 3U48A 1JB1A 5LU8A 3B82A 1H65A 2RBKA 2IZOA 5JS2A 4JENA 3BULA 5IH3A 4DJEC 1TO6A 2XDYA 1GU7A 1PTJA 4GI2A 3WGKA 4MQUA 3R20A 3AI1A 1D4ZA 2R79A 1DG9A 3AJAA 3RS7A 4J4TA 5CR9A 1XTBA 1E79D 3LO5A 3WSTA 4NK5A 1O95A 4KUHA 4NJMB 1YR7A 2DPGA 1AB6A 4QNMA 1YZTA 4GOKA 4JOBA 3RRZA 3O47A 3UCFA 2D1SA 3DUFA 3C48A 4L8GA 1RAFA 1UBMS 3GCGA 5K3SA 1KSGA 3T3HA 1W76A 3DM5A 2ZSBA 3LWZA 3KXDA 2Z1MA 4WX2B 4YWHA 5T41A 3V4LA 1IULA 2OTCA 3G2HA 4CM9A 3IB3A 4L75A 5AOAA 2C2ZA 4CN8A 2D6FA 2P68A 1MDFA 2QLFA 1RWXA 2A9KA 2IE0A 2FPGA 2VDRB 5C18A 2ZFUA 3TAUA 4IHJA 5C1BA 4XB2A 1P1CA 3QFTA 1GDTA 3R7SA 1TKCA 1I2BA 1K86A 3BGOS 3PL5A 3LO8A 1UBTS 1EWTA 2HOQA 3N59A 3PRJA 3GDFA 4KIJA 2IUFA 1ULUA 3B5IA 3S44A 1O6GA 3GLFE 3I2IA 1ACMA 2G1KA 4ZRNA 1NI4B 2YMLA 1E2FA 5JARA 1QZUA 3R0VA 2XJ9A 1EBUA 1T3HA 3KPWA 3PHCA 3E8SA 3NPAA 2VXYA 1L5FA 3OP1A 2AK3A 4LJ8A 4YUYA 4HEHA 5KEIA 4IW3B 3WGLA 2XMSA 3ZGZA 1GA1A 2JRLA 1U0NA 2NSYA 3AILA 5CX4A 2VQ6A 2O5EA 1OMOA 1YWGO 1PFKA 2XECA 4IHQA 3V42A 3HEBA 5BWMA 2OV8A 3I83A 4AP5A 2EL9A 1AX9A 1B15A 1BVHA 1K7XB 1M1ZA 3PKIA 4R9VA 1X0XA 3RADC 1C80A 4H6WA 4G01B 4DJ5X 2XCRB 2G1PA 3ILYA 4K9PA 3SZOA 3GLGB 4R1QA 3R23A 1CR0A 3DJYA 3HADA 2VP2A 5BSFA 2XTNA 3ODGA 2OA0A 1XMVA 2C3MA 2ESRA 3KQKA 4WJKB 5ADHA 1X1TA 3EXIB 3L4BA 5H3HA 4QDTA 1XV5A 1E3IA 4TOIA 2A35A 2F1OA 3FMVA 1QLWA 4OQEA 4YRLA 2O0HA 1MJFA 2DPYA 4MPDA 3FTEA 2HLDD 2QOEA 1A96A 2BW0A 5FBLB 4DV6B 4TMYA 1EXDA 1YBAA 2EKZA 1J5XA 4S1WA 3FOWA 2I0FA 3HM2A 3RFVA 1RAGA 1NX9A 4H3HB 3S81A 4CM6A 3LKVA 4J1NA 4QPDA 3FLBA 3R9KA 4BIMA 5KMGB 5K0EA 1H22A 2KHZA 2WJ3A 1GJRA 4JDUA 3QWHA 2NUBA 3SGLA 1M5UA 2OAP1 1CUXA 4B74A 3GPCA 5DOVA 5EIXA 3T4XA 2P3SA 3C85A 4L72A 3FDXA 3QWBA 2XT6A 3W5UA 1ZK2A 3S8YA 2ZPUA 1NI3A 2LDXA 1QANA 4FS8A 1A9ZA 4PFSA 3T7CA 2FGJA 2MSLA 1SUDA 2ZRFA 3HJHA 5M29A 2O8BB 1AF7A 1SULA 1YZVA 4LV5B 4YX9A 3MUFA 5BV2P 4II3A 3RS9A 4G2NA 4K9MA 4ZYLA 5K3AA 4FNAA 4ONEA 3WIOA 4ZYVA 2DHCA 1TRHA 1KDVA 1RXVA 3KZVA 4NDAA 1GZ3A 2IDMA 3HR8A 3NDBB 1N8SA 4PX2A 3FTCA 1SVWA 5JXGA 2XHEA 4MW2A 4UVDA 2OM6A 4UE2A 4L3WA 4QG3A 2XITA 3LRPA 1RBZA 1N3YA 3X44A 2CHEA 2D2VA 5L9AA 3QKSB 1N2ZA 3VHRA 5JIBA 1GZ4A 3P9KA 4IOMA 5DBIA 2CFIA 4Q37A 3KLOA 3FAZA 1R12A 5AICA 3JWPA 1KARA 3NT2A 2CD9A 2AF3C 3GFFA 3N75A 1P62B 1M2NA 1INLA 2HBZA 3DWIA 1VE9A 2P2SA 3D0KA 3GXBA 2I9KA 4NC9A 3HYTA 4ZYXA 7MDHA 1DPFA 1SC3A 1KOFA 1AS3A 3GVCA 2BMVA 3GLIE 2ZSKA 1F4VA 1QYCA 4UNQA 2XRMA 4QYIB 1YB4A 2Y1DA 4ER0A 2PEZA 3OEED 3IUSA 4GKBA 4BO1A 5DF1A 4IJVA 1ILEA 1AN0A 1ZN8A 1JG1A 2YMQA 4ITUA 3TJRA 4EMBA 3EGXB 1XB2A 3T7JA 1EGHA 2WJGA 4YRSA 1BE0A 3DMYA 4IIEA 5CVDA 1UMBA 4DPKA 3CVUA 1JKMA 2CLIB 1PCXA 3BB3A 3PRYA 3VOBA 1AN9A 2PLFA 4QOSA 2DECA 2FZCA 2GGSA 1NJSA 1ODLA 2COKA 2MR6A 3KYDB 3LWDA 3UXMA 4PQGA 4E1VA 3QFRA 1UK8A 2AEJA 4JNCA 2PX0A 2GK3A 1AQJA 4DLRA 1L5SA 1I14A 1MT3A 1XCMA 2X77A 3PNOA 4KQ2A 1FQJA 3H2SA 3E0XA 5BURA 1MF7A 1N5DA 2AMFA 2QRGA 2WINI 4P3OA 3SXUB 4KFRA 3P71T 1W0JD 2DETA 1HFWA 1H1LB 4J0DA 1PV2A 2JLYA 1HWYA 1XVIA 3IOBA 3V7YA 1R8XA 1J9GA 5CG1A 4A8JC 4WKGA 5EERA 1IN1A 4PO1A 4BQRA 2F4VB 4GWLA 1JE0A 5CJJA 2FF7A 2XY4A 1Z6XA 2XQKA 3IS3A 3AEYA 4HD8A 1BDIA 4J0CA 1U7PA 1YIAA 5EKTA 4EA8A 1PD1A 5EIBC 4UVIA 4NBVA 1ZU5A 4EI9A 4JP8A 5HKAA 4J94A 5HCNA 3GYBA 5JYDA 2HIHA 4GECA 2AG1A 5ALJA 1P8JA 4M7OA 1Z82A 2UYGA 2CLOB 1SHUX 2B4QA 3K0SA 2BCGY 2R6CA 1YL6A 2XA2A 3HDYA 2WKRA 4Y7CA 5CTJA 3QVWA 4PZCA 1QLHA 3N76A 1SKAA 1U8ZA 2A0KA 2RG7A 1Z6PA 3A4TA 4JL6A 4MROA 4NZZA 4WKNA 3ZI7A 3HCDA 2G5GX 3EFOB 3N2NA 2GUGA 2ZUTA 1NBAA 2F3RA 4GP9A 3QMPA 3U61B 1YVUA 2HW8A 3DM9B 2ZREA 4I5EA 1VPWA 1NQ5A 2LWIA 3GVHA 1LS1A 3IT2A 2J3HA 1Y98A 4ZO6A 3SLGA 5FPQA 2XGSA 2NOAA 3PI7A 2V7VA 1HE4A 1JJIA 4U2EA 4DY4A 4WSOA 1MPTA 1F8GA 3OJXA 4ZC1A 3I5YA 1NXPA 1ZMRA 2HA0A 3E35A 3ZHZA 3EF0A 4J0FA 1XCPA 1BFUA 1R2QA 3IEIA 1SVOA 3TQIA 4UZFA 1QIMA 2FOIA 2R84A 2K7FA 3R9WA 3OFSA 2G1UA 5FI3A 5IK2D 3LC1O 2NO6A 4Q4HA 3TLYA 2L82A 5EEGA 2KPOA 1XRPA 4YRZA 1ODKA 1XZFA 2JFNA 1JAIA 5K4AA 4FMDB 4D8XA 1LFDB 4OXKA 4BKUA 2WP0A 1U1IA 3M1LA 3PF8A 3TE6A 3T3NA 3FLMA 3OY2A 4GC5A 4RJ2A 3MTAA 3CVYA 4EHNA 3OQNA 4R2HA 2JFFA 1WABA 3GLIA 1T0IA 1ZOSA 1XCLA 3DAPA 4KR2A 4BN0A 2QR5A 4HNUA 1DIRA 2X9VA 3D4OA 3NR2A 2P6PA 3LQQA 4Y9UA 3A2MA 2I2XB 1P2SA 3I6MA 4GKVA 5ADWA 3VHXB 1CRZA 5J4VA 3VOSA 4GYYA 5PNTA 2JEYA 4TMXA 3WJ7A 3V8VA 1ZEJA 4UE6A 5LKRA 4HAYA 1J0CA 3JYQA 3U7IA 2B4AA 5BNIA 1CETA 3DWGA 2NADA 3QI7A 2WD9A 4HNRA 1VYVA 4NWIA 1IG3A 3PHBE 5DCLA 3CVOA 2OB1A 1S8OA 1E1QD 2BTQB 3DYIA 1QPZA 3AKDA 1Z8FA 2YWXA 5KX5F 1OD6A 1QCYA 5F21A 1R8JA 2ZYSA 5KINB 2BUBA 3CH7A 4Z4CA 2OFOA 3G6WA 3S1AA 2MYNA 2PUWA 3AP2A 3H04A 3HSYA 3I8OA 4W8OA 5K0GA 3DCYA 3B3FA 4E07A 1XMQB 5IJ9A 3IP1A 1PEYA 2JI7A 4BVGA 4TTRA 4F12A 5KTTA 1XDGA 5CD9A 2GDZA 4CG2A 3ADDA 3WGHA 4UCWA 4YDRA 1RWVA 1NDHA 4CKWA 3PITA 2AJTA 1A9RA 4HNAA 2HMTA 1QB7A 3CQ9A 5FA6A 2BUAA 5FF9A 3M70A 4AZ3B 1Z17A 4EZBA 3ZIAD 3FR7A 3GUVA 3QZUA 1RPNA 4AK9A 3SXPA 3DLHA 1T9DA 1GTVA 1V3UA 4NQZA 3GA0A 4URXR 4GKKB 1JS1X 4MR8B 2AUMA 5CTAA 3ZNNA 4GX0A 1ULSA 4II2A 2NO1A 4B2PA 1QAOA 1M0WA 1Y3DE 3LV8A 1H69A 1YXMA 4WV3A 4J6EA 4RQUA 1DAPA 2EQBA 1V1RB 2WIDA 2ZBFA 1QTIA 4YT5A 1PFUA 1XGKA 4KSCA 4CT4B 4EG8A 3H83A 4J0EA 3ZY6A 2D1TA 1F8XA 5T8KA 2QRKA 2ADOA 2OD2A 2PE5A 4CCWA 3U7EB 1VMAA 1ZHHA 4XTCS 5HG0A 3NTLA 4TTAA 1NRIA 1YI8A 3ZY4A 1KJ8A 5I7FA 5JC8A 4Z4GA 2GN2A 3T7DA 4OHYA 3NTVA 4M7WA 1BHO1 1PF7E 4XLZA 4IM7A 4EZIA 3LD9A 5KNCH 2Y1XA 2X5KO 3E0QA 3MJRA 4FOOA 3TEJA 4CM9D 1P1IA 3O3NB 1L7OA 5KUTA 3HY6A 4FUTA 3R74A 1Q7RA 3F7OA 2R7KA 3OIUA 1QR2A 2NVUA 5BQ5A 3SJZA 4QU0A 3T0IA 4JU9A 3AEUB 3NKLA 4DGSA 3NNNA 4F7DA 1LLDA 3ZHBA 1MLDA 4ZRDA 3PQ7A 4QTXA 4J29A 2FK7A 3L8HA 1XX6A 3MAAC 4TLLB 1IWBB 4KV7A 5AXDA 3L4KA 3CSUA 3C45A 5DPMA 1UJ5A 1YS1X 3JCZA 3M1IA 4PS0A 2PRKA 1COWA 2NT4A 2QT1A 3TVDA 4WXHA 3M0EA 4J7AA 5DYYA 4U2GA 1EZZA 4P08A 5K0FA 3NUQA 3VSAA 2WWGA 4EUFA 3PUIA 4H0NA 3PD0A 1LB1B 5EC8A 4AY2A 4FEYA 4QFMA 3LBAA 3A2KA 3NRJA 4RH3A 2EWVA 1QWOA 1WO8A 3PS9A 3HU3A 1RU3A 2DFVA 1MC4A 3DLTA 4HFJA 4P98A 5JI2E 3C97A 5E7MA 3KQUA 1NLMA 4QX6A 3TI7A 5L7YA 3KQYA 4LJRA 1AGPA 5I7SA 5B1IA 2H1VA 1DOAA 1T3ZA 3F9RA 3R24A 4WEOA 5TB5A 4DBVO 3ZDXB 4CMEA 4QASA 3BWXA 1T8UA 3WISA 3ZU4A 2XVMA 1DQZA 3II6X 4QOFA 2H1OA 3A8TA 4L6IA 5DI3B 2VHUA 3C24A 3SQMA 1XP8A 4ZN6A 4M8KA 1P1KA 4RH1A 5FUBA 1K3FA 4FE4A 1W75A 1W88A 3DTTA 1WZIA 1U5BA 4H7DA 2I78A 2IV7A 4C4ZA 1J8MF 3UAYA 2VUUA 3MRXA 3SLKA 2DQ4A 4F3YA 3IQGX 1RAHA 4TL9A 2EU8A 2QGZA 5KOJA 3J7AC 1E4VA 2GBCA 2ZJ8A 3TOVA 1XCJA 2HLDA 3C1AA 2V9ZA 4O1HA 3TINA 2BFFB 1S2GA 2X2EA 4M0DA 4IWNA 4UQOA 3FJYA 3JQFA 4GH5A 3PD1A 4QXOA 4JLDA 3TGLA 2PU5A 3NDPA 2P6RA 1DIGA 3I2HA 3WGNA 3MBIA 2VS1A 4MKZA 1V4BA 1EA5A 4PQFA 3BOSA 5DWVA 1QIEA 3B13B 4UOQA 4ZQGA 4ARZB 1UINA 1E6KA 2F48A 1EFPB 1AS0A 3QPBA 2JAXA 3UT0A 3L8DA 3T5DA 4EHDA 4KQJA 3ETHA 1I1QB 1O89A 1VJRA 3NC4A 4NBTA 1E5LA 4PQEA 4F21A 4NXMB 4KXVA 4AJJA 1YB7A 1TO2E 5CB0A 1NBMA 5BWLA 1AZSC 1EUYA 2R4TA 3RUCA 2PUDA 1R6UA 1MO2A 5B6PA 1OJ7A 5FA5A 1D03A 3U56A 5DYIA 3GP3A 1KEVA 2BVNA 2QL9A 1Y89A 4FDMA 4W7SA 2WHXA 4DBLE 3RIHA 3HWX1 1JG6A 4HAOA 1U2PA 3ILHA 2J3KA 4RWZA 4JP2A 4KNWA 1L7XA 5JHGB 3NKVA 4GQIA 5K8CA 4V0MA 4J91A 1NXVA 1EJ0A 2OUIA 3C14C 5FBQB 5HGJA 1GPDG 1F0PA 1OLUA 4JQOA 2J0UA 2F17A 4IJQA 4CF6A 3VR4A 3DPUA 2GWHA 2G71A 3K3PA 3QXGA 4IIGA 3X2EA 3G23A 3HFSA 2CLKB 1XZPA 3DBHB 3H9BA 1YKFA 3UAGA 4MNTA 3R8CA 1UPFA 4G1FA 4MS3A 4AL4A 3KR0A 1DOHA 1UPAA 1X19A 1XSEA 1GUDA 3OEHD 4WY8A 3TX2A 5DHTA 1JXOA 3DDWA 4F8JA 5JBNA 1U7DA 5I47A 1O97D 2HK9A 4CE6A 4HAZA 4EL5A 4PLTA 4YGYA 1A2KC 4XH9B 2VYVA 3A3YA 4JMLA 4FBGA 4IIVA 1K92A 1JFSA 3CWCA 2FE4A 2ZAYA 3EFHA 2C4NA 3ORFA 2XVAA 4BO7A 3CMMA 1USWA 3D0QA 1GGMA 3G2JA 1CRQA 1E4EB 2VPQA 3STWA 1IHOA 5C46F 5ITVA 4I1PA 1A9PA 2IVFA 1C7JA 2DERA 5FQOA 4AG6A 2DUUA 2FWPA 4UM9D 4EKNB 2H59A 1D4AA 2XE6A 4V24A 5H80A 3SFVA 2IQIA 1QRUA 1TJ3A 2CCJA 3QK7A 1VKRA 3VYUB 1CQZA 1V9LA 4JJ7A 4LDJA 4U6NA 3TG2A 3MTEA 5CLGA 5ALVA 2PGLA 3B9PA 2J7PA 3DQPA 1CVLA 3OWOA 1NASA 3HI6A 1U02A 3LF1A 4I4TB 2JCBA 2FV8A 3B5EA 5EWJB 3GBSA 4AG5A 2Q7DA 1EP1B 2G9RA 2XVXA 1G8PA 1HTBA 4X62B 4MS4B 2L17A 1ZQ1A 3AW8A 2VVTA 4EY5A 4D44A 4J8PA 3KKPA 2ATVA 5AQEA 1KQNA 4EB8A 1WP4A 3HJUA 2M6LA 3TD6A 4F9EA 5J23A 3OQOA 4L16A 1BC5A 3P26A 1HT0A 1SBIA 1LQTA 3WL7A 3AJ8A 3I92A 4CI0B 3C16C 4DIDA 5K4GA 2EAUA 1CC1S 2POQX 2UXCB 1M83A 3DC2A 1NVBA 1RWKA 1QQ6A 1ZL0A 1OC2A 2YV3A 3A0UA 1K63A 3PEUA 2OCYC 2PH3A 3DP9A 4L0MA 3FNBA 1HDZA 3KFLA 5T67A 2BFCA 4PS1A 2W42A 3KZ1E 1J07A 1YTLA 1PV4A 1QP0A 3BF8A 1G9TA 2I3ZA 4UKDA 1Y42X 4DLBA 3SOZA 3V4FA 4RK4A 4B4OA 4TRRA 1ZUHA 1XO1A 4EK9A 3WIDA 2I4NA 4HBGA 4S35A 1DKNA 3T34A 3ZJ4A 5AIBA 3UATA 3Q9SA 3V55A 3M4YA 5CAEB 1Z4PX 3EAFA 2WF7A 2CNNA 3H9CA 3C1OA 3LQ2A 4BE4A 1OAOA 1ES9A 3NTRA 2VH5R 2B21A 1LRJA 3TUJC 2TMGA 3WK7A 4XUGB 1IOWA 2PKYX 3IAM1 5EPOA 1YQUA 1KZHA 1X39A 3DXYA 5DRYA 3RFFA 3ZXUB 4AWBA 4CM8A 4DG5A 2Y93A 2Y9PB 1PFGA 2GVZC 2HC9A 1UANA 2RH8A 3L7BA 2G9NA 3TIFA 1V8FA 1VHTA 3H5NA 3IJ5A 4G97A 2ZUEA 4BYGA 821PA 4CCYB 4HWTA 1E5XA 2YIMA 1GR1A 2H6EA 3P1JA 4G5XA 1OH5A 1NNEA 3HXQA 1ESCA 1NIPA 4PCUA 4Y9TA 4AZSA 4O2BF 1U6KA 1QGUB 3LDAA 4QA9A 1NLFA 1I51A 4Q3EA 4TGLA 4TXHA 4OQLA 1JIKA 5T3UA 1PZHA 5IZ4A 3V3KA 1JTFA 1U04A 1HR0B 2H5IA 1W6UA 3N70A 6REQA 4DR3B 2KBEA 4INZA 1H2XA 1P2DA 3ROZA 3OH8A 2ZBUA 1KTVA 1MEJA 2QM7A 1H2YA 4EFDA 1UZUA 5HJ2A 1WIWA 1BE6A 1O3YA 2J3LA 3IBFA 4IXMA 2P6OA 1ZFNA 4IIJB 4QARA 2EFEB 1JXAA 4KXNA 4LA4A 1G9XA 1GITA 3T7KA 5LOVB 5C4IA 4D0GA 1P81A 2XKAA 3R5KA 3RS0A 1P6XA 4I1IA 4NCIA 3AKEA 1VBMA 1Z36A 4FOLA 3BL8A 3IP7A 3K0HA 3DBRB 3NKFA 1OE0A 2X0IA 4UU1A 1JIVA 2DBZA 1L5VA 2FX2A 1YI1A 3CCFA 3ZZMA 4PZYA 1Z4MA 3TXYA 3MJHA 4QUBA 2VHWA 2PFSA 2B7CA 2WFZA 2X3FA 4E11A 1UDRA 2B99A 2G1AA 4HZUA 3EGDB 1AV6A 3KJHA 4BBAA 1UJ4A 1SBNE 4KDFA 1R8YA 2GTPA 1ZOOA 3HJCA 3BUSA 3SICE 4PW0A 2G83A 3ZKWB 3ILSA 3LJKA 1ZPDA 4UTNA 2P9TA 3BB1A 2J85A 5HKBA 2CB9A 3OM0A 4UVGA 5A05A 3V9AA 2FMXA 1EXWA 2GFHA 2XQIA 1WF3A 2FW7A 3WMRA 1UP6A 4GIBA 4U9IS 2DJ5A 3AFHA 5G4LA 3ECSA 1G59A 3AR3A 3CT6A 2P2CA 4K1LA 1NF9A 1NIJA 1P91A 2HB6A 2VAXA 2XOKA 4MUKA 2YHIB 2OESA 1LTQA 4P22A 5AKZA 5KNDD 5DCYA 1SQ6A 5DGXA 3IDFA 3LC0A 3ZHYA 2CDNA 4G1MB 4ZEOA 2NT3A 3VMFA 3HWWA 3ZVMA 4Y6SA 1BA2A 1JU4A 2IV3A 2J59A 5HKKA 4DCGA 2FMUA 1FS6A 5DTMA 5HXAA 2GJAA 2OCGA 2G4CA 1E2JA 2OORC 2UZ1B 3F5MA 5FJIA 2YXBA 5LD2B 1E60A 5EEHA 1Q0UA 1TCVA 3EPRA 1P4RA 4RLSA 1X15A 2ZU0C 4KXXA 5CA0F 1GCAA 2BFFA 2ZDGA 1WB9A 4MUNA 1E96A 1FVHA 1NJ1A 3CF6R 4D74A 2WWHA 3ZGLA 3N1UA 3TL3A 1AY0A 4QOJA 4Y9DA 1P6UA 4IDQA 3W6OA 2JJQA 3RWOA 1CFZA 5ALTA 4A0FA 2ZCVA 3TKAA 2GXSA 1NQUA 4MH0R 3MMSA 1YE5A 4JB8A 5AW7A 1TTTA 4FJ2A 4P8RA 3ITNA 1XA3A 1S1CA 1EWKA 4HNSA 4UDOA 5LA6B 4EO7A 4W5QA 1G3MA 4ZYUA 5BPHA 1R00A 2QTNA 3ZPXA 2XTMA 2P90A 3D5EA 5FDFA 2PGDA 4ZCLA 5EMNA 2WWWA 2CXXA 4HZUB 2FEMA 2H4FA 4IGAA 3U5ZB 1KRWA 4UEKA 5BSWA 2JKZA 2QVXX 3RQSA 4CTOA 1B74A 1DTEA 3K8ZA 4IDAA 4BO8A 5A06A 4N3BA 1W8IA 3EVGA 4OP1A 6YASA 3QOYA 1XAHA 4G0ZA 4RVNA 5A7HA 1E2MA 1YRHA 3SQOA 5K8IA 4O2BA 3AQIA 1O9HA 4TQUS 1F0NA 1BDHA 5FOXA 3FH0A 4DQUA 2XZDA 4DDHA 1WSBA 2I99A 3A14A 1BQ4A 3O8QA 3RUHA 3JX9A 1B8PA 2YFQA 3Q3IA 3Q3EA 2H7YA 4GI1A 5FTNA 4WBNF 4YIHA 5A6VA 3MPOA 4F3KA 1ZGAA 5THQA 1MOSA 1RMQA 1WCIB 4DSUA 3VU9B 4KHPB 4KDRA 4G1CA 2Q6KA 2WYWA 3O8DA 4KX3A 3OQVA 1NUAA 4WD3A 4RPKA 1M34E 4IYRA 4QQ8A 1X7WA 1XZDA 4DIEA 5I48A 1GNRA 1WBDA 2ZTMA 2AJCA 2XUAA 4R5MA 1EBBA 4GP7A 4DMMA 1ZVMA 3I5MA 3QYFA 1B14A 1UAGA 5LXTB 3U4GA 2H1SA 5KYWB 4L50A 2XH8A 2V7UA 6GPBA 2P4UA 2XEDA 4BNJA 3TFOA 3KYBA 1TIPA 4DLKA 1ECGA 2F3SA 3T94A 3WNCA 3THWA 2ACKA 2CXRA 5AOBA 2BGUA 4LHYA 2Q5OA 4PICA 4D92A 1NAIA 5SZIA 3M6AA 3INTA 1XDDA 4ZDJA 1TMKA 1U8TA 1TIBA 1ATIA 2NZJA 1WSWA 2D5CA 3V34A 2JVIA 3LX5A 3OU2A 4JT4A 3G8DA 3FOEC 1P7ZA 4WLVA 2DQSA 3QA3E 2O4UX 4UHKA 4ZAWA 4UCQA 3S8MA 3WP0A 1M2VB 3IQEA 2YZGA 4IOLA 1EHYA 1ONSA 3X2SA 2VDUE 4DA6A 3DOJA 2J6CA 3HP1A 3ASUA 2JLXA 5DX1A 4Z2YA 1AH2A 1B7GO 4PAMA 2JLWA 1I7PA 1UDAA 3SFZA 3BCSA 1ZXBA 4Q93A 4LMRA 5ALFA 4O4HB 3S28A 3KJEA 3C1UA 5FAXA 2ZDHA 3KZKA 1TTHA 1PR5A 1V8OA 2WKWA 3INNA 2ZAOA 3LLUA 3QNMA 2ZW9A 3I6QA 1CQIA 2VJQA 1AXRA 4D3YA 5BR1A 1C7EA 4QJ3A 1J8YF 1V0JA 4TUYF 2BMAA 4HX9A 2IIVA 4JNKA 3DDOA 3O8NA 1GZSA 2UYHA 4D8VA 1LRLA 3NASA 3VMMA 1E5QA 3OZCA 4UBJA 4B35A 5A4AA 2GCPA 3U7HB 1G41A 4CV2A 2QQ0A 3TTSA 1QVWA 2HV8A 3K0FB 4ARBA 4UBOA 5HZMA 5FHQA 3LZDA 2CV0A 2D8MA 2V5AA 3OO1A 4V03A 3KALA 3KBOA 1R6XA 3LI2A 1L4EA 3Q8LA 3ORRA 3LW8A 4ASUA 4ZI7B 1NBME 1XMOB 1SEPA 4JJEA 4RXMA 2W8BB 2GOYA 1QGED 1WDKA 4WN3A 4ZOBA 4ZT2A 5HSGA 1JX6A 3P5BA 4ZGBA 5MN5A 1WW2A 4EL0A 2IKSA 1E5DA 3IUJA 4AYXA 1P72A 4M4SA 1ZMTA 4LJAA 4IP0A 3DEFA 1AKUA 4YJGA 3VR6D 5IAJA 1R9GA 2DUMA 3GRRA 3BFPA 2II6A 1TUBA 2X2FA 3K1AB 4OI2A 2AGVA 3ZCQA 3BGWA 3IOMA 1LCIA 4V38A 3WA7A 4FC7A 4HG2A 4QEDA 3SX4A 2I6UA 5BOSA 4YRJA 4MVJP 5AWFC 2N3ZA 2JJ2A 4R2MA 4NK4A 2VPPA 2BHSA 2R1TA 4G0WA 1RKQA 2QTLA 2PNFA 5KNCA 2VJAA 3MWEB 4RSHA 3HUUA 4XFKA 1I5EA 2WP8J 3I2YX 4PO8A 1NN3A 1IG0A 4MV4A 2JCYA 5TQ0B 2GHRA 3ZBQA 1ESEA 1I36A 1LWNA 2NU7B 3ZG6A 3VAAA 4HQNA 4ZJPA 1TMOA 5LDHA 1G8HA 4ZO9A 2GEFA 1Z5OA 1JMKC 3K15A 3DLBA 1PS0A 2G06A 3VHLB 2GZMA 2BTEA 4BMNA 3LUFA 3TMYA 4KMSA 3C2QA 1HXHA 1N6PA 2YJZA 3M7IA 5AUQA 1B8OA 3IHTA 3ZHRA 2BEKA 5BV7A 1SZJG 3GPDG 2H1HA 4IH9A 1CUVA 1V7CA 4AI6A 2ETVA 1NKSA 1V7ZA 1OAAA 1YQWA 4GSYA 4JKOA 2DWQA 1DDIA 2GSWA 3DZDA 3H3FA 4R51A 5K05A 1K5GA 3CH5A 3HVKA 3W5IA 3UAVA 2C4MA 2FRXA 1H2WA 2IVZA 2J3MA 2AFVA 1ICIA 2QSZA 2I1VB 1OC4A 3RVDA 4YYEA 2XBLA 5E9AA 4ZVPA 2IP2A 4M98A 2ZB3A 1XPJA 4EARA 2WZQA 2V3WA 3CLSD 2QYOA 1J23A 1AKRA 3DWFA 2HPHA 2WJIA 3FIJA 3GN2A 3QI2A 4IHJF 4TMTA 5FFMA 3RC2A 3ZK9A 4DWOA 1L4FA 3AR2A 4IDDA 2FUG1 8ATCA 1KMCA 2H4WA 5DHAA 4CV3A 1P77A 2Q1WA 2O4CA 3D9QX 5E3IA 2DCUA 3ZWXA 3CLRD 1Y6FA 3R5JA 2Z2JA 3CLUC 4DM4A 1LZLA 4RNDB 3B9QA 3CVXA 4R31A 4HSGA 1OI4A 2Z6VA 4JX8A 1U2QA 4I9GA 4L28A 3IRVA 1PFVA 1QBGA 4B32A 1OTXA 3DL7A 1M8PA 2BGMA 3AY3A 5KVSA 4PCVA 4HZGA 2EW1A 3F5DA 4H0CA 5CEFA 5C8VA 1ZWLA 2QVGA 4AO7A 1MOZA 3UG7A 2EZ4A 2PIAA 5CT9A 4N5DA 2CBGA 4CR8A 4YMGA 2GK6A 3C6ZA 2A3RA 1JQ3A 5LMZA 1G3RA 2O8DB 1FJ2A 3NM6B 4DXAA 1J2JA 1D8TA 4KKXB 3LT2A 5DU2A 2QW0X