1KKXA

Solution structure of the dna-binding domain of adr6
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
102
structure length
102
Chain Sequence
NNKQYELFMKSLIENCKKRNMPLQSIPEIGNRKINLFYLYMLVQKFGGADQVTRTQQWSMVAQRLQISDYQQLESIYFRILLPYERHMISQEGIKETQAKRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1H, 13C and 15N resonance assignments and secondary structure of ADR6 DNA-binding domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
molecule keywords Transcription regulatory protein ADR6
total genus 18
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2001-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 1kkxA00
2EH9A 1IG6A 1KKXA 2LI6A 1KQQA 2EQYA 1RYUA 2JXJA 4LJXA 2OEHA 1C20A 1KN5A 2YQEA 2JRZA 5K4LA 2LM1A 2RQ5A 5CEHA 2CXYA 2KK0A
chains in the Genus database with same CATH superfamily
2H3FA 3GZFA 2XY5A 1ZQBA 4JWNA 5AIAA 2FPKA 4QNLA 4GLXA 1OUQA 9ICJA 1DK3A 2W7OA 1B4FA 1OXJA 2RHFA 5DB9A 4QWDA 1MQ2A 4FO6A 5JUMA 3OGUA 1S0VA 1SXEA 3KFUF 5HMLA 2GLEA 3TAQA 4XQ8A 1KDHA 3MGIA 4QWAA 2JH7A 4PJ0U 2HDOA 5HNKA 4EBDA 3TANA 1TAUA 2KHVA 1XWLA 2OCEA 3IM1A 7ICGA 2ATLA 2LHTA 2Y1IA 4F4ZA 3V6KA 1JXEA 4KN4A 2Y0SF 4ELUA 2HW3A 1BPYA 4UB5A 2VA2A 2G07A 1LB2B 4DFJA 3ED5A 2WB1C 3H4DA 4J9PA 2HHVA 4M2YA 3QU7A 2I5HA 4KLJA 1KSPA 3UMGA 4MF2A 4DOCA 4BXOA 2MUTA 5KFTA 3FAHA 3NVYA 2W04A 3NVZA 1B0XA 4Y2UA 1WWUA 5BOMA 5AM3A 4RQ6A 1HUZA 5D49A 2HHQA 2ASLA 4OJ6A 4M47A 2JXJA 1BVSA 4GXIA 2NRXA 3BQ2A 5KFSA 1SKSA 2K4PA 1O03A 1BPXA 4G3IA 1SL1A 2HHUA 2KTQA 4ED6A 5KFMA 2Q0ZX 2JRZA 4B9SA 8ICSA 3TAPA 4QW8A 1P7DA 1AQ6A 4DSIA 5ALOA 1QQ5A 5KFJA 4QZCA 5AI0A 2KMDA 4ED7A 1DRGA 1ZETA 4WJ3B 3MGVA 2B21A 2XGQA 4BX9C 2YMLA 4EZ6A 2QLTA 5DBCA 3RBEA 9ICSA 5BPCA 4YD1A 3AMZA 1KFDA 3BQ1A 2J6SA 9ICEA 1ZQJA 5KFLA 4CF4A 3PR5B 2AGOA 5KG2A 3WK9A 1JUDA 3MR3A 3SQIA 2W9MA 5ALMA 3RJGA 2L5YA 1Z00A 4K4IA 2HSZA 4ED3A 5J0QA 5DLFA 4O3RA 1N2XA 4F93B 4P0PA 1RDFA 2A1AA 4M9JA 1MC8A 2FI1A 4I2FA 5AI6A 4CNQA 2A1JA 4Y2VA 2VA8A 5KFAA 2Y9UA 2ZJ5A 2K4IA 2DWQA 4JUZA 2WFAA 3KHLA 4M9LA 5IINA 3PR4A 2KK0A 3B0YA 1PZNA 4DOBA 4I27A 3H4BA 1U4BA 1NK4A 1NZPA 4R65A 1N48A 5KT5A 5ALEA 2WF8A 2C2EA 5KFNA 2PXIA 5CJ7A 1KQQA 3C28A 2W3SA 2AJQA 4PPXA 2MRLA 1UHUA 5HR6A 3L3FX 3TADC 1TAMA 4NL9A 3ZD8A 1S76D 1CI4A 4DSEA 5JRTA 3UMCA 1TK8A 3IP4B 1GO3F 1X9XA 2E1FA 4O3QA 1S0NA 1RXWA 2QB1A 4DL3A 2E8NA 1H38A 1UPHA 2XY6A 2EZYA 3CNHA 3KZXA 4C7YA 5J0PA 4YQWA 3PW5A 4B9LA 1UT8A 4DFDA 3NVVA 3RJIA 3C1YA 5AHXA 2YB1A 3KZIU 4J9QA 2PFPA 2JH1A 4C8OA 1SL0A 2MAXA 2JMGA 3NVWA 2QB0B 9ICPA 2JGAA 4UAVA 4OD0A 1DGSA 4RQNA 5J0WA 4IRCA 3QEAZ 5ALHA 2K60A 3K1RB 1ZQMA 3WK6A 2V4QA 4O0IA 2KZMA 4G9BA 4MEYA 3C21A 3C5FA 3QUBA 2W8KA 3PW4A 1DXSA 7ICUA 1BPZA 4DQSA 3A0HU 3H8JA 3H7IA 1ZQFA 1WG8A 4I29A 3D2SA 2FE9A 4KLQA 5AKYA 2F1HA 4UARA 4M6WA 3RJJA 9ICUA 5KT2A 4KN7A 2G0AA 5J2CA 3ZDEA 1T3NA 4TQSA 2KJ8A 3CYMA 2AGPA 1L7PA 5DG7A 5ALXA 3M9MB 3HW8A 4O3MA 8ICGA 5KFKA 4YVZA 2W9BA 4OJ5A 4QWBA 4NLGA 4NWIA 1NK8A 1ZQLA 5L9XA 4IQUA 1XC9A 4PZNA 4ELTA 5KFEA 2H5XA 4DL2A 3RH6A 2BCVA 2KICA 5L1MA 2KKPA 5L1LA 1L8OA 3LDAA 3RR7A 1S5LU 2FMQA 8ICRA 3M6ZA 3EWAA 5ALTA 2OEHA 1SV4A 3U26A 5J2BA 4LZGA 1N60A 2MUTB 2J6UA 2E1EA 3IV6A 4R8UB 3FYHA 2XCAA 1ZQSA 3BQ0A 5KT4A 1EXNA 3IG8A 5AI4A 4F5NA 4ECZA 3SMVA 2FPMA 4QZ9A 7ICHA 2KFNA 1Z19A 3JPRA 2UVUA 4IRDA 5AK6A 3WK5A 2JZBB 2YMPA 5EWEA 2W9BB 1NK0A 4FE3A 4IL6U 3TI0A 5J0RA 4F71A 3QYPA 2K8CB 4RPXA 2W11A 5KNIA 3UXPA 4EYHB 4P4OA 4I2CA 1HEKA 2GOLA 2P35A 4QZBA 1S97A 4RUAA 4DWIA 4F4YA 3HP6A 5KFGA 8ICJA 4IR1A 4M9NA 4K4HA 4YG2A 1KN5A 2XC9A 4P0QB 1RZTA 2JEFA 3NUQA 4KLEA 5EE3A 3BZCA 1NNLA 3O0FA 1QH9A 8ICPA 3RF9A 5DQGA 2CRXA 1U9LA 2HOIA 4B6JA 5ALKA 2DL0A 2K89A 4QIWC 5JTIA 1M6YA 3IRUA 2LYBA 1WWVA 4TUQA 7ICQA 5ALGA 3PNCA 4C7ZA 3H8MA 1RM6C 5KFIA 4KLLA 4O9MA 5GTHU 4RUCA 1VDVA 4EBCA 5ALJA 5J0TA 4DSJA 3GIIA 4B9VA 1PVQA 4CF3A 1L3SA 4M9HA 2KN7A 1AROP 2QARB 1K1SA 3S6JA 2LPEA 2PI5A 4RZRA 4FZMA 1ZQ1C 1BPBA 4TUPA 1L7NA 4ECRA 9ICOA 4J9KA 5DBBA 4FBTA 3EW9A 5J2EA 4QZFA 2UVRA 3KHGA 3T5HA 1NK6A 4UB2A 9ICFA 2XICA 4NY8A 4M0AA 3NRWA 2HBJA 4M04A 5J8YC 4BUGA 1JN3A 2M0NA 4J9RA 5AK4A 5DB6A 4LZDA 1NKEA 1ZD2P 1NK7A 5J0OA 1RQNA 5KFXA 2OWOA 3MDAA 3JPSA 2W3RA 2QB0A 2J6TA 1D8BA 9ICVA 2I6XA 3EYZA 1KFSA 3DEEA 4GFJA 2KNJA 2ZJ8A 4FS1A 3KHHA 4ECXA 5IILA 1L7MA 2QARA 2VA3A 4RQMA 4ZOHC 9ICGA 1TK5A 3JPNA 1ZQGA 5J2HA 5C0YA 4Z6DA 3K75D 4HYKA 1Z4OA 2IHNA 5K4LA 4JB3A 4C4RA 2K4HA 2WF6A 2KE7A 3BDPA 8ICBA 2AQ4A 2Z7JA 3A0BU 2BDUA 8ICKA 1IV8A 4YCXA 5KL1B 8ICQA 3Q8RB 3MDCA 4IR9A 1SV0C 3K1ZA 3M1YA 1SZPA 3CRXA 3PMNA 1S8OA 1ZQQA 1F44A 5KFOA 3RB0A 1TE2A 4O5CA 4YXMA 1SB3C 8ICFA 4OJLA 5KG3A 4ECYA 4JWMA 3K4GA 2DKZA 3AQEA 1V9PA 1ZQCA 3NTUA 1RG6A 4JK1A 3TACB 8ICHA 1B43A 3WKAA 5B5EU 5EE1A 4EZ9A 4DF8A 4RNNA 3WK4A 5KAFU 2RP5A 4DO9A 3PSFA 4PGXA 4Y2QA 1TK0A 1ZQEA 2JR5A 1FFUA 5AKEA 5CB1A 3RH5A 3F2DA 1URJA 5C5JA 1BNPA 4DQRA 4P4PA 3GDXA 3GIJA 5KTQA 8ICNA 1ZQXA 3AU2A 1BNOA 1HUOA 1L3UA 2ISOA 4Q8EA 3C2MA 2HBKA 3OHBA 1ZRNA 7ICIA 3TFRA 4I2IA 4QZGA 2WF7A 3E58A 2UVVA 1LKYA 4YD2A 1MQ3A 2WF5A 1TV9A 4F8RA 2R8IA 1X40A 5KFZA 2ZTEA 1ZQDA 2OYYA 4NV0A 4CRXA 4KLHA 7ICVA 3FC4A 2KEYA 5ALPA 1UA1A 1XSNA 4DQPA 5DB7A 5A0LA 4B9UA 1TFRA 3PY8A 1PVRA 2N1RA 1U47A 4GXKA 1X6IA 2XO7A 2Y1JA 2G5IB 2P6UA 4ECUA 2P6RA 4B9TA 7ICFA 2OH2A 3N28A 4F3OA 1C7YA 2UVWA 2BQUA 4EBEA 1QLNA 4NM2A 1SV0A 2PMZC 1NJYA 5J2KA 4Q44A 3B9JA 4I28A 3OTQA 3R9KA 2F8KA 2LM4A 2ZG6A 4ICAA 4C4TA 4E0DA 1ZQUA 3D2QA 1Q46A 4I2JA 1N5XA 4NJ8A 3ZI4A 4QZEA 3ICXA 1ED1A 4YR2A 4FZNA 4C8KA 5ALUA 3RR8A 3N97B 4DL7A 1X9WA 4O5KA 2BKEA 3QXGA 4ELVA 5KFFA 2HVIA 4RPZA 5IIJA 4J03A 2W9CA 1XSLA 4AYBC 3LWMA 2BGWA 4F50A 2KOBA 2ASDA 4FZLA 2YB4A 5J0SA 3JPQA 3QUQA 4F72A 2VANA 4PHEA 2ASJA 5B66U 2GO7A 5ALNA 1UCVA 5KT7A 1JX4A 2GH1A 4NLZA 1FO4A 1ZYQA 1JIHA 3ONNA 3ISCA 1NZBA 2H3ZA 3QU2A 3PW7A 2OM6A 3G6VA 4Y2TA 2R8HA 4ECQA 4I2HA 2KJ5A 2ZUCA 4DFMA 4UB6U 3GU3A 2BHNA 2R8KA 4CGZA 3HWTA 9ICHA 5L1IA 2ES6A 4U7CA 2ZIVB 4IS7A 3H40A 3BJYA 4C8MA 4R8UA 2IOHA 1NKBA 2E3TA 5ALWA 3JPPA 1WUDA 2BR0A 3SV4A 1BPDA 5ALRA 2DPIA 3PZPA 4IC9A 4Z6EA 4KX5A 1DGJA 1IG6A 2C22A 5KG6A 9ICLA 2YTUA 3AM9A 1ZQWA 1JMSA 3AN1A 3HJEA 7ICMA 3MR2A 4ECWA 4FBUA 3GIKA 1ZJMA 2ZIXB 4YN4A 1ZQAA 3KBBA 4DQQA 1Q3VA 2YY6A 5KG1A 5DG8A 3PV8A 3PO5A 2EZZA 2O6KA 3V6HA 2LMRA 4YMMA 4R64A 4P0QA 4PHDA 2ZTDA 4OO1J 4A8EA 8ICEA 4HAIA 8ICMA 2NRWA 5T14A 2LBOA 4FFDA 3GILA 2HHSA 9ICTA 4RQ5A 5KFVA 2FJ6A 4RU9A 1OW5A 1COKA 3HKZF 5KFHA 3MR6A 4PGQA 2C2DA 2KSOB 5H2FU 2ISPA 1F5SA 2HOFA 3RFAA 2F1IA 1PVPA 2ALZA 2P66A 5G5HA 1BGXT 4Y2RA 1WCNA 2XIDA 5TZVA 3ETRA 2VJ4A 3Q8QB 1S77D 2G5HB 4DCCA 4MF8A 3MBYA 2W03A 4QZAA 4NLCA 5KFCA 3UXOA 4O3SA 2EANA 4YMNA 1U49A 2GWSA 4DS5A 2IMWP 4XRHA 2PI4A 4JV2A 3BS5A 2XCPA 4PGYA 3Q8LA 3NGDA 3RB4A 2HBMA 3EUB2 4UATA 3TQ1A 4GXJA 4UAWA 1COOA 4EYIB 1X66A 3NASA 1SKWA 3ZDCA 4GC6A 5AICA 2KFZA 4R63A 2VIXA 5KFYA 5D46A 2EDUA 5J29A 5AM5A 2D3DA 2FDRA 4TURA 5DQHA 5J0YA 1N61A 1X2IA 5J2JA 1KBUA 9ICXA 5AM2A 4Q8FA 1NK9A 4QZDA 2R18A 4BWJA 1QQ6A 3GV8B 4I2AA 4UB8U 3HILA 4DL6A 7ICJA 2H3VA 2JHDA 3WKCA 1B22A 3UQ2A 3JPOA 1Z4NA 3MFHA 3B0XA 3EPGA 5KG0A 5KFRA 3M9OB 3L5KA 2AQ0A 5ALYA 4JMUA 8ICYA 3QUTA 1A77A 7ICPA 2ZJAA 4PHPA 3SV3A 4DS4A 4QZ8A 1ZD5A 3WKEA 3FM9A 2IOFA 2KVSA 2FMSA 3F2BA 2ZIUB 4DSFA 4DFPA 3H8WA 5BOLA 3Q8KA 2G06A 4PL1A 3E0FA 3AL0B 1J2NA 2ZIWA 2YMQA 7ICRA 1ZQRA 2CPRA 3UM9A 8ICVA 5AI9A 5J2FA 5J0UA 1L7OA 1KLNA 3EPIA 5DG9A 5F9LA 3SI8A 5DBAA 5GTIU 3QU9A 3HRDD 1V85A 4Y2JA 2HHWA 4QZHA 1D9DA 1D8YA 4QW9A 1WCLA 1LV5A 8ICIA 1ZD4A 8ICUA 2HHXA 4DSKA 3ISBA 4KLIA 3AU6A 3MC1A 3I1YA 3EZ5A 1ZQIA 1BPEA 4NLBA 4F4XA 4QIWF 5L1JA 2R8JA 4PH5A 1NJXA 1UA0A 5KT6A 4MFAA 5EE0A 4F5QA 1SWVA 4MHVA 5CEHA 4IQWA 3PSPA 1NK5A 4UAZA 3OPXA 3RH4A 3SAFA 1LVHA 3C29A 1JXLA 4US9A 3AUOA 4DLEA 3PX6A 4UB1A 3KOOA 3NS1A 3J81j 1QQ7A 7ICOA 1SZHA 3CP8A 1K5OA 4KLMA 3ALRA 9ICNA 2WF9A 2PFOA 2KP7A 3F2CA 3T5KA 2ZXHA 2D6FC 3QEBZ 4Q43A 2JEGA 2WAQC 4UAUA 5J8YA 2IBKA 1TVAA 2OHFA 2JEIA 5EWGA 3SYZA 3FDSA 2FLPA 5J2IA 1SKRA 1KL9A 5AK5A 5F3XB 5CR0A 4MFFA 1QSYA 4ED8A 5KFPA 4DSLA 4O3NA 5ALQA 4KLGA 4FS2A 1KTQA 2XY7A 4O3PA 1Q3UA 3BQ7A 5IIMA 8ICWA 3SZ2A 2EH9A 2AU0A 2DPJA 3WKBA 3C2KA 2KZ3A 3V6JA 2I9GA 2E8MA 1ZQVA 2F44A 3ETLA 3WK7A 2F76X 1ZQPA 4NXZA 7ICSA 4J9OA 1Z1VA 4BGDA 3IDWA 5ALSA 2BDPA 3H0MB 1LKYB 4RPYA 2HMXA 3T79A 2KSOA 2IOFK 1ZQHA 4Z6CA 4EELA 4XUSA 4KX3A 4RQ0A 1ZOLA 3PX0A 4UAYA 3LWLA 7ICLA 2E8PA 2BPFA 3G6YA 1NI3A 1SL2A 3OJSA 2CXYA 5EOZA 4UBBA 5KFWA 1CRXA 2ESEA 3SAGA 4F91B 1DK2A 3D6JA 2BCQA 1D8LA 3IN5A 1L6NA 2W7PA 3N7SC 2G09A 1SWWA 4DF4A 3M8RA 4X5VA 1UQVA 2BCRA 3OSPA 3AQFA 3C23A 1NJZA 3PO4A 2G08A 4NL9C 4TUSA 1L8LA 4RNOA 2ZXIA 5AM4A 2MA1A 5DGBA 3H0RB 4Y2XA 2W9CB 5AM1A 3PMLA 3RJHA 1SGGA 5L1KA 1ZQOA 3E2EA 4DLGA 2JEJA 5DQIA 1DOQA 1T3QA 5KG7A 2F3NA 2A3VA 1V97A 3RB6A 4US8A 3Q8SB 2EQYA 5DB8A 2PKEA 2EAOA 1JALA 1X42A 2NRTA 4AYBF 4ECVA 2KZZA 1N56A 5ALVA 5ALDA 2ZUDA 1MSWD 3QUCA 4OJPA 1VJ5A 2Y9TA 4DQIA 3KHRA 3H8SA 2W54A 4AP9A 4YFKA 4DOAA 1T4GA 3I76A 2YQEA 2XGPA 3THVA 2EAMA 2NRVA 4F4KA 4IQTA 4NLNA 3SR6A 1N62A 4F2SA 4F2RA 1S0OA 4USAA 2ZIXA 4PL2A 2XI9A 4C80A 1ZQYA 9ICCA 3MGHA 2KJ9A 3N7RC 4KLOA 9ICMA 4TQRA 3SAHA 4P0PB 4QWEA 2MU2A 1ZQNA 2MSNA 5AKHA 8ICLA 3V7KA 1ZRMA 3GV7B 3PVXA 3MABA 1D9FA 5HMMA 5DDYA 3D2NA 3UPQA 1PK3A 2I1QA 1YZ7A 5CRXA 4BWMA 4RQ4A 4Y2SA 2JZBA 1ZQKA 5KL8B 1C20A 4RQ2A 2HVHA 3RJEA 3SD7A 4JV0A 4YR0A 4KLUA 1ZJNA 3T3FA 1QSSA 3PW2A 2Q4TA 1KFTA 2ZTCA 1RYSA 3RAXA 2FLNA 4F5PA 4ACOA 2DGZA 1N63A 3C1ZA 3M7DA 2HCFA 4IRKA 2K4EA 3Q8PB 3HT3A 7ICKA 2XVTA 4EEYA 2W55A 1XNSA 1ZQZA 2FPLA 2ODGA 2E5SA 2BZFA 7ICNA 2RDIA 4YP3A 2LM1A 3GFKB 3LVVA 4RQ7A 3VC8A 4Q45A 2H3IA 3N7PD 1ZD3A 2B0CA 3MFIA 2BCSA 2LYHA 3V7LA 3IHQB 3HPOA 2JV3A 5KFBA 3RBDA 4BJQA 2RLTA 3LVWA 4KTQA 3MR5A 4MFCA 4KLTA 1KRPA 7ICTA 3UXNA 5KT3A 1XSPA 2H3QA 8ICOA 4C8NA 4J9SA 4BXOB 1L5UA 1IIPA 5AKZA 3TFSA 2KV2A 5DKWA 4RT2A 4UBCA 1MN8A 2WB1F 2C28A 3BZKA 1FIQA 4F5RA 2PFQA 2M9NA 4CCHA 5ALZA 3WK8A 5E79U 3NRZA 2ZIVA 1S0MA 4KITB 1ZQTA 1UT5A 5IIIA 4ZH4A 1XO0A 3CW2C 3C5GA 2V4RA 2AGQA 1JROA 2K8BB 5CP2A 3ZDAA 2KIWA 3KD3A 1X9MA 2W9AA 3M8SA 1KKXA 4MEXA 1A6SA 1Q8KA 2NRZA 3F5AA 2QKQA 4J9LA 5EWFA 4P4MA 3RJFA 2AXTU 4U6PA 2KD1A 3QNMA 3PSIA 1FEZA 3ORYA 9ICRA 2RRDA 5KFUA 4QZIA 2VJ5A 5HHIA 2NV3A 1RQLA 2BPGA 4EENA 4M9GA 4DL4A 3SENA 4QJFB 4UW9A 4ED0A 3WU2U 1RPLA 1YT3A 4KMOB 9ICAA 5TISU 4J9MA 2A19A 3UMBA 2HI0A 1NKCA 4IQVA 4O3OA 4YMOA 4RQ1A 4LVSA 4ECSA 1O08A 3QZ8A 2Y0SC 1U45A 1PK1B 2KVCA 4O5EA 3KKAA 5AKXA 9ICIA 8ICCA 4RQ3A 5DDMA 5HP4A 2AH5A 1JI7A 4DL5A 3ZDBA 4KLFA 2BQ3A 2HOQA 2WHEA 4F4WA 2W8LA 2WAQF 3PSTA 5HR7A 1NOMA 3QX7A 4RT3A 9ICKA 2DBYA 4CE6A 2V9WA 3RRHA 4QWCA 4XA5A 2NO5A 3OJUA 3QU5A 2HHTA 2YMMA 3F5EA 4UQGA 2WTFA 1S10A 4KLSA 1A0PA 2YX8A 2OXOA 4UB3A 3TKAA 1XO1A 5ALFA 3QU4A 4M6WB 1X6JA 4DFKA 9ICBA 1ZXIA 4GIBA 3RAQA 4C4SA 5J2DA 1Z3EB 2KKVA 1X9SA 8ICTA 2C2RA 1MA7A 1KEJA 5FP0A 1L3TA 3JPTA 2KG5A 5DGAA 5AI5A 1J2MA 4KLDA 2PMZF 5AKLA 4DEZA 1JRPA 8ICAA 5AKGA 2EZXA 3C2LA 4F92B 5AK3A 2DFLA 3RB3A 1J97A 4NM1A 1U48A 1PUZA 1RYUA 3HX0A 2B6GA 4JV1A 1ECWA 3L4PA 2RQ5A 2KIVA 1KW4A 4CDGA 2F77X 3PW0A 5AIBA 1VLBA 2CN1A 8ICZA 1WYGA 1Z1BA 2NYVA 5JU5A 4KMUA 1HIWA 2D8CA 4NLKA 1TAQA 3OSNA 1S9FA 4LJXA 4PZOA 2R8GA 4B9NA 4J9NA 3BS7A 3V7JA 5KG4A 1K1QA 3KKAC 2ZIWB 3N4MB 2KHQA 3LK9A 5IIKA 3G6XA 3UQ0A 3GQCA 1F0MA 1XU4A 4ED2A 1CEZA 4BDPA 3M9NB 1V38A 1Z00B 5AKKA 4EX6A 1TKDA 4Y2PA 3BQTA 3PX4A 3ZD9A 1RXVA 1IXRA 4I2EA 3F53A 3WKDA 3BS5B 3T5LA 3GIMA 4C8LA 4I2GA 9ICQA 5HHHA 7ICEA 5AI8A 2A1JB 3KTQA 1N5WA 3HKZC 2DF4B 1T8EA 2YN4A 4K4GA 2LYAA 3ISDA 3RTVA 3IG5A 3SEIA 3H0LB 5IIOA 3V72A 1QSLA 2F8LA 2W43A 3LYSA 4UASA 3ZDDA 2ZIUA 2DKXA 5EE9A 4I2BA 2BQRA 5CHGA 5KG5A 2IHMA 1QCKA 1XS9D 2EAPA 4EEKA 4CF5A 1YZ6A 2HBLA 2F2AB 1IM4A 1L3VA 5ALIA 5CWRA 4R66A 4YXJA 1A76A 3DV9A 2DUYA 2DQNB 1PK1A 4Y2YA 5AKJA 3GV5B 2BPCA 5D4BA 4C0ZA 2AHOB 3TADA 2FLLA 1HJPA 1T7PA 3M6KA 5KFDA 5KFQA 3AEVA 2LKYA 8ICXA 5AM0A 4ECTA 1CUKA 5J0XA 2ZUBA 3RJKA 4OJOA 1T94A 4UB4A 4YR3A 3I28A 2F1JA 1Y88A 5J2AA 2LI6A 3T5JA 4Z6FA 4F5OA 4I2DA 4P2HA 2PFNA 9ICWA 3QZ7A 5ALLA 2BCUA 5F9NA 3VCBA 1SXDA 3DDHA 4RNMA 3Q8MA 3TARA 3RRGA 1RYRA 3QE9Y 4B9MA 4PHAA 5CA7A 2K8AA 4EX7A 2FMPA 5J2GA 2VKQA 2IA6A 2RDJA 2NO4A 1NJWA 4RQ8A 5KAIU 4GC7A 5AKIA 1SIJA 1FFVA 5DLGA 3OHAA 1QTMA 4OCZA 4ED1A 5G5GA 2E8OA
chains in the Genus database with same CATH topology
2EH9A 1IG6A 1KKXA 2LI6A 1KQQA 2EQYA 1RYUA 2JXJA 4LJXA 2OEHA 1C20A 1KN5A 2YQEA 2JRZA 5K4LA 2LM1A 2RQ5A 5CEHA 2CXYA 2KK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EH9 A;  1IG6 A;  1KKX A;  2LI6 A;  1KQQ A;  2EQY A;  1RYU A;  2JXJ A;  4LJX A;  2OEH A;  1C20 A;  1KN5 A;  2YQE A;  2JRZ A;  5K4L A;  2LM1 A;  2RQ5 A;  5CEH A;  2CXY A;  2KK0 A; 
#chains in the Genus database with same CATH topology
 2H3F A;  3GZF A;  2XY5 A;  1ZQB A;  4JWN A;  5AIA A;  2FPK A;  4QNL A;  4GLX A;  1OUQ A;  9ICJ A;  1DK3 A;  2W7O A;  1B4F A;  1OXJ A;  2RHF A;  5DB9 A;  4QWD A;  1MQ2 A;  4FO6 A;  5JUM A;  3OGU A;  1S0V A;  1SXE A;  3KFU F;  5HML A;  2GLE A;  3TAQ A;  4XQ8 A;  1KDH A;  3MGI A;  4QWA A;  2JH7 A;  4PJ0 U;  2HDO A;  5HNK A;  4EBD A;  3TAN A;  1TAU A;  2KHV A;  1XWL A;  2OCE A;  3IM1 A;  7ICG A;  2ATL A;  2LHT A;  2Y1I A;  4F4Z A;  3V6K A;  1JXE A;  4KN4 A;  2Y0S F;  4ELU A;  2HW3 A;  1BPY A;  4UB5 A;  2VA2 A;  2G07 A;  1LB2 B;  4DFJ A;  3ED5 A;  2WB1 C;  3H4D A;  4J9P A;  2HHV A;  4M2Y A;  3QU7 A;  2I5H A;  4KLJ A;  1KSP A;  3UMG A;  4MF2 A;  4DOC A;  4BXO A;  2MUT A;  5KFT A;  3FAH A;  3NVY A;  2W04 A;  3NVZ A;  1B0X A;  4Y2U A;  1WWU A;  5BOM A;  5AM3 A;  4RQ6 A;  1HUZ A;  5D49 A;  2HHQ A;  2ASL A;  4OJ6 A;  4M47 A;  2JXJ A;  1BVS A;  4GXI A;  2NRX A;  3BQ2 A;  5KFS A;  1SKS A;  2K4P A;  1O03 A;  1BPX A;  4G3I A;  1SL1 A;  2HHU A;  2KTQ A;  4ED6 A;  5KFM A;  2Q0Z X;  2JRZ A;  4B9S A;  8ICS A;  3TAP A;  4QW8 A;  1P7D A;  1AQ6 A;  4DSI A;  5ALO A;  1QQ5 A;  5KFJ A;  4QZC A;  5AI0 A;  2KMD A;  4ED7 A;  1DRG A;  1ZET A;  4WJ3 B;  3MGV A;  2B21 A;  2XGQ A;  4BX9 C;  2YML A;  4EZ6 A;  2QLT A;  5DBC A;  3RBE A;  9ICS A;  5BPC A;  4YD1 A;  3AMZ A;  1KFD A;  3BQ1 A;  2J6S A;  9ICE A;  1ZQJ A;  5KFL A;  4CF4 A;  3PR5 B;  2AGO A;  5KG2 A;  3WK9 A;  1JUD A;  3MR3 A;  3SQI A;  2W9M A;  5ALM A;  3RJG A;  2L5Y A;  1Z00 A;  4K4I A;  2HSZ A;  4ED3 A;  5J0Q A;  5DLF A;  4O3R A;  1N2X A;  4F93 B;  4P0P A;  1RDF A;  2A1A A;  4M9J A;  1MC8 A;  2FI1 A;  4I2F A;  5AI6 A;  4CNQ A;  2A1J A;  4Y2V A;  2VA8 A;  5KFA A;  2Y9U A;  2ZJ5 A;  2K4I A;  2DWQ A;  4JUZ A;  2WFA A;  3KHL A;  4M9L A;  5IIN A;  3PR4 A;  2KK0 A;  3B0Y A;  1PZN A;  4DOB A;  4I27 A;  3H4B A;  1U4B A;  1NK4 A;  1NZP A;  4R65 A;  1N48 A;  5KT5 A;  5ALE A;  2WF8 A;  2C2E A;  5KFN A;  2PXI A;  5CJ7 A;  1KQQ A;  3C28 A;  2W3S A;  2AJQ A;  4PPX A;  2MRL A;  1UHU A;  5HR6 A;  3L3F X;  3TAD C;  1TAM A;  4NL9 A;  3ZD8 A;  1S76 D;  1CI4 A;  4DSE A;  5JRT A;  3UMC A;  1TK8 A;  3IP4 B;  1GO3 F;  1X9X A;  2E1F A;  4O3Q A;  1S0N A;  1RXW A;  2QB1 A;  4DL3 A;  2E8N A;  1H38 A;  1UPH A;  2XY6 A;  2EZY A;  3CNH A;  3KZX A;  4C7Y A;  5J0P A;  4YQW A;  3PW5 A;  4B9L A;  1UT8 A;  4DFD A;  3NVV A;  3RJI A;  3C1Y A;  5AHX A;  2YB1 A;  3KZI U;  4J9Q A;  2PFP A;  2JH1 A;  4C8O A;  1SL0 A;  2MAX A;  2JMG A;  3NVW A;  2QB0 B;  9ICP A;  2JGA A;  4UAV A;  4OD0 A;  1DGS A;  4RQN A;  5J0W A;  4IRC A;  3QEA Z;  5ALH A;  2K60 A;  3K1R B;  1ZQM A;  3WK6 A;  2V4Q A;  4O0I A;  2KZM A;  4G9B A;  4MEY A;  3C21 A;  3C5F A;  3QUB A;  2W8K A;  3PW4 A;  1DXS A;  7ICU A;  1BPZ A;  4DQS A;  3A0H U;  3H8J A;  3H7I A;  1ZQF A;  1WG8 A;  4I29 A;  3D2S A;  2FE9 A;  4KLQ A;  5AKY A;  2F1H A;  4UAR A;  4M6W A;  3RJJ A;  9ICU A;  5KT2 A;  4KN7 A;  2G0A A;  5J2C A;  3ZDE A;  1T3N A;  4TQS A;  2KJ8 A;  3CYM A;  2AGP A;  1L7P A;  5DG7 A;  5ALX A;  3M9M B;  3HW8 A;  4O3M A;  8ICG A;  5KFK A;  4YVZ A;  2W9B A;  4OJ5 A;  4QWB A;  4NLG A;  4NWI A;  1NK8 A;  1ZQL A;  5L9X A;  4IQU A;  1XC9 A;  4PZN A;  4ELT A;  5KFE A;  2H5X A;  4DL2 A;  3RH6 A;  2BCV A;  2KIC A;  5L1M A;  2KKP A;  5L1L A;  1L8O A;  3LDA A;  3RR7 A;  1S5L U;  2FMQ A;  8ICR A;  3M6Z A;  3EWA A;  5ALT A;  2OEH A;  1SV4 A;  3U26 A;  5J2B A;  4LZG A;  1N60 A;  2MUT B;  2J6U A;  2E1E A;  3IV6 A;  4R8U B;  3FYH A;  2XCA A;  1ZQS A;  3BQ0 A;  5KT4 A;  1EXN A;  3IG8 A;  5AI4 A;  4F5N A;  4ECZ A;  3SMV A;  2FPM A;  4QZ9 A;  7ICH A;  2KFN A;  1Z19 A;  3JPR A;  2UVU A;  4IRD A;  5AK6 A;  3WK5 A;  2JZB B;  2YMP A;  5EWE A;  2W9B B;  1NK0 A;  4FE3 A;  4IL6 U;  3TI0 A;  5J0R A;  4F71 A;  3QYP A;  2K8C B;  4RPX A;  2W11 A;  5KNI A;  3UXP A;  4EYH B;  4P4O A;  4I2C A;  1HEK A;  2GOL A;  2P35 A;  4QZB A;  1S97 A;  4RUA A;  4DWI A;  4F4Y A;  3HP6 A;  5KFG A;  8ICJ A;  4IR1 A;  4M9N A;  4K4H A;  4YG2 A;  1KN5 A;  2XC9 A;  4P0Q B;  1RZT A;  2JEF A;  3NUQ A;  4KLE A;  5EE3 A;  3BZC A;  1NNL A;  3O0F A;  1QH9 A;  8ICP A;  3RF9 A;  5DQG A;  2CRX A;  1U9L A;  2HOI A;  4B6J A;  5ALK A;  2DL0 A;  2K89 A;  4QIW C;  5JTI A;  1M6Y A;  3IRU A;  2LYB A;  1WWV A;  4TUQ A;  7ICQ A;  5ALG A;  3PNC A;  4C7Z A;  3H8M A;  1RM6 C;  5KFI A;  4KLL A;  4O9M A;  5GTH U;  4RUC A;  1VDV A;  4EBC A;  5ALJ A;  5J0T A;  4DSJ A;  3GII A;  4B9V A;  1PVQ A;  4CF3 A;  1L3S A;  4M9H A;  2KN7 A;  1ARO P;  2QAR B;  1K1S A;  3S6J A;  2LPE A;  2PI5 A;  4RZR A;  4FZM A;  1ZQ1 C;  1BPB A;  4TUP A;  1L7N A;  4ECR A;  9ICO A;  4J9K A;  5DBB A;  4FBT A;  3EW9 A;  5J2E A;  4QZF A;  2UVR A;  3KHG A;  3T5H A;  1NK6 A;  4UB2 A;  9ICF A;  2XIC A;  4NY8 A;  4M0A A;  3NRW A;  2HBJ A;  4M04 A;  5J8Y C;  4BUG A;  1JN3 A;  2M0N A;  4J9R A;  5AK4 A;  5DB6 A;  4LZD A;  1NKE A;  1ZD2 P;  1NK7 A;  5J0O A;  1RQN A;  5KFX A;  2OWO A;  3MDA A;  3JPS A;  2W3R A;  2QB0 A;  2J6T A;  1D8B A;  9ICV A;  2I6X A;  3EYZ A;  1KFS A;  3DEE A;  4GFJ A;  2KNJ A;  2ZJ8 A;  4FS1 A;  3KHH A;  4ECX A;  5IIL A;  1L7M A;  2QAR A;  2VA3 A;  4RQM A;  4ZOH C;  9ICG A;  1TK5 A;  3JPN A;  1ZQG A;  5J2H A;  5C0Y A;  4Z6D A;  3K75 D;  4HYK A;  1Z4O A;  2IHN A;  5K4L A;  4JB3 A;  4C4R A;  2K4H A;  2WF6 A;  2KE7 A;  3BDP A;  8ICB A;  2AQ4 A;  2Z7J A;  3A0B U;  2BDU A;  8ICK A;  1IV8 A;  4YCX A;  5KL1 B;  8ICQ A;  3Q8R B;  3MDC A;  4IR9 A;  1SV0 C;  3K1Z A;  3M1Y A;  1SZP A;  3CRX A;  3PMN A;  1S8O A;  1ZQQ A;  1F44 A;  5KFO A;  3RB0 A;  1TE2 A;  4O5C A;  4YXM A;  1SB3 C;  8ICF A;  4OJL A;  5KG3 A;  4ECY A;  4JWM A;  3K4G A;  2DKZ A;  3AQE A;  1V9P A;  1ZQC A;  3NTU A;  1RG6 A;  4JK1 A;  3TAC B;  8ICH A;  1B43 A;  3WKA A;  5B5E U;  5EE1 A;  4EZ9 A;  4DF8 A;  4RNN A;  3WK4 A;  5KAF U;  2RP5 A;  4DO9 A;  3PSF A;  4PGX A;  4Y2Q A;  1TK0 A;  1ZQE A;  2JR5 A;  1FFU A;  5AKE A;  5CB1 A;  3RH5 A;  3F2D A;  1URJ A;  5C5J A;  1BNP A;  4DQR A;  4P4P A;  3GDX A;  3GIJ A;  5KTQ A;  8ICN A;  1ZQX A;  3AU2 A;  1BNO A;  1HUO A;  1L3U A;  2ISO A;  4Q8E A;  3C2M A;  2HBK A;  3OHB A;  1ZRN A;  7ICI A;  3TFR A;  4I2I A;  4QZG A;  2WF7 A;  3E58 A;  2UVV A;  1LKY A;  4YD2 A;  1MQ3 A;  2WF5 A;  1TV9 A;  4F8R A;  2R8I A;  1X40 A;  5KFZ A;  2ZTE A;  1ZQD A;  2OYY A;  4NV0 A;  4CRX A;  4KLH A;  7ICV A;  3FC4 A;  2KEY A;  5ALP A;  1UA1 A;  1XSN A;  4DQP A;  5DB7 A;  5A0L A;  4B9U A;  1TFR A;  3PY8 A;  1PVR A;  2N1R A;  1U47 A;  4GXK A;  1X6I A;  2XO7 A;  2Y1J A;  2G5I B;  2P6U A;  4ECU A;  2P6R A;  4B9T A;  7ICF A;  2OH2 A;  3N28 A;  4F3O A;  1C7Y A;  2UVW A;  2BQU A;  4EBE A;  1QLN A;  4NM2 A;  1SV0 A;  2PMZ C;  1NJY A;  5J2K A;  4Q44 A;  3B9J A;  4I28 A;  3OTQ A;  3R9K A;  2F8K A;  2LM4 A;  2ZG6 A;  4ICA A;  4C4T A;  4E0D A;  1ZQU A;  3D2Q A;  1Q46 A;  4I2J A;  1N5X A;  4NJ8 A;  3ZI4 A;  4QZE A;  3ICX A;  1ED1 A;  4YR2 A;  4FZN A;  4C8K A;  5ALU A;  3RR8 A;  3N97 B;  4DL7 A;  1X9W A;  4O5K A;  2BKE A;  3QXG A;  4ELV A;  5KFF A;  2HVI A;  4RPZ A;  5IIJ A;  4J03 A;  2W9C A;  1XSL A;  4AYB C;  3LWM A;  2BGW A;  4F50 A;  2KOB A;  2ASD A;  4FZL A;  2YB4 A;  5J0S A;  3JPQ A;  3QUQ A;  4F72 A;  2VAN A;  4PHE A;  2ASJ A;  5B66 U;  2GO7 A;  5ALN A;  1UCV A;  5KT7 A;  1JX4 A;  2GH1 A;  4NLZ A;  1FO4 A;  1ZYQ A;  1JIH A;  3ONN A;  3ISC A;  1NZB A;  2H3Z A;  3QU2 A;  3PW7 A;  2OM6 A;  3G6V A;  4Y2T A;  2R8H A;  4ECQ A;  4I2H A;  2KJ5 A;  2ZUC A;  4DFM A;  4UB6 U;  3GU3 A;  2BHN A;  2R8K A;  4CGZ A;  3HWT A;  9ICH A;  5L1I A;  2ES6 A;  4U7C A;  2ZIV B;  4IS7 A;  3H40 A;  3BJY A;  4C8M A;  4R8U A;  2IOH A;  1NKB A;  2E3T A;  5ALW A;  3JPP A;  1WUD A;  2BR0 A;  3SV4 A;  1BPD A;  5ALR A;  2DPI A;  3PZP A;  4IC9 A;  4Z6E A;  4KX5 A;  1DGJ A;  1IG6 A;  2C22 A;  5KG6 A;  9ICL A;  2YTU A;  3AM9 A;  1ZQW A;  1JMS A;  3AN1 A;  3HJE A;  7ICM A;  3MR2 A;  4ECW A;  4FBU A;  3GIK A;  1ZJM A;  2ZIX B;  4YN4 A;  1ZQA A;  3KBB A;  4DQQ A;  1Q3V A;  2YY6 A;  5KG1 A;  5DG8 A;  3PV8 A;  3PO5 A;  2EZZ A;  2O6K A;  3V6H A;  2LMR A;  4YMM A;  4R64 A;  4P0Q A;  4PHD A;  2ZTD A;  4OO1 J;  4A8E A;  8ICE A;  4HAI A;  8ICM A;  2NRW A;  5T14 A;  2LBO A;  4FFD A;  3GIL A;  2HHS A;  9ICT A;  4RQ5 A;  5KFV A;  2FJ6 A;  4RU9 A;  1OW5 A;  1COK A;  3HKZ F;  5KFH A;  3MR6 A;  4PGQ A;  2C2D A;  2KSO B;  5H2F U;  2ISP A;  1F5S A;  2HOF A;  3RFA A;  2F1I A;  1PVP A;  2ALZ A;  2P66 A;  5G5H A;  1BGX T;  4Y2R A;  1WCN A;  2XID A;  5TZV A;  3ETR A;  2VJ4 A;  3Q8Q B;  1S77 D;  2G5H B;  4DCC A;  4MF8 A;  3MBY A;  2W03 A;  4QZA A;  4NLC A;  5KFC A;  3UXO A;  4O3S A;  2EAN A;  4YMN A;  1U49 A;  2GWS A;  4DS5 A;  2IMW P;  4XRH A;  2PI4 A;  4JV2 A;  3BS5 A;  2XCP A;  4PGY A;  3Q8L A;  3NGD A;  3RB4 A;  2HBM A;  3EUB 2;  4UAT A;  3TQ1 A;  4GXJ A;  4UAW A;  1COO A;  4EYI B;  1X66 A;  3NAS A;  1SKW A;  3ZDC A;  4GC6 A;  5AIC A;  2KFZ A;  4R63 A;  2VIX A;  5KFY A;  5D46 A;  2EDU A;  5J29 A;  5AM5 A;  2D3D A;  2FDR A;  4TUR A;  5DQH A;  5J0Y A;  1N61 A;  1X2I A;  5J2J A;  1KBU A;  9ICX A;  5AM2 A;  4Q8F A;  1NK9 A;  4QZD A;  2R18 A;  4BWJ A;  1QQ6 A;  3GV8 B;  4I2A A;  4UB8 U;  3HIL A;  4DL6 A;  7ICJ A;  2H3V A;  2JHD A;  3WKC A;  1B22 A;  3UQ2 A;  3JPO A;  1Z4N A;  3MFH A;  3B0X A;  3EPG A;  5KG0 A;  5KFR A;  3M9O B;  3L5K A;  2AQ0 A;  5ALY A;  4JMU A;  8ICY A;  3QUT A;  1A77 A;  7ICP A;  2ZJA A;  4PHP A;  3SV3 A;  4DS4 A;  4QZ8 A;  1ZD5 A;  3WKE A;  3FM9 A;  2IOF A;  2KVS A;  2FMS A;  3F2B A;  2ZIU B;  4DSF A;  4DFP A;  3H8W A;  5BOL A;  3Q8K A;  2G06 A;  4PL1 A;  3E0F A;  3AL0 B;  1J2N A;  2ZIW A;  2YMQ A;  7ICR A;  1ZQR A;  2CPR A;  3UM9 A;  8ICV A;  5AI9 A;  5J2F A;  5J0U A;  1L7O A;  1KLN A;  3EPI A;  5DG9 A;  5F9L A;  3SI8 A;  5DBA A;  5GTI U;  3QU9 A;  3HRD D;  1V85 A;  4Y2J A;  2HHW A;  4QZH A;  1D9D A;  1D8Y A;  4QW9 A;  1WCL A;  1LV5 A;  8ICI A;  1ZD4 A;  8ICU A;  2HHX A;  4DSK A;  3ISB A;  4KLI A;  3AU6 A;  3MC1 A;  3I1Y A;  3EZ5 A;  1ZQI A;  1BPE A;  4NLB A;  4F4X A;  4QIW F;  5L1J A;  2R8J A;  4PH5 A;  1NJX A;  1UA0 A;  5KT6 A;  4MFA A;  5EE0 A;  4F5Q A;  1SWV A;  4MHV A;  5CEH A;  4IQW A;  3PSP A;  1NK5 A;  4UAZ A;  3OPX A;  3RH4 A;  3SAF A;  1LVH A;  3C29 A;  1JXL A;  4US9 A;  3AUO A;  4DLE A;  3PX6 A;  4UB1 A;  3KOO A;  3NS1 A;  3J81 j;  1QQ7 A;  7ICO A;  1SZH A;  3CP8 A;  1K5O A;  4KLM A;  3ALR A;  9ICN A;  2WF9 A;  2PFO A;  2KP7 A;  3F2C A;  3T5K A;  2ZXH A;  2D6F C;  3QEB Z;  4Q43 A;  2JEG A;  2WAQ C;  4UAU A;  5J8Y A;  2IBK A;  1TVA A;  2OHF A;  2JEI A;  5EWG A;  3SYZ A;  3FDS A;  2FLP A;  5J2I A;  1SKR A;  1KL9 A;  5AK5 A;  5F3X B;  5CR0 A;  4MFF A;  1QSY A;  4ED8 A;  5KFP A;  4DSL A;  4O3N A;  5ALQ A;  4KLG A;  4FS2 A;  1KTQ A;  2XY7 A;  4O3P A;  1Q3U A;  3BQ7 A;  5IIM A;  8ICW A;  3SZ2 A;  2EH9 A;  2AU0 A;  2DPJ A;  3WKB A;  3C2K A;  2KZ3 A;  3V6J A;  2I9G A;  2E8M A;  1ZQV A;  2F44 A;  3ETL A;  3WK7 A;  2F76 X;  1ZQP A;  4NXZ A;  7ICS A;  4J9O A;  1Z1V A;  4BGD A;  3IDW A;  5ALS A;  2BDP A;  3H0M B;  1LKY B;  4RPY A;  2HMX A;  3T79 A;  2KSO A;  2IOF K;  1ZQH A;  4Z6C A;  4EEL A;  4XUS A;  4KX3 A;  4RQ0 A;  1ZOL A;  3PX0 A;  4UAY A;  3LWL A;  7ICL A;  2E8P A;  2BPF A;  3G6Y A;  1NI3 A;  1SL2 A;  3OJS A;  2CXY A;  5EOZ A;  4UBB A;  5KFW A;  1CRX A;  2ESE A;  3SAG A;  4F91 B;  1DK2 A;  3D6J A;  2BCQ A;  1D8L A;  3IN5 A;  1L6N A;  2W7P A;  3N7S C;  2G09 A;  1SWW A;  4DF4 A;  3M8R A;  4X5V A;  1UQV A;  2BCR A;  3OSP A;  3AQF A;  3C23 A;  1NJZ A;  3PO4 A;  2G08 A;  4NL9 C;  4TUS A;  1L8L A;  4RNO A;  2ZXI A;  5AM4 A;  2MA1 A;  5DGB A;  3H0R B;  4Y2X A;  2W9C B;  5AM1 A;  3PML A;  3RJH A;  1SGG A;  5L1K A;  1ZQO A;  3E2E A;  4DLG A;  2JEJ A;  5DQI A;  1DOQ A;  1T3Q A;  5KG7 A;  2F3N A;  2A3V A;  1V97 A;  3RB6 A;  4US8 A;  3Q8S B;  2EQY A;  5DB8 A;  2PKE A;  2EAO A;  1JAL A;  1X42 A;  2NRT A;  4AYB F;  4ECV A;  2KZZ A;  1N56 A;  5ALV A;  5ALD A;  2ZUD A;  1MSW D;  3QUC A;  4OJP A;  1VJ5 A;  2Y9T A;  4DQI A;  3KHR A;  3H8S A;  2W54 A;  4AP9 A;  4YFK A;  4DOA A;  1T4G A;  3I76 A;  2YQE A;  2XGP A;  3THV A;  2EAM A;  2NRV A;  4F4K A;  4IQT A;  4NLN A;  3SR6 A;  1N62 A;  4F2S A;  4F2R A;  1S0O A;  4USA A;  2ZIX A;  4PL2 A;  2XI9 A;  4C80 A;  1ZQY A;  9ICC A;  3MGH A;  2KJ9 A;  3N7R C;  4KLO A;  9ICM A;  4TQR A;  3SAH A;  4P0P B;  4QWE A;  2MU2 A;  1ZQN A;  2MSN A;  5AKH A;  8ICL A;  3V7K A;  1ZRM A;  3GV7 B;  3PVX A;  3MAB A;  1D9F A;  5HMM A;  5DDY A;  3D2N A;  3UPQ A;  1PK3 A;  2I1Q A;  1YZ7 A;  5CRX A;  4BWM A;  4RQ4 A;  4Y2S A;  2JZB A;  1ZQK A;  5KL8 B;  1C20 A;  4RQ2 A;  2HVH A;  3RJE A;  3SD7 A;  4JV0 A;  4YR0 A;  4KLU A;  1ZJN A;  3T3F A;  1QSS A;  3PW2 A;  2Q4T A;  1KFT A;  2ZTC A;  1RYS A;  3RAX A;  2FLN A;  4F5P A;  4ACO A;  2DGZ A;  1N63 A;  3C1Z A;  3M7D A;  2HCF A;  4IRK A;  2K4E A;  3Q8P B;  3HT3 A;  7ICK A;  2XVT A;  4EEY A;  2W55 A;  1XNS A;  1ZQZ A;  2FPL A;  2ODG A;  2E5S A;  2BZF A;  7ICN A;  2RDI A;  4YP3 A;  2LM1 A;  3GFK B;  3LVV A;  4RQ7 A;  3VC8 A;  4Q45 A;  2H3I A;  3N7P D;  1ZD3 A;  2B0C A;  3MFI A;  2BCS A;  2LYH A;  3V7L A;  3IHQ B;  3HPO A;  2JV3 A;  5KFB A;  3RBD A;  4BJQ A;  2RLT A;  3LVW A;  4KTQ A;  3MR5 A;  4MFC A;  4KLT A;  1KRP A;  7ICT A;  3UXN A;  5KT3 A;  1XSP A;  2H3Q A;  8ICO A;  4C8N A;  4J9S A;  4BXO B;  1L5U A;  1IIP A;  5AKZ A;  3TFS A;  2KV2 A;  5DKW A;  4RT2 A;  4UBC A;  1MN8 A;  2WB1 F;  2C28 A;  3BZK A;  1FIQ A;  4F5R A;  2PFQ A;  2M9N A;  4CCH A;  5ALZ A;  3WK8 A;  5E79 U;  3NRZ A;  2ZIV A;  1S0M A;  4KIT B;  1ZQT A;  1UT5 A;  5III A;  4ZH4 A;  1XO0 A;  3CW2 C;  3C5G A;  2V4R A;  2AGQ A;  1JRO A;  2K8B B;  5CP2 A;  3ZDA A;  2KIW A;  3KD3 A;  1X9M A;  2W9A A;  3M8S A;  1KKX A;  4MEX A;  1A6S A;  1Q8K A;  2NRZ A;  3F5A A;  2QKQ A;  4J9L A;  5EWF A;  4P4M A;  3RJF A;  2AXT U;  4U6P A;  2KD1 A;  3QNM A;  3PSI A;  1FEZ A;  3ORY A;  9ICR A;  2RRD A;  5KFU A;  4QZI A;  2VJ5 A;  5HHI A;  2NV3 A;  1RQL A;  2BPG A;  4EEN A;  4M9G A;  4DL4 A;  3SEN A;  4QJF B;  4UW9 A;  4ED0 A;  3WU2 U;  1RPL A;  1YT3 A;  4KMO B;  9ICA A;  5TIS U;  4J9M A;  2A19 A;  3UMB A;  2HI0 A;  1NKC A;  4IQV A;  4O3O A;  4YMO A;  4RQ1 A;  4LVS A;  4ECS A;  1O08 A;  3QZ8 A;  2Y0S C;  1U45 A;  1PK1 B;  2KVC A;  4O5E A;  3KKA A;  5AKX A;  9ICI A;  8ICC A;  4RQ3 A;  5DDM A;  5HP4 A;  2AH5 A;  1JI7 A;  4DL5 A;  3ZDB A;  4KLF A;  2BQ3 A;  2HOQ A;  2WHE A;  4F4W A;  2W8L A;  2WAQ F;  3PST A;  5HR7 A;  1NOM A;  3QX7 A;  4RT3 A;  9ICK A;  2DBY A;  4CE6 A;  2V9W A;  3RRH A;  4QWC A;  4XA5 A;  2NO5 A;  3OJU A;  3QU5 A;  2HHT A;  2YMM A;  3F5E A;  4UQG A;  2WTF A;  1S10 A;  4KLS A;  1A0P A;  2YX8 A;  2OXO A;  4UB3 A;  3TKA A;  1XO1 A;  5ALF A;  3QU4 A;  4M6W B;  1X6J A;  4DFK A;  9ICB A;  1ZXI A;  4GIB A;  3RAQ A;  4C4S A;  5J2D A;  1Z3E B;  2KKV A;  1X9S A;  8ICT A;  2C2R A;  1MA7 A;  1KEJ A;  5FP0 A;  1L3T A;  3JPT A;  2KG5 A;  5DGA A;  5AI5 A;  1J2M A;  4KLD A;  2PMZ F;  5AKL A;  4DEZ A;  1JRP A;  8ICA A;  5AKG A;  2EZX A;  3C2L A;  4F92 B;  5AK3 A;  2DFL A;  3RB3 A;  1J97 A;  4NM1 A;  1U48 A;  1PUZ A;  1RYU A;  3HX0 A;  2B6G A;  4JV1 A;  1ECW A;  3L4P A;  2RQ5 A;  2KIV A;  1KW4 A;  4CDG A;  2F77 X;  3PW0 A;  5AIB A;  1VLB A;  2CN1 A;  8ICZ A;  1WYG A;  1Z1B A;  2NYV A;  5JU5 A;  4KMU A;  1HIW A;  2D8C A;  4NLK A;  1TAQ A;  3OSN A;  1S9F A;  4LJX A;  4PZO A;  2R8G A;  4B9N A;  4J9N A;  3BS7 A;  3V7J A;  5KG4 A;  1K1Q A;  3KKA C;  2ZIW B;  3N4M B;  2KHQ A;  3LK9 A;  5IIK A;  3G6X A;  3UQ0 A;  3GQC A;  1F0M A;  1XU4 A;  4ED2 A;  1CEZ A;  4BDP A;  3M9N B;  1V38 A;  1Z00 B;  5AKK A;  4EX6 A;  1TKD A;  4Y2P A;  3BQT A;  3PX4 A;  3ZD9 A;  1RXV A;  1IXR A;  4I2E A;  3F53 A;  3WKD A;  3BS5 B;  3T5L A;  3GIM A;  4C8L A;  4I2G A;  9ICQ A;  5HHH A;  7ICE A;  5AI8 A;  2A1J B;  3KTQ A;  1N5W A;  3HKZ C;  2DF4 B;  1T8E A;  2YN4 A;  4K4G A;  2LYA A;  3ISD A;  3RTV A;  3IG5 A;  3SEI A;  3H0L B;  5IIO A;  3V72 A;  1QSL A;  2F8L A;  2W43 A;  3LYS A;  4UAS A;  3ZDD A;  2ZIU A;  2DKX A;  5EE9 A;  4I2B A;  2BQR A;  5CHG A;  5KG5 A;  2IHM A;  1QCK A;  1XS9 D;  2EAP A;  4EEK A;  4CF5 A;  1YZ6 A;  2HBL A;  2F2A B;  1IM4 A;  1L3V A;  5ALI A;  5CWR A;  4R66 A;  4YXJ A;  1A76 A;  3DV9 A;  2DUY A;  2DQN B;  1PK1 A;  4Y2Y A;  5AKJ A;  3GV5 B;  2BPC A;  5D4B A;  4C0Z A;  2AHO B;  3TAD A;  2FLL A;  1HJP A;  1T7P A;  3M6K A;  5KFD A;  5KFQ A;  3AEV A;  2LKY A;  8ICX A;  5AM0 A;  4ECT A;  1CUK A;  5J0X A;  2ZUB A;  3RJK A;  4OJO A;  1T94 A;  4UB4 A;  4YR3 A;  3I28 A;  2F1J A;  1Y88 A;  5J2A A;  2LI6 A;  3T5J A;  4Z6F A;  4F5O A;  4I2D A;  4P2H A;  2PFN A;  9ICW A;  3QZ7 A;  5ALL A;  2BCU A;  5F9N A;  3VCB A;  1SXD A;  3DDH A;  4RNM A;  3Q8M A;  3TAR A;  3RRG A;  1RYR A;  3QE9 Y;  4B9M A;  4PHA A;  5CA7 A;  2K8A A;  4EX7 A;  2FMP A;  5J2G A;  2VKQ A;  2IA6 A;  2RDJ A;  2NO4 A;  1NJW A;  4RQ8 A;  5KAI U;  4GC7 A;  5AKI A;  1SIJ A;  1FFV A;  5DLG A;  3OHA A;  1QTM A;  4OCZ A;  4ED1 A;  5G5G A;  2E8O A; 
#chains in the Genus database with same CATH homology
 2EH9 A;  1IG6 A;  1KKX A;  2LI6 A;  1KQQ A;  2EQY A;  1RYU A;  2JXJ A;  4LJX A;  2OEH A;  1C20 A;  1KN5 A;  2YQE A;  2JRZ A;  5K4L A;  2LM1 A;  2RQ5 A;  5CEH A;  2CXY A;  2KK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...