1KKXA

Solution structure of the dna-binding domain of adr6
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
102
structure length
102
Chain Sequence
NNKQYELFMKSLIENCKKRNMPLQSIPEIGNRKINLFYLYMLVQKFGGADQVTRTQQWSMVAQRLQISDYQQLESIYFRILLPYERHMISQEGIKETQAKRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1H, 13C and 15N resonance assignments and secondary structure of ADR6 DNA-binding domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
molecule keywords Transcription regulatory protein ADR6
total genus 18
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2001-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 1kkxA00
2JXJA 1KN5A 1KQQA 1IG6A 2CXYA 2KK0A 2YQEA 5K4LA 1C20A 2LI6A 4LJXA 2EH9A 2RQ5A 2EQYA 2OEHA 1KKXA 5CEHA 2LM1A 1RYUA 2JRZA
chains in the Genus database with same CATH superfamily
4DL4A 2UVWA 8ICQA 4ECQA 2WB1C 3NVVA 2QB0B 5AIBA 1HJPA 2W9BA 2ZTDA 5ALNA 1MQ2A 8ICOA 3A0BU 4QZAA 4NJ8A 5F3XB 1AQ6A 3V7KA 9ICWA 5AI9A 3ED5A 1T3NA 1K5OA 5IIMA 4IQVA 1M6YA 5AKYA 5JU5A 3WK6A 3WK8A 4F91B 1B4FA 4O0IA 3KKAC 3EUB2 2GH1A 3LWLA 4EBCA 3D2SA 4DSEA 2YMPA 1AROP 2J6SA 4CDGA 3SENA 4PL2A 5JUMA 1H38A 3H4DA 1ZQLA 3BS5A 4UAWA 4DL3A 5DB6A 5J0RA 2FPLA 3KHLA 2OHFA 4KLIA 4G9BA 5KFOA 2FLLA 3NRZA 4PZNA 2JGAA 2ZJ8A 4DS5A 3RB3A 1A77A 8ICBA 4HAIA 4Z6CA 2HHSA 2H3QA 3CP8A 2ZIXA 4BX9C 1ZQMA 2LI6A 4EZ9A 4FZMA 4P0PB 2KV2A 1JUDA 2ISPA 3QU5A 5KFXA 5HHIA 3SAGA 3QUBA 3Q8RB 3VC8A 2KEYA 3K1RB 2KMDA 9ICBA 4YFKA 5E79U 2ZXIA 2F8LA 1NK8A 4CNQA 4R8UB 3BZCA 4F8RA 4KLQA 1ZQHA 2HBJA 4QIWF 3WKCA 2YN4A 2BPGA 3N28A 4PJ0U 3TACB 3HJEA 5GTIU 1B0XA 3EYZA 4J9MA 3NS1A 1SL0A 1S0VA 4RQ0A 2RHFA 3Q8PB 3RB0A 1ZQCA 5EE1A 1S8OA 3ORYA 4QIWC 4I2AA 9ICVA 1SV0A 3ALRA 4IQTA 3BS5B 1UPHA 5KL1B 1J2MA 4BGDA 4QWDA 2ZIWA 3Q8QB 4QWCA 4FBTA 1JMSA 2BDPA 3I76A 3AQFA 3SAHA 4F4YA 1RQNA 3F5AA 4WJ3B 3T5LA 3OTQA 3QU4A 2FI1A 4RPZA 5L1IA 4GLXA 5IIIA 4PGXA 2BGWA 2W8LA 3PX6A 2IA6A 3C2LA 3RH6A 4O3MA 1BGXT 4ECUA 2MU2A 4Q43A 4RQ2A 2E8NA 3C5GA 4QW9A 5CR0A 8ICPA 4DQPA 5JTIA 5EE3A 3LVVA 5J8YC 3HWTA 4O3QA 5J0WA 5AI6A 2E3TA 5KAIU 5ALOA 2DGZA 5ALTA 3GIKA 4M47A 2YY6A 4C0ZA 4F5OA 2M9NA 4DQRA 1NK6A 2JHDA 1B43A 5KG3A 1PZNA 1QQ6A 1HUZA 2G08A 9ICKA 3TADC 3PNCA 1QSLA 4RT3A 3H0LB 2HDOA 3OGUA 4M9NA 7ICMA 1ED1A 2JZBB 1ZQFA 1X9MA 1T7PA 2HMXA 4Z6DA 3AMZA 2K4IA 2W3RA 2KSOA 3MC1A 4QZEA 3GU3A 5L1LA 5C0YA 2Z7JA 1KBUA 2C22A 2AQ4A 1RXVA 1KN5A 4UB6U 4PHAA 2P35A 4I2GA 4EX6A 1WYGA 4YR2A 4I27A 5EOZA 2NRWA 1JXEA 4P4OA 1J97A 4Y2PA 3UM9A 1BPDA 1TFRA 1X6JA 3M9NB 1BPZA 1U48A 2K4EA 2RDIA 2L5YA 2VA2A 4PHPA 5KTQA 2AGOA 4PPXA 3PW4A 5DB9A 2LM1A 1SXEA 3GFKB 1XO0A 4IC9A 5ALQA 4GXKA 1S0MA 2UVRA 2K4PA 3E58A 4DFPA 5KNIA 3M8SA 2XC9A 3OPXA 1ZQYA 2KE7A 3I1YA 4MF2A 3NASA 4P4PA 3D2QA 1D8BA 3C28A 3ZD8A 4JMUA 5KFUA 5AKKA 1TKDA 5KFEA 2F76X 3DEEA 7ICFA 3CRXA 4KLDA 5DBCA 4DQQA 1B22A 2KZMA 4O3NA 8ICXA 7ICJA 1D9DA 3TKAA 3UXNA 3K75D 3LK9A 4MFAA 2YB4A 1XSPA 5ALRA 4FS1A 2JEGA 1N61A 4ECYA 1WUDA 2ATLA 5CA7A 4KN4A 4ED0A 2K4HA 2OXOA 5AKGA 4KLFA 1BPYA 1YZ7A 5J2IA 2K8BB 3RJJA 2BKEA 3U26A 4JUZA 4KN7A 4EYHB 4I28A 4MFCA 1QSYA 3H4BA 5KFWA 4TUQA 4AYBF 1DOQA 2KTQA 5K4LA 1U47A 4QZ8A 4JB3A 1BPXA 4YCXA 5TZVA 2CPRA 4PZOA 3AUOA 4FO6A 1S5LU 4XQ8A 5EWGA 2RP5A 4NLNA 2AXTU 2FLNA 5ALIA 1XO1A 1ZRMA 4BXOB 4XUSA 4M2YA 4J9SA 1TV9A 5KFMA 3NUQA 3ISCA 4KLMA 1Q3VA 1QQ7A 1S0NA 2LKYA 3RRHA 4U6PA 3EZ5A 1IXRA 2KIVA 3TFSA 2D6FC 2HOQA 2DQNB 3WK4A 3JPOA 4UAZA 5CEHA 2ZIVA 5KFIA 3BQ0A 4YD1A 5J0QA 1SL2A 4IRKA 5L9XA 1U4BA 5CP2A 1NJWA 1Z4NA 2W55A 5F9NA 4Z6FA 3T3FA 1XSNA 4ECXA 5KFVA 2EANA 4RQ4A 2KZ3A 2OCEA 2DKXA 1RPLA 1MA7A 4ED1A 4R66A 2XGPA 1KTQA 2QB1A 2EZXA 2QKQA 2W03A 2VIXA 1P7DA 5KFCA 2AGPA 2C28A 2EH9A 4OD0A 1ZQJA 2R8GA 2JZBA 5HR7A 3AN1A 4C80A 5ALJA 2BQ3A 5ALXA 2DFLA 2QARA 3HX0A 3MR2A 3A0HU 4IQUA 1IV8A 5J0YA 5KT2A 2W9CB 4GC7A 1L7PA 2D3DA 5J2KA 8ICAA 1FIQA 5KT4A 3OHBA 2JEIA 4YD2A 4MFFA 1NNLA 1TK5A 4NY8A 2WF7A 4TQRA 1L8LA 8ICJA 2ZTCA 2KIWA 4NLGA 1CEZA 7ICHA 4U7CA 5ALLA 2Y1IA 3KHGA 1ZJNA 1SB3C 9ICEA 1S10A 4MHVA 3ETLA 1A6SA 4PH5A 2K89A 1SWWA 2FLPA 1DGSA 3RAQA 5DDMA 1ZQZA 5EWFA 1SZPA 2KKPA 2W3SA 3RR7A 3AEVA 3IM1A 4X5VA 1UT5A 1YT3A 3SAFA 2PMZC 4NLCA 2ASLA 4ICAA 1HUOA 4DOCA 3HKZF 9ICXA 7ICRA 2OM6A 4P0QA 3PO5A 3QUCA 2KKVA 2F1HA 4C8NA 5ALFA 2WAQC 2ZIWB 5DGAA 2BHNA 2E8MA 8ICZA 3ISDA 5KG1A 3BQ2A 1SWVA 4J03A 1L7NA 4GFJA 2JRZA 2EAOA 2UVVA 3IDWA 1TK8A 3RJHA 4F2RA 1ZQRA 2PFPA 2B21A 4Y2RA 4GIBA 4TUPA 5J0TA 5D46A 2XIDA 1NK7A 2FPMA 1LB2B 5BOMA 4ED3A 5KG7A 1NJYA 2H3VA 4ED2A 3FDSA 4RQ6A 5HMLA 9ICAA 2KSOB 4UB3A 2LPEA 5IIOA 1S9FA 1J2NA 3JPTA 3IG5A 3QZ7A 8ICFA 2WF9A 3RAXA 9ICLA 3R9KA 3ONNA 4O3RA 8ICMA 1GO3F 4Y2SA 5KFQA 2DKZA 4Q8EA 1UCVA 2K8AA 3LWMA 8ICTA 3THVA 4UARA 1JIHA 4LZDA 1DK3A 4BWJA 3TQ1A 5AK6A 4DSFA 8ICGA 5KG2A 3M6ZA 3TI0A 2H3FA 4OJLA 3ZDCA 4Y2UA 4EENA 2VKQA 1MQ3A 4IL6U 1MN8A 2FMQA 1N62A 3B0YA 2F1JA 7ICSA 4O3OA 1RYSA 4KX5A 3N7PD 4Q44A 3CW2C 2CN1A 5KFLA 4LZGA 3C29A 4DQSA 4KMUA 5KT7A 5B66U 3T5KA 3LDAA 5ALMA 3IRUA 3QX7A 2JEFA 2YMQA 4NV0A 1Q3UA 2O6KA 3PV8A 1L3SA 2NV3A 2DBYA 3NVWA 4ECVA 3GZFA 2BQUA 3QZ8A 2R8HA 3MGHA 3NTUA 3GILA 3SQIA 2V9WA 4C7ZA 2PFNA 1VDVA 9ICJA 5AM0A 1QSSA 4YXJA 2WHEA 2LYBA 4K4HA 5J0PA 3TANA 1PVPA 2C2RA 1KW4A 4RNMA 1QQ5A 4DFKA 3NRWA 3PX0A 4R8UA 2PXIA 3ZDAA 4RQMA 1RYUA 4ECRA 2AU0A 1Z3EB 2KD1A 2G0AA 1NJXA 2GLEA 4DQIA 3QXGA 2HI0A 5ALYA 4I2FA 2HBLA 2CXYA 7ICEA 5J2AA 1SL1A 2ZUCA 3QUQA 5AKIA 5KFTA 5KFYA 4JV0A 3SV4A 2BR0A 4DOBA 2VANA 5CB1A 1XC9A 4PGQA 5KG6A 2W04A 4Y2XA 5AICA 4KLHA 1VJ5A 1S76D 4Q8FA 8ICEA 5AIAA 2XICA 2LM4A 5G5GA 3RF9A 3AM9A 5AI0A 3C2MA 1BNOA 2JR5A 4KLLA 5AM4A 4Y2TA 2KJ5A 1ZQVA 3HILA 2QB0A 5KFHA 5KT6A 3SZ2A 3WU2U 1Z00B 2KFNA 2H5XA 3T5HA 1ZQXA 4UAVA 4IS7A 2Q4TA 3IP4B 2LYAA 1DXSA 4M0AA 4RT2A 2R8JA 1NI3A 2W7OA 3QUTA 2RRDA 5KFPA 4QZHA 3NGDA 1TAMA 9ICPA 3B0XA 2OWOA 3GDXA 2V4RA 3DDHA 4RQ3A 2LYHA 5ALPA 1N63A 4DS4A 3GQCA 3Q8SB 1L8OA 3PMNA 4QJFB 1NKEA 4KLGA 2Q0ZX 5AI5A 4RZRA 4M9HA 3K1ZA 2BZFA 1X2IA 3H8MA 4JV1A 3MFIA 1D9FA 2F1IA 3BQTA 1X66A 4QZGA 1UA0A 3RRGA 5AHXA 1N56A 2V4QA 7ICIA 3KBBA 5KT3A 4M9JA 4YMMA 4USAA 4I2DA 2H3ZA 2NRVA 3Q8LA 1OW5A 4TQSA 4ZH4A 3T5JA 4C4RA 3GIIA 4DSKA 3Q8MA 4PHDA 2R8KA 7ICPA 3RFAA 3OJSA 2MA1A 4EYIB 4ED8A 5CJ7A 4DL2A 5J2BA 4C4SA 1A76A 1SV4A 2BQRA 4Q45A 5CHGA 3I28A 3MABA 2NRZA 5AM1A 3MGVA 1JX4A 4DSJA 3KHHA 3RR8A 2A19A 3PW2A 2KVCA 3WK5A 4O5KA 3J81j 4F2SA 4O5EA 2PFOA 1Z1VA 4NM1A 2DF4B 1ZRNA 5KL8B 3HKZC 4A8EA 2ZUDA 5ALZA 1N2XA 1F44A 4UB4A 1FEZA 4US9A 1RZTA 4GXIA 2XY7A 3F2CA 5KFRA 5KG0A 2LHTA 3V6KA 9ICGA 3UMCA 4KMOB 3ISBA 4JV2A 1K1QA 1NOMA 3PSPA 4R63A 3M8RA 4QWBA 3PW5A 2BPFA 1S97A 4UBCA 2WAQF 3MDCA 5T14A 5D4BA 4C8KA 5DDYA 2IMWP 1T94A 9ICMA 2KOBA 1V97A 3MFHA 3JPRA 2W11A 3RH4A 2G5IB 1COOA 1JALA 2Y0SF 2JH1A 3VCBA 1PUZA 4J9OA 2R8IA 1NZPA 5DB8A 2E5SA 4QZDA 4C7YA 1RQLA 3CNHA 2P66A 4GXJA 2NO4A 3UQ2A 4DL7A 1X9WA 3OSNA 7ICNA 3PW7A 3JPSA 3PW0A 3QE9Y 2OEHA 2ISOA 4I2HA 1LKYA 2YMMA 4O9MA 1ZETA 4F5QA 2AQ0A 5J29A 2ZXHA 2XCPA 5J0XA 4CGZA 2AJQA 3PSIA 1PVQA 2DL0A 1Z4OA 4FE3A 1RG6A 5L1MA 2GOLA 4J9NA 5H2FU 1V38A 4DO9A 3RB6A 3IV6A 1SKWA 4NLZA 4ELUA 3C1ZA 5AKXA 1F5SA 1Q8KA 3M9MB 3SD7A 9ICFA 4IRCA 2C2EA 2HCFA 3IHQB 1BPBA 4DOAA 3V7LA 3PO4A 1QCKA 5AKLA 3NVYA 4CCHA 2ZIUB 2A1JA 3C23A 1TAUA 3AQEA 5ALDA 3RBEA 1ZQTA 1KRPA 4ED7A 1TE2A 1NK5A 3EWAA 4F4WA 2MRLA 1KEJA 3E2EA 3C1YA 5A0LA 4OJPA 5HP4A 1ZD2P 2OYYA 4F3OA 2JH7A 5J0SA 4DSLA 4M04A 5KAFU 4UB8U 3N4MB 3M1YA 5J2EA 2HHQA 2G07A 3D6JA 2W43A 2WB1F 4DCCA 2MAXA 1SV0C 2W54A 5KFGA 4EBEA 4I2IA 1KLNA 4DF8A 2K60A 3C21A 1L7MA 2FMPA 3AL0B 3RJIA 1SZHA 4BUGA 2HW3A 4IQWA 2XGQA 1C7YA 2F3NA 7ICUA 3RB4A 5HR6A 1XNSA 1A0PA 1X42A 4FBUA 3IG8A 1N48A 2E8PA 1KFSA 3GIJA 2KVSA 4YMNA 5B5EU 3ZDEA 5DB7A 3SV3A 2GWSA 2P6RA 1L7OA 1JRPA 4TUSA 2ZJ5A 4Y2YA 4YN4A 4QZCA 3TARA 2I5HA 4M9GA 5CRXA 2IHNA 2JMGA 3V72A 1SKRA 3KFUF 2AH5A 3B9JA 4JWNA 9ICUA 4C4TA 5L1KA 3UQ0A 2ZIUA 2E1EA 3LYSA 2W9BB 2BCRA 3AU2A 4C8MA 2HBKA 1NKBA 2I1QA 1XWLA 2PMZF 3QEAZ 1XS9D 1T8EA 4QW8A 3H0RB 1CUKA 4EELA 1OXJA 2W9MA 4UB1A 3N7RC 4M6WB 1PK3A 4J9PA 1UA1A 3EPGA 4F93B 1UHUA 2F77X 1URJA 2FPKA 2WF8A 1UQVA 3SR6A 3BDPA 5HHHA 7ICTA 4KLOA 4EZ6A 1NJZA 1COKA 4F71A 5KT5A 2F2AB 3QU2A 4J9KA 2VA3A 1ZQWA 4RUCA 5DQIA 1ECWA 3ZDDA 3UMGA 2VJ5A 5J2FA 3FYHA 3TAQA 9ICIA 4RQ5A 1IM4A 5KG5A 4F92B 3H8JA 1ZOLA 3ICXA 1NZBA 4DL5A 2KG5A 7ICKA 5IIJA 3GV5B 1KDHA 4ZOHC 5J8YA 4KITB 1C20A 2NO5A 5J2CA 2XY6A 2YB1A 4RQNA 4HYKA 1F0MA 3MBYA 4FZNA 2RQ5A 3L4PA 4ELVA 2XCAA 5ALSA 4RPXA 4RUAA 4EEKA 5ALGA 5CWRA 1U45A 3OSPA 3QU7A 2GO7A 2UVUA 1O03A 1KQQA 3N7SC 1ZQUA 2PKEA 4YMOA 3CYMA 2IHMA 1L6NA 1V85A 4UAUA 3GV7B 8ICRA 3V6HA 4DL6A 1ZQEA 4OO1J 1IG6A 2B0CA 1ZD4A 2KN7A 3MR6A 3S6JA 2Y0SC 1L3TA 5AKHA 2ES6A 3T79A 2JEJA 2K8CB 4UW9A 1CI4A 4AYBC 3O0FA 1D8YA 9ICCA 4O5CA 4NLKA 4DWIA 1L5UA 2HOIA 5KFDA 1XSLA 5IILA 4DFMA 4CE6A 3WKBA 3ZD9A 5JRTA 5FP0A 2E1FA 5J2JA 3Q8KA 4JWMA 3BJYA 2BPCA 5BOLA 4RQ1A 1MC8A 2ESEA 3N97B 8ICKA 5DLFA 2DPIA 5F9LA 2G5HB 1YZ6A 5J2GA 4UB5A 1QTMA 1ZYQA 2EQYA 3L5KA 3MR3A 2HBMA 3QEBZ 3ETRA 4RU9A 2RDJA 8ICSA 3H8SA 5KFSA 3F2BA 1KFTA 4RQ8A 5AI8A 3RJFA 3SMVA 3H0MB 3UXOA 5KFFA 4QWAA 3UPQA 3SYZA 2HHUA 2XO7A 2YMLA 3QU9A 3EPIA 3WKEA 3MR5A 1D8LA 5ALVA 3IN5A 4DFJA 2M0NA 2P6UA 5AKEA 1NK9A 9ICRA 1DK2A 2ZUBA 2ZIVB 3TAPA 2JV3A 2MSNA 4YVZA 4YQWA 3RJEA 1Q46A 1S0OA 3PR5B 2KK0A 4QWEA 5DBAA 3MDAA 8ICIA 3PY8A 2N1RA 4QZFA 2QARB 4KLTA 3NVZA 4B9VA 4ECSA 1Y88A 4PL1A 2KJ8A 4UQGA 3KZXA 5J0OA 2FJ6A 1PVRA 1QLNA 8ICHA 9ICTA 1WCLA 4NL9A 4O3PA 1Z00A 2MUTB 1HIWA 2ALZA 3D2NA 2Y9UA 5KFJA 3K4GA 3SI8A 2XY5A 5J0UA 2E8OA 1JXLA 4I29A 3HP6A 3HT3A 4ECTA 2H3IA 2HHVA 1ZQSA 2PFQA 2FDRA 1ZQOA 1SXDA 2IBKA 3GIMA 3EW9A 4F5PA 4I2EA 9ICNA 1U49A 4ECZA 4DEZA 5HNKA 2ASJA 3MGIA 4EBDA 5KG4A 5EE9A 1ZQ1C 5DG9A 3FC4A 1TK0A 4B9MA 4NXZA 5C5JA 5AM5A 4ED6A 4K4GA 3G6VA 4PHEA 3HPOA 1ZQQA 4BDPA 2DWQA 3BS7A 3HRDD 5KFKA 3G6YA 1LVHA 4O3SA 5AM2A 1WWUA 3RTVA 2D8CA 3JPPA 3C2KA 1BNPA 5AK3A 4ACOA 4CF3A 2KZZA 1MSWD 1ZQPA 1T3QA 3V6JA 3RJKA 4F4KA 7ICOA 2NYVA 5AKZA 1LV5A 9ICSA 4US8A 2NRTA 2YX8A 2YTUA 7ICVA 4TURA 2I9GA 4KLSA 1RDFA 2FE9A 4UATA 2LBOA 2EZZA 2AHOB 3F2DA 4KLJA 1WWVA 1ZQDA 9ICOA 5DQHA 2ODGA 4DFDA 3M9OB 2HVHA 5D49A 1ZD5A 3OHAA 2XVTA 5BPCA 2G09A 4XRHA 3WKDA 5KFNA 4RQ7A 2HSZA 1Z1BA 4Z6EA 4UBBA 1RM6C 5KFZA 2HHTA 5DKWA 2A1AA 1TVAA 4P0PA 4QZIA 4F50A 1L3VA 4YP3A 5EE0A 1QH9A 5AKJA 5TISU 4QZ9A 4UB2A 4F4XA 1RXWA 2A1JB 4P4MA 5J2HA 2RLTA 3KKAA 4DLGA 4I2CA 4IR9A 3SEIA 5AM3A 1ZQAA 3BQ7A 1IIPA 5ALWA 2W7PA 1SGGA 1N5XA 1ZQGA 4Y2VA 4G3IA 3WK9A 4KX3A 4LJXA 2W8KA 1DRGA 2ZJAA 4NWIA 2BCUA 3HW8A 1NK0A 1Z19A 3PMLA 2F44A 2CRXA 3UMBA 1EXNA 4OJ6A 2ZIXB 4BJQA 2ZG6A 1FO4A 4FFDA 4J9QA 3KD3A 2KJ9A 2KHVA 4Y2QA 2BCSA 1LKYB 2EAMA 3LVWA 4NL9C 4ELTA 2EZYA 5L1JA 2W9AA 2F8KA 1ZQNA 2IOFK 1ZD3A 4CF5A 2Y1JA 4MEYA 8ICLA 4C8OA 3H40A 3G6XA 2W9CA 1S77D 1K1SA 4I2BA 2WF5A 2VA8A 1KL9A 2ZTEA 9ICHA 3KOOA 3TFRA 1ZQIA 4CRXA 4QNLA 1CRXA 4P0QB 8ICYA 5AI4A 4P2HA 1JI7A 7ICGA 5ALKA 4AP9A 4OJ5A 4KLEA 4MEXA 2BDUA 3QYPA 4KLUA 2Y9TA 5J2DA 2FMSA 2HOFA 2PI5A 1HEKA 5DQGA 3TADA 3H8WA 4R65A 4R64A 4E0DA 2HVIA 2LMRA 3PR4A 2R18A 3F53A 3H7IA 5DLGA 9ICQA 2J6UA 2A3VA 2BCVA 4B9NA 2G06A 1DGJA 2MUTA 5ALUA 3GV8B 1ZQKA 2B6GA 2EAPA 3JPNA 4M6WA 1OUQA 3FM9A 4FZLA 1BVSA 1JN3A 4JK1A 1X9XA 1U9LA 3L3FX 3BZKA 4EX7A 4F4ZA 1WG8A 1ZXIA 3ZDBA 2PI4A 1V9PA 4BWMA 3RH5A 2KICA 3KHRA 2C2DA 4RNOA 4PGYA 4NM2A 5ALHA 1SIJA 2BCQA 2KNJA 3V7JA 1KFDA 3FAHA 4F5NA 1SKSA 2HHXA 1XU4A 1ZQBA 2WTFA 5DG7A 4DSIA 3BQ1A 1X6IA 3RBDA 4B6JA 1T4GA 3PX4A 4RPYA 5KFBA 8ICWA 1KKXA 4BXOA 1ZJMA 3M6KA 2YQEA 2I6XA 4IRDA 4YR0A 4C8LA 1PK1A 3WK7A 1KSPA 5IINA 5HMMA 4I2JA 3OJUA 1RYRA 2NRXA 3C5FA 4DF4A 5EWEA 4J9LA 5G5HA 4YXMA 2OH2A 5DGBA 3AU6A 3JPQA 2HHWA 4CF4A 1FFUA 5DG8A 1JROA 2ASDA 4M9LA 4MF8A 4UAYA 7ICLA 4DLEA 2XI9A 4FS2A 4K4IA 4GC6A 1X40A 1L3UA 1NKCA 1PK1B 4YG2A 3PZPA 4B9TA 4LVSA 1UT8A 1O08A 8ICVA 3DV9A 4B9SA 3PSFA 4QZBA 5DBBA 7ICQA 4F5RA 2DUYA 3QNMA 2WFAA 5IIKA 3UXPA 3PVXA 3RJGA 4F72A 3KTQA 2WF6A 4OCZA 4RNNA 4UASA 8ICNA 2AGQA 1X9SA 2KHQA 5AK4A 1TAQA 4EEYA 5ALEA 2IOHA 4XA5A 2KFZA 3PSTA 4IR1A 4YR3A 3M7DA 5GTHU 2IOFA 8ICCA 4KTQA 4OJOA 8ICUA 3F5EA 3WKAA 4B9LA 1WCNA 1BPEA 4J9RA 5KFAA 4Y2JA 2KP7A 1N60A 1VLBA 2QLTA 1NK4A 4B9UA 1N5WA 2JXJA 3ZI4A 5AK5A 2VJ4A 3KZIU 1FFVA 2EDUA 4ECWA 3E0FA 2J6TA 2DPJA 4NLBA
chains in the Genus database with same CATH topology
2JXJA 1KN5A 1KQQA 1IG6A 2CXYA 2KK0A 2YQEA 5K4LA 1C20A 2LI6A 4LJXA 2EH9A 2RQ5A 2EQYA 2OEHA 1KKXA 5CEHA 2LM1A 1RYUA 2JRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JXJ A;  1KN5 A;  1KQQ A;  1IG6 A;  2CXY A;  2KK0 A;  2YQE A;  5K4L A;  1C20 A;  2LI6 A;  4LJX A;  2EH9 A;  2RQ5 A;  2EQY A;  2OEH A;  1KKX A;  5CEH A;  2LM1 A;  1RYU A;  2JRZ A; 
#chains in the Genus database with same CATH topology
 4DL4 A;  2UVW A;  8ICQ A;  4ECQ A;  2WB1 C;  3NVV A;  2QB0 B;  5AIB A;  1HJP A;  2W9B A;  2ZTD A;  5ALN A;  1MQ2 A;  8ICO A;  3A0B U;  4QZA A;  4NJ8 A;  5F3X B;  1AQ6 A;  3V7K A;  9ICW A;  5AI9 A;  3ED5 A;  1T3N A;  1K5O A;  5IIM A;  4IQV A;  1M6Y A;  5AKY A;  5JU5 A;  3WK6 A;  3WK8 A;  4F91 B;  1B4F A;  4O0I A;  3KKA C;  3EUB 2;  2GH1 A;  3LWL A;  4EBC A;  3D2S A;  4DSE A;  2YMP A;  1ARO P;  2J6S A;  4CDG A;  3SEN A;  4PL2 A;  5JUM A;  1H38 A;  3H4D A;  1ZQL A;  3BS5 A;  4UAW A;  4DL3 A;  5DB6 A;  5J0R A;  2FPL A;  3KHL A;  2OHF A;  4KLI A;  4G9B A;  5KFO A;  2FLL A;  3NRZ A;  4PZN A;  2JGA A;  2ZJ8 A;  4DS5 A;  3RB3 A;  1A77 A;  8ICB A;  4HAI A;  4Z6C A;  2HHS A;  2H3Q A;  3CP8 A;  2ZIX A;  4BX9 C;  1ZQM A;  2LI6 A;  4EZ9 A;  4FZM A;  4P0P B;  2KV2 A;  1JUD A;  2ISP A;  3QU5 A;  5KFX A;  5HHI A;  3SAG A;  3QUB A;  3Q8R B;  3VC8 A;  2KEY A;  3K1R B;  2KMD A;  9ICB A;  4YFK A;  5E79 U;  2ZXI A;  2F8L A;  1NK8 A;  4CNQ A;  4R8U B;  3BZC A;  4F8R A;  4KLQ A;  1ZQH A;  2HBJ A;  4QIW F;  3WKC A;  2YN4 A;  2BPG A;  3N28 A;  4PJ0 U;  3TAC B;  3HJE A;  5GTI U;  1B0X A;  3EYZ A;  4J9M A;  3NS1 A;  1SL0 A;  1S0V A;  4RQ0 A;  2RHF A;  3Q8P B;  3RB0 A;  1ZQC A;  5EE1 A;  1S8O A;  3ORY A;  4QIW C;  4I2A A;  9ICV A;  1SV0 A;  3ALR A;  4IQT A;  3BS5 B;  1UPH A;  5KL1 B;  1J2M A;  4BGD A;  4QWD A;  2ZIW A;  3Q8Q B;  4QWC A;  4FBT A;  1JMS A;  2BDP A;  3I76 A;  3AQF A;  3SAH A;  4F4Y A;  1RQN A;  3F5A A;  4WJ3 B;  3T5L A;  3OTQ A;  3QU4 A;  2FI1 A;  4RPZ A;  5L1I A;  4GLX A;  5III A;  4PGX A;  2BGW A;  2W8L A;  3PX6 A;  2IA6 A;  3C2L A;  3RH6 A;  4O3M A;  1BGX T;  4ECU A;  2MU2 A;  4Q43 A;  4RQ2 A;  2E8N A;  3C5G A;  4QW9 A;  5CR0 A;  8ICP A;  4DQP A;  5JTI A;  5EE3 A;  3LVV A;  5J8Y C;  3HWT A;  4O3Q A;  5J0W A;  5AI6 A;  2E3T A;  5KAI U;  5ALO A;  2DGZ A;  5ALT A;  3GIK A;  4M47 A;  2YY6 A;  4C0Z A;  4F5O A;  2M9N A;  4DQR A;  1NK6 A;  2JHD A;  1B43 A;  5KG3 A;  1PZN A;  1QQ6 A;  1HUZ A;  2G08 A;  9ICK A;  3TAD C;  3PNC A;  1QSL A;  4RT3 A;  3H0L B;  2HDO A;  3OGU A;  4M9N A;  7ICM A;  1ED1 A;  2JZB B;  1ZQF A;  1X9M A;  1T7P A;  2HMX A;  4Z6D A;  3AMZ A;  2K4I A;  2W3R A;  2KSO A;  3MC1 A;  4QZE A;  3GU3 A;  5L1L A;  5C0Y A;  2Z7J A;  1KBU A;  2C22 A;  2AQ4 A;  1RXV A;  1KN5 A;  4UB6 U;  4PHA A;  2P35 A;  4I2G A;  4EX6 A;  1WYG A;  4YR2 A;  4I27 A;  5EOZ A;  2NRW A;  1JXE A;  4P4O A;  1J97 A;  4Y2P A;  3UM9 A;  1BPD A;  1TFR A;  1X6J A;  3M9N B;  1BPZ A;  1U48 A;  2K4E A;  2RDI A;  2L5Y A;  2VA2 A;  4PHP A;  5KTQ A;  2AGO A;  4PPX A;  3PW4 A;  5DB9 A;  2LM1 A;  1SXE A;  3GFK B;  1XO0 A;  4IC9 A;  5ALQ A;  4GXK A;  1S0M A;  2UVR A;  2K4P A;  3E58 A;  4DFP A;  5KNI A;  3M8S A;  2XC9 A;  3OPX A;  1ZQY A;  2KE7 A;  3I1Y A;  4MF2 A;  3NAS A;  4P4P A;  3D2Q A;  1D8B A;  3C28 A;  3ZD8 A;  4JMU A;  5KFU A;  5AKK A;  1TKD A;  5KFE A;  2F76 X;  3DEE A;  7ICF A;  3CRX A;  4KLD A;  5DBC A;  4DQQ A;  1B22 A;  2KZM A;  4O3N A;  8ICX A;  7ICJ A;  1D9D A;  3TKA A;  3UXN A;  3K75 D;  3LK9 A;  4MFA A;  2YB4 A;  1XSP A;  5ALR A;  4FS1 A;  2JEG A;  1N61 A;  4ECY A;  1WUD A;  2ATL A;  5CA7 A;  4KN4 A;  4ED0 A;  2K4H A;  2OXO A;  5AKG A;  4KLF A;  1BPY A;  1YZ7 A;  5J2I A;  2K8B B;  3RJJ A;  2BKE A;  3U26 A;  4JUZ A;  4KN7 A;  4EYH B;  4I28 A;  4MFC A;  1QSY A;  3H4B A;  5KFW A;  4TUQ A;  4AYB F;  1DOQ A;  2KTQ A;  5K4L A;  1U47 A;  4QZ8 A;  4JB3 A;  1BPX A;  4YCX A;  5TZV A;  2CPR A;  4PZO A;  3AUO A;  4FO6 A;  1S5L U;  4XQ8 A;  5EWG A;  2RP5 A;  4NLN A;  2AXT U;  2FLN A;  5ALI A;  1XO1 A;  1ZRM A;  4BXO B;  4XUS A;  4M2Y A;  4J9S A;  1TV9 A;  5KFM A;  3NUQ A;  3ISC A;  4KLM A;  1Q3V A;  1QQ7 A;  1S0N A;  2LKY A;  3RRH A;  4U6P A;  3EZ5 A;  1IXR A;  2KIV A;  3TFS A;  2D6F C;  2HOQ A;  2DQN B;  3WK4 A;  3JPO A;  4UAZ A;  5CEH A;  2ZIV A;  5KFI A;  3BQ0 A;  4YD1 A;  5J0Q A;  1SL2 A;  4IRK A;  5L9X A;  1U4B A;  5CP2 A;  1NJW A;  1Z4N A;  2W55 A;  5F9N A;  4Z6F A;  3T3F A;  1XSN A;  4ECX A;  5KFV A;  2EAN A;  4RQ4 A;  2KZ3 A;  2OCE A;  2DKX A;  1RPL A;  1MA7 A;  4ED1 A;  4R66 A;  2XGP A;  1KTQ A;  2QB1 A;  2EZX A;  2QKQ A;  2W03 A;  2VIX A;  1P7D A;  5KFC A;  2AGP A;  2C28 A;  2EH9 A;  4OD0 A;  1ZQJ A;  2R8G A;  2JZB A;  5HR7 A;  3AN1 A;  4C80 A;  5ALJ A;  2BQ3 A;  5ALX A;  2DFL A;  2QAR A;  3HX0 A;  3MR2 A;  3A0H U;  4IQU A;  1IV8 A;  5J0Y A;  5KT2 A;  2W9C B;  4GC7 A;  1L7P A;  2D3D A;  5J2K A;  8ICA A;  1FIQ A;  5KT4 A;  3OHB A;  2JEI A;  4YD2 A;  4MFF A;  1NNL A;  1TK5 A;  4NY8 A;  2WF7 A;  4TQR A;  1L8L A;  8ICJ A;  2ZTC A;  2KIW A;  4NLG A;  1CEZ A;  7ICH A;  4U7C A;  5ALL A;  2Y1I A;  3KHG A;  1ZJN A;  1SB3 C;  9ICE A;  1S10 A;  4MHV A;  3ETL A;  1A6S A;  4PH5 A;  2K89 A;  1SWW A;  2FLP A;  1DGS A;  3RAQ A;  5DDM A;  1ZQZ A;  5EWF A;  1SZP A;  2KKP A;  2W3S A;  3RR7 A;  3AEV A;  3IM1 A;  4X5V A;  1UT5 A;  1YT3 A;  3SAF A;  2PMZ C;  4NLC A;  2ASL A;  4ICA A;  1HUO A;  4DOC A;  3HKZ F;  9ICX A;  7ICR A;  2OM6 A;  4P0Q A;  3PO5 A;  3QUC A;  2KKV A;  2F1H A;  4C8N A;  5ALF A;  2WAQ C;  2ZIW B;  5DGA A;  2BHN A;  2E8M A;  8ICZ A;  3ISD A;  5KG1 A;  3BQ2 A;  1SWV A;  4J03 A;  1L7N A;  4GFJ A;  2JRZ A;  2EAO A;  2UVV A;  3IDW A;  1TK8 A;  3RJH A;  4F2R A;  1ZQR A;  2PFP A;  2B21 A;  4Y2R A;  4GIB A;  4TUP A;  5J0T A;  5D46 A;  2XID A;  1NK7 A;  2FPM A;  1LB2 B;  5BOM A;  4ED3 A;  5KG7 A;  1NJY A;  2H3V A;  4ED2 A;  3FDS A;  4RQ6 A;  5HML A;  9ICA A;  2KSO B;  4UB3 A;  2LPE A;  5IIO A;  1S9F A;  1J2N A;  3JPT A;  3IG5 A;  3QZ7 A;  8ICF A;  2WF9 A;  3RAX A;  9ICL A;  3R9K A;  3ONN A;  4O3R A;  8ICM A;  1GO3 F;  4Y2S A;  5KFQ A;  2DKZ A;  4Q8E A;  1UCV A;  2K8A A;  3LWM A;  8ICT A;  3THV A;  4UAR A;  1JIH A;  4LZD A;  1DK3 A;  4BWJ A;  3TQ1 A;  5AK6 A;  4DSF A;  8ICG A;  5KG2 A;  3M6Z A;  3TI0 A;  2H3F A;  4OJL A;  3ZDC A;  4Y2U A;  4EEN A;  2VKQ A;  1MQ3 A;  4IL6 U;  1MN8 A;  2FMQ A;  1N62 A;  3B0Y A;  2F1J A;  7ICS A;  4O3O A;  1RYS A;  4KX5 A;  3N7P D;  4Q44 A;  3CW2 C;  2CN1 A;  5KFL A;  4LZG A;  3C29 A;  4DQS A;  4KMU A;  5KT7 A;  5B66 U;  3T5K A;  3LDA A;  5ALM A;  3IRU A;  3QX7 A;  2JEF A;  2YMQ A;  4NV0 A;  1Q3U A;  2O6K A;  3PV8 A;  1L3S A;  2NV3 A;  2DBY A;  3NVW A;  4ECV A;  3GZF A;  2BQU A;  3QZ8 A;  2R8H A;  3MGH A;  3NTU A;  3GIL A;  3SQI A;  2V9W A;  4C7Z A;  2PFN A;  1VDV A;  9ICJ A;  5AM0 A;  1QSS A;  4YXJ A;  2WHE A;  2LYB A;  4K4H A;  5J0P A;  3TAN A;  1PVP A;  2C2R A;  1KW4 A;  4RNM A;  1QQ5 A;  4DFK A;  3NRW A;  3PX0 A;  4R8U A;  2PXI A;  3ZDA A;  4RQM A;  1RYU A;  4ECR A;  2AU0 A;  1Z3E B;  2KD1 A;  2G0A A;  1NJX A;  2GLE A;  4DQI A;  3QXG A;  2HI0 A;  5ALY A;  4I2F A;  2HBL A;  2CXY A;  7ICE A;  5J2A A;  1SL1 A;  2ZUC A;  3QUQ A;  5AKI A;  5KFT A;  5KFY A;  4JV0 A;  3SV4 A;  2BR0 A;  4DOB A;  2VAN A;  5CB1 A;  1XC9 A;  4PGQ A;  5KG6 A;  2W04 A;  4Y2X A;  5AIC A;  4KLH A;  1VJ5 A;  1S76 D;  4Q8F A;  8ICE A;  5AIA A;  2XIC A;  2LM4 A;  5G5G A;  3RF9 A;  3AM9 A;  5AI0 A;  3C2M A;  1BNO A;  2JR5 A;  4KLL A;  5AM4 A;  4Y2T A;  2KJ5 A;  1ZQV A;  3HIL A;  2QB0 A;  5KFH A;  5KT6 A;  3SZ2 A;  3WU2 U;  1Z00 B;  2KFN A;  2H5X A;  3T5H A;  1ZQX A;  4UAV A;  4IS7 A;  2Q4T A;  3IP4 B;  2LYA A;  1DXS A;  4M0A A;  4RT2 A;  2R8J A;  1NI3 A;  2W7O A;  3QUT A;  2RRD A;  5KFP A;  4QZH A;  3NGD A;  1TAM A;  9ICP A;  3B0X A;  2OWO A;  3GDX A;  2V4R A;  3DDH A;  4RQ3 A;  2LYH A;  5ALP A;  1N63 A;  4DS4 A;  3GQC A;  3Q8S B;  1L8O A;  3PMN A;  4QJF B;  1NKE A;  4KLG A;  2Q0Z X;  5AI5 A;  4RZR A;  4M9H A;  3K1Z A;  2BZF A;  1X2I A;  3H8M A;  4JV1 A;  3MFI A;  1D9F A;  2F1I A;  3BQT A;  1X66 A;  4QZG A;  1UA0 A;  3RRG A;  5AHX A;  1N56 A;  2V4Q A;  7ICI A;  3KBB A;  5KT3 A;  4M9J A;  4YMM A;  4USA A;  4I2D A;  2H3Z A;  2NRV A;  3Q8L A;  1OW5 A;  4TQS A;  4ZH4 A;  3T5J A;  4C4R A;  3GII A;  4DSK A;  3Q8M A;  4PHD A;  2R8K A;  7ICP A;  3RFA A;  3OJS A;  2MA1 A;  4EYI B;  4ED8 A;  5CJ7 A;  4DL2 A;  5J2B A;  4C4S A;  1A76 A;  1SV4 A;  2BQR A;  4Q45 A;  5CHG A;  3I28 A;  3MAB A;  2NRZ A;  5AM1 A;  3MGV A;  1JX4 A;  4DSJ A;  3KHH A;  3RR8 A;  2A19 A;  3PW2 A;  2KVC A;  3WK5 A;  4O5K A;  3J81 j;  4F2S A;  4O5E A;  2PFO A;  1Z1V A;  4NM1 A;  2DF4 B;  1ZRN A;  5KL8 B;  3HKZ C;  4A8E A;  2ZUD A;  5ALZ A;  1N2X A;  1F44 A;  4UB4 A;  1FEZ A;  4US9 A;  1RZT A;  4GXI A;  2XY7 A;  3F2C A;  5KFR A;  5KG0 A;  2LHT A;  3V6K A;  9ICG A;  3UMC A;  4KMO B;  3ISB A;  4JV2 A;  1K1Q A;  1NOM A;  3PSP A;  4R63 A;  3M8R A;  4QWB A;  3PW5 A;  2BPF A;  1S97 A;  4UBC A;  2WAQ F;  3MDC A;  5T14 A;  5D4B A;  4C8K A;  5DDY A;  2IMW P;  1T94 A;  9ICM A;  2KOB A;  1V97 A;  3MFH A;  3JPR A;  2W11 A;  3RH4 A;  2G5I B;  1COO A;  1JAL A;  2Y0S F;  2JH1 A;  3VCB A;  1PUZ A;  4J9O A;  2R8I A;  1NZP A;  5DB8 A;  2E5S A;  4QZD A;  4C7Y A;  1RQL A;  3CNH A;  2P66 A;  4GXJ A;  2NO4 A;  3UQ2 A;  4DL7 A;  1X9W A;  3OSN A;  7ICN A;  3PW7 A;  3JPS A;  3PW0 A;  3QE9 Y;  2OEH A;  2ISO A;  4I2H A;  1LKY A;  2YMM A;  4O9M A;  1ZET A;  4F5Q A;  2AQ0 A;  5J29 A;  2ZXH A;  2XCP A;  5J0X A;  4CGZ A;  2AJQ A;  3PSI A;  1PVQ A;  2DL0 A;  1Z4O A;  4FE3 A;  1RG6 A;  5L1M A;  2GOL A;  4J9N A;  5H2F U;  1V38 A;  4DO9 A;  3RB6 A;  3IV6 A;  1SKW A;  4NLZ A;  4ELU A;  3C1Z A;  5AKX A;  1F5S A;  1Q8K A;  3M9M B;  3SD7 A;  9ICF A;  4IRC A;  2C2E A;  2HCF A;  3IHQ B;  1BPB A;  4DOA A;  3V7L A;  3PO4 A;  1QCK A;  5AKL A;  3NVY A;  4CCH A;  2ZIU B;  2A1J A;  3C23 A;  1TAU A;  3AQE A;  5ALD A;  3RBE A;  1ZQT A;  1KRP A;  4ED7 A;  1TE2 A;  1NK5 A;  3EWA A;  4F4W A;  2MRL A;  1KEJ A;  3E2E A;  3C1Y A;  5A0L A;  4OJP A;  5HP4 A;  1ZD2 P;  2OYY A;  4F3O A;  2JH7 A;  5J0S A;  4DSL A;  4M04 A;  5KAF U;  4UB8 U;  3N4M B;  3M1Y A;  5J2E A;  2HHQ A;  2G07 A;  3D6J A;  2W43 A;  2WB1 F;  4DCC A;  2MAX A;  1SV0 C;  2W54 A;  5KFG A;  4EBE A;  4I2I A;  1KLN A;  4DF8 A;  2K60 A;  3C21 A;  1L7M A;  2FMP A;  3AL0 B;  3RJI A;  1SZH A;  4BUG A;  2HW3 A;  4IQW A;  2XGQ A;  1C7Y A;  2F3N A;  7ICU A;  3RB4 A;  5HR6 A;  1XNS A;  1A0P A;  1X42 A;  4FBU A;  3IG8 A;  1N48 A;  2E8P A;  1KFS A;  3GIJ A;  2KVS A;  4YMN A;  5B5E U;  3ZDE A;  5DB7 A;  3SV3 A;  2GWS A;  2P6R A;  1L7O A;  1JRP A;  4TUS A;  2ZJ5 A;  4Y2Y A;  4YN4 A;  4QZC A;  3TAR A;  2I5H A;  4M9G A;  5CRX A;  2IHN A;  2JMG A;  3V72 A;  1SKR A;  3KFU F;  2AH5 A;  3B9J A;  4JWN A;  9ICU A;  4C4T A;  5L1K A;  3UQ0 A;  2ZIU A;  2E1E A;  3LYS A;  2W9B B;  2BCR A;  3AU2 A;  4C8M A;  2HBK A;  1NKB A;  2I1Q A;  1XWL A;  2PMZ F;  3QEA Z;  1XS9 D;  1T8E A;  4QW8 A;  3H0R B;  1CUK A;  4EEL A;  1OXJ A;  2W9M A;  4UB1 A;  3N7R C;  4M6W B;  1PK3 A;  4J9P A;  1UA1 A;  3EPG A;  4F93 B;  1UHU A;  2F77 X;  1URJ A;  2FPK A;  2WF8 A;  1UQV A;  3SR6 A;  3BDP A;  5HHH A;  7ICT A;  4KLO A;  4EZ6 A;  1NJZ A;  1COK A;  4F71 A;  5KT5 A;  2F2A B;  3QU2 A;  4J9K A;  2VA3 A;  1ZQW A;  4RUC A;  5DQI A;  1ECW A;  3ZDD A;  3UMG A;  2VJ5 A;  5J2F A;  3FYH A;  3TAQ A;  9ICI A;  4RQ5 A;  1IM4 A;  5KG5 A;  4F92 B;  3H8J A;  1ZOL A;  3ICX A;  1NZB A;  4DL5 A;  2KG5 A;  7ICK A;  5IIJ A;  3GV5 B;  1KDH A;  4ZOH C;  5J8Y A;  4KIT B;  1C20 A;  2NO5 A;  5J2C A;  2XY6 A;  2YB1 A;  4RQN A;  4HYK A;  1F0M A;  3MBY A;  4FZN A;  2RQ5 A;  3L4P A;  4ELV A;  2XCA A;  5ALS A;  4RPX A;  4RUA A;  4EEK A;  5ALG A;  5CWR A;  1U45 A;  3OSP A;  3QU7 A;  2GO7 A;  2UVU A;  1O03 A;  1KQQ A;  3N7S C;  1ZQU A;  2PKE A;  4YMO A;  3CYM A;  2IHM A;  1L6N A;  1V85 A;  4UAU A;  3GV7 B;  8ICR A;  3V6H A;  4DL6 A;  1ZQE A;  4OO1 J;  1IG6 A;  2B0C A;  1ZD4 A;  2KN7 A;  3MR6 A;  3S6J A;  2Y0S C;  1L3T A;  5AKH A;  2ES6 A;  3T79 A;  2JEJ A;  2K8C B;  4UW9 A;  1CI4 A;  4AYB C;  3O0F A;  1D8Y A;  9ICC A;  4O5C A;  4NLK A;  4DWI A;  1L5U A;  2HOI A;  5KFD A;  1XSL A;  5IIL A;  4DFM A;  4CE6 A;  3WKB A;  3ZD9 A;  5JRT A;  5FP0 A;  2E1F A;  5J2J A;  3Q8K A;  4JWM A;  3BJY A;  2BPC A;  5BOL A;  4RQ1 A;  1MC8 A;  2ESE A;  3N97 B;  8ICK A;  5DLF A;  2DPI A;  5F9L A;  2G5H B;  1YZ6 A;  5J2G A;  4UB5 A;  1QTM A;  1ZYQ A;  2EQY A;  3L5K A;  3MR3 A;  2HBM A;  3QEB Z;  3ETR A;  4RU9 A;  2RDJ A;  8ICS A;  3H8S A;  5KFS A;  3F2B A;  1KFT A;  4RQ8 A;  5AI8 A;  3RJF A;  3SMV A;  3H0M B;  3UXO A;  5KFF A;  4QWA A;  3UPQ A;  3SYZ A;  2HHU A;  2XO7 A;  2YML A;  3QU9 A;  3EPI A;  3WKE A;  3MR5 A;  1D8L A;  5ALV A;  3IN5 A;  4DFJ A;  2M0N A;  2P6U A;  5AKE A;  1NK9 A;  9ICR A;  1DK2 A;  2ZUB A;  2ZIV B;  3TAP A;  2JV3 A;  2MSN A;  4YVZ A;  4YQW A;  3RJE A;  1Q46 A;  1S0O A;  3PR5 B;  2KK0 A;  4QWE A;  5DBA A;  3MDA A;  8ICI A;  3PY8 A;  2N1R A;  4QZF A;  2QAR B;  4KLT A;  3NVZ A;  4B9V A;  4ECS A;  1Y88 A;  4PL1 A;  2KJ8 A;  4UQG A;  3KZX A;  5J0O A;  2FJ6 A;  1PVR A;  1QLN A;  8ICH A;  9ICT A;  1WCL A;  4NL9 A;  4O3P A;  1Z00 A;  2MUT B;  1HIW A;  2ALZ A;  3D2N A;  2Y9U A;  5KFJ A;  3K4G A;  3SI8 A;  2XY5 A;  5J0U A;  2E8O A;  1JXL A;  4I29 A;  3HP6 A;  3HT3 A;  4ECT A;  2H3I A;  2HHV A;  1ZQS A;  2PFQ A;  2FDR A;  1ZQO A;  1SXD A;  2IBK A;  3GIM A;  3EW9 A;  4F5P A;  4I2E A;  9ICN A;  1U49 A;  4ECZ A;  4DEZ A;  5HNK A;  2ASJ A;  3MGI A;  4EBD A;  5KG4 A;  5EE9 A;  1ZQ1 C;  5DG9 A;  3FC4 A;  1TK0 A;  4B9M A;  4NXZ A;  5C5J A;  5AM5 A;  4ED6 A;  4K4G A;  3G6V A;  4PHE A;  3HPO A;  1ZQQ A;  4BDP A;  2DWQ A;  3BS7 A;  3HRD D;  5KFK A;  3G6Y A;  1LVH A;  4O3S A;  5AM2 A;  1WWU A;  3RTV A;  2D8C A;  3JPP A;  3C2K A;  1BNP A;  5AK3 A;  4ACO A;  4CF3 A;  2KZZ A;  1MSW D;  1ZQP A;  1T3Q A;  3V6J A;  3RJK A;  4F4K A;  7ICO A;  2NYV A;  5AKZ A;  1LV5 A;  9ICS A;  4US8 A;  2NRT A;  2YX8 A;  2YTU A;  7ICV A;  4TUR A;  2I9G A;  4KLS A;  1RDF A;  2FE9 A;  4UAT A;  2LBO A;  2EZZ A;  2AHO B;  3F2D A;  4KLJ A;  1WWV A;  1ZQD A;  9ICO A;  5DQH A;  2ODG A;  4DFD A;  3M9O B;  2HVH A;  5D49 A;  1ZD5 A;  3OHA A;  2XVT A;  5BPC A;  2G09 A;  4XRH A;  3WKD A;  5KFN A;  4RQ7 A;  2HSZ A;  1Z1B A;  4Z6E A;  4UBB A;  1RM6 C;  5KFZ A;  2HHT A;  5DKW A;  2A1A A;  1TVA A;  4P0P A;  4QZI A;  4F50 A;  1L3V A;  4YP3 A;  5EE0 A;  1QH9 A;  5AKJ A;  5TIS U;  4QZ9 A;  4UB2 A;  4F4X A;  1RXW A;  2A1J B;  4P4M A;  5J2H A;  2RLT A;  3KKA A;  4DLG A;  4I2C A;  4IR9 A;  3SEI A;  5AM3 A;  1ZQA A;  3BQ7 A;  1IIP A;  5ALW A;  2W7P A;  1SGG A;  1N5X A;  1ZQG A;  4Y2V A;  4G3I A;  3WK9 A;  4KX3 A;  4LJX A;  2W8K A;  1DRG A;  2ZJA A;  4NWI A;  2BCU A;  3HW8 A;  1NK0 A;  1Z19 A;  3PML A;  2F44 A;  2CRX A;  3UMB A;  1EXN A;  4OJ6 A;  2ZIX B;  4BJQ A;  2ZG6 A;  1FO4 A;  4FFD A;  4J9Q A;  3KD3 A;  2KJ9 A;  2KHV A;  4Y2Q A;  2BCS A;  1LKY B;  2EAM A;  3LVW A;  4NL9 C;  4ELT A;  2EZY A;  5L1J A;  2W9A A;  2F8K A;  1ZQN A;  2IOF K;  1ZD3 A;  4CF5 A;  2Y1J A;  4MEY A;  8ICL A;  4C8O A;  3H40 A;  3G6X A;  2W9C A;  1S77 D;  1K1S A;  4I2B A;  2WF5 A;  2VA8 A;  1KL9 A;  2ZTE A;  9ICH A;  3KOO A;  3TFR A;  1ZQI A;  4CRX A;  4QNL A;  1CRX A;  4P0Q B;  8ICY A;  5AI4 A;  4P2H A;  1JI7 A;  7ICG A;  5ALK A;  4AP9 A;  4OJ5 A;  4KLE A;  4MEX A;  2BDU A;  3QYP A;  4KLU A;  2Y9T A;  5J2D A;  2FMS A;  2HOF A;  2PI5 A;  1HEK A;  5DQG A;  3TAD A;  3H8W A;  4R65 A;  4R64 A;  4E0D A;  2HVI A;  2LMR A;  3PR4 A;  2R18 A;  3F53 A;  3H7I A;  5DLG A;  9ICQ A;  2J6U A;  2A3V A;  2BCV A;  4B9N A;  2G06 A;  1DGJ A;  2MUT A;  5ALU A;  3GV8 B;  1ZQK A;  2B6G A;  2EAP A;  3JPN A;  4M6W A;  1OUQ A;  3FM9 A;  4FZL A;  1BVS A;  1JN3 A;  4JK1 A;  1X9X A;  1U9L A;  3L3F X;  3BZK A;  4EX7 A;  4F4Z A;  1WG8 A;  1ZXI A;  3ZDB A;  2PI4 A;  1V9P A;  4BWM A;  3RH5 A;  2KIC A;  3KHR A;  2C2D A;  4RNO A;  4PGY A;  4NM2 A;  5ALH A;  1SIJ A;  2BCQ A;  2KNJ A;  3V7J A;  1KFD A;  3FAH A;  4F5N A;  1SKS A;  2HHX A;  1XU4 A;  1ZQB A;  2WTF A;  5DG7 A;  4DSI A;  3BQ1 A;  1X6I A;  3RBD A;  4B6J A;  1T4G A;  3PX4 A;  4RPY A;  5KFB A;  8ICW A;  1KKX A;  4BXO A;  1ZJM A;  3M6K A;  2YQE A;  2I6X A;  4IRD A;  4YR0 A;  4C8L A;  1PK1 A;  3WK7 A;  1KSP A;  5IIN A;  5HMM A;  4I2J A;  3OJU A;  1RYR A;  2NRX A;  3C5F A;  4DF4 A;  5EWE A;  4J9L A;  5G5H A;  4YXM A;  2OH2 A;  5DGB A;  3AU6 A;  3JPQ A;  2HHW A;  4CF4 A;  1FFU A;  5DG8 A;  1JRO A;  2ASD A;  4M9L A;  4MF8 A;  4UAY A;  7ICL A;  4DLE A;  2XI9 A;  4FS2 A;  4K4I A;  4GC6 A;  1X40 A;  1L3U A;  1NKC A;  1PK1 B;  4YG2 A;  3PZP A;  4B9T A;  4LVS A;  1UT8 A;  1O08 A;  8ICV A;  3DV9 A;  4B9S A;  3PSF A;  4QZB A;  5DBB A;  7ICQ A;  4F5R A;  2DUY A;  3QNM A;  2WFA A;  5IIK A;  3UXP A;  3PVX A;  3RJG A;  4F72 A;  3KTQ A;  2WF6 A;  4OCZ A;  4RNN A;  4UAS A;  8ICN A;  2AGQ A;  1X9S A;  2KHQ A;  5AK4 A;  1TAQ A;  4EEY A;  5ALE A;  2IOH A;  4XA5 A;  2KFZ A;  3PST A;  4IR1 A;  4YR3 A;  3M7D A;  5GTH U;  2IOF A;  8ICC A;  4KTQ A;  4OJO A;  8ICU A;  3F5E A;  3WKA A;  4B9L A;  1WCN A;  1BPE A;  4J9R A;  5KFA A;  4Y2J A;  2KP7 A;  1N60 A;  1VLB A;  2QLT A;  1NK4 A;  4B9U A;  1N5W A;  2JXJ A;  3ZI4 A;  5AK5 A;  2VJ4 A;  3KZI U;  1FFV A;  2EDU A;  4ECW A;  3E0F A;  2J6T A;  2DPJ A;  4NLB A; 
#chains in the Genus database with same CATH homology
 2JXJ A;  1KN5 A;  1KQQ A;  1IG6 A;  2CXY A;  2KK0 A;  2YQE A;  5K4L A;  1C20 A;  2LI6 A;  4LJX A;  2EH9 A;  2RQ5 A;  2EQY A;  2OEH A;  1KKX A;  5CEH A;  2LM1 A;  1RYU A;  2JRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...