1KKRA

Crystal structure of citrobacter amalonaticus methylaspartate ammonia lyase containing (2s,3s)-3-methylaspartic acid
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
411
structure length
411
Chain Sequence
MKIKQALFTAGYSSFYFDDQQAIKNGAGHDGFIYTGDPVTPGFTSVRQAGECVSVQLILENGAVAVGDCAAVQYSGAGGRDPLFLAEHFIPFLNDHIKPLLEGRDVDAFLPNARFFDKLRIDGNLLHTAVRYGLSQALLDATALASGRLKTEVVCDEWQLPCVPEAIPLFGQSGDDRYIAVDKMILKGVDVLPHALINNVEEKLGFKGEKLREYVRWLSDRILSLRSSPRYHPTLHIDVYGTIGLIFDMDPVRCAEYIASLEKEAQGLPLYIEGPVDAGNKPDQIRMLTAITKELTRLGSGVKIVADEWCNTYQDIVDFTDAGSCHMVQIKTPDLGGIHNIVDAVLYCNKHGMEAYQGGTCNETEISARTCVHVALAARPMRMLIKPGMGFDEGLNIVFNEMNRTIALLQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 3-METHYLASPARTATE AMMONIA-LYASE
publication title Insights into enzyme evolution revealed by the structure of methylaspartate ammonia lyase.
pubmed doi rcsb
source organism Citrobacter amalonaticus
molecule tags Lyase
total genus 149
structure length 411
sequence length 411
chains with identical sequence B
ec nomenclature ec 4.3.1.2: Methylaspartate ammonia-lyase.
pdb deposition date 2001-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05034 MAAL_N Methylaspartate ammonia-lyase N-terminus
A PF07476 MAAL_C Methylaspartate ammonia-lyase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1kkrA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1kkrA01
5EU9A 1BQGA 3T9PA 3UCCA 4KPLA 3U4FA 3B97A 1TE6A 3ZLHA 3NFUA 1MNSA 1EC7A 3FXGA 1SJDA 1L8PA 2PP0A 2NQLA 3Q4DA 3S5SA 3QTPA 2XH7A 3DESA 1EBGA 1XPYA 2HXUA 4HCDA 4KWSA 1ECQA 2AL1A 3ZLFA 3GC2A 1EC9A 1SJCA 3TCSA 3D46A 1WUFA 3RRAA 1XS2A 2GSHA 3ES7A 4E6MA 3KUMA 4IZGA 2PU1A 3VDGA 1KKOA 3DG6A 3SN0A 2ZC8A 3V4BA 3IJQA 1YEYA 3FVDA 2PTZA 3CK5A 3MY9A 4A35A 3RR1A 3OPSA 3STPA 3UXKA 4E5TA 1P43A 2PGWA 1DTNA 3MKCA 1E9IA 2QDDA 3T4WA 4MKSA 5FJPA 2GGJA 1R6WA 3ENLA 1OEPA 3HPFA 4HYRA 2ZADA 3SN4A 2OQHA 3RCYA 2P3ZA 2XH0A 3I6EA 3RGTA 5ENLA 1KCZA 2AL2B 4HCHA 4DYEA 1KD0A 1MDLA 3JW7A 4J1OA 4GISA 4GGHA 2PODA 3FJ4A 3OW1A 3R25A 3ZVHA 4GMEA 2OLAA 3R11A 1IYXA 3N6JA 3Q45A 4KEMA 1W6TA 2HZGA 3PWGA 2MNRA 2PSNA 3UCDA 1WUEA 1SJBA 2OG9A 2P8CA 4H83A 1R0MA 5IDZA 3BSMA 1MDRA 3RITA 4FI4A 4J3ZA 3R10A 3TJ4A 1ONEA 3DDMA 3FV9A 2FKPA 3UXLA 3QKEA 3IK4A 3R0UA 3VCNA 3IJLA 3UJEA 2XSXA 4M6UA 2P88A 1JDFA 3OTRA 4E4UA 2QGYA 5FJRA 2AKZA 4G7FA 3JZUA 2OZ8A 4K8GA 4ROPA 3SBFA 3DGBA 1NU5A 3FYYA 4K2SA 3DEQA 2HNEA 3TWAA 2QJMA 1MUCA 3R0KA 3CAWA 3N4EA 3THUA 3BOXA 2OZ3A 4Z1YA 3DERA 4HNLA 2PTYA 4HCLA 3H12A 2GGHA 3QLDA 3N4FA 3V5CA 2OO6A 3SQSA 4GFIA 5BOEA 4HN8A 3VA8A 3U9IA 4A3RA 3GO2A 2DW7A 3R1ZA 4GYPC 3ZVHB 1EC8A 3QN3A 3P93A 3H8AA 4M0XA 3VFCA 2PGEA 3JVAA 3NO1A 3MQTA 2CHRA 2P0IA 4FP1A 4DX3A 3PWIA 3FCPA 3TOYA 4IT1A 3PK7A 2FYMA 3IJIA 3ZVIA 4X2PA 3VC5A 1TKKA 2AKMA 3N6HA 5FJOA 6ENLA 4ZCWA 4IP5A 4IL2A 3K1GA 4IL0A 1SJAA 3GY1A 3BJSA 3TQPA 3MSYA 1RVKA 4MMWA 3CYJA 2GL5A 3T8QA 3TW9A 2OKTA 2PP3A 3DG7A 1FHUA 2ONEA 2QQ6A 2PMQA 2QJJA 2XGZA 2PP1A 3CXOA 2OX4A 3MUCA 3UJSA 2O56A 3I6TA 4G8TA 1EBHA 3DG3A 4HNCA 4KT2A 3P3BA 2I5QA 1NELA 2PTWA 3TWBA 1JCTA 4JN8A 1F9CA 4H1ZA 3UJRA 4H2HA 4E8GA 2MUCA 3T6CA 4F4RA 5BOFA 3PFRA 3I4KA 2PA6A 3TTEA 3NZGA 2XH4A 3GD6A 1PDZA 3P0WA 2OZTA 1MRAA 2QDEA 3V3WA 1KKRA 3CB3A 5FJUA 3OP2A 3QPEA 2QVHA 4A6GA 4DWDA 3V5FA 2PTXA 4JHMA 3D47A 1BKHA 3SJNA 2OVLA 3TJIA 3UGVA 3SSZA 3UJFA 5J04A 3H70A 3OZYA 4YWSA 3H7VA 4GGBA 4ZA0A 3VC6A 3NXLA 1ELSA 4GIRA 1JPDX 3DFYA 1P48A 3DFHA 1TZZA 3EKGA 2PU0A 4DHGA 2PS2A 4H19A 4MGGA 2PPGA 4JN7A 2QJNA 3ZLGA 3VCCA 1FHVA 1PDYA 2DW6A 3MWCA 3UJ2A 2HXTA 5FJTA 1JPMA 3MZNA 2P8BA 4EWJA 4GYPA 3EEZA 2OQYA 3S47A 2XH2A 2GDQA 3CT2A 4K1WA 2OPJA 3OZMA 4IHCA 4ENLA 4Z17A 2RDXA 7ENLA 3ES8A 2GGGA 4HPNA 2OFJA 4IP4A 2PCEA 3RO6A 2GGEA 4E4FA 2AL2A 4DXKA 2POZA 2GGIA 3SN1A 3DIPA 4DN1A
chains in the Genus database with same CATH superfamily
4UQCA 2TYSA 1H63A 1W9BM 4LCRA 1PV8A 1IWAA 2JK2A 3U4FA 1L2UA 3MSRA 3EWDA 3WLHA 4MYAA 1JDAA 3FXGA 1SJDA 5HNNA 1ZB5A 1B4KA 1H3GA 3S5SA 1WV2A 3QW3A 1BRLA 4AHQA 4CQDA 5EBUA 4JTLA 3NQCA 1K7EA 4K7ZA 5CPTA 4DI8A 1M3UA 5BWAA 2GQ3A 1GRFA 1HJUA 3L4ZA 3N11A 3EMCA 4N9BA 1XS2A 4CN1A 1OD8A 4GC4A 3VOJA 3VINA 1HKJA 4E6MA 3SUVA 2FTYA 1GG1A 4UTWA 5AYYA 1BEUA 1EEXA 5HUPA 3KOFA 1VCGA 1CW2A 2WKGA 4Y8FA 4JIRA 1AW2A 2IW0A 5D03A 1ODUA 3G1SA 1OCNA 2VUNA 2EQ6A 4IM4A 2W3RA 3WF0A 4EMJA 3GLCA 1JJKA 3DUGA 4L6OA 5BW6A 2BMBA 3UG3A 4V15A 1SSDA 3HPFA 4BURA 3WJYA 3IAPA 3N29A 3SCVA 2VR4A 2D22A 4TMBA 4KEUA 5K7JA 3NQVA 5CZTA 4N42A 5PTDA 1NVMA 4FEZA 4Y6GA 1VP5A 1MZRA 3EWZA 3ARPA 1KM4A 2VRJA 5EMMA 1M6IA 3KCLA 4RUBA 2BB0A 1QNOA 1DKWA 3ZVHA 3DENA 1T96A 1FP8A 1HXJA 3CQIA 1H49A 1EWDA 2D0FA 1D8WA 4KEMA 3GHSA 3P84A 5IM51 2HZGA 5BXSA 1OGGA 2Y5JA 5D9MA 2NX3A 3UGRA 1V59A 2PDIA 1B5TA 1E9ZB 3VOGA 2O4MA 3V0TA 1R5YA 3WDIA 1BXNA 3U2EA 4N4QA 1OM0A 4PN2A 3NJ3A 3I4EA 1CB2A 4UFMA 1GJWA 1XIEA 3VDHA 1EGZA 3XISA 4IQLA 4C6KA 3M0KA 3SRDA 2JBMA 1R3TA 2VFIA 3STCA 1CWYA 2C3CA 2QCFA 3BV7A 3W70A 2XGBA 2HK1A 4OTKA 4TX9A 3ZMRA 1P4CA 1XLEA 2AKZA 6ALDA 1W1A1 1VKFA 3TZFA 4A8NA 5A1AA 2PB1A 4QJ3B 1LTDA 3DGBA 3LTSA 1YTDA 3FYYA 1J2WA 4J7RA 1OZMA 3CAWA 4YL2A 4RE2A 1UR3M 3OVQA 3URAA 5A8OA 2CFYA 2YGYA 1VEOA 2OZ3A 4IJCA 3B0YA 3DYOA 5XIAA 5BU6A 3FAWA 2ZZ5A 1T3QC 3RM8A 4CQCA 3EOOA 3WCZA 1FH9A 3EAUA 3KRZA 4GFIA 4HZ7A 3LBOA 3WQ4A 4M19A 3M0VA 4PL2A 4DAFA 3WH6A 2FVMA 4JHZA 3UR5A 4DWSC 3BG3A 3CXBA 1EJWC 4MM1A 1RALA 2J7EA 2ZRUA 5FAGA 5LHFA 1BGGA 2ZE3A 4NQ1A 1SO3A 1QI4A 5C5YA 4GYJA 3A23A 2JEPA 5DXXA 3E0VA 5ECVA 3E49A 4Q22A 3NO1A 3AZRA 3W4RA 3AMCA 2CHRA 1OX5A 3E0LA 4IIHA 4Q7BA 3QKZA 4BJHA 3S46A 3PTDA 5HWJA 1J4EA 1OY0A 1KXTA 2PFHA 5BWFA 4DRSA 3BAXA 3LN3A 2EPMX 8TIMA 3N6HA 5A6JA 4IH3A 1XISA 3EDFA 3IRDA 1V79A 1QPKA 3PB2A 4FHAA 4LA1A 1MUWA 1WAWA 5EMYA 1KRCC 2GVGA 3EEGA 2BY0A 4PMYA 2QJJA 2YZRA 4JIQA 5DT7A 2ZZ1A 1B3OA 5C9XA 3K8MA 1A50A 1DVJA 1AQ0A 5HMFA 1AH3A 1MZHA 2PWHA 3TWBA 4AEOA 1Q6QA 3OVGA 4BF5A 1DWGM 5A2CA 3QMRA 3UF9A 1PBGA 5K9DA 3S9ZA 4ZE4A 4UFLA 2WJFA 4XD4A 2JQXA 4GI6A 3KWXA 1AW5A 2YDAA 3MUIA 4M29A 2WBKA 1BXCA 1FOBA 4L6HA 2H3BA 3I10A 4X22A 1EDQA 2PF0A 3LBMA 1W32A 5IFTA 3AZSA 1LWIA 3G3MA 4WLCA 1QK2A 1ZZMA 4JHMA 3GKAA 3AZTA 4LBUA 3SSZA 3H54A 1RHCA 2PE4A 3EPOA 2V6AA 4YWSA 3HBLA 4GIYA 3O6DA 2X09A 1FRBA 4QDPA 2NLIA 3W7KA 1UC5A 3IARA 1OB0A 2PDLA 1GHRA 1K1DA 2ABBA 3B8IA 5ABHA 2AQWA 5AHMA 1REQA 2QYGA 3NVYB 4OOZA 4DNHA 1JNDA 1MFUA 4P7LA 5I7GA 5HQMA 1FHVA 1WDSA 2DW6A 1EWEA 2V2CA 4CCZA 4ZOHB 2ODOA 1HJXA 5BU9A 1XI3A 4EWJA 2BP1A 4HNVA 2AAQA 1RJPA 1EJTC 3NTYA 3EEZA 3BMVA 3UPBA 3NQMA 1W37A 1XLCA 4E2VA 3M44A 3V0SA 3SR6B 5G1MA 1LJYA 3GNPA 1VPQA 3GXDA 6XIMA 3TA9A 3GTIA 3DFTA 1W3IA 1WXYA 2WQPA 1XL9A 4IHCA 1SMDA 3LUTA 1RD5A 1Z42A 4ENLA 5T9BG 1VEMA 3GS6A 4D6FA 1CCWB 4N7QA 3LSBA 4AZCB 3CEUA 1HG3A 5HINA 1GYNA 2OFJA 4I5XA 1SR9A 3CMJA 3S2JA 3WDJA 2ZZCA 4HMEA 3EX4A 4IQJA 4AIEA 5IHRA 5LHEA 3GDRA 2GGIA 3KHJA 2YL9A 4DN1A 1TQJA 3EWCA 1DEDA 1TJ2A 1P0DA 3DK9A 1Q5MA 1ZHAA 2YPIA 1EIBA 1YNPA 3RX4A 1IEWA 1RY8A 4XK2A 1FTXA 1T7LA 1CYGA 4K36A 1PCKA 1OC7A 4UUIA 5A94A 1CLVA 1E4MM 1VJSA 1QO2A 5JRBA 3FW6A 1EHNA 3OA5A 1WUFA 5HULA 1GK8A 2HDJA 1T40A 2YLLA 4ZE5A 1LL7A 4IZGA 1OIFA 1AA1B 1LROA 3SN0A 5AHEA 3LRLA 1UWIA 5FACA 3VIIA 4IG2B 4PUMA 2GPTA 4H9YA 1HQTA 3RR1A 3STPA 2C91A 2R14A 4YCPA 4E5TA 3DBPA 1TVNA 2V82A 1E9IA 3WLJA 4D8LA 3MJMA 2Z1WA 3MA8A 3AMLA 3VIGA 2GJRA 2NT1A 1SO4A 4ILSA 1MQRA 2EG8A 2VEGA 8CGTA 1K8ZA 5I02A 2OQHA 4PTNA 4REQB 2P3ZA 3L4XA 2C3ZA 3IIZA 4AUBA 3CWHA 4HTBA 4WR3A 4B5WA 3ATZA 1S5NA 4AD0A 4EF8A 2PLMA 1TV5A 2CWNA 3UWZA 4UTLA 2A7PA 3GNRA 1Q66A 2Q8XA 2J7BA 4IXXA 1R8LA 4U5IA 3OW1A 2Y1HA 4KFOA 3W1XA 2O92A 3VGDA 3RFAA 1G4EA 1CB7B 1M7OA 4IIDA 3GWQA 5BROA 5G2IA 4O18A 4I9TA 3QV8A 4YS1A 3S2CA 2X2YA 2Z1BA 3DYPA 1GPWA 1JROA 4JS3A 5A6SA 1BYBA 9XIAA 4HPGA 2DVXA 3WBXA 3QOKA 5I3KA 1EDGA 4QROA 4E2DA 1YPIA 1VBRA 1SPQA 4OFCA 5BXRA 3URQA 4A05A 4JTSA 2W5FA 1M1BA 3FKRA 3WH7A 2VCCA 4O1AA 1VYPX 3N2CA 4NZ1A 2WOVA 4JDBA 3DEQA 2HNEA 3BUVA 1RJQA 3N4EA 4US6A 1V51A 3SECA 3BOXA 3D5HA 4FNSA 2NQ9A 2H9AA 3OVPA 1TIMA 3G22A 1QVBA 3W71A 3DZ1A 3UPMA 1GRTA 9RUBA 4ZQNA 1ZDLA 2WP6A 3AWNA 1HJQA 4M1BA 4YHEA 4XIMA 1TVLA 1ZNNA 2X30A 1YHTA 5ABFB 2IQDA 3CZJA 4I5RA 3VAVA 1XCFA 4ZO9A 4DVOA 4LAKA 3GO2A 1F2JA 2YVJA 3E9AA 5LA1A 2F7FA 3TMLA 3W02A 3GU2A 4W93A 5T9CE 3UA3A 1EC8A 3HQ1A 3K30A 2WKLA 3FAXA 4D71A 3LXDA 4GVHA 3DHFA 2FH8A 1PYFA 4AD5A 2VURA 5DQPA 4GBUA 1LDCA 4WZHA 2Q3OA 3M43A 1EJXC 5AC8A 3VCRA 1B0IA 4XZWA 5GPRA 5SWUA 4GJ1A 4AWSA 3N1AA 3C52A 1F3PA 3AMDA 4J40A 1F8WA 3A7AA 3ZT7A 2NVCA 2Y5EA 4NEVA 2V38A 2CBVA 3VGHA 1F61A 4V27A 3CV1A 1W3JA 1TTPA 4NSBA 1JZ6A 5H91A 3QFEA 1GVOA 1M04A 2O7SA 1ZJIA 2EPKX 1N8FA 4C65A 5BMXA 2WJZA 1G5AA 1OCQA 3H6OA 3A3HA 2PP1A 3CXOA 4Z42C 4WDXA 3CNYA 1RM6B 2KZHA 2YXXA 2XIIA 4BWLA 3DG3A 1H6VA 1UD6A 1S1PA 4OT7A 4O57A 5C9WA 1JFXA 3KS6A 5EKYA 1OZQA 1B9ZA 4IUOA 3BLEA 3TYBA 2QXWA 1GOQA 2VX5A 4X61A 4ZQCA 3N17A 1UA3A 1VJZA 3P0WA 3R43A 3VNKA 1GV4A 1QWKA 3A47A 1Z32X 4CNPA 4H00A 3OLDA 1QTWA 3S8HA 3VVGA 1GESA 4NF7A 3VOFA 4CNNA 3EDDA 1FUYA 3AS1A 4PUWA 2J66A 3M5ZA 5KVIA 2Y6ZA 4F8XA 4TIMA 5A6LA 1S5MA 2E6DA 2VC7A 4MB4A 2Q8LA 1AZ1A 3N3TA 2E6AA 3L5OA 2WOWA 3QLLA 1ZFJA 4O19A 1ELSA 1LBLA 1TJ0A 3UBPC 2CZVA 1QBBA 2A3BA 1LM1A 4QS5A 3DFNA 3ITTA 1UZHA 1K8CA 3HPSA 1JYVA 1GERA 1GVRA 1D9EA 1JRCA 3R8GA 1P6WA 1HUVA 4XIAA 3CMFA 1G67A 1UWAA 4WJEA 1K03A 1ICQA 5HQLA 1MWOA 3NEVA 1J5SA 2I57A 2Y7EA 2QCDB 3BAYA 4JN6A 3EX2A 3CT2A 1QAPA 4QG8A 1X7IA 4CUCA 3HJZA 1EDTA 1KGWA 2XINA 3QPZA 3GYCA 3VDBA 2V3FA 3ABOA 3NQDA 2WZMA 3FVMA 1VHNA 3LCHA 1YE6A 4DJFC 2YAUA 3QC3A 1VPXA 2DVTA 4N2YA 3SCNA 1AOGA 3D3AA 3WEZA 2WM1A 3HGOA 3M6DA 4QQUA 4Z2GA 5DBTA 3MO7A 5L6UA 3CZKA 1KXHA 4S23A 5HR7A 5FF3A 3UCCA 1EJ7L 4GXWA 5LZLA 4MAVA 3QSRA 2ZX8A 1GVYA 1V3IA 3CZEA 3V1HA 1KN0A 3HMJG 4RNFA 3BG5A 3NVDA 4WJXA 2DUAA 1NEYA 2D73A 3ISIX 3U2OA 2DZPA 1P6CA 3S83A 3QC0A 2HS8A 2C14A 1O1ZA 3KDNA 3L65A 1C93A 3BSHA 3G8RA 4EQXA 1HJVA 3ES7A 1R38A 3DHDA 4FO4A 4BHYA 2QUNA 2POTA 4EPDC 5CC7A 4HYVA 4HMDA 3LHVA 2UWFA 4MUPA 4NXKA 4O1CA 1J01A 2WHMA 1XYLA 1MXDA 1SU5A 2NXGA 5C71A 4PUJA 3UEQA 2E68A 1KFBA 4G5DA 3T2QA 2RHGA 4HNTA 1TPUA 3NSMA 3RHGA 2EEXA 3GC4A 3KFTA 4JFUA 2FGZA 2GGJA 4PFMA 3SEPA 3PTQA 4AF0A 4KWWA 1AMKA 4L61A 5IOBA 4NY2A 3QVQA 2HRWA 2XUCA 3QRHA 1UUMA 3ABSA 2DFAA 3WH5A 4EAYA 5LGZA 4KEVA 4H6RA 3WNKA 1XW8A 1TZ7A 2WMHA 8A3HA 3R7MA 1KC7A 2ZRXA 2C71A 4LNYA 1ZBWA 4WUIA 3PBVA 1IEVA 1R9YA 3CBWA 5EYWA 3IGXA 3MUY1 1YADA 1V5XA 1M41A 1IHIA 1IYXA 1JDCA 1GNXA 5U25A 3GAKA 3PZNA 1KCLA 4S38A 3LDVA 4J56A 1WDDA 5DY3A 3TIMA 1TR1A 4N9DA 1EA9C 2V3AA 3INPA 1WYIA 5FS6A 3EZ4A 1BRLB 1WUEA 1HJSA 3WNOA 4YLWA 1E1EA 4Z0SA 2XG9A 2GVEA 4H8HA 4FI4A 4NNAA 1GTHA 1SO5A 3NM3A 3PJXA 3TQ0A 5LNVA 2E5AA 5GJMA 4Q6XA 4XQ6A 4IOTA 5E93A 3VIJA 4UFKA 3AN1A 5AN7A 7CGTA 1XFBA 4H50A 4M6UA 4XVDA 1H50A 1S5WA 3PBMA 3OZOA 4KS0A 1UKTA 4YYCA 3O0HA 4CNTA 3M0LA 2WBAA 3MC5A 2X0SA 2Y4SA 4ROPA 3SZ8A 4IXHA 1L0PA 2D2GA 3CTLA 1C92A 2GRTA 4LUIA 2WPGA 4YN5A 4GZEA 1UMYA 1CDGA 2INFA 3THUA 2VVSA 4J5NA 5DO8A 2PDMA 1JCJA 4S3AA 4JTGA 2Z7KA 4QCEA 2GVLA 1CGTA 1Z89A 1KXVA 3TTYA 2JKAA 2ZX5A 4AHOA 4HN8A 1LG1A 2I1OA 3TSDA 2LLEA 4QG9A 5EBKA 2I9UA 5JCIA 4A3RA 4AZ6A 2PDQA 4MYXA 4W84A 4FR6A 4J57A 3ZVHB 1LORA 3EOUA 4ACYA 1R85A 2XPKA 3VKJA 2BBFA 4W7WA 5E0CA 4PTMA 3F1QA 4HPXA 1PJ9A 1U33A 3JVAA 2Y88A 3GNDA 3CQKA 3MQTA 1IEXA 2BX7A 3PWIA 3QQ1A 2WHJA 5CXPA 3B9NA 2FYMA 2HPMA 1M03A 3ZVIA 2O9RA 3LB0A 1TPH1 3P0XA 1EJVC 2DIEA 2BDQA 1Q45A 1XCWA 4TR9A 5F4SA 4AWEA 2DT3A 2XVGA 4QHRA 3WJSA 3K4DA 3WD2A 4NG3A 3ITLA 5G5HB 3K1GA 1E6QM 3LHWA 3OA3A 2QAFA 1XGZA 3U4AA 3C2OA 3FJLA 1NQ6A 4AY7A 2Q6ZA 3EB4A 4MLJA 3GXPA 4O14A 3LK6A 3NZQA 3NVVB 2ZRZA 3PFMA 2ISSA 4M1RA 1TB3A 3ZFHA 4HA1A 2NX9A 4WY0A 3A24A 4EQWA 4JEQA 2EKGA 4ORMA 2QMKA 4RK8A 4J35A 1Q4WA 2EGZA 1W9XA 1NDZA 1TWWA 2BC0A 1M01A 3GDKA 3GG1A 1HO4A 3L2LA 1W3HA 4P2VA 1S39A 1X8FA 3UETA 3E0WA 3PZUA 3HN3A 3M47A 1RCOB 4EAMA 1MRAA 2X1IA 2QDEA 1VLIA 3AIRA 3N9SA 2EPHA 2VFDA 5DEZA 2IPJA 2ISVA 4KH2A 4HK6A 3AI0A 3BCDA 4AYSA 4G56A 1LLZA 6CGTA 3BV4A 3VX0A 3ITOA 1PAMA 2VVNA 3EKZA 2NX1A 2OVLA 1JYNA 1QW9A 3JUGA 1DQXA 4P7RA 3ZT5A 3GNOA 1GORA 2J8TA 1QBAA 1POJA 2EF9A 1GXFA 2DEPA 2PC8A 2WANA 5CPQA 1R87A 1XXXA 3W2NA 4DHGA 2F6KA 2ZTJA 4QSHA 4HPJA 3MT1A 3EPMA 4WDWA 2VX7A 3K46A 3H2FA 4JTRA 4JX4A 1PDYA 3CGBA 1QO5A 1KQZA 1DJQA 2IMRA 4CU8A 1OX6A 3DGZA 5FEZA 7A3HA 4LF2A 3TC3A 3K8LA 4QDMA 3FOKA 2R9ZA 5IXEA 2QGHA 3IGUA 1V3MA 3NZ1A 1UWSA 3AISA 5KZEA 4OGZA 3A4WA 2PF8A 5KZDA 3E0IA 4MDPA 1A53A 7ENLA 2DSWA 3AIQA 1ZX9A 3POHA 1VFMA 1O5XA 3A6OA 4XD3A 4MFDA 1DJXA 2Z4GA 1XQLA 4O4VA 5CGTA 3S5ZA 2GGEA 3B9JB 1SR0A 5JMUA 4ZXOA 4QJ4B 1FCQA 2Q09A 4YCOA 5A95A 3NQ6A 2XZ7A 2ALDA 2VC6A 4IPJA 3S5YA 3ZR4A 3UZXA 3MYPA 4UQAA 4PZVA 2BXYA 3HV8A 1M65A 4JY8A 2VGGA 3GRIA 2E7FA 2C6QA 4RW3A 5HWMA 4HKPA 4Q32A 3S1UA 4LWWA 2CWXA 4IGMA 2EO7A 4Z1BA 1FH8A 3CZGA 1REQB 1GEHA 1KB3A 4JL1A 4MVAA 2CESA 1JXKA 1WZLA 1AD4A 3ALFA 4PUEA 3VDGA 3SUWA 5T91A 1HKMA 4KCTA 3S9IA 3WELA 3GSMA 2E9LA 3W7QA 4FXSA 4WK9A 2Z6IA 3CGEA 5FJIA 4UOQA 4UR8A 4A3HA 5FCZA 1UH4A 3A64A 2DY3A 4DPPA 5D38A 5FJPA 5HWNA 1A4LA 2DIJA 3WN6A 1IT8A 2RGMA 4MKNA 4HYRA 5E0FA 2CLLA 2XWEA 4R7JA 2A6LA 4WHBA 4IP7A 4KF1A 1E1CA 2ZA2A 4DYEA 1KD0A 2H90A 3VILA 1NPXA 3HV9A 4UBPC 4H41A 2WC3A 3BURA 3PZ9A 4ZB5A 4IJBA 4LALA 1U1UA 2YA1A 3QFBA 3N34A 2JFEX 2CLIA 1JDEA 1V3HA 1WDPA 1MXSA 1M9HA 1OF8A 4P8XA 3QTGA 1X1OA 3G1AA 2BVYA 3UR7A 5CPOA 5C0QA 2G96A 2XJ7A 3PWGA 1T8QA 1FP9A 3OG3A 3MU7A 4H83A 5LXEA 2FMNA 2X05A 2H8XA 1E73M 4UTKA 3LXBA 1BSIA 2A21A 2OB3A 2FKPA 3IIVA 1EA0A 3TZNA 1U5JA 2VZOA 5LNWA 3EA3A 3DK4A 5GRTA 1SMAA 2C8NA 2A4AA 3MSGA 3WMSA 1UWTA 1WX0A 2WJEA 3KS5A 1LLOA 3PP7A 3PNZA 4HZMA 3DJGX 4IF2A 3V35A 2CYGA 1NM9A 2NZLA 4PA8A 4JICA 1K9TA 3W27A 1ISYA 3UY8A 4AAJA 4XZMX 4F9JA 1OC5A 1UD5A 3ARRA 1UKSA 2BODX 3C0SA 1SUXA 1UR4A 1JZ8A 2A3AA 2QT3A 2PTYA 3W2JA 4AZHA 1XX1A 3W7CA 3F5LA 3EOLA 4D8ZA 1PKLA 3AROA 2WPEA 4NJGA 4IGNA 4RV8A 3ABXA 4LB4A 3RJXA 3PZOA 4GYPC 3WFLA 4RNHA 1KM0A 2VRKA 3GC5A 4GPNA 1XYCA 3SGZA 3G5EA 1YTKA 4M0XA 4B5UA 3S5OA 2A5HA 3IJ8A 3HGRA 4GWEA 3AYRA 1TRIA 3AU6A 1DOSA 3W82A 3UZZA 3ITXA 3EB2A 1TKKA 4J2MA 4IIBA 1LUCA 3VYLA 3CQJA 5F2IA 3B3DA 3JR2A 2Z1KA 1EP1A 3BJSA 4LCSA 4PUNA 1RVKA 5EL1A 4F0HA 4HN4A 4NYUA 3CPGA 4FNTA 4LEFA 4U2ZA 4MJMA 1Z8AA 4B3LA 2FHBA 5DMNA 3QBUA 1VR6A 3PHAA 3WLRA 1YRRA 4HQVA 1PWMA 3NWRA 4HNCA 2YVGA 3H2NA 4ES4A 1GRAA 5CSRA 5KINA 5CBJA 1TPEA 1W3KA 3UJRA 3THQA 4Z1CA 3VE9A 3JS3A 2WHLA 2H9AB 3T6CA 4UR7A 3GH7A 5BOFA 4C6QA 1JZ4A 4FLRA 3T05A 3TNBA 2XH4A 3TA6A 2HPIA 2G50A 3SSJA 3OYZA 1CI1A 1ZAHA 1G9HA 2NWRA 3PUGA 5HDRA 2PAJA 3GG7A 4YJ5A 3SGUA 1NHQA 1TG7A 2PTXA 1JUEA 2GQ8A 2A7NA 3DHUA 3FDKA 3M07A 4LIIA 2QUTA 1Z44A 2PGFA 3L4YA 4KERA 3UJFA 1E0VA 5JQ9A 4AIBA 1TV7A 4DEFA 3MTWA 1G01A 4OU1A 3VC6A 1CXKA 1FWEC 3I6RA 2VT0A 1JPDX 2OWWA 3LX9A 3SGGA 3ALGA 4UOZA 4MNLA 4IMGA 3WF4A 3KE0A 4AYGA 2YJQA 4GI8A 3VFLA 3M5XA 2J6VA 3GU1A 3GH4A 3GFXA 3CV7A 2V5JA 2VDHA 1Q1RA 4DWSA 4W8AA 2F84A 3QFWA 2TPSA 3W23A 5CAKA 1GT8A 3KL5A 3HPAA 4HZ8A 3WD3A 3NRZB 3OBKA 2Y8UA 3G1RA 2IPGA 2J78A 3R6IA 4M8UA 3W1AA 1P1MA 1QHPA 1R2RA 4HNOA 3QY8A 3SUTA 1JZ5A 2ZCGA 5C9ZA 3PBGA 4JCMA 1SYTA 4RL3A 1X1NA 3TXVA 1KTBA 3ES8A 3G1VA 2X7VA 1UROA 2CIPA 3ZR6A 1FWJC 4US5A 2E9MA 2WM0A 3UR8A 1P5BA 3VMNA 4DO5A 4S3DA 4Y7EA 2OSWA 1EGVA 3RPDA 3TU9A 3MMWA 4PMRA 2V9DA 3CUXA 1ZRQA 4PBEA 2DSVA 1ISXA 5BRBA 6XIAA 4BQ5A 2I17A 1YXYA 2XIMA 4LY8A 1HT6A 3GDTA 2V5DA 4F2BA 4X60A 1FFUC 5AKQA 3WJWA 1TWDA 3NFUA 3EMZA 1CX9A 4JIIX 4M81A 1XGEA 4QNWA 4QITA 2G37A 2WAGA 4NI3A 3ERPA 1RA0A 4WSJA 5BZAA 3PZIA 4LXFA 2VOTA 2V8ZA 4KCVA 3DC0A 2QUUA 3HPZA 1UWRA 3RPTA 4GD0A 4HMCA 5H8MA 1FWTA 1KGXA 1RY0A 3W7EA 4LF1A 1SZNA 3HFTA 4H8NA 4F9DA 5DFAA 5EFFA 3USBA 1BTCA 1RA5A 4AU0A 5G2HA 3V18A 3DGRA 2ZC8A 3ARTA 5D2XA 4ZB2A 1JQVA 2CC0A 3WH8A 4K39A 2E6FA 1NY1A 2WVVA 3U2CA 1KO0A 3AQUA 2CXEA 2TAAA 4MZYA 3T8LA 4M82A 1FWIC 1PX4A 1DTNA 4CD7A 2QDDA 4QLLA 3LCGA 5BRPA 1E0TA 1YDYA 3ARXA 4RDZA 2OYLA 3ENLA 2BCPA 3KL3A 5EBAA 2QJIA 3A5FA 3BXWA 3HOJA 2VELA 4A8RA 2JEQA 3OGSA 1QW7A 4DZHA 2C16A 3WFZA 3LV5A 3DU0A 1FWCC 1JEZA 4QIUA 5A8NA 1KR1A 3FJ4A 1QXLA 3PZVA 2QCLA 1KM1A 3TP4A 5F4XA 3LPPA 3WLTA 3U3HA 1J11A 2J88A 3FIGA 4HHPA 1I9CB 1NF0A 3L5MA 4MZ1A 4C6BA 5C7VA 4MADA 2V81A 4JEJA 4D72A 3NM1A 4Q4QA 3TJ4A 1H4PA 1E4IA 1KBBA 2EHHA 3OLGA 5C2XA 4G7EA 3W7RA 4XZIA 1VC4A 1XIHA 3GX9A 5HMDA 2AGTA 4QQ3A 4JR5A 4WKHA 5HAOA 1IXOA 1WBJA 2REQA 2V2DA 2VM8A 1O95A 1T8XA 4E0CA 2ESCA 3QHNA 3WD0A 3EX1A 1SFSA 1D3CA 2E28A 3GU9A 4AF0B 1O5QA 3SI9A 1UYQA 2NV2A 4HCLA 4ADUA 3H12A 4I3GA 1W8SA 4PUDA 1Y5WA 1OT1A 1CT5A 5KETA 3FDGA 1E40A 1DIKA 5CZJA 3C6CA 5FF7A 2YQUA 5CSSA 1VYRA 2P50A 2Q3RA 3ANYA 4U4MA 1C9WA 3IIPA 1XD0A 1W5NA 4O10A 3W85A 3K13A 1YPFA 2RDWA 2NLYA 3THDA 2C1HA 2BWGA 4HHLA 5AVNA 1AQFA 2GJPA 4WD0A 3VNIA 3NL3A 5BXPA 3VFCA 4LBSA 3XINA 2ZZ6A 4DX3A 4S3BA 1TPFA 4XO7A 2J8FA 1E6SM 1XWYA 2OQLA 5A6MA 3MMUA 4CD4A 2E5CA 2VGFA 1US2A 1KR0A 2WPFA 2J4GA 2BZNA 2QVNA 2WZIA 3CHEA 2DT0A 2PLJA 1FX6A 4IL0A 1HP4A 3MSYA 1ME7A 3G0SA 3T4CA 1WDRA 1RP9A 3AIWA 2OKTA 4MB3A 4KCUA 1QNSA 4FB7A 3QSTA 2XGZA 1DV7A 4Q8UA 4GUFA 1K9EA 3ELFA 4JQ4A 1EOMA 4ZOEA 1QI2A 2VCAA 1AL8A 3VKBA 3B8SA 2VP8A 5LIKX 3VO0A 1LQ0A 3LZ3A 5A5WA 3NVZB 2VFGA 4TU1A 4EQSA 1IR2A 3K5XA 2MUCA 4FOUA 2J62A 5JCMA 4LS0A 4ZOCA 4AWUA 1EYEA 1B3YA 5I24A 2R6OA 1W1B1 4TVWA 5HBFA 3REQA 6PTDA 4ZVJA 1DJWA 3F4VA 1GVEA 1THFD 2GOUA 5HJXA 1HKVA 1E4LA 5E0KA 3LADA 3PWAA 4RPPA 4YPJA 2XU2A 2BGNE 4KFNA 2WCSA 4AC7C 2NUWA 4JDYA 3P7YA 3I3EA 1DIEA 3WZ0E 1AJZA 3QXBA 5HXMA 1JR1A 3IANA 4KW2A 1LQAA 4QCFA 1FXPA 3U7BA 4TV6A 2Y0FA 1E51A 4MGGA 2OEMA 3BARA 5AVHA 1J6PA 3FG2P 2ZXBA 1KGUA 1F76A 2ZKMX 3LHUA 3C0JA 3BTNA 1OFQA 3DX5A 1E3XA 1KM2A 2J9ZA 4A29A 3G0UA 1QI0A 5D33A 3B0PA 2RJGA 4RDWA 2ZA3A 3QGKC 3WBYA 4HU8A 2GDQA 1XLDA 3O6YX 4WSKA 1U1HA 2TMDA 4WY0B 2DZXA 4GNJA 1PWLA 2ZUVA 3C4UA 4A21A 2QR6A 2F5ZA 3ZT6A 2Y89A 4I7VA 3WLPA 1P0BA 3QMTA 1MQQA 4Y90A 4GCAA 4HB7A 1WKDA 3AXHA 4O54A 1UKQA 1QMLA 2WNZA 4IP4A 4PGLA 3SDOA 3NURA 3TJXA 1PZ3A 4GNVA 5GNZA 3V7PA 2YCJA 4H2CA 2NVAA 3T0CA 1VJIA 4B3ZA 5G4WA 1GONA 1FXQA 1XKYA 5C9RA 1J0HA 3R79A 4UFHA 3BSGA 1NAL1 2ZX7A 2VEPA 5A8GA 1TE6A 4TTUA 1EQPA 5GJNA 4DYKA 5BYWA 2Z6JA 1RJRA 3TQVA 3H4KA 2IKGA 1E15A 3IV8A 1Z69A 3I7RA 2GFTA 3PBWA 3PPFA 2YVFA 3DESA 2VEFA 3BZGA 1S2TA 1QOXA 1VFOA 2PDUA 1GPFA 2ZVIA 4JQAA 3LXCA 4H4SA 3BW3A 3DC8A 3Q2DA 1EC9A 3WLKX 3D46A 3R12A 4ICNA 4JQ3A 1B3XA 1MEHA 3C0QA 1H0GA 1GOWA 2FJUB 3QZAA 1K8XA 3KBVA 4AMCA 3ME3A 3W7NA 1EJUC 3GXFA 1HW6A 1E6RA 4GUGA 1YEYA 4E2BA 3FJNA 4C7DA 4RX0A 5I6SA 4A35A 3HG5A 3AUJA 2R1PA 4N02A 3F4DA 3KRSA 3GG8A 3FEMA 5BNKA 2HQAA 3W7PA 2J7HA 4JHOA 1OHLA 5E9AA 5CBBA 5IRPA 2EBNA 5LA0A 2IQTA 4EPBC 1GKPA 1G4PA 1L9WA 4PMUA 3KOZA 5LSMA 1XP3A 5DN1A 3NGJA 3GAYA 2WK2A 3CT7A 2VZTA 1I0BA 3PANA 1W1TA 3K8KA 4JFVA 2ZRVA 3GB6A 1Q8AA 4NZ4A 3L67A 3SCWA 1GG0A 4R88A 1L6GA 3BCJA 3VIPA 3BJFA 2Y63A 1W6TA 2MNRA 2QIIA 2CZDA 4FX9A 3FK4A 2HTMA 2BTMA 1DIDA 2I5GA 3WJZA 1D3HA 5LIWX 3SADA 4A2RA 3F4WA 3UXLA 4DJFA 4M56A 3VCNA 3QGVA 3MO4A 3IJLA 4LTSA 4W8BA 1QPOA 2D0HA 1K77A 5BMWA 1UP2A 2D23A 1A0DA 3C86A 5CPLA 2QUMA 4E4UA 4G7FA 5D2VA 1XRFA 3LCIA 1UIOA 1H0IA 4K8GA 4IX2A 4C6FA 2W3ZA 1R7OA 3HU7A 2DZAA 4ZB0A 3W07A 2PUZA 4E8CA 4H3DA 4ERIA 4MG4A 2PDPA 4CD5A 1LLWA 4GCXA 3UU0A 2WVTA 1NARA 3A3WA 4O0ZA 2X1TA 4P8VA 2ZE0A 1DYSA 3DERA 4HNLA 3SUUA 1UD2A 5K3VA 4MUZA 3N4FA 1E1CB 2VC5A 3SQSA 4JKMA 2CERA 3GBDA 1UH3A 4IQDA 1SO6A 2QDGA 4Q8QA 3VA8A 3U7VA 5D2TA 3U9IA 2WSQA 4L80A 4DJDD 1XM3A 2CBUA 1ML1A 4D6HA 2ZDRA 1FWSA 4DJED 5L9FA 3OQ8A 2ZZ2A 1X8CA 2NXIA 3GM8A 2ZZBA 1Y5XA 4XZ9A 1TPB1 1C8QA 3FCPA 4O4WA 3HG4A 4LVAA 4ZOAA 4FAMA 5GVJA 4LC6A 5CEWA 3CPUA 4MWAC 1KFKA 4ZCWA 1UR0A 2XVNA 4O1FA 4MNKA 2J27A 3TSBA 5D8WA 3VM5A 1CENA 3FYOA 1BGAA 1A5BA 1VRXA 1F07A 3TW9A 1H1NA 3LMZA 1E71M 3T7VA 4GUIA 2X99A 4PCNA 3UWYA 2J7FA 4LQ1A 1Q2SA 5TAOA 5GNXA 2I16A 4JYEA 2XSAA 4IQEA 3VGBA 2HJPA 1TZ9A 4XUGA 5ABEA 4NJJA 1EBHA 3W29A 1LL6A 1R3WA 1V4YA 4H7VA 4AD3A 3SRHA 3HPXA 4I9JA 3M9YA 3F2DA 4CQ8A 2PA6A 4H4TA 3N19B 4OV4A 5H8PA 1B90A 4HU3A 1PXGA 4ZQRA 4ZFMA 4LUSA 1TMLA 4Z2LA 2J9XA 2DP3A 1KFWA 1OFPA 4AZ7A 3LB8A 1WKFA 4GE8A 4B92A 2BASA 2FZDA 2YB4A 4O16A 1ZBKA 3UVAA 2WZHA 1ITXA 2DZUA 3HTWA 2XFRA 3SM0A 2J7DA 4W8LA 5F2GA 2BHYA 3DI0A 4DBEA 4U33A 3CHCA 1H41A 5E09A 1RZMA 4DXVA 4NL1A 3LGEA 1FDZA 1XRTA 4NKCA 3D0CA 1EF2A 1I2PA 2QPUA 1A0CA 3BW2A 1LUCB 4B3KA 5G1YA 1AJ0A 2J24A 5DRIA 2O55A 3CAQA 1P6BA 3VD3A 2PS2A 1TFVA 1BYCA 4YHGA 1WCGA 1SZRA 2A1YA 1ZJHA 3MV11 2RDUA 2FDMA 1GYMA 2JKPA 5I03A 3B40A 3NQ2A 4AG0A 4PCPA 1F6PA 1WZAA 3TN6A 1V6UA 4GLEA 4H7CA 3IVTA 3NL2A 4NIRA 3OZMA 2ZUMA 1M7XA 4HD5A 4W4QA 3MUXA 4ZSUA 2XYLA 5H6HA 3BGAA 4IIFA 1K6WA 1IT0A 1TVPA 7REQA 4P8UA 2O0TA 4MJ2A 2RH9A 1RQBA 1A0EA 1C90A 2G41A 3AXXA 1XLIA 4TX8A 4BI7A 4AZIA 2DT2A 3WY1A 4ERAA 1HX0A 3G1DA 3WDPP 1OWQA 3R8RA 1WDQA 2ZBTA 3GTNA 2W63A 1A5NC 3OIXA 1H5YA 3FHAA 4XISA 2WMGA 2GYIA 3L12A 2BNJA 2OEKA 2OELA 3IV3A 2X1SA 1LRQA 2XH7A 1EZ2A 4OIFA 1QATA 1XPYA 1X98A 1K4QA 4U3AA 4DUXA 2HXUA 4KWSA 4UQ9A 3CGTA 3NS1B 4HYWA 1R86A 1PTAA 4BKNA 4S3EA 4UNKA 4IWWA 3HB9A 3O6CA 3LHYA 2OXNA 2EG7A 2ASHA 2OMAA 4ADTA 4DWSB 4HP5A 1NFPA 1O94A 2PTZA 3OPSA 3E5BA 2X7WA 1O68A 1P43A 3RDKA 1FY6A 5FSEC 3MKCA 3W2KA 1I2NA 3SQPA 1R6WA 2G3FA 2BSLA 3Q6JA 1NWUA 3DH7A 3RCMA 3T81A 1VFTA 2CU0A 4B9YA 3MZ2A 4A3YA 5D9PA 3H22A 1N63C 4R3UA 3UP8A 3P8IA 4RE0A 4YIWA 4X63A 4IFOA 1QNPA 2V2HA 5HK4A 3MJYA 2EPLX 1FFQA 4D6DA 2JK6A 2C3DA 1MNZA 5M3WA 1UUQA 4BCEA 3LY0A 2WMKA 1BTMA 1NWTA 1VYSX 4DM2A 4G6CA 2B7OA 2J7CA 1UA7A 2VEMA 2D1ZA 1SJBA 4GVIA 2P8CA 1A3XA 2CHOA 4RNJA 4XD6A 3DH9A 3VKCA 4PMQA 3BICA 2RKXA 4EPEC 4H4XA 3O8AA 3N4AA 2DSUA 5CC6A 4JBRA 3AHTA 2PLKA 3POCA 4Q4PA 4CCDA 3DDMA 3FV9A 3O2LA 3N12A 1J8VA 1H09A 1TA3A 3NNTA 5I23A 4M52A 3UXIA 4HGXA 4DIAA 2HQMA 4O0KA 2OWXA 3CAVA 1W5MA 3H2OA 1J0ZA 5TR3A 3RAOA 4B5TA 5RUBA 1S5TA 2WVVB 1W9UA 4A4AA 4JTKA 3JZUA 3PZTA 4JDRA 4ACZA 3QPYA 3MHUA 3GXTA 1JUBA 3R0KA 2ADAA 4H8VA 3GQYA 3EOSA 1FKWA 1UB3A 3WYZA 4IICA 1SGJA 1HL8A 4QAIA 4K3ZA 1OQFA 3R13A 4M6PA 5EA9A 2CETA 4GO8A 3WL0A 4YTQA 2D3LA 2FZNA 1MEIA 2BY2A 2W27A 4Q8TA 3E2VA 4P7NA 3R1ZA 4NJKA 4AZBA 5CJ5A 1JD9A 1J2BA 4BI5A 3WNNA 3J7HA 4EMWA 2OT0A 2VR2A 2ZIDA 2P0IA 1JAKA 3ZWSA 4BEUA 3W1RA 4PSRA 5TF0A 4Z2HA 4D9PA 1WOBA 1FWFC 5CLTA 3MVTA 2JE8A 2Z27A 2ZUNA 2FB3A 2PDHA 4X9YA 1WYGA 2D2HA 3G18A 4O13A 3IJ9A 5FIPA 2G8ZA 2R24A 3E0FA 3BZJA 2V3BA 3TX9A 1J9YA 1OG0A 3CJPA 3TYUA 2PGRA 4G7EB 3FYPA 1R2TA 4XZHA 3N2TA 4HSNA 2DGAA 1F3WA 2DQWA 3A13A 3MSDA 2REQB 1NDWA 1JZ2A 3FHQA 2NVDA 2EPOA 4A22A 3UJSA 2E8ZA 1WKYA 3E2QA 4JNYA 1NELA 1TQXA 4JN8A 1LOSA 2BGQA 4LW7A 3T2PA 5TD4A 2Q71A 1ZJBA 3QR0A 3CASA 1A5SA 2BOEX 3VX1A 2W67A 6REQA 1RVGA 3B9EA 3SRKA 1MOKA 2E1WA 4PRWA 5FJUA 2WWDA 1FWWA 1A3WA 3CC1A 3HQOA 2VDGA 1OG6A 2RJHA 3SFWA 4N4PA 1PCWA 3D47A 1VQZA 3TJIA 3LI0A 3JZEA 4ZSTA 1E5JA 1G94A 2OKOA 3PG9A 1H2IA 1I45A 1OGSA 5M2FX 3RX2A 3MPGA 1R30A 1O1HA 3W22A 2DT1A 3IUIA 5EMUA 3U57A 3ZM8A 3O07A 2RABA 2XIBA 1WPCA 1R3YA 2PU0A 5E5CA 3QEZA 4H19A 3RK8A 4L6DA 3VNDA 2PDFA 2GZXA 4JTHA 2QJNA 4DYJA 1EL3A 4J3SA 3ONBA 2NQJA 1AQMA 3MWCA 4XTDA 4GYPA 1TSIA 2E25A 1FWDC 1L6FA 3MS8A 1KRMA 1W5PA 3L21A 3S47A 1RLDA 1YTEA 3CH9A 2GJXA 2E8YA 2QZRA 5B80A 1FWAC 5HNUA 1OBAA 4CEXC 3C3NA 4BZYA 1LYXA 4HU0A 3VUPA 2E3TA 2G97A 1JDDA 1NH6A 4C1KA 3MV01 4F0KA 3SRFA 3I65A 1CTNA 4UOJA 3REQB 3HRDC 4F48A 5D04C 5REQA 2CZEA 3RO6A 3EF6A 3H53A 4WDTA 5D37A 1XUUA 1L6YA 1V03A 2PDJA 1JXJA 2HISA 4OBSA 2B7QA 4J4KA 2JGYA 1BQGA 4PMXA 1KRAC 3MHGA 5I3FA 5G1TA 3LI1A 5CGQA 1MNSA 1IV8A 1QPNA 4S39A 1PSCA 2NQLA 5E6YA 1D2KA 1LG2A 3EWXA 1VENA 4GXPA 1OFOA 4O12A 2AL1A 1SW0A 5CJMA 2VR5A 1TPWA 4L64A 3RCNA 3FY1A 4GOAA 4LY4A 2X16A 1JCXA 1G0CA 3MB9A 1YQ2A 1ENUA 1Q7MA 5D32A 1XC4A 2Z29A 2AOSA 3HZ3A 1VAHA 4K7VA 3VIMA 3U0HA 1R9XA 1UD8A 3QZEA 4UXDA 3VDCA 3VOIA 2VQTA 4LJ3A 3H4GA 4UTUA 2G4FA 2GUUA 1FWHC 1HKWA 1DHKA 2NW0A 2OOFA 3DCPA 2OOGA 5HNTA 1LRNA 1RCXB 2BOGX 2W4XA 2XH0A 2CXGA 2YYTA 1XSJA 1BWKA 3GDBA 3IGSA 7TAAA 2CLOA 3M5YA 1M5WA 3JW7A 4PUUA 5AHFA 1PKMA 3CLMA 2DH2A 1EEPA 1UWUA 1Q1WA 5XINA 2Z00A 3NPXA 4PMNA 4K37A 3F5KA 4UFIA 3NQBA 3TFXA 1LBFA 2JF7A 2EQ8A 3AMZA 3R11A 4NHVA 2Z1XA 4MDOA 1OYAA 3AICA 1UP3A 2WWCA 3W74A 1WDWA 1BWLA 1KCXA 2C13A 4Q4MA 1W3LA 3P14A 3FA4A 1ICPA 3STGA 3LTPA 4GHRA 3H23A 3HJEA 1W1YA 1FCBA 1ONXA 3VIFA 1R2SA 3O06A 1JRBA 3HG3A 1U1JA 3D9XA 3EXSA 3CIWA 2ZZ0A 3AALA 4HIBA 4R7OA 3SCOA 1KBIA 2QDHA 4BQ4A 4OHQA 4E2OA 3B9DA 2F6UA 2P5NA 4FLQA 4NYYA 4C6JA 3COTA 3O7UA 4DWSD 3MUZ1 3HQPA 1UIPA 5C2GA 4LUJA 1J93A 1YDVA 2C15A 3WQEA 1VBJA 3HURA 3WQCA 3CU2A 3TYCA 2YZ5A 3VD9A 1FKXA 3TUUA 1NU5A 4KIEA 1B3VA 1PUDA 1X39A 1QOQA 3H55A 4Y9OA 2QJMA 1LZOA 1QNRA 5HPOA 4F0SA 1XIDA 3LRMA 1F4HA 3B8DA 1ISVA 2YCLA 4MB5A 5I0DA 1Q4NX 4W88A 2KAUC 3N15A 4US5D 5FEXA 3OEXA 3L4VA 2OYMA 3S42A 2OU4A 3UXAA 3LHZA 1CXLA 1F5ZA 2C19A 4Z1DA 2ZWZA 1OT2A 4NAFA 4GZ7A 2IUZA 4MJ4A 5HPCA 4PCTA 2YBVA 3WUEA 4F2TA 4AY8A 1XGDA 3WUGA 1JD7A 4NUWA 3LPGA 2IXUA 4KESA 3P67A 5A3HA 2WVSA 4L65A 2AMGA 3ARUA 1HFBA 1Z48A 3KZSA 2FJKA 2WSKA 1Q6GA 3WD4A 5EMKA 3S0CA 4UC5A 2XFFA 2X8CA 2RGLA 4X2PA 1OCBA 5LGXA 3VD7A 5B7YA 2AKMA 3M7WA 3SB0A 2YKKA 2HE5A 2WPBA 1SJAA 4LNCA 3ZXWA 1QCWA 4GVGA 4V1XA 1KNWA 2FPTA 1PZ2A 3GHUA 3NQEA 2YDQA 3O3RA 3R8HA 4JOMA 2QS8A 1JNEA 4JTAA 4DO6A 5EPDA 3RO8A 3RLVA 4WQ6A 1NP2A 4N9EA 3W7MA 1NOWA 1BKSA 1P0NA 3KOYA 4R53A 3W25A 4UTJA 1R3RA 4MSSA 3TTSA 4H4WA 4DBSA 5DCEA 1S3HA 4F4RA 5M5DA 5G4EA 1HL2A 4ZQPA 3TTEA 5GNYA 5FEWA 1XRSA 2PRHA 3W1NA 4K8DA 3CEPA 3GBEA 3RLHA 3CHVA 1A47A 1N8IA 1US0A 2Q02A 4AQLA 5I06A 1Z9AA 2QVHA 1KXQA 1HGYA 2YL6A 2EJ1A 5D02A 2ZZ4A 2IS7A 3V0UA 4AD1A 2MANA 3ARSA 1N2VA 1J0YA 3LG3A 4M7SA 5FF0A 4NILA 4D2JA 3F7JA 4W7UA 5JXQA 3VNLA 4WRHA 4LAOA 3U8GA 3KLJA 3THAA 3UVIA 4LUTA 2VJXA 2OWCA 1KBKA 4YWOA 4C1LA 3CQHA 1OIMA 4PBFA 3VE7A 4PMVA 3G0XA 3P81A 4GINA 4F79A 4PTVA 1F3XA 1KLZA 4GNKB 2B7PA 2E3ZA 4MPKA 5FD0A 2QIWA 4F2UA 4HHHA 5C54A 2VX6A 3TTOA 3ZSSA 2WOIA 1AMYA 4QE4A 3TLQA 3U5UA 2G5WA 1ZY9A 4UQEA 4FOJA 3GVRA 3DK8A 2QHAA 1AQHA 1GRHA 3FA3A 1ICSA 4I5UA 1XHCA 4HK5A 5F1UA 1EX1A 4A8LA 3L4TA 2YLAA 2QUVA 1LP6A 2CEQA 4ZQOA 1UJPA 1UQZA 2WC4A 3KTSA 1B2YA 3LNMA 3M0MA 3W38A 3VIKA 4M6QA 1JRPA 1OFDA 3W7GA 1BYAA 1UG6A 5FAJA 1Y0EA 3W1UA 3KHDA 4FK9A 5AYXA 4DQWA 3UT0A 3JRKA 3EDKA 1VEPA 5D2YA 2VWTA 3L5AA 4QEHA 2VGBA 4H6QA 2YYUA 1RD6A 5FOOA 3L66A 4P8WA 3ZLFA 1E5NA 1G6CA 3VZZA 2HBVA 4R9XA 4BI6A 3E5PA 2G0WA 3TROA 1UR1A 4L1GA 3LGDA 5J5RA 3EDJA 2VENA 3KLLA 2QF8A 1S5VA 4UNIA 2PD5A 3ABRA 3A21A 3DN5A 4R33A 2V5KA 1KBJA 3DKLA 5CPNA 3V4BA 3L0NA 3RMEA 4QE1A 3ZR5A 4B16A 3FVDA 3CAKA 3MY9A 3W26A 1FHLA 3UXKA 3UWQA 1POKA 1UH2A 1D8CA 1LPFA 3SUSA 3V5OA 5AC7A 4LGXA 3EWUA 1SW3A 2Z28A 4UCGA 4YXGA 3BDKA 7REQB 2WSRA 2HWGA 3TQKA 6A3HA 1EJRC 3RCYA 3CYVA 3TVAA 4PCSA 2FLIA 3CB8A 4CEUC 3KW3A 2BVDA 3AO0A 3LHTA 1LT7A 3BVJA 4I7UA 2GLKA 2J6XA 3RR4A 3NG3A 3H24A 2DZWA 4JKLA 3W53A 1XLAA 2QCNA 3PSWA 4GISA 2ZZ7A 3E1F1 3OLIA 3R25A 1DNCA 2CFFA 3APTA 5DT5A 4WCJA 3N6JA 3KVMA 3GR4A 1SFTA 5H2ZA 3KDOA 3A22A 1RP8A 2HE8A 4A2SA 1R0MA 2PURA 4QLKA 3RITA 5KMYA 4Q4KA 4KGJA 3T0BA 1T5AA 3KBNA 4CVUA 2J8GA 1BAGA 4GG9A 3DHPA 3BAWA 3B0VC 3CGCA 1ALDA 1QUMA 3CHDA 1AZ2A 4U31A 4G2DA 4BQ2A 4YVPA 2BGSA 3WQOA 4AMAA 2XSXA 2D20A 4FF7A 4GIEA 5C6MA 1R3SA 2HMCA 1MO0A 1UD3A 3OTRA 4DUOA 3OG2A 1EUAA 2Z7GA 3OYXA 2BFGA 4FXRA 3W37A 1RR2A 1NDYA 4ZFCA 4GK8A 3VDAA 4APNA 4LPCA 3DFPA 5K4ZA 4AIUA 1Y8BA 4J3TA 1PL9A 3R0DA 1PVNA 3A9BA 4XZLX 3RLUA 1C7TA 4OBRA 1GGOA 1JULA 2GGHA 5CZKA 3LS9A 5FF4A 5FA5A 5AZ0A 4L4LA 2DUXA 2NV9A 5JU6A 5ER0A 2X1UA 3CV6A 4DO4A 3KEHA 3T1GA 2F2HA 4HBKA 1JYWA 1EKOA 1E6ZA 1W8GA 2I14A 3L9CA 2DW7A 2VNCA 1EZWA 1ONRA 2ATSA 3LA4A 1MFVA 1GETA 1A5OC 2NVKX 3QN3A 3P93A 1QASA 1YW1A 3SR7A 1F73A 5HR6A 4JQ1A 1TUXA 2PGEA 1FFVC 3PBUA 4WEVX 4FP1A 4AVNA 4IT1A 1S2VA 4RE4A 4PMDA 1JFHA 1H60A 1WXZA 2WLZA 3M0JA 3WBWA 3VIHA 1GQLA 1GSNA 3LCFA 1C8XA 2OX1A 1QW8A 1EHAA 1SZEA 2WXDM 3TKFA 2J75A 4B4FA 4TVUA 2DIKA 2A8XA 3BC9A 4QE5A 2V63A 1XR2A 1GOKA 1K7FA 1TA3B 1OABA 4AIOA 2ACSA 3GRSA 3AXIA 4HT3A 1BSLA 1N60C 3PB0A 3PBYA 1UKOA 3O9NA 3ETRB 3EDEA 1Z41A 1AJ2A 1LCOA 4PMZA 2Y24A 4FX8A 2B0MA 4ZBCA 3AHXA 4J3XA 1F6YA 3YPIA 1HVQA 3C2YA 3BQ5A 4DBUA 4ACZB 4O0QA 4WF7A 2HROA 1O66A 4K68A 2PTWA 2X40A 1HL9A 3CV2A 2FB2A 4H1ZA 4DJDA 4L9ZA 2C0AA 3KZPA 2L5HA 4DJEA 3P82A 1BHGA 4LVDA 2X0YA 1TJ1A 3KM8A 1W3NA 4HA3A 4CQ9A 2YFNA 3II1A 4Q8PA 4ERGA 1ZPTA 2ZUWA 4EMIA 4R85A 3NDYA 1FECA 1XQKA 4ALDA 4G9PA 3DYMA 3F2CA 4UTFA 2CLFA 2FZ9A 1GHSA 1W2VA 1OJTA 1B9BA 4AZGA 5CH9A 3TOPA 5J04A 4C6EA 3B05A 3VZYA 5I3GA 2ZOXA 3CUGA 4ZA0A 1NWRA 1T6MA 4DJFD 1QPQA 1DXLA 3F2BA 2IPFA 1AH0A 1DBTA 4R9OA 1GTEA 3KOXA 1CXFA 3H4XA 3W28A 3UG5A 1QI3A 3KVKA 1US3A 4B5XA 4PC8A 5A8PA 4WOQA 5CKSA 3EA1A 1AD1A 3RMJA 2G95A 4DF2A 3WJXA 3W3OA 1CGWA 7TIMA 4BY3A 1XV8A 2WSPA 4K8EA 1GRGA 4WKFA 2OPJA 3USZA 3PG8A 2D24A 4DZ5A 3KP1A 1RV8A 2FHCA 5CAHA 4W7VA 2OCZA 1TWZA 4B5NA 2A79A 1IQ8A 3CWNA 1G7UA 4AVOA 3IPWA 2ICSA 4MWAA 2CLPA 6REQB 5FMHA 1AH4A 4AB4A 2WQDA 1PB0A 4AX7A 1X2HA 4UFJA 2QPSA 4M80A 3T44A 3KL0A 4EPKA 1O12A 2XN1A 3DIPA 1X6LA 1KM5A 3CPRA 1FA2A 1ITCA 3EXTA 3WSUA 5DF0A 2WO5A 1BWVA 2A2IA 3AHZA 2FGBA 4EIVA 4O1DA 2BY3A 4RCXA 4RXGA 1U5HA 1OVDA 1P7TA 3DOPA 2Z2BA 2PP0A 4I90A 2PWEA 2PWGA 3IK2A 4FLOA 3GUGA 2NUXA 4EWND 4HCDA 1JG9A 3GC2A 4AD4A 4DB7A 4XUYA 4QJ5B 5G5IA 4P5UA 4LBRA 3GIPA 2GR0A 4LX4A 4QM1A 1BPLB 2E09A 2DH3A 2PDCA 1RXOB 2GR3A 1PHWA 4JTTA 4JYDA 4DZIA 3QY7A 3WMLA 2XFWA 1DXEA 3BAJA 1YPXA 5IDIA 3CK5A 1Q6CA 2CNCA 3TH6A 2GJXB 2B7NA 4IGSA 4D6GA 1T41A 1IIHA 4OUIA 1VDVA 3WNPA 4CLMA 4HU4A 4CQAA 2BV9A 3WQWA 4Y2WA 3TW7A 2B31A 3QFAA 4GRTA 1K7XA 2FFCA 3N2XA 3K4AA 3LM3A 3RGTA 3VGGA 5REQB 3UCQA 3ARZA 1CGVA 1B54A 1CGUA 3PN8A 4JD4A 3AU2A 1MDLA 1Z6KA 3M0XA 4TUFA 1R46A 3Q37A 5CG0A 2OYKA 1TWIA 3D3FA 1MO9A 2PCQA 2FVKA 3WEMA 3Q45A 2A3CA 3DFOA 2WHKA 4NZCA 4TVCA 4XKYA 4OOUA 1I8JA 4I8YA 1WNOA 1MDRA 1XHGA 2FTPA 2EPNA 2QCGA 2RAGA 5FS9A 4B91A 1LRTA 1BXBA 4K38A 3AOFA 4I9AA 2PWDA 3QKEA 1Q6LA 1XYBA 1XRVA 5IHSA 1IWPA 3IJDA 3KBSA 1GJPA 2IQ0A 5D2WA 1XD1A 5LNRA 1W1VA 1KFCA 1E56A 8XIAA 1FEBA 3EA2A 1V0KA 3B06A 4C60A 1XDIA 2XHYA 3QHOA 2UY4A 1QHZA 4JAWA 4RNIA 1MUCA 1H61A 5D9OA 3N3MA 3QYQA 4FMVA 3TEVA 1A5UA 3UNDA 1L6WA 1F3EA 5TNVA 2FDSA 1RBAA 3EX3A 3QYSA 4PL1A 3ZOAA 1RQHA 2ZFAA 5JIPA 1JCLA 3MCMA 4LFYA 1VFLA 4DLFA 3KXQA 3VUSA 4Q4RA 2ZWYA 1TV3A 2QEZA 4JQ2A 3W0KA 4MF4A 4QG6A 3DFSA 3IRSA 4PEKA 3GUWA 2Y7DA 2ZUUA 3I7SA 4ADSA 4EXQA 3LEPA 4DM1A 3TK7A 3OO2A 2QPXA 3MVIA 1DQWA 3N6QA 2W54A 1NP0A 1I2RA 3TOYA 1OGBA 2Z1VA 5ECUA 4UCFA 5I3HA 4EK7A 2VEKA 2DUZA 1C3FA 1X7FA 2DQXA 3MYOA 3IGHX 1CEOA 2YA0A 3AJXA 5BOOA 4ADWA 1BVNP 4BEQA 3UR2A 5AC4A 5FJOA 2QMJA 4W5ZA 3NSXA 1TWSA 4IP5A 3QY6A 3WQ5A 4JPGA 4NNCA 2JIWA 4QXIA 2PDNA 4HNNA 2XVLA 4MMWA 2OEJA 2GL5A 3MDUA 2YCIX 4ATLA 3WLOA 4AWTA 3W9ZA 3UZJA 2PRLA 4A8IA 1WB0A 1N55A 1Z3NA 1S7MA 5K2ZA 1PX3A 1YYAA 1C8YA 1TTJA 4DO7A 3PSVA 3CUJA 3UFYA 2WBGA 3MI2A 3L7RA 4JXCA 3WLSA 1DWAM 3PTKA 1K3UA 5DMLA 2YCLB 3W1PA 2OTDA 2V3GA 1E55A 3TJLA 3NZGA 1ONFA 1WAUA 1PDZA 3L4WA 3VD5A 3XIMA 4NAFB 3QPEA 2D2OA 1R3QA 1K4HA 1B3WA 3L0GA 3GIYA 2X1RA 4BFAA 4DZAA 3EWBX 4ZXLA 2PDBA 2DZSA 1YNYA 1F05A 1VCVA 3SJNA 1XLJA 3HW2A 4CD6A 3B0XA 1DWFM 1FCVA 4WKAA 1BWCA 4KMQA 4NNBA 3MCNA 4GGBA 4GQQA 1SZFA 2W62A 4DLMA 1ZS2A 5AYIA 2VTFA 1C7SA 3EKGA 2NSXA 4LAMA 1O5RA 3KVJA 3M16A 4P61A 1D7KA 1MYRA 3MCOA 3TN5A 1KQYA 3N9KA 2ZICA 3M1ZA 3M46A 1Q6RA 1I0DA 3WF2A 2Z1SA 1LT8A 1O6IA 3WF3A 1W31A 4FZIA 3P74A 5LNSA 2WB5A 5CCZA 2W91A 4LYQA 2I56A 4PSPA 2BC1A 1VGAA 2DPEA 1EQCA 3MMTA 3UA4A 4ZMGA 4YMZA 2YDSA 4PCFA 2YX0A 2J3NA 1OFBA 4N9CA 3EWYA 4KWVA 3AWOA 1A5CA 4TMCA 2EQ9A 3GTFA 1W56A 5AHLA 1NDAA 2ACRA 1HN1A 2R1MA 3ARQA 2HCVA 4IPIA 4QDWA 5KVHA 3F5JA 2ZX9A 1RLCL 4DUVA 3N2BA 5JBEA 1K9FA 2CLEA 2CPUA 1K02A 4KKXA 5EU9A 1BVWA 5FL1A 4F66A 4IMEA 4DXXA 1UOZA 4WX2A 1ITQA 1GUVA 1S2CA 1M6JA 3M7SA 5J5DA 1W1PA 3OQEA 2OZ0A 1P1XA 2XVPA 1VH7A 4LUTB 1WP6A 2P10A 1WXJA 3GD4A 3ZSTA 1SJCA 2XGIA 3AXMA 4UTMA 1EIXA 2ZRYA 1ISZA 3VNJA 3NSNA 4C6OA 1BG9A 3E96A 3R2GA 4DPQA 1XLFA 3PZGA 3LOTA 3BO9A 2FTWA 4GVFA 3AYSA 1WO2A 4QTGA 3LPFA 1NSJA 4KRTA 4C7GA 3ZJKA 4E38A 4PTWA 5CPMA 3E74A 1I1WA 2GK1A 2VDIA 2DVUA 1ZY8A 4W87A 2ISWA 3N18A 5F7UA 1V08A 3G8EA 3FNDA 4P7OA 4M5PA 1VLWA 2W79A 2VFHA 4F40A 1E72M 1HP5A 1F7BA 4Y9PA 1M68A 1V7YA 3I6EA 3G1XA 1AK5A 3NL6A 4D1IA 2A3HA 3KWSA 3W83A 1PZ1A 1GQJA 3PC0A 5BCAA 1TX2A 2ISDA 1V97A 4TTGA 4NAEA 3V75A 3H7UA 5CZSA 3BG9A 1ZQ5A 3B0UX 1YXCA 4NVTA 3APGA 5CPSA 1KCKA 4GMEA 3GH5A 5E70A 1UZ4A 1YDNA 5DX7A 3HQNA 2YIHA 4XVEA 4W85A 5I09A 4JNMA 4GX9A 1IT7A 2J25A 3SCRA 2XIQA 2OG9A 3E02A 1CLKA 3GZAA 3N04A 1FO4A 3T78A 3BJTA 1FHDA 3P62A 3W2UA 5U4NA 3AJ7A 1ONEA 4ML9A 1PS9A 3LYEA 4GX8A 3U6WA 5BRQA 4ASTA 1JGIA 2VKZG 2YOCA 2GVJA 1TMQA 2VD8A 2NWSA 3GFYA 1CXHA 3A9IA 3FKKA 1H62A 4L4PA 1DIOA 1TTIA 1JDFA 2VRQA 3K1DA 4B5VA 1UD4A 3T0TA 2TRSA 4S3JA 2QGYA 2VC9A 1AG1O 1W9PA 4ZTXA 4XAPA 3NIYA 3OHMB 4Q8MA 3B9AA 4CNSA 3W2LA 3TWAA 3ANVA 3CGDA 1G69A 3SCTA 1UPPA 2W61A 4V28A 1L6SA 5CQ1A 2XWDA 2NT0A 3AHYA 1F74A 3G1FA 3WQFA 3CLWA 3ORWA 2XSBA 3MHFA 1N5WC 4CCCA 3TONA 2V3EA 4HSOA 1X6UA 1F4AA 3L0KA 2FH6A 1GCYA 5T26A 1OSEA 4QFUA 3LLDA 3PZMA 1W3TA 3WDHA 3C8NA 4AW7A 1TCMA 1KTNA 5CZ0A 3M0YA 4GUHA 3KCOA 1EP2A 1U22A 1F3TA 4ORIA 3RXZA 2BVTA 1HJWA 2RDTA 1M7JA 1KWKA 2PTDA 2DDXA 2QCHA 1VFHA 4MWAE 5GQBA 1G4TA 3R89A 4MIMA 5LYRA 1QI5A 1O4UA 4Z2IA 2RUSA 3N25A 3OGRA 4S3FA 4HJFA 3VC5A 5TQLA 2CBJA 1JGMA 3RNDA 6ENLA 1PKYA 1X6NA 1Q6OA 1FEAA 4XZBA 3AYTA 3BMWA 4JYFA 3WNLA 4LEQA 3BLLA 3TQPA 3GVGA 3W7JA 1GOXA 5M1TA 3AIUA 4FOKA 3U48A 1PTDA 1XKJA 1IR1A 1J6OA 2ONEA 4LU0A 2PMQA 3O6AA 1F8MA 1MXGA 3SIMA 4O50A 3MUCA 1Z7AA 2O56A 5KITA 1ZMCA 4LV9A 4H4RA 1H2JA 3IEBA 3WK2A 3A3XA 4INFA 2EKCA 3MP4A 1EO7A 4QRNA 4YTTA 3G1HA 3UQNA 4JIPA 4QR6A 1IGWA 5DBUA 4DELA 1ZJAA 3K2GA 4IUGA 3FLUA 4HA0A 3VMPA 5AZ1A 3GD6A 3OLEA 5A6BA 1XIMA 3S9YA 2GDUA 3T42A 2WZEA 1GREA 3VZXA 2FPYA 3CB3A 4PMOA 5FSDC 2XVKA 2A7RA 3WEOA 4ZQMA 3TR2A 2SFPA 4JTEA 3TLLA 4XTIA 2H8ZA 1XYMA 3ZJ6A 4M6VA 4AC1X 3C8FA 4YWIA 3MKKA 4GJJA 4KWUA 5H8UA 4L1WA 1BQCA 1VF8A 3LM7A 1FH7A 4J3WA 1T0OA 2J9YA 3FEQA 4U3CA 3OZYA 4H8UA 3P8JA 1OINA 2VFFA 1PX8A 3L4UA 3H7VA 1HTIA 1NJJA 1Y65A 1FWBC 5F1VA 3KRUA 1PIIA 1ISWA 3BLKA 2YBUA 2P1FA 1FWRA 4B90A 3GVVA 4UQBA 3F03K 3BAKA 3ITYA 4TV5A 4Q3MA 2ZX6A 3QV7A 3WQDA 3WO8A 3WX7A 1ZAIA 3GD3A 1SM9A 4V1YA 1R47A 1XFCA 1S1RA 3CL6A 3GIQA 3SCQA 4GIAA 3MP5A 4NZFA 2ZUSA 3AS2A 2Z25A 5HATA 2X0HA 3C56A 3TAKA 8XIMA 3WK1A 1TR9A 2D3NA 3GYEA 3RPMA 3TV8A 4Q7IA 1KW1A 1J10A 3G2GA 1ONWA 4UZSA 4E4FA 2AL2A 4DXKA 3LBCA 1GYLA 1QNVA 4E8DA 3R5EA 4KCWA 2YL8A 4U10A 3HA1A 4FNPA 4FALA 1X96A 4RDVA 3AAMA 1KBLA 3SY5A 1GQKA 4N6EA 1OD0A 2IKHA 4JTUA 4NT0A 1XH1A 2A85A 2ISFA 3SO7A 4MZ8A 3EX6A 1V6VA 4EKJA 2EXOA 2WV8A 3ZIZA 1EH9A 4HSHA 1ECQA 4CD8A 3B9OA 3VNYA 4U28A 3GVQA 2VZVA 1V0LA 4H9UA 3UZYA 2WZTA 3BLDA 3S6DA 2EJAA 5JH2A 1E70M 1AL7A 1V3KA 2O9OA 1DE6A 3BCFA 1JVNA 5IBXC 3O0FA 4ML4A 3CTTA 4C6MA 2QNEA 1G7VA 3QV6A 1JCYA 4J9JA 1GRBA 2YW4A 4DF1A 4JCLA 2W66A 1Q6EA 4MKSA 2WSYA 4JIHA 4MY8A 4NP7A 4EXBA 3VNZA 3QMSA 1VBGA 3CWOX 4RR4A 3VTRA 2XN2A 3HG2A 3EWWA 1Y5VA 4X0NA 4MWAB 4CN4A 3W7IA 3GG0A 2ZVRA 5FKYA 2BLEA 1CZ1A 1VBHA 4ZR8A 2OODA 3VGEA 4CU7A 4LOCA 2QAEA 3SY8A 2PWFA 2ZXQA 5G2WA 1GVFA 2JIEA 5DLCA 3FA5A 2WMFA 1P7TB 4MB1A 1SFJA 3KBMA 1DQUA 3S2MA 4FIQA 3VKAA 1IIGA 4UTTC 1DWIM 3ABZA 3FJ6A 4FX7A 1EP3A 1TV8A 1W9VA 1RAKA 2FIQA 4MTVA 1H7NA 4GRSA 1CGXA 4HJWA 3WBAA 4YTUA 3IK4A 3R0UA 5DELA 4URIA 3W7OA 3UJEA 4RW5A 4LRTA 5HQEA 5LIUX 4EACA 1UP0A 1W1ZA 3LCWA 1XCXA 5C8BB 1ZXIC 1VFUA 3UD6A 3GXMA 3MDWA 1EXPA 1TO3A 3NQ7A 1EBDA 3LLXA 3PUEA 5F4WA 1IXPA 3EKLA 1DORA 3SBFA 1XBXA 1KFJA 5HJYA 1YE4A 1ZBVA 1T99A 3M0IA 3CQ0A 4JZ5A 3KTXA 3UG8A 3DKJA 1R9ZA 3B4UA 1U83A 3KBWA 4Z1YA 3UWEA 4WOZA 3NOYA 3OB8A 4PODA 4BQ3A 1XSIA 3FGCA 1MW2A 1NOUA 4MHBA 4PB5A 4DUWA 1H1ZA 1OYCA 1ADDA 1EOKA 1FCUA 3VMOA 3C61A 4GR1A 4JTFA 3THCA 1EJSC 2PRMA 2QAPA 3FN9A 4EP8C 4IIGA 4S3GA 1TPC1 3WLMA 1TREA 1IEQA 4H4ZA 4LYRA 1KM3A 1AODA 3M0ZA 4KIRA 1RQEA 3LTYA 3T0DA 5CSUA 2XIOA 1R3VA 1OFEA 3T09A 3W7LA 1IF2A 4XKYB 5A2AA 3KAOA 2JGQA 3BLIA 3BL3A 5DCDA 5A2BA 3CO4A 3AMGA 4LS1A 2R1LA 3GK0A 1I60A 4AVFA 3S1WA 4H4YA 2IKJA 4S2CA 4XV0A 4JTDA 1TJPA 4NJHA 2YCKX 1V6XA 5C7HA 4F0RA 1GOMA 5JBDA 2AAMA 3PJUA 1JPIA 4CU6A 2NQ5A 4JFTA 5F2LA 4OE7A 1UMLA 1HF6A 1NHRA 3C2EA 1E6NA 1RPKA 1WZMA 4TQTA 2HSAA 3OVRA 1IZCA 1V02A 3A7UA 1GVIA 4GZIA 1XANA 2Y85A 2JKEA 1JL8A 4QISA 3QV9A 4OZOA 4M24A 4UNLA 1E6XM 1JI1A 1I4NA 4X0VA 1PHQA 3ZJ8A 3TDFA 3GKFA 5M17A 3TXZA 1UZ1A 1F8IA 4NRRA 3PUDA 2C1IA 3CIXA 1U5VA 1YKWA 1DJNA 1YX1A 3T55A 4JFSA 5CBIA 3RM9A 2CW6A 3OOQA 2GWGA 1V6WA 5D30A 2WLYA 3G6MA 2WNWA 1K8YA 4O52A 1BFNA 5C2CA 3EMQA 4DBWA 4DWDA 1GVQA 1UUOA 1J96A 1GW9A 2GQ9A 5I77A 1FIQB 3AIBA 4HHMA 4I6KA 1A5LC 1OCJA 2R94A 1E0UA 4F0LA 3W7DA 3D6NA 4OUEA 3AC0A 4OKDA 3IJ7A 1ADSA 4K7YA 1UWQA 1LBMA 4WVXA 1J18A 3TAOA 1JZ3A 1ZLPA 1S46A 3CZLA 1UHVA 1DHPA 4QEEA 3A5VA 1ZTVA 4MNJA 1GQIA 1TZZA 2E40A 3ECQA 4QNEA 5JVLA 1V77A 2XM1A 3ZJ7A 1ZKQA 4H9ZA 3LXAA 3ZLGA 3VCCA 1EUNA 4M7TA 4TO8A 1JPMA 1HKKA 2J7GA 3AMKA 2AQOA 2BY1A 1GKQA 3WDRA 5CGMA 2OLHA 3P2VA 2P53A 3I3DA 3P80A 2E1DA 1B30A 5AYZA 2ZRWA 3IUDA 3V16A 4LUYA 1ZP3A 3PNUA 3BPWA 4QBXA 4W89A 3LCLA 1V3LA 1TTQA 4K8HA 1GOOA 3GFZA 3GW0A 4Z17A 1VIZA 4ZEPA 4BV6A 4B2DD 2NXHA 1VQTA 1DJHA 2HEJA 3UXDA 2XIJA 2FFIA 2YBTA 2POZA 2YW3A 5HJLA 1LF1A 2X42A 4JX5A 2PBOA 2ZTKA 2UBPC 3SN1A 2XFYA 3P61A 3KBJA 4AXNA 2WMIA 2RFGA 4EM4A 1S2WA 5C70A 1WBHA 4GH1A 1XH2A 1HNYA 4KPLA 2C1GA 3PY2A 2E9BA 4LV4A 3B97A 4NI8A 4WGXA 1EC7A 4GC3A 1QWGA 4DI9A 2W3SA 1SZGA 1E1FA 5EFDA 3GZ3A 3BOLA 4Q33A 4CNOA 2EAWA 1YBQA 3H2MA 3NDZA 3ITGA 3WKZA 3TCSA 2GOKA 3RF9A 1XINA 5M03A 2P76A 1V8EA 5LIXX 3WK0A 3B8WA 4GQRA 2W0HA 4H4QA 3ZO9A 1KKOA 1G4SA 2NSOA 1UR8A 3ITVA 3IJQA 2R8WA 3KOWA 4FNUA 1JAEA 5ABGA 3BAIA 2E5BA 1BLIA 4HOXA 1KFLA 1RK6A 5AHIA 1DPMA 4UB9A 1W2PA 4AX6A 2NPXA 4UR9A 4R27A 4GKTA 1A80A 3BQ6A 3UNTA 1PKNA 1HGWA 1XYZA 3NR0A 4GUJA 5ENLA 4D6CA 4HCHA 4XAFA 1GZJA 2YL5A 3DAQA 1DE5A 4KQNA 2O7QA 2J77A 3EBVA 4CQBA 2PODA 3NQAA 4EF9A 1KLYA 3NEHA 1Q3NA 2OLAA 3W86A 3N73A 1VRDA 1Q63A 3ITCA 1NWSA 5MKGA 2Z2AA 2TSYA 2PSNA 2W0UA 2ZXDA 1XDMA 3W1MA 5AC5A 2BHZA 1V7AA 4H9XA 3VOCA 4XBJA 3R58A 5IDZA 3SIZA 3NVTA 4TVYA 1JEHA 1D7FA 5D09A 1O60A 3Q65A 4O53A 1DTUA 3AXKA 1VFFA 4M3PA 1LWJA 1JZ7A 1N62C 1GZGA 1XYAA 1VIWA 1U30A 1XC6A 1A49A 2BVWA 3GXIA 1QHOA 2GUYA 5E1QA 4OBTA 3WL1A 1JOAA 2GK1B 2OJPA 4KBXA 2OZ8A 4OVXA 3UESA 1K70A 4FLSA 5GJPA 1S2AA 2GJNA 4X9SA 4WIWA 4O8RA 3L23A 4LRSA 2XM2A 4MWAD 3WDQA 3OHIA 3TCEA 4E4PA 3M4HA 5D4YA 4HPHA 3OBAA 1ZSXA 1H5VA 4ICMA 5MHBA 4JTQA 1NDVA 4NAEB 3UYIA 3WQ8A 3VGFA 4POCA 5TIMA 2FMOA 1NFBA 4ZO8A 3GHTA 1TX0A 3RU8X 3PG6A 4UMCA 3SQLA 3B04A 3SFKA 1GKRA 2ZA1A 4RZ6A 4OECA 4E3TA 4FSAA 1J0JA 5DY2A 4RV3A 3WMCA 2ATMA 2W92A 4XX6A 1CBGA 3PTMA 4EOUA 4MJZA 2YXGA 4V33A 5LNUA 3IACA 3U2ZA 4C6CA 1W1IE 1LL4A 4AXKA 1JQXA 1WKEA 1QT1A 1XDLA 3NCOA 2CKSA 4F3HA 4JTCA 1XUZA 4LC8A 4L9XA 1MUMA 3MMDA 3GY1A 2G3NA 3W75A 1KRBC 2PC4A 4KGLA 4I6VA 1RBLA 2FVLA 2F61A 3GNXA 4HNUA 2QQ6A 2Z2UA 3VABA 4GKLA 1TIWA 1MEWA 4D1JA 2HVMA 4GH3A 2DZTA 1Q7ZA 5CC3A 2OGJA 2Y7GA 2V0TA 2Z24A 2WNQA 3I6TA 1ZUAX 3AUOA 3IIOA 3TYDA 3GRTA 4RZ5A 3BANA 1E3ZA 4DF0A 2A3EA 3WLLA 3RM4A 1X2GA 2GR2A 4NXSA 4NZ5A 2VGIA 4FS9A 3VNMA 4YTRA 4RXFA 1EFZA 4YYFA 1S3TC 4UTWC 4RZ4A 3SY1A 1K4GA 2D69A 3CUZA 2E0PA 4XBKA 1J5TA 4JTJA 3OC4A 4RLIA 2I5IA 3ICJA 1ZAJA 3GVWA 5JCLA 3PUOA 5A8QA 3OGVA 5JCNA 2BXZA 4C5ZA 2PWUA 2V30A 3DFQA 3HGJA 3H2CA 3ID7A 2G4JA 1KV5A 1P0EA 4TOQA 4ICCX 1YIXA 5KZ6A 3WF1A 1A5MC 4IFKA 2ZXAA 4S3KA 1P48A 3L2MA 2H6RA 3W1QA 1HO1A 2GSEA 2ON3A 3T40A 2C7FA 3WUFA 2PPGA 2VZSA 3PJWA 4D6JA 1DWHM 2HXTA 1E0XA 3PR2A 1B3ZA 2EG6A 5DCBA 4RDYA 4LYPA 4RE3A 2VMFA 3LQGA 3BGJA 1JUKA 4IMDA 1CNVA 3CUFA 5LKYA 1IE7C 1JYXA 3W00A 3VXGA 2EQ7A 2FZ8A 4W5UA 3T07A 3C5QA 1VB9A 4LAZA 3MANA 4S3CA 2IKIA 5K4XA 1MQPA 3E38A 1H11A 2VEIA 1M53A 1WA3A 5I3JA 4Y8EA 2RDXA 3BE7A 2GGGA 4TX6A 1TJRA 4HMNA 4NU7A 4FR1A 3GTXA 4ZO7A 2HNHA 5ABTA 2UZ9A 1CXEA 1DL3A 1Q65A 1JIBA 2X50A 2DZBA 4EQRA 2ACQA 1FBAA 4QS6A 3ABQA 4U5KA 5JUVA 1OK6A 3QGAC 1N61C 1SW7A 1XSKA 5B7ZA 5FL0A 4I9MA 3WH9A 1W5OA 1EXBA 3CS2A 2OGYA 3N14A 1TPDA 4C1NA 1CXIA 4NRSA 3OIHA 2WP5A 4Q8VA 5KZMA 4IJRA 3QTPA 7PTDA 3A7RA 2ACUA 5AY7A 3NPWA 2VYOA 1FWNA 1TRDA 4NZJA 2DSZA 4NX5A 3TYAA 3G77A 2GR1A 4GQBA 1EGMA 1EYWA 3FSTA 4JL2A 4B15A 4BA0A 3QW4B 2XN0A 3RRAA 3Q94A 2WNNA 4I8DA 1LOLA 4K1GA 1HZYA 2UY5A 1QPRA 2QCEA 1ZGDA 1XBVA 2PU1A 3NO3A 1W91A 3UW6A 1UBPC 3L2IA 4K6AA 1E4NA 1YLVA 1CECA 2V5LA 1LQ2A 5LA2A 2VFEA 3W73A 5JH1A 3W81A 2R82A 1U2YA 3FX4A 3UWWA 5I3DA 3TN3A 2PD9A 2A0NA 3RG6A 2PEVA 1GOIA 2NV1A 4J28A 1JPHA 3SN4A 1H7PA 2HK0A 4QLJA 2IXVA 2ZUTA 2FZMA 3CH0A 2ZZ3A 1JI2A 3OBEA 1KCZA 4W86A 2AL2B 4N0RA 5HMEA 1HIZA 2E4TA 4PMJA 2ALRA 1O5KA 1V02E 2BHUA 2BOFX 1UZDA 1UW9A 1XLLA 3HGSA 1CPUA 3QQ0A 2YSWA 1EF3A 1XBYA 5I3IA 2A6NA 1HVXA 7ODCA 2ANUA 3CL7A 4ECLA 5LIYX 4KEZA 1E43A 5U1OA 3LLFA 3W1LA 2PI6A 1ADOA 2GJLA 1ZL1A 3ARYA 4MKVA 3WUBA 1TV2A 3TR9A 8RUCA 3GDLA 4HZ6A 4PE8A 1BG4A 4L56A 3WENA 4JY9A 3UCDA 2V5CA 5D05A 1PIFA 2CLHA 2HVNA 4PR4A 3EUB3 2I7GA 1ZP4A 1Q85A 3L8KA 2V69A 4J3ZA 3IC9A 3MBFA 3TSMA 3LERA 5A6TC 4WY0F 5E9XA 4Q8WA 4J3VA 4MFEA 2V68A 4IMCA 3LU2A 1FDYA 3HMCA 3S4TA 2C18A 3WNMA 1B4EA 1SSGA 3W84A 1KTCA 3UY7A 1UR9A 4JKKA 3W6LA 4ATWA 4AY1A 2W9MA 4P7QA 5FJRA 1OX4A 2KX9A 4XAYA 3O15A 1MW1A 3S6OA 4Y9MA 1TV4A 3H7RA 3R07C 2FPVA 2XISA 1NTHA 5AECA 4ZL1A 4PYSA 1PEZA 4UQDA 4UMAA 4D6EA 7XIMA 4RKAA 4C6NA 1UJQA 1BZLA 2DZVA 2J13A 2R91A 3UERA 4Q6JA 1C8VA 2IPWA 2OO6A 1RCQA 2E77A 4UIOA 3E2SA 4KFPA 1QK0A 3NPVA 3EANA 5T8GA 2CDUA 4YU1A 3LGGA 4O1BA 1W0MA 3C2RA 1SFLA 3EYPA 2VD9A 1H7WA 2CHNA 4O11A 3H8AA 3NXFA 3ZWTA 2YA2A 4H01A 3O05A 4PUKA