1KKXA

Solution structure of the dna-binding domain of adr6
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
102
structure length
102
Chain Sequence
NNKQYELFMKSLIENCKKRNMPLQSIPEIGNRKINLFYLYMLVQKFGGADQVTRTQQWSMVAQRLQISDYQQLESIYFRILLPYERHMISQEGIKETQAKRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription regulatory protein ADR6
publication title 1H, 13C and 15N resonance assignments and secondary structure of ADR6 DNA-binding domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 18
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2001-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 1kkxA00
2OEHA 1KKXA 2LM1A 1IG6A 2LI6A 2CXYA 2JXJA 4LJXA 1KQQA 2YQEA 2KK0A 2EQYA 2JRZA 2EH9A 1RYUA 1KN5A 2RQ5A 1C20A 5CEHA 5K4LA
chains in the Genus database with same CATH superfamily
4YG2A 1RPLA 2E5SA 3RB0A 1NK5A 1ZQFA 2BQ3A 1ZQCA 4PHDA 1XSNA 2I9GA 2W55A 4O3PA 3QXGA 2DL0A 1WCLA 3RJEA 4FS2A 1S77D 1PVPA 4CF4A 3T5KA 1XNSA 1L7NA 2Y9TA 4TURA 2CRXA 3SENA 4DL4A 1NJWA 3WKAA 2HOIA 3MGHA 1O08A 1SWWA 2LYBA 3QU7A 4ELUA 1KLNA 2QKQA 2FDRA 3IDWA 2G5HB 1F44A 4UB1A 5KG2A 3RBDA 3GV8B 2PI4A 2QB0B 8ICYA 2ZTCA 4J9RA 8ICCA 1ECWA 5IIKA 1BPYA 5JUMA 2W3SA 3RJJA 4NV0A 4UB6U 2ZIUA 1VJ5A 2JRZA 3N7PD 3E0FA 3ZDAA 2GWSA 4F5QA 2HHSA 3GIKA 2QARB 4C7YA 3NVYA 5ALXA 2RHFA 3CNHA 2ZTEA 4B9MA 2KNJA 3V7LA 2DKXA 5KT7A 5CP2A 2B0CA 7ICQA 1LV5A 2M0NA 1CI4A 1ZQHA 2KKVA 7ICFA 4MEYA 5AI9A 2HHWA 3RTVA 2EAOA 3AN1A 3WKDA 5GTHU 4FO6A 1A77A 4EENA 2E8MA 3MR6A 2DBYA 4C8LA 2RDJA 4EEKA 5KL8B 2JHDA 2PKEA 5IINA 2ES6A 1ZQPA 4O9MA 1S97A 3D2NA 1HIWA 3C1ZA 4PGXA 2YB1A 1XS9D 3RB6A 2HBLA 3AUOA 2AH5A 8ICTA 1NK7A 3KKAA 2KP7A 4F92B 3C5GA 2G0AA 2WF5A 1K1QA 2Y0SC 2O6KA 5J2FA 4OJ6A 3RR8A 2ESEA 3KFUF 3SMVA 2RRDA 7ICHA 3RH5A 4RPXA 2AGPA 4PHPA 3ONNA 5EWFA 4C7ZA 4JWMA 5AIBA 2W43A 3N7RC 3M9OB 1S0OA 4I28A 3C28A 1KFSA 2C2EA 4EBDA 1SZHA 2MAXA 4O3MA 4EX6A 1ZJMA 1X6IA 2IOHA 3B0YA 2J6SA 5J2HA 4ICAA 2RQ5A 4AYBF 2KHVA 1ZQEA 5CRXA 2KZMA 1SV0C 2IHMA 2OEHA 2BPGA 4I2IA 1FIQA 4NL9C 4TQRA 2HOFA 4F2RA 3UQ0A 2NV3A 4PPXA 4B9TA 3KHHA 1U4BA 3QEAZ 1SKRA 1ZD2P 4P2HA 3ISBA 2KJ5A 4DL5A 4K4IA 1JX4A 2DWQA 3BJYA 9ICEA 1COOA 3PW0A 5D49A 2OH2A 2W9CB 4Z6EA 5KFZA 9ICTA 3M6ZA 4F4ZA 4Q44A 4ECRA 4US9A 4JWNA 4MF2A 1QQ5A 5AM1A 3G6YA 1L3UA 5ALOA 4DCCA 4DQRA 3MGVA 2KSOB 4M9NA 5AI4A 3GDXA 3T5JA 4YCXA 1QSSA 3V7JA 2XC9A 1L7MA 4Y2RA 5KFPA 1IG6A 2IA6A 2R8HA 1SL2A 5J2AA 1IM4A 3CW2C 4RQ8A 4DSKA 4EZ9A 4IQTA 8ICUA 1L3SA 3PMLA 3N4MB 3SYZA 3SR6A 2OYYA 3U26A 9ICIA 4J9OA 2HHVA 4DF8A 2DKZA 1U49A 4IL6U 5KG0A 1RQNA 4FZLA 2QB0A 1BPBA 4I2BA 3DDHA 4DQQA 2KJ8A 5DKWA 2YY6A 1RXVA 5AK4A 1BGXT 1A0PA 1X2IA 3NGDA 4KLUA 3M8RA 4IR1A 4KLSA 2G08A 1H38A 4Y2YA 1DK2A 2KIWA 1T8EA 5GTIU 3SD7A 5J0RA 2K8BB 4OJLA 4FZMA 4J9PA 1U47A 4O3NA 1S0VA 1OW5A 3K1ZA 5AKEA 3RRGA 4PZNA 3RJKA 3EPGA 4Z6DA 4F50A 4Z6FA 4QZHA 4FFDA 1RG6A 1X66A 4DL6A 1U45A 1BPDA 4CCHA 8ICXA 1L3VA 4TUQA 2KVCA 5DBCA 5J8YC 7ICVA 4RQ3A 1ZQUA 4DOBA 1S0NA 4JMUA 1JROA 2EZYA 3GZFA 3QZ8A 2YMPA 4Y2VA 5KFRA 3WK6A 1XWLA 3JPTA 1PVRA 5KFWA 2PI5A 5DGBA 3IRUA 4Y2SA 4QZGA 5AI8A 3TARA 2BCUA 3MBYA 3BQ2A 5AI0A 1X40A 4PGQA 3AM9A 1TAMA 4YD2A 1ZOLA 1UA0A 2BZFA 1Z00B 5F9NA 2UVWA 1MC8A 4Z6CA 7ICIA 4AP9A 3GV7B 3G6VA 1UA1A 4O3RA 3B0XA 1X6JA 8ICGA 2HDOA 3QUCA 3TANA 1TFRA 2MRLA 5ALEA 3HJEA 1SXEA 2KD1A 3OGUA 3AEVA 2XICA 4EELA 1A76A 3UQ2A 5EWGA 5ALWA 3Q8RB 5BPCA 7ICGA 4ECZA 2BDUA 1MQ3A 3OPXA 1K5OA 4DS4A 2PFPA 4UQGA 2K89A 3NRWA 4JB3A 3UXNA 5AKKA 9ICFA 7ICNA 2JGAA 3L4PA 5AKYA 2AGQA 2Y1JA 2C2DA 3N7SC 4NLGA 4ECYA 3G6XA 4RU9A 2CN1A 1VDVA 1BNPA 9ICQA 1TV9A 5AKXA 2F76X 2W9CA 5ALQA 5DB8A 3JPNA 1Z4OA 5ALNA 2G09A 5KFQA 1NK8A 7ICRA 2YTUA 3ZDEA 1QQ6A 1N5XA 3IN5A 2WB1F 2HBJA 4UB4A 5J0SA 2BGWA 3GQCA 2IMWP 5KG5A 2KSOA 1YZ7A 5F9LA 3PSFA 2UVUA 4UAWA 5IIJA 5J2BA 3UXPA 5AM3A 1ED1A 3D6JA 2KK0A 2JEJA 2ZJ8A 1XSPA 1JN3A 3WK8A 5J0OA 4NLBA 4CF5A 4ECQA 1TKDA 4IR9A 1SIJA 4UB3A 4KMOB 4M47A 4A8EA 3F2CA 1Q3UA 4YR2A 5ALTA 2BPCA 4RQ7A 4MF8A 3RFAA 1ZQMA 8ICEA 2E1EA 4P0PB 1JXEA 1D8BA 3ETRA 9ICXA 1SXDA 4YXMA 3PW2A 4IQWA 1UCVA 2XO7A 1UT8A 3F53A 4BDPA 3NVVA 5D4BA 2V4RA 1C20A 2BCVA 2LYAA 2Y0SF 2VA8A 1NKCA 3BZCA 1U9LA 3AQFA 3T79A 3RF9A 5KG7A 3LK9A 4EZ6A 1B43A 4R66A 2OHFA 3OHAA 2AU0A 1CUKA 1J2MA 3WK5A 4DL3A 4F4WA 5DQGA 3WK9A 1PK1B 1KQQA 4ECVA 2NYVA 1K1SA 3EYZA 1MQ2A 1PK3A 2GLEA 4I2DA 5KFDA 8ICAA 4GIBA 2L5YA 1A6SA 2FJ6A 1SL1A 2W11A 4Y2XA 4J9NA 3T5HA 2ZXIA 4PJ0U 4TUPA 3Q8LA 3ZD9A 4ECTA 1BPXA 4O5EA 1T3NA 1ZRNA 3GIJA 1SV0A 4J9LA 2W9AA 3H4BA 1ZXIA 7ICSA 4KN4A 4F5NA 4DQPA 4DSEA 5DDMA 3H0RB 1JIHA 4I29A 4IRKA 5L1MA 1BPZA 8ICWA 2FPLA 4GXJA 1QSLA 5KT3A 3M8SA 4U7CA 4ED7A 1TK0A 2LYHA 3MC1A 4KN7A 5KFEA 2KN7A 3RH4A 5CA7A 2MUTB 4RNNA 2PFNA 3CRXA 8ICJA 2PMZC 1Z00A 4F5PA 3KHGA 2K4EA 5HMLA 5KFXA 3B9JA 5C5JA 3UXOA 5CJ7A 4ZH4A 4RQ5A 5ALJA 4KLGA 2R8IA 1TVAA 4QZIA 5AKZA 4KLQA 2IBKA 2WF7A 5L1IA 1B22A 3TFSA 4I2CA 1DGSA 1SZPA 5DG7A 1RM6C 4P4PA 2J6TA 7ICTA 2F3NA 4PHAA 2HVHA 2MU2A 2ISOA 5BOLA 7ICEA 5EE9A 4F91B 3SQIA 5EE1A 3LWMA 8ICNA 9ICRA 4CF3A 2JV3A 8ICHA 5J0UA 5HNKA 1URJA 5ALIA 5KFUA 1X9MA 1LB2B 3HKZC 4I2GA 2ZUCA 1FEZA 2Q0ZX 5J2EA 2H3VA 2BDPA 1KSPA 5ALZA 2YMLA 3PO5A 3V72A 1NKBA 5AI6A 2G5IB 5DB6A 4C0ZA 3KHRA 3BDPA 2LI6A 1X42A 3NVWA 1O03A 1AQ6A 3IV6A 1RZTA 5KFOA 5EOZA 5J2GA 4MHVA 3RB3A 2H5XA 3IG8A 3QYPA 2F1HA 1ZQDA 5CR0A 1XC9A 1J97A 3IP4B 2K4HA 1QLNA 1Z4NA 4LVSA 3VCBA 2W03A 1QH9A 3IM1A 3Q8PB 3JPQA 1SWVA 4J9MA 4QW8A 4GLXA 5KFMA 2KKPA 4R8UB 1SB3C 3L5KA 3M1YA 3GILA 1XSLA 7ICLA 9ICKA 1V97A 4QIWC 3IHQB 3GV5B 2DGZA 3N28A 2G07A 3AQEA 4JK1A 5EWEA 5J8YA 1N63A 4P0PA 1DOQA 7ICUA 4JV1A 2WAQF 4DOCA 5G5HA 2V4QA 4DOAA 3DV9A 3QUQA 3LVVA 3MABA 5KAFU 4C80A 3F5EA 2XGPA 2FMPA 5AK6A 1KW4A 2BCRA 5KT6A 2MSNA 3F2BA 2JXJA 2EZZA 5DG9A 4IC9A 2JMGA 2JH7A 1PK1A 2UVVA 2WTFA 8ICZA 1OXJA 3MR3A 2GO7A 3H8WA 5ALGA 4I2AA 3QU4A 1COKA 5KTQA 1S8OA 2OWOA 4M04A 2LMRA 3FYHA 2RLTA 5HMMA 3LDAA 1BNOA 5A0LA 1RXWA 4UASA 2E8NA 2ZIXB 1FFUA 4ECSA 3Q8MA 2F77X 4KLOA 4NWIA 1NJYA 2UVRA 4I27A 4MEXA 3PO4A 1ZQBA 1KN5A 3BQ7A 8ICOA 2RP5A 5J29A 4Y2JA 2QLTA 2Z7JA 1FO4A 4KLFA 3TADA 4UAUA 2ATLA 4M2YA 4KLHA 4YR3A 3UPQA 2WF9A 5ALYA 5KFYA 2G06A 5ALDA 8ICMA 3QZ7A 4NM1A 2R8GA 1WG8A 5HR7A 3L3FX 4LZGA 1ZQXA 1HEKA 4QWBA 4QWCA 1NJZA 5TISU 3N97B 2OCEA 1WCNA 2XGQA 1ZQ1C 5AICA 9ICHA 2DFLA 2LHTA 2MUTA 4B9VA 1RYSA 3Q8KA 1SKWA 3I28A 3V7KA 2ZUBA 2F8LA 5IIOA 2ASDA 5IILA 9ICOA 4IQUA 3H0LB 4C4SA 5JTIA 5KG6A 3C29A 2ODGA 3TAPA 4DSIA 2D8CA 2W9MA 8ICSA 2EZXA 1N5WA 1U48A 1ZQQA 3JPSA 4F3OA 2I1QA 4I2JA 1ZQYA 4XA5A 1JMSA 4IRDA 1ZQSA 1GO3F 2LKYA 2P35A 3Q8SB 4G3IA 3TKAA 9ICMA 5L9XA 2DF4B 4J9KA 1TK8A 4ELTA 2HMXA 3QU9A 3IG5A 3T3FA 2ZTDA 3H7IA 3D2QA 4EEYA 3H8JA 2KV2A 1ZQGA 2QARA 2FPMA 3ZDDA 4DSLA 1S0MA 1NK6A 2FPKA 2C28A 4PGYA 5KFGA 5J2JA 4PL1A 1S9FA 2P66A 5KFFA 2KOBA 5AK5A 4O5CA 3BS7A 2HHXA 3THVA 5KG4A 4NLZA 5J0WA 2Q4TA 3QEBZ 3KBBA 2XY7A 1L7OA 4YD1A 2CXYA 4BWMA 2GOLA 4CRXA 4ED6A 1VLBA 2EQYA 5AM2A 2C22A 2AHOB 4BWJA 4C4RA 5KFJA 3OHBA 2KMDA 3H0MB 4JUZA 5KG3A 3OSNA 5ALVA 3PSPA 1ZQKA 2VA3A 2FLNA 3MFIA 5CEHA 3C2MA 4BXOB 9ICUA 3SV4A 2XY5A 2DPJA 4DQSA 2W9BB 1KDHA 4DS5A 4ECUA 3BQ0A 1KFDA 4DEZA 4R8UA 5C0YA 3GIMA 5FP0A 2KZZA 3EZ5A 4QNLA 4NM2A 9ICVA 3SAGA 4B9SA 4QJFB 5DBAA 2W8KA 5DG8A 1KKXA 2LM1A 2IOFK 3R9KA 2ISPA 3D2SA 2DUYA 9ICNA 4IS7A 1ZETA 5KT4A 3WK4A 3OJSA 3C2KA 2F8KA 3C1YA 2ZIWB 4NLNA 2P6UA 3HRDD 1N56A 3KD3A 4RQ2A 7ICKA 3NVZA 4OJ5A 5KG1A 2BKEA 5KFBA 5J0TA 4AYBC 4UB2A 1ZQJA 1ZD3A 3GFKB 3FDSA 5AM5A 8ICQA 9ICBA 1NKEA 4ECXA 1D8YA 1N60A 4M9JA 9ICGA 2ZIXA 4I2HA 3NTUA 3EUB2 5BOMA 5AK3A 2VANA 4BX9C 1PUZA 5AKIA 2KEYA 4CDGA 2EAMA 4FBTA 5KFAA 4M9HA 1D9FA 2J6UA 4BUGA 3QUTA 2HHTA 5G5GA 5KAIU 2R8JA 4M9GA 3WKEA 3RR7A 1YZ6A 4Y2PA 1YT3A 3QX7A 2NO5A 3A0BU 3RJGA 3RRHA 2DPIA 2E3TA 5DGAA 3WK7A 5KFNA 1V38A 9ICLA 2DQNB 3CYMA 3QNMA 1D9DA 3WKBA 1JUDA 1T7PA 3E58A 4R64A 5IIIA 2H3QA 4ED3A 1ZJNA 9ICAA 2JZBB 9ICJA 4GC7A 3QU2A 2E8OA 5B66U 1DRGA 3E2EA 4JV2A 3UMBA 3C21A 2KFNA 2A19A 5KFSA 1KTQA 5IIMA 4MFAA 1NK4A 2ALZA 4KLMA 5ALKA 1N61A 1J2NA 2IOFA 4QZDA 4OJOA 3KTQA 1RDFA 4HYKA 2KFZA 1QTMA 2KICA 3K1RB 2YMQA 1IV8A 1RYRA 2K60A 2HHQA 1ZQTA 5AM4A 3SZ2A 4DFPA 4RUCA 2VJ5A 5AM0A 9ICPA 1Q3VA 4F4KA 4NJ8A 3C2LA 3PZPA 7ICMA 8ICIA 4M9LA 3SI8A 1ZYQA 4I2FA 2JH1A 3LYSA 4C8NA 4Y2UA 4R63A 1ZQOA 1JRPA 2ASLA 4B6JA 3KZXA 3NRZA 4C4TA 5F3XB 3UMGA 3QU5A 1Q46A 3RB4A 4DL7A 4O3SA 4YVZA 2NO4A 5KL1B 3M9NB 5KT5A 4F93B 5DQIA 4RQ6A 2MA1A 8ICVA 3M6KA 5HR6A 1Z1BA 4ELVA 5J0PA 1DGJA 2K4PA 3ZDBA 4NL9A 4KX5A 3PX4A 3HT3A 1AROP 3BQ1A 4Q45A 4YMNA 2OM6A 2VIXA 1N62A 2PFQA 3JPPA 4DSFA 4BXOA 4QZEA 1WYGA 4UB5A 4F4XA 4B9NA 2W9BA 2AGOA 2K8AA 3ETLA 2Y1IA 5B5EU 3Q8QB 5HHIA 3FM9A 5J0YA 2I5HA 2YX8A 4UBBA 3JPOA 1Q8KA 4LJXA 3MGIA 1JALA 3AU2A 1TK5A 1NI3A 3RJIA 2VA2A 1F0MA 4P4MA 4O5KA 2BPFA 2NRVA 1CRXA 4O3QA 2XI9A 2BQRA 2KHQA 2ZIWA 4Q8EA 3J81j 4PL2A 4IRCA 4Q8FA 4UAVA 1Z19A 2WF6A 3PR4A 1V9PA 1KL9A 1KFTA 3C23A 2K4IA 8ICFA 5ALSA 1C7YA 3ZI4A 4ED8A 5T14A 1ZQRA 5EE0A 5L1KA 2W54A 3NUQA 2E1FA 1L3TA 3MR2A 2D6FC 5J2KA 4F71A 5CB1A 5KFCA 1QSYA 1ZQZA 4KLDA 2IHNA 4ED1A 5ALRA 2JEGA 3ISCA 4DSJA 2H3FA 4KLLA 2OXOA 3HILA 4X5VA 3PMNA 3TFRA 4HAIA 4XUSA 2KIVA 5CWRA 4RUAA 4UB8U 4KTQA 3LWLA 1HJPA 4TQSA 1NJXA 5CHGA 2BHNA 3HPOA 4DLGA 3RH6A 5DLFA 3OSPA 2WB1C 4OJPA 4E0DA 4FS1A 3PV8A 4G9BA 9ICSA 2W7PA 1ZQVA 4KLEA 1OUQA 3RAQA 1B0XA 4YXJA 8ICBA 5KT2A 4K4HA 2KG5A 3V6KA 9ICCA 1DXSA 2JZBA 4UAZA 1M6YA 2A1JB 4F8RA 3PW4A 1DK3A 4Q43A 5AKLA 4I2EA 1NZPA 4J03A 3RJFA 4M6WB 1WUDA 4JV0A 2NRXA 5AKJA 3WU2U 4ZOHC 1XO1A 4YQWA 4EX7A 5ALFA 1HUOA 3H8SA 3K75D 4P0QB 3S6JA 3KOOA 3TQ1A 4KLIA 4RPYA 4DQIA 8ICKA 3H4DA 4BJQA 2ASJA 5J0XA 4QWEA 4UAYA 3SEIA 5AI5A 4FZNA 2BQUA 1UQVA 1LVHA 2E8PA 5KFLA 2HCFA 5HHHA 4PH5A 4GC6A 2HW3A 4RT3A 4LZDA 3KHLA 3PVXA 1V85A 2ZG6A 3A0HU 1MN8A 3PY8A 4OO1J 7ICOA 1X9SA 2XCAA 2B21A 4YR0A 4QWDA 4USAA 4ACOA 2AXTU 2HSZA 4YFKA 1P7DA 2ZIVB 2EAPA 1RQLA 2WHEA 2VJ4A 5J0QA 1QCKA 3LVWA 2KZ3A 3WKCA 3MR5A 3DEEA 5KFKA 2V9WA 1ZD5A 3I76A 3HW8A 1TAQA 1S5LU 4ED0A 2QB1A 5DLGA 1KEJA 4EBCA 1MSWD 4YMOA 4Y2QA 2XY6A 2ZJAA 4YP3A 4RZRA 4DFJA 2Y9UA 3H40A 1BVSA 5DDYA 3TACB 1JXLA 2FLLA 2ZXHA 1Z3EB 1WWUA 4GXIA 3OJUA 4C8KA 4DFMA 1LKYB 2D3DA 2W3RA 2W7OA 4QZAA 1HUZA 1Y88A 3FAHA 5DB9A 4NLCA 2CPRA 4US8A 2HVIA 4O0IA 2JR5A 4F5RA 3AMZA 4M0AA 2HOQA 5HP4A 3M7DA 4NLKA 2VKQA 2C2RA 3AL0B 5TZVA 1T94A 2XCPA 3QE9Y 1L8OA 1S76D 1TE2A 1PVQA 3ISDA 3SAHA 1IXRA 5ALPA 1UPHA 2AQ4A 4J9QA 2LPEA 1QQ7A 1XU4A 3EW9A 4CGZA 4RQNA 2YB4A 5KFIA 3PW5A 3GU3A 7ICPA 2GH1A 2WFAA 2A1AA 4EBEA 4IQVA 1JI7A 4CE6A 4KITB 5J2IA 5JU5A 4DL2A 4XRHA 4EYHB 4QZBA 4F4YA 4RNOA 5AKGA 4QZ8A 2P6RA 3F5AA 1T3QA 4U6PA 4ED2A 1Z1VA 2FI1A 3HP6A 4DO9A 8ICRA 4DF4A 2WF8A 5ALUA 2YQEA 5KFTA 3BS5B 5D46A 3ALRA 4DFDA 4RQ1A 1KRPA 2EDUA 4RQMA 3BQTA 1MA7A 1TAUA 5AKHA 4Y2TA 2A1JA 1EXNA 2BCQA 1SGGA 4OD0A 1UT5A 3KKAC 2YN4A 5AHXA 3ED5A 4QW9A 4K4GA 2PFOA 4M6WA 3VC8A 3C5FA 2LM4A 3MFHA 3NS1A 2WAQC 3JPRA 3CP8A 4P0QA 2ZJ5A 3BZKA 3O0FA 5J2DA 4RT2A 2FLPA 4FBUA 3PSIA 4YMMA 3MDAA 3SAFA 2NRWA 2F1JA 2W04A 2F1IA 4F72A 4UARA 5J2CA 1ZQIA 3V6JA 4KMUA 1FFVA 2PMZF 2RDIA 4DWIA 4B9UA 4FE3A 2BR0A 3ICXA 1NK0A 4QZFA 9ICWA 3EWAA 3GIIA 3QUBA 4O3OA 4GXKA 3V6HA 4NXZA 4KLTA 5DBBA 3RAXA 3RBEA 4QZCA 2ZUDA 5ALMA 3HX0A 1B4FA 3PX0A 2KTQA 2ZIUB 2W8LA 4MFCA 4J9SA 2K8CB 2N1RA 3TADC 2ZIVA 1NK9A 4F5OA 1XO0A 2KE7A 1L5UA 4GFJA 1KBUA 5KNIA 3PSTA 3PW7A 3H8MA 5KFHA 3T5LA 4RPZA 2HBKA 2YMMA 3OTQA 1S10A 5E79U 2H3ZA 3AU6A 2JEFA 2F44A 3PX6A 2EANA 3RJHA 4QWAA 3PNCA 1L7PA 5DB7A 4QZ9A 3HKZF 1ZQNA 2KVSA 1NZBA 4F2SA 1X9WA 1X9XA 2HHUA 1PZNA 1ZRMA 4CNQA 3M9MB 3TI0A 5H2FU 4DLEA 1N2XA 1ZD4A 2BCSA 2FMQA 2R18A 2LBOA 1LKYA 4UBCA 1T4GA 1WWVA 4RNMA 2M9NA 2B6GA 1L8LA 1SV4A 2EH9A 3SV3A 3FC4A 1CEZA 1RYUA 2KJ9A 2A3VA 4EYIB 4WJ3B 8ICLA 1IIPA 2FMSA 8ICPA 1D8LA 2PXIA 1NNLA 4PHEA 4C8MA 2NRTA 2XVTA 7ICJA 4PZOA 5KFVA 4QIWF 2AJQA 1SL0A 4UATA 4TUSA 5DQHA 1BPEA 3I1YA 3MDCA 4DFKA 4YN4A 2XIDA 4RQ0A 5L1JA 2FE9A 4RQ4A 2H3IA 1ZQLA 1N48A 1L6NA 3ORYA 2HI0A 3KZIU 1ZQWA 4XQ8A 3UMCA 3UM9A 5L1LA 4KX3A 5EE3A 4UW9A 2R8KA 5ALLA 3ZDCA 4BGDA 1SKSA 3BS5A 1F5SA 2AQ0A 1ZQAA 2HBMA 3TAQA 4ECWA 5AIAA 4MFFA 3F2DA 5K4LA 3K4GA 4NY8A 4OCZA 4KLJA 3HWTA 3PR5B 2JEIA 4P4OA 3NASA 3EPIA 5ALHA 4B9LA 2I6XA 5JRTA 1NOMA 3ZD8A 4R65A 1UHUA 2F2AB 4C8OA 2NRZA
chains in the Genus database with same CATH topology
2OEHA 1KKXA 2LM1A 1IG6A 2LI6A 2CXYA 2JXJA 4LJXA 1KQQA 2YQEA 2KK0A 2EQYA 2JRZA 2EH9A 1RYUA 1KN5A 2RQ5A 1C20A 5CEHA 5K4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OEH A;  1KKX A;  2LM1 A;  1IG6 A;  2LI6 A;  2CXY A;  2JXJ A;  4LJX A;  1KQQ A;  2YQE A;  2KK0 A;  2EQY A;  2JRZ A;  2EH9 A;  1RYU A;  1KN5 A;  2RQ5 A;  1C20 A;  5CEH A;  5K4L A; 
#chains in the Genus database with same CATH topology
 4YG2 A;  1RPL A;  2E5S A;  3RB0 A;  1NK5 A;  1ZQF A;  2BQ3 A;  1ZQC A;  4PHD A;  1XSN A;  2I9G A;  2W55 A;  4O3P A;  3QXG A;  2DL0 A;  1WCL A;  3RJE A;  4FS2 A;  1S77 D;  1PVP A;  4CF4 A;  3T5K A;  1XNS A;  1L7N A;  2Y9T A;  4TUR A;  2CRX A;  3SEN A;  4DL4 A;  1NJW A;  3WKA A;  2HOI A;  3MGH A;  1O08 A;  1SWW A;  2LYB A;  3QU7 A;  4ELU A;  1KLN A;  2QKQ A;  2FDR A;  3IDW A;  2G5H B;  1F44 A;  4UB1 A;  5KG2 A;  3RBD A;  3GV8 B;  2PI4 A;  2QB0 B;  8ICY A;  2ZTC A;  4J9R A;  8ICC A;  1ECW A;  5IIK A;  1BPY A;  5JUM A;  2W3S A;  3RJJ A;  4NV0 A;  4UB6 U;  2ZIU A;  1VJ5 A;  2JRZ A;  3N7P D;  3E0F A;  3ZDA A;  2GWS A;  4F5Q A;  2HHS A;  3GIK A;  2QAR B;  4C7Y A;  3NVY A;  5ALX A;  2RHF A;  3CNH A;  2ZTE A;  4B9M A;  2KNJ A;  3V7L A;  2DKX A;  5KT7 A;  5CP2 A;  2B0C A;  7ICQ A;  1LV5 A;  2M0N A;  1CI4 A;  1ZQH A;  2KKV A;  7ICF A;  4MEY A;  5AI9 A;  2HHW A;  3RTV A;  2EAO A;  3AN1 A;  3WKD A;  5GTH U;  4FO6 A;  1A77 A;  4EEN A;  2E8M A;  3MR6 A;  2DBY A;  4C8L A;  2RDJ A;  4EEK A;  5KL8 B;  2JHD A;  2PKE A;  5IIN A;  2ES6 A;  1ZQP A;  4O9M A;  1S97 A;  3D2N A;  1HIW A;  3C1Z A;  4PGX A;  2YB1 A;  1XS9 D;  3RB6 A;  2HBL A;  3AUO A;  2AH5 A;  8ICT A;  1NK7 A;  3KKA A;  2KP7 A;  4F92 B;  3C5G A;  2G0A A;  2WF5 A;  1K1Q A;  2Y0S C;  2O6K A;  5J2F A;  4OJ6 A;  3RR8 A;  2ESE A;  3KFU F;  3SMV A;  2RRD A;  7ICH A;  3RH5 A;  4RPX A;  2AGP A;  4PHP A;  3ONN A;  5EWF A;  4C7Z A;  4JWM A;  5AIB A;  2W43 A;  3N7R C;  3M9O B;  1S0O A;  4I28 A;  3C28 A;  1KFS A;  2C2E A;  4EBD A;  1SZH A;  2MAX A;  4O3M A;  4EX6 A;  1ZJM A;  1X6I A;  2IOH A;  3B0Y A;  2J6S A;  5J2H A;  4ICA A;  2RQ5 A;  4AYB F;  2KHV A;  1ZQE A;  5CRX A;  2KZM A;  1SV0 C;  2IHM A;  2OEH A;  2BPG A;  4I2I A;  1FIQ A;  4NL9 C;  4TQR A;  2HOF A;  4F2R A;  3UQ0 A;  2NV3 A;  4PPX A;  4B9T A;  3KHH A;  1U4B A;  3QEA Z;  1SKR A;  1ZD2 P;  4P2H A;  3ISB A;  2KJ5 A;  4DL5 A;  4K4I A;  1JX4 A;  2DWQ A;  3BJY A;  9ICE A;  1COO A;  3PW0 A;  5D49 A;  2OH2 A;  2W9C B;  4Z6E A;  5KFZ A;  9ICT A;  3M6Z A;  4F4Z A;  4Q44 A;  4ECR A;  4US9 A;  4JWN A;  4MF2 A;  1QQ5 A;  5AM1 A;  3G6Y A;  1L3U A;  5ALO A;  4DCC A;  4DQR A;  3MGV A;  2KSO B;  4M9N A;  5AI4 A;  3GDX A;  3T5J A;  4YCX A;  1QSS A;  3V7J A;  2XC9 A;  1L7M A;  4Y2R A;  5KFP A;  1IG6 A;  2IA6 A;  2R8H A;  1SL2 A;  5J2A A;  1IM4 A;  3CW2 C;  4RQ8 A;  4DSK A;  4EZ9 A;  4IQT A;  8ICU A;  1L3S A;  3PML A;  3N4M B;  3SYZ A;  3SR6 A;  2OYY A;  3U26 A;  9ICI A;  4J9O A;  2HHV A;  4DF8 A;  2DKZ A;  1U49 A;  4IL6 U;  5KG0 A;  1RQN A;  4FZL A;  2QB0 A;  1BPB A;  4I2B A;  3DDH A;  4DQQ A;  2KJ8 A;  5DKW A;  2YY6 A;  1RXV A;  5AK4 A;  1BGX T;  1A0P A;  1X2I A;  3NGD A;  4KLU A;  3M8R A;  4IR1 A;  4KLS A;  2G08 A;  1H38 A;  4Y2Y A;  1DK2 A;  2KIW A;  1T8E A;  5GTI U;  3SD7 A;  5J0R A;  2K8B B;  4OJL A;  4FZM A;  4J9P A;  1U47 A;  4O3N A;  1S0V A;  1OW5 A;  3K1Z A;  5AKE A;  3RRG A;  4PZN A;  3RJK A;  3EPG A;  4Z6D A;  4F50 A;  4Z6F A;  4QZH A;  4FFD A;  1RG6 A;  1X66 A;  4DL6 A;  1U45 A;  1BPD A;  4CCH A;  8ICX A;  1L3V A;  4TUQ A;  2KVC A;  5DBC A;  5J8Y C;  7ICV A;  4RQ3 A;  1ZQU A;  4DOB A;  1S0N A;  4JMU A;  1JRO A;  2EZY A;  3GZF A;  3QZ8 A;  2YMP A;  4Y2V A;  5KFR A;  3WK6 A;  1XWL A;  3JPT A;  1PVR A;  5KFW A;  2PI5 A;  5DGB A;  3IRU A;  4Y2S A;  4QZG A;  5AI8 A;  3TAR A;  2BCU A;  3MBY A;  3BQ2 A;  5AI0 A;  1X40 A;  4PGQ A;  3AM9 A;  1TAM A;  4YD2 A;  1ZOL A;  1UA0 A;  2BZF A;  1Z00 B;  5F9N A;  2UVW A;  1MC8 A;  4Z6C A;  7ICI A;  4AP9 A;  3GV7 B;  3G6V A;  1UA1 A;  4O3R A;  3B0X A;  1X6J A;  8ICG A;  2HDO A;  3QUC A;  3TAN A;  1TFR A;  2MRL A;  5ALE A;  3HJE A;  1SXE A;  2KD1 A;  3OGU A;  3AEV A;  2XIC A;  4EEL A;  1A76 A;  3UQ2 A;  5EWG A;  5ALW A;  3Q8R B;  5BPC A;  7ICG A;  4ECZ A;  2BDU A;  1MQ3 A;  3OPX A;  1K5O A;  4DS4 A;  2PFP A;  4UQG A;  2K89 A;  3NRW A;  4JB3 A;  3UXN A;  5AKK A;  9ICF A;  7ICN A;  2JGA A;  3L4P A;  5AKY A;  2AGQ A;  2Y1J A;  2C2D A;  3N7S C;  4NLG A;  4ECY A;  3G6X A;  4RU9 A;  2CN1 A;  1VDV A;  1BNP A;  9ICQ A;  1TV9 A;  5AKX A;  2F76 X;  2W9C A;  5ALQ A;  5DB8 A;  3JPN A;  1Z4O A;  5ALN A;  2G09 A;  5KFQ A;  1NK8 A;  7ICR A;  2YTU A;  3ZDE A;  1QQ6 A;  1N5X A;  3IN5 A;  2WB1 F;  2HBJ A;  4UB4 A;  5J0S A;  2BGW A;  3GQC A;  2IMW P;  5KG5 A;  2KSO A;  1YZ7 A;  5F9L A;  3PSF A;  2UVU A;  4UAW A;  5IIJ A;  5J2B A;  3UXP A;  5AM3 A;  1ED1 A;  3D6J A;  2KK0 A;  2JEJ A;  2ZJ8 A;  1XSP A;  1JN3 A;  3WK8 A;  5J0O A;  4NLB A;  4CF5 A;  4ECQ A;  1TKD A;  4IR9 A;  1SIJ A;  4UB3 A;  4KMO B;  4M47 A;  4A8E A;  3F2C A;  1Q3U A;  4YR2 A;  5ALT A;  2BPC A;  4RQ7 A;  4MF8 A;  3RFA A;  1ZQM A;  8ICE A;  2E1E A;  4P0P B;  1JXE A;  1D8B A;  3ETR A;  9ICX A;  1SXD A;  4YXM A;  3PW2 A;  4IQW A;  1UCV A;  2XO7 A;  1UT8 A;  3F53 A;  4BDP A;  3NVV A;  5D4B A;  2V4R A;  1C20 A;  2BCV A;  2LYA A;  2Y0S F;  2VA8 A;  1NKC A;  3BZC A;  1U9L A;  3AQF A;  3T79 A;  3RF9 A;  5KG7 A;  3LK9 A;  4EZ6 A;  1B43 A;  4R66 A;  2OHF A;  3OHA A;  2AU0 A;  1CUK A;  1J2M A;  3WK5 A;  4DL3 A;  4F4W A;  5DQG A;  3WK9 A;  1PK1 B;  1KQQ A;  4ECV A;  2NYV A;  1K1S A;  3EYZ A;  1MQ2 A;  1PK3 A;  2GLE A;  4I2D A;  5KFD A;  8ICA A;  4GIB A;  2L5Y A;  1A6S A;  2FJ6 A;  1SL1 A;  2W11 A;  4Y2X A;  4J9N A;  3T5H A;  2ZXI A;  4PJ0 U;  4TUP A;  3Q8L A;  3ZD9 A;  4ECT A;  1BPX A;  4O5E A;  1T3N A;  1ZRN A;  3GIJ A;  1SV0 A;  4J9L A;  2W9A A;  3H4B A;  1ZXI A;  7ICS A;  4KN4 A;  4F5N A;  4DQP A;  4DSE A;  5DDM A;  3H0R B;  1JIH A;  4I29 A;  4IRK A;  5L1M A;  1BPZ A;  8ICW A;  2FPL A;  4GXJ A;  1QSL A;  5KT3 A;  3M8S A;  4U7C A;  4ED7 A;  1TK0 A;  2LYH A;  3MC1 A;  4KN7 A;  5KFE A;  2KN7 A;  3RH4 A;  5CA7 A;  2MUT B;  4RNN A;  2PFN A;  3CRX A;  8ICJ A;  2PMZ C;  1Z00 A;  4F5P A;  3KHG A;  2K4E A;  5HML A;  5KFX A;  3B9J A;  5C5J A;  3UXO A;  5CJ7 A;  4ZH4 A;  4RQ5 A;  5ALJ A;  4KLG A;  2R8I A;  1TVA A;  4QZI A;  5AKZ A;  4KLQ A;  2IBK A;  2WF7 A;  5L1I A;  1B22 A;  3TFS A;  4I2C A;  1DGS A;  1SZP A;  5DG7 A;  1RM6 C;  4P4P A;  2J6T A;  7ICT A;  2F3N A;  4PHA A;  2HVH A;  2MU2 A;  2ISO A;  5BOL A;  7ICE A;  5EE9 A;  4F91 B;  3SQI A;  5EE1 A;  3LWM A;  8ICN A;  9ICR A;  4CF3 A;  2JV3 A;  8ICH A;  5J0U A;  5HNK A;  1URJ A;  5ALI A;  5KFU A;  1X9M A;  1LB2 B;  3HKZ C;  4I2G A;  2ZUC A;  1FEZ A;  2Q0Z X;  5J2E A;  2H3V A;  2BDP A;  1KSP A;  5ALZ A;  2YML A;  3PO5 A;  3V72 A;  1NKB A;  5AI6 A;  2G5I B;  5DB6 A;  4C0Z A;  3KHR A;  3BDP A;  2LI6 A;  1X42 A;  3NVW A;  1O03 A;  1AQ6 A;  3IV6 A;  1RZT A;  5KFO A;  5EOZ A;  5J2G A;  4MHV A;  3RB3 A;  2H5X A;  3IG8 A;  3QYP A;  2F1H A;  1ZQD A;  5CR0 A;  1XC9 A;  1J97 A;  3IP4 B;  2K4H A;  1QLN A;  1Z4N A;  4LVS A;  3VCB A;  2W03 A;  1QH9 A;  3IM1 A;  3Q8P B;  3JPQ A;  1SWV A;  4J9M A;  4QW8 A;  4GLX A;  5KFM A;  2KKP A;  4R8U B;  1SB3 C;  3L5K A;  3M1Y A;  3GIL A;  1XSL A;  7ICL A;  9ICK A;  1V97 A;  4QIW C;  3IHQ B;  3GV5 B;  2DGZ A;  3N28 A;  2G07 A;  3AQE A;  4JK1 A;  5EWE A;  5J8Y A;  1N63 A;  4P0P A;  1DOQ A;  7ICU A;  4JV1 A;  2WAQ F;  4DOC A;  5G5H A;  2V4Q A;  4DOA A;  3DV9 A;  3QUQ A;  3LVV A;  3MAB A;  5KAF U;  4C80 A;  3F5E A;  2XGP A;  2FMP A;  5AK6 A;  1KW4 A;  2BCR A;  5KT6 A;  2MSN A;  3F2B A;  2JXJ A;  2EZZ A;  5DG9 A;  4IC9 A;  2JMG A;  2JH7 A;  1PK1 A;  2UVV A;  2WTF A;  8ICZ A;  1OXJ A;  3MR3 A;  2GO7 A;  3H8W A;  5ALG A;  4I2A A;  3QU4 A;  1COK A;  5KTQ A;  1S8O A;  2OWO A;  4M04 A;  2LMR A;  3FYH A;  2RLT A;  5HMM A;  3LDA A;  1BNO A;  5A0L A;  1RXW A;  4UAS A;  2E8N A;  2ZIX B;  1FFU A;  4ECS A;  3Q8M A;  2F77 X;  4KLO A;  4NWI A;  1NJY A;  2UVR A;  4I27 A;  4MEX A;  3PO4 A;  1ZQB A;  1KN5 A;  3BQ7 A;  8ICO A;  2RP5 A;  5J29 A;  4Y2J A;  2QLT A;  2Z7J A;  1FO4 A;  4KLF A;  3TAD A;  4UAU A;  2ATL A;  4M2Y A;  4KLH A;  4YR3 A;  3UPQ A;  2WF9 A;  5ALY A;  5KFY A;  2G06 A;  5ALD A;  8ICM A;  3QZ7 A;  4NM1 A;  2R8G A;  1WG8 A;  5HR7 A;  3L3F X;  4LZG A;  1ZQX A;  1HEK A;  4QWB A;  4QWC A;  1NJZ A;  5TIS U;  3N97 B;  2OCE A;  1WCN A;  2XGQ A;  1ZQ1 C;  5AIC A;  9ICH A;  2DFL A;  2LHT A;  2MUT A;  4B9V A;  1RYS A;  3Q8K A;  1SKW A;  3I28 A;  3V7K A;  2ZUB A;  2F8L A;  5IIO A;  2ASD A;  5IIL A;  9ICO A;  4IQU A;  3H0L B;  4C4S A;  5JTI A;  5KG6 A;  3C29 A;  2ODG A;  3TAP A;  4DSI A;  2D8C A;  2W9M A;  8ICS A;  2EZX A;  1N5W A;  1U48 A;  1ZQQ A;  3JPS A;  4F3O A;  2I1Q A;  4I2J A;  1ZQY A;  4XA5 A;  1JMS A;  4IRD A;  1ZQS A;  1GO3 F;  2LKY A;  2P35 A;  3Q8S B;  4G3I A;  3TKA A;  9ICM A;  5L9X A;  2DF4 B;  4J9K A;  1TK8 A;  4ELT A;  2HMX A;  3QU9 A;  3IG5 A;  3T3F A;  2ZTD A;  3H7I A;  3D2Q A;  4EEY A;  3H8J A;  2KV2 A;  1ZQG A;  2QAR A;  2FPM A;  3ZDD A;  4DSL A;  1S0M A;  1NK6 A;  2FPK A;  2C28 A;  4PGY A;  5KFG A;  5J2J A;  4PL1 A;  1S9F A;  2P66 A;  5KFF A;  2KOB A;  5AK5 A;  4O5C A;  3BS7 A;  2HHX A;  3THV A;  5KG4 A;  4NLZ A;  5J0W A;  2Q4T A;  3QEB Z;  3KBB A;  2XY7 A;  1L7O A;  4YD1 A;  2CXY A;  4BWM A;  2GOL A;  4CRX A;  4ED6 A;  1VLB A;  2EQY A;  5AM2 A;  2C22 A;  2AHO B;  4BWJ A;  4C4R A;  5KFJ A;  3OHB A;  2KMD A;  3H0M B;  4JUZ A;  5KG3 A;  3OSN A;  5ALV A;  3PSP A;  1ZQK A;  2VA3 A;  2FLN A;  3MFI A;  5CEH A;  3C2M A;  4BXO B;  9ICU A;  3SV4 A;  2XY5 A;  2DPJ A;  4DQS A;  2W9B B;  1KDH A;  4DS5 A;  4ECU A;  3BQ0 A;  1KFD A;  4DEZ A;  4R8U A;  5C0Y A;  3GIM A;  5FP0 A;  2KZZ A;  3EZ5 A;  4QNL A;  4NM2 A;  9ICV A;  3SAG A;  4B9S A;  4QJF B;  5DBA A;  2W8K A;  5DG8 A;  1KKX A;  2LM1 A;  2IOF K;  3R9K A;  2ISP A;  3D2S A;  2DUY A;  9ICN A;  4IS7 A;  1ZET A;  5KT4 A;  3WK4 A;  3OJS A;  3C2K A;  2F8K A;  3C1Y A;  2ZIW B;  4NLN A;  2P6U A;  3HRD D;  1N56 A;  3KD3 A;  4RQ2 A;  7ICK A;  3NVZ A;  4OJ5 A;  5KG1 A;  2BKE A;  5KFB A;  5J0T A;  4AYB C;  4UB2 A;  1ZQJ A;  1ZD3 A;  3GFK B;  3FDS A;  5AM5 A;  8ICQ A;  9ICB A;  1NKE A;  4ECX A;  1D8Y A;  1N60 A;  4M9J A;  9ICG A;  2ZIX A;  4I2H A;  3NTU A;  3EUB 2;  5BOM A;  5AK3 A;  2VAN A;  4BX9 C;  1PUZ A;  5AKI A;  2KEY A;  4CDG A;  2EAM A;  4FBT A;  5KFA A;  4M9H A;  1D9F A;  2J6U A;  4BUG A;  3QUT A;  2HHT A;  5G5G A;  5KAI U;  2R8J A;  4M9G A;  3WKE A;  3RR7 A;  1YZ6 A;  4Y2P A;  1YT3 A;  3QX7 A;  2NO5 A;  3A0B U;  3RJG A;  3RRH A;  2DPI A;  2E3T A;  5DGA A;  3WK7 A;  5KFN A;  1V38 A;  9ICL A;  2DQN B;  3CYM A;  3QNM A;  1D9D A;  3WKB A;  1JUD A;  1T7P A;  3E58 A;  4R64 A;  5III A;  2H3Q A;  4ED3 A;  1ZJN A;  9ICA A;  2JZB B;  9ICJ A;  4GC7 A;  3QU2 A;  2E8O A;  5B66 U;  1DRG A;  3E2E A;  4JV2 A;  3UMB A;  3C21 A;  2KFN A;  2A19 A;  5KFS A;  1KTQ A;  5IIM A;  4MFA A;  1NK4 A;  2ALZ A;  4KLM A;  5ALK A;  1N61 A;  1J2N A;  2IOF A;  4QZD A;  4OJO A;  3KTQ A;  1RDF A;  4HYK A;  2KFZ A;  1QTM A;  2KIC A;  3K1R B;  2YMQ A;  1IV8 A;  1RYR A;  2K60 A;  2HHQ A;  1ZQT A;  5AM4 A;  3SZ2 A;  4DFP A;  4RUC A;  2VJ5 A;  5AM0 A;  9ICP A;  1Q3V A;  4F4K A;  4NJ8 A;  3C2L A;  3PZP A;  7ICM A;  8ICI A;  4M9L A;  3SI8 A;  1ZYQ A;  4I2F A;  2JH1 A;  3LYS A;  4C8N A;  4Y2U A;  4R63 A;  1ZQO A;  1JRP A;  2ASL A;  4B6J A;  3KZX A;  3NRZ A;  4C4T A;  5F3X B;  3UMG A;  3QU5 A;  1Q46 A;  3RB4 A;  4DL7 A;  4O3S A;  4YVZ A;  2NO4 A;  5KL1 B;  3M9N B;  5KT5 A;  4F93 B;  5DQI A;  4RQ6 A;  2MA1 A;  8ICV A;  3M6K A;  5HR6 A;  1Z1B A;  4ELV A;  5J0P A;  1DGJ A;  2K4P A;  3ZDB A;  4NL9 A;  4KX5 A;  3PX4 A;  3HT3 A;  1ARO P;  3BQ1 A;  4Q45 A;  4YMN A;  2OM6 A;  2VIX A;  1N62 A;  2PFQ A;  3JPP A;  4DSF A;  4BXO A;  4QZE A;  1WYG A;  4UB5 A;  4F4X A;  4B9N A;  2W9B A;  2AGO A;  2K8A A;  3ETL A;  2Y1I A;  5B5E U;  3Q8Q B;  5HHI A;  3FM9 A;  5J0Y A;  2I5H A;  2YX8 A;  4UBB A;  3JPO A;  1Q8K A;  4LJX A;  3MGI A;  1JAL A;  3AU2 A;  1TK5 A;  1NI3 A;  3RJI A;  2VA2 A;  1F0M A;  4P4M A;  4O5K A;  2BPF A;  2NRV A;  1CRX A;  4O3Q A;  2XI9 A;  2BQR A;  2KHQ A;  2ZIW A;  4Q8E A;  3J81 j;  4PL2 A;  4IRC A;  4Q8F A;  4UAV A;  1Z19 A;  2WF6 A;  3PR4 A;  1V9P A;  1KL9 A;  1KFT A;  3C23 A;  2K4I A;  8ICF A;  5ALS A;  1C7Y A;  3ZI4 A;  4ED8 A;  5T14 A;  1ZQR A;  5EE0 A;  5L1K A;  2W54 A;  3NUQ A;  2E1F A;  1L3T A;  3MR2 A;  2D6F C;  5J2K A;  4F71 A;  5CB1 A;  5KFC A;  1QSY A;  1ZQZ A;  4KLD A;  2IHN A;  4ED1 A;  5ALR A;  2JEG A;  3ISC A;  4DSJ A;  2H3F A;  4KLL A;  2OXO A;  3HIL A;  4X5V A;  3PMN A;  3TFR A;  4HAI A;  4XUS A;  2KIV A;  5CWR A;  4RUA A;  4UB8 U;  4KTQ A;  3LWL A;  1HJP A;  4TQS A;  1NJX A;  5CHG A;  2BHN A;  3HPO A;  4DLG A;  3RH6 A;  5DLF A;  3OSP A;  2WB1 C;  4OJP A;  4E0D A;  4FS1 A;  3PV8 A;  4G9B A;  9ICS A;  2W7P A;  1ZQV A;  4KLE A;  1OUQ A;  3RAQ A;  1B0X A;  4YXJ A;  8ICB A;  5KT2 A;  4K4H A;  2KG5 A;  3V6K A;  9ICC A;  1DXS A;  2JZB A;  4UAZ A;  1M6Y A;  2A1J B;  4F8R A;  3PW4 A;  1DK3 A;  4Q43 A;  5AKL A;  4I2E A;  1NZP A;  4J03 A;  3RJF A;  4M6W B;  1WUD A;  4JV0 A;  2NRX A;  5AKJ A;  3WU2 U;  4ZOH C;  1XO1 A;  4YQW A;  4EX7 A;  5ALF A;  1HUO A;  3H8S A;  3K75 D;  4P0Q B;  3S6J A;  3KOO A;  3TQ1 A;  4KLI A;  4RPY A;  4DQI A;  8ICK A;  3H4D A;  4BJQ A;  2ASJ A;  5J0X A;  4QWE A;  4UAY A;  3SEI A;  5AI5 A;  4FZN A;  2BQU A;  1UQV A;  1LVH A;  2E8P A;  5KFL A;  2HCF A;  5HHH A;  4PH5 A;  4GC6 A;  2HW3 A;  4RT3 A;  4LZD A;  3KHL A;  3PVX A;  1V85 A;  2ZG6 A;  3A0H U;  1MN8 A;  3PY8 A;  4OO1 J;  7ICO A;  1X9S A;  2XCA A;  2B21 A;  4YR0 A;  4QWD A;  4USA A;  4ACO A;  2AXT U;  2HSZ A;  4YFK A;  1P7D A;  2ZIV B;  2EAP A;  1RQL A;  2WHE A;  2VJ4 A;  5J0Q A;  1QCK A;  3LVW A;  2KZ3 A;  3WKC A;  3MR5 A;  3DEE A;  5KFK A;  2V9W A;  1ZD5 A;  3I76 A;  3HW8 A;  1TAQ A;  1S5L U;  4ED0 A;  2QB1 A;  5DLG A;  1KEJ A;  4EBC A;  1MSW D;  4YMO A;  4Y2Q A;  2XY6 A;  2ZJA A;  4YP3 A;  4RZR A;  4DFJ A;  2Y9U A;  3H40 A;  1BVS A;  5DDY A;  3TAC B;  1JXL A;  2FLL A;  2ZXH A;  1Z3E B;  1WWU A;  4GXI A;  3OJU A;  4C8K A;  4DFM A;  1LKY B;  2D3D A;  2W3R A;  2W7O A;  4QZA A;  1HUZ A;  1Y88 A;  3FAH A;  5DB9 A;  4NLC A;  2CPR A;  4US8 A;  2HVI A;  4O0I A;  2JR5 A;  4F5R A;  3AMZ A;  4M0A A;  2HOQ A;  5HP4 A;  3M7D A;  4NLK A;  2VKQ A;  2C2R A;  3AL0 B;  5TZV A;  1T94 A;  2XCP A;  3QE9 Y;  1L8O A;  1S76 D;  1TE2 A;  1PVQ A;  3ISD A;  3SAH A;  1IXR A;  5ALP A;  1UPH A;  2AQ4 A;  4J9Q A;  2LPE A;  1QQ7 A;  1XU4 A;  3EW9 A;  4CGZ A;  4RQN A;  2YB4 A;  5KFI A;  3PW5 A;  3GU3 A;  7ICP A;  2GH1 A;  2WFA A;  2A1A A;  4EBE A;  4IQV A;  1JI7 A;  4CE6 A;  4KIT B;  5J2I A;  5JU5 A;  4DL2 A;  4XRH A;  4EYH B;  4QZB A;  4F4Y A;  4RNO A;  5AKG A;  4QZ8 A;  2P6R A;  3F5A A;  1T3Q A;  4U6P A;  4ED2 A;  1Z1V A;  2FI1 A;  3HP6 A;  4DO9 A;  8ICR A;  4DF4 A;  2WF8 A;  5ALU A;  2YQE A;  5KFT A;  3BS5 B;  5D46 A;  3ALR A;  4DFD A;  4RQ1 A;  1KRP A;  2EDU A;  4RQM A;  3BQT A;  1MA7 A;  1TAU A;  5AKH A;  4Y2T A;  2A1J A;  1EXN A;  2BCQ A;  1SGG A;  4OD0 A;  1UT5 A;  3KKA C;  2YN4 A;  5AHX A;  3ED5 A;  4QW9 A;  4K4G A;  2PFO A;  4M6W A;  3VC8 A;  3C5F A;  2LM4 A;  3MFH A;  3NS1 A;  2WAQ C;  3JPR A;  3CP8 A;  4P0Q A;  2ZJ5 A;  3BZK A;  3O0F A;  5J2D A;  4RT2 A;  2FLP A;  4FBU A;  3PSI A;  4YMM A;  3MDA A;  3SAF A;  2NRW A;  2F1J A;  2W04 A;  2F1I A;  4F72 A;  4UAR A;  5J2C A;  1ZQI A;  3V6J A;  4KMU A;  1FFV A;  2PMZ F;  2RDI A;  4DWI A;  4B9U A;  4FE3 A;  2BR0 A;  3ICX A;  1NK0 A;  4QZF A;  9ICW A;  3EWA A;  3GII A;  3QUB A;  4O3O A;  4GXK A;  3V6H A;  4NXZ A;  4KLT A;  5DBB A;  3RAX A;  3RBE A;  4QZC A;  2ZUD A;  5ALM A;  3HX0 A;  1B4F A;  3PX0 A;  2KTQ A;  2ZIU B;  2W8L A;  4MFC A;  4J9S A;  2K8C B;  2N1R A;  3TAD C;  2ZIV A;  1NK9 A;  4F5O A;  1XO0 A;  2KE7 A;  1L5U A;  4GFJ A;  1KBU A;  5KNI A;  3PST A;  3PW7 A;  3H8M A;  5KFH A;  3T5L A;  4RPZ A;  2HBK A;  2YMM A;  3OTQ A;  1S10 A;  5E79 U;  2H3Z A;  3AU6 A;  2JEF A;  2F44 A;  3PX6 A;  2EAN A;  3RJH A;  4QWA A;  3PNC A;  1L7P A;  5DB7 A;  4QZ9 A;  3HKZ F;  1ZQN A;  2KVS A;  1NZB A;  4F2S A;  1X9W A;  1X9X A;  2HHU A;  1PZN A;  1ZRM A;  4CNQ A;  3M9M B;  3TI0 A;  5H2F U;  4DLE A;  1N2X A;  1ZD4 A;  2BCS A;  2FMQ A;  2R18 A;  2LBO A;  1LKY A;  4UBC A;  1T4G A;  1WWV A;  4RNM A;  2M9N A;  2B6G A;  1L8L A;  1SV4 A;  2EH9 A;  3SV3 A;  3FC4 A;  1CEZ A;  1RYU A;  2KJ9 A;  2A3V A;  4EYI B;  4WJ3 B;  8ICL A;  1IIP A;  2FMS A;  8ICP A;  1D8L A;  2PXI A;  1NNL A;  4PHE A;  4C8M A;  2NRT A;  2XVT A;  7ICJ A;  4PZO A;  5KFV A;  4QIW F;  2AJQ A;  1SL0 A;  4UAT A;  4TUS A;  5DQH A;  1BPE A;  3I1Y A;  3MDC A;  4DFK A;  4YN4 A;  2XID A;  4RQ0 A;  5L1J A;  2FE9 A;  4RQ4 A;  2H3I A;  1ZQL A;  1N48 A;  1L6N A;  3ORY A;  2HI0 A;  3KZI U;  1ZQW A;  4XQ8 A;  3UMC A;  3UM9 A;  5L1L A;  4KX3 A;  5EE3 A;  4UW9 A;  2R8K A;  5ALL A;  3ZDC A;  4BGD A;  1SKS A;  3BS5 A;  1F5S A;  2AQ0 A;  1ZQA A;  2HBM A;  3TAQ A;  4ECW A;  5AIA A;  4MFF A;  3F2D A;  5K4L A;  3K4G A;  4NY8 A;  4OCZ A;  4KLJ A;  3HWT A;  3PR5 B;  2JEI A;  4P4O A;  3NAS A;  3EPI A;  5ALH A;  4B9L A;  2I6X A;  5JRT A;  1NOM A;  3ZD8 A;  4R65 A;  1UHU A;  2F2A B;  4C8O A;  2NRZ A; 
#chains in the Genus database with same CATH homology
 2OEH A;  1KKX A;  2LM1 A;  1IG6 A;  2LI6 A;  2CXY A;  2JXJ A;  4LJX A;  1KQQ A;  2YQE A;  2KK0 A;  2EQY A;  2JRZ A;  2EH9 A;  1RYU A;  1KN5 A;  2RQ5 A;  1C20 A;  5CEH A;  5K4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...