1KKXA

Solution structure of the dna-binding domain of adr6
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
102
structure length
102
Chain Sequence
b'NNKQYELFMKSLIENCKKRNMPLQSIPEIGNRKINLFYLYMLVQKFGGADQVTRTQQWSMVAQRLQISDYQQLESIYFRILLPYERHMISQEGIKETQAKRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription regulatory protein ADR6
publication title 1H, 13C and 15N resonance assignments and secondary structure of ADR6 DNA-binding domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 18
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2001-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 1kkxA00
2KK0A 2JRZA 2JXJA 2EH9A 2EQYA 1KQQA 2CXYA 2LI6A 1RYUA 2OEHA 1C20A 2LM1A 1KKXA 2RQ5A 5K4LA 1KN5A 2YQEA 4LJXA 5CEHA 1IG6A
chains in the Genus database with same CATH superfamily
2H3QA 4C8OA 1T8EA 4PH5A 4QZ8A 2UVVA 4UB6U 3GQCA 1FFUA 4QIWC 4RPXA 3T5HA 1ZQNA 1XS9D 2E8NA 3KKAC 1S76D 2IHMA 3QUQA 1Z00B 3UM9A 2V4RA 3NVYA 1JXEA 4UAWA 4FBUA 2DGZA 3D2QA 5EE9A 4M2YA 1MC8A 2RDJA 5DB9A 4Q8FA 4AYBF 3HP6A 1PK3A 5KFAA 3KHRA 4DQRA 1Z4OA 2HHTA 1NK8A 3SR6A 3RR7A 2HBMA 4RQ8A 4R66A 4DEZA 2F44A 3RJGA 2FMQA 2XO7A 3V6HA 4F91B 1RQNA 5L9XA 2KZMA 4JV2A 3SAGA 1FEZA 1CRXA 3UQ2A 3MR5A 1SIJA 3Q8KA 5GTHU 1O03A 2LPEA 4CE6A 4F4YA 4C8KA 2WF8A 5AI0A 7ICEA 2IMWP 3LWMA 4Y2TA 3F53A 4B9VA 4O3QA 2M9NA 2KKVA 1HIWA 1VJ5A 3I28A 4YCXA 2KJ8A 5CB1A 5HHHA 4BDPA 4UB4A 1V38A 3JPPA 3PX0A 3C23A 5KT3A 3G6XA 5CRXA 2Y9UA 4ED2A 8ICFA 4DO9A 5EE3A 2UVWA 2ZIWA 4DOBA 4EX6A 5DBCA 4OJ6A 5J2CA 3RBDA 1KTQA 3QUCA 3GDXA 5DB7A 4UASA 3PW4A 2P35A 2KHVA 4MEXA 2G07A 8ICTA 4NL9A 5KFUA 3SQIA 1TK8A 2JEFA 3BS7A 5CA7A 3MABA 3UPQA 1HJPA 2WTFA 3ZDAA 8ICHA 3CNHA 5HR7A 1BGXT 2PXIA 8ICUA 2RHFA 2CRXA 2G09A 3ETLA 2FPLA 4DL5A 1XO0A 2CN1A 2GH1A 5AI4A 2K4PA 4B9LA 2AGOA 5ALDA 5DDMA 3V72A 1ECWA 3R9KA 5J2IA 4OO1J 3MGHA 1NNLA 1DXSA 4TUQA 8ICWA 1SB3C 4ECRA 2BDUA 4OJPA 2OWOA 4BXOB 4OJOA 4GXIA 3HILA 1DK2A 4DSJA 8ICOA 3G6YA 3THVA 4KLGA 3C2LA 4M9NA 4JV1A 1KFTA 5DBAA 2W54A 4ECWA 1ZQUA 3GZFA 2XVTA 4BWMA 2HBKA 2JXJA 2K4HA 3B0XA 5L1LA 2H5XA 5D49A 2C28A 3H0LB 4DFDA 2NRZA 2J6SA 3VCBA 2NYVA 4P0PA 4O9MA 1T4GA 2YTUA 2C2DA 1HUOA 3TFSA 1URJA 3N7PD 5J0QA 3IG5A 3IHQB 1U4BA 1SWWA 1SKSA 4F5NA 4R63A 1SV4A 2E1EA 2I9GA 5EWEA 4YFKA 1TV9A 3WU2U 4J9MA 4XA5A 2ZUCA 3SAHA 2BCUA 4U6PA 2FMPA 4I2DA 1YT3A 2G06A 1K1QA 3NUQA 1T7PA 4DQSA 4QWDA 1SL1A 2HBLA 1N63A 5AKXA 2OYYA 5ALPA 4YR3A 3AU6A 4TUSA 2W04A 4B9SA 5ALHA 3GIKA 3SI8A 4PHPA 2G08A 4F72A 3QU9A 4X5VA 5L1KA 3M6KA 1ZJNA 4Y2QA 4KLOA 3TAPA 4DSEA 5J0UA 2HMXA 5DGBA 1QSSA 2MSNA 4BX9C 5DDYA 5KL8B 8ICKA 3T5JA 2HCFA 2OEHA 1ZQVA 3Q8QB 5KFOA 1H38A 5ALIA 1SL0A 2H3ZA 4KLLA 1UHUA 3PY8A 3SYZA 4ECUA 2YMLA 3N7SC 2K60A 2B0CA 1X9WA 1NK9A 5J29A 1HUZA 4DQPA 2ZIUA 4KX5A 4RT2A 1KLNA 2BGWA 3UQ0A 2FLPA 1ZQHA 2EZYA 2HVIA 2KSOA 4EZ9A 1N56A 4KLTA 4E0DA 5DQIA 5G5GA 2IOFA 2HHQA 4CRXA 2HOIA 2XGPA 1RXWA 4XUSA 2PFOA 2KFNA 3MDAA 1A76A 4UBCA 2I5HA 3DV9A 4M04A 1Z00A 2ZXHA 2LM1A 3N4MB 2R18A 5KG3A 3F5AA 4EZ6A 4O5EA 2VKQA 2KNJA 4O5KA 2FMSA 4FE3A 4IRCA 3I76A 4US9A 1RQLA 5J2FA 5KFMA 2JEJA 3QNMA 3C2MA 4YMNA 1AROP 4B6JA 2LYBA 3B9JA 1IV8A 4IQTA 1CI4A 3V6JA 4B9MA 4PGQA 2XY5A 3PSFA 3SD7A 4RNNA 4QZIA 2ASDA 4F8RA 5DQGA 4GC7A 3T3FA 4FZLA 2D8CA 2PFNA 2ZTEA 3PSTA 1ZETA 4ECXA 3KFUF 2BPGA 5J0OA 3KD3A 9ICXA 5KG1A 3QEBZ 5DGAA 3KKAA 4ECYA 2PI5A 5HNKA 3UXOA 4F71A 1UA1A 4QZAA 3CW2C 4YD1A 8ICQA 4QZ9A 1SKRA 5J2KA 3EPGA 4F4KA 1N5WA 4RPYA 4RQ5A 4DSFA 2DWQA 2VJ4A 4LVSA 1BPBA 9ICLA 4UAYA 4C7ZA 2ISOA 1IIPA 4IRDA 2MAXA 4DFPA 1NZPA 2ISPA 5GTIU 2C2RA 2W55A 3D2NA 1C7YA 3LVWA 4M9LA 1SXEA 5IILA 2H3FA 2DF4B 3ISCA 1ZQMA 5KFXA 8ICLA 7ICTA 1N62A 2W43A 1D9FA 2WF6A 4CDGA 2ZJ8A 5L1MA 5ALRA 4Q44A 4DOCA 4PHEA 2KE7A 3K4GA 2KTQA 1JROA 2KJ5A 2DPJA 9ICNA 4GIBA 4P0PB 5DG9A 1NK5A 2Q0ZX 2KV2A 1TAUA 4FBTA 3TFRA 3CP8A 2MU2A 2Y1IA 2NRWA 1S0VA 2ZJ5A 2YX8A 3SMVA 4NY8A 5KFNA 1UA0A 9ICRA 1ZQYA 4QZCA 3IN5A 9ICFA 3PMLA 5ALKA 3H40A 8ICRA 4DWIA 4EEYA 4BWJA 3WKCA 4P0QB 1KEJA 2FE9A 2RRDA 3M7DA 3WK4A 5DQHA 1TK5A 1J2NA 2PKEA 2YY6A 4RQ2A 4KLHA 2F1IA 1LVHA 5CEHA 1LV5A 1WUDA 3LDAA 2V9WA 2R8HA 3KBBA 2KP7A 1SL2A 3OTQA 3QZ7A 5AK3A 1QH9A 3QUBA 2A19A 4MFAA 5AKHA 9ICGA 5J2EA 2E3TA 1L7MA 2VA8A 3ZDEA 1QTMA 1XSNA 3C5FA 4FZNA 4DFJA 4B9TA 4I2CA 3ALRA 4I2HA 4QIWF 1X6JA 4KTQA 4J9NA 3RB4A 3EUB2 8ICPA 5AKZA 5KG5A 3PZPA 4C8LA 4UB2A 3PW7A 5H2FU 4NM1A 1L7OA 1C20A 3MFIA 1NJYA 3E0FA 1A0PA 4KLSA 3WKAA 5DB8A 5KFRA 5KT6A 5J0TA 1ZQDA 3MR6A 2KSOB 2WF5A 3FYHA 3GV8B 4IR9A 4PGXA 5J0SA 5ALOA 3RF9A 2WF7A 4Z6EA 3WK7A 4F5PA 1XO1A 2F8LA 2BKEA 5KG4A 1TVAA 3UXNA 3A0HU 2EAMA 4ED6A 3E58A 3NASA 4QZFA 4JWNA 2W9CB 1ZQOA 2J6TA 2H3IA 3UXPA 4Y2XA 4O3RA 3LYSA 5J2AA 3RRGA 2KICA 1ZRNA 3FM9A 3AQFA 4NLBA 2A3VA 1ZYQA 5DLFA 3M6ZA 2JV3A 4TURA 2VIXA 1ZQTA 9ICKA 2E8OA 1NKCA 3T79A 2OCEA 1RYRA 3RB3A 2F1JA 3KOOA 2KVCA 3RBEA 4RQ1A 3FC4A 5ALSA 5AK6A 7ICMA 1TKDA 4F93B 4DOAA 1N61A 4I2FA 1QQ6A 4QWCA 5IIIA 1MA7A 2WB1F 2HOQA 5KTQA 3ONNA 5KFFA 3NVWA 4CNQA 8ICSA 3RH4A 3RJHA 2DBYA 3BZCA 2BR0A 3H8SA 3L4PA 3J81j 2A1AA 2RDIA 4DS5A 4O3OA 1IXRA 2JMGA 4YMOA 5J0PA 1ZQCA 3FAHA 3WK5A 2KG5A 4PGYA 1MQ3A 3EW9A 4UAVA 1S77D 1A6SA 4EBEA 9ICPA 2XICA 1L6NA 5ALFA 3RR8A 3H8JA 4IS7A 3H4BA 2YQEA 3H0RB 2K4IA 2VJ5A 1OW5A 1ZQQA 2DL0A 5AM5A 5J0WA 1X66A 1QLNA 2EZXA 1UPHA 2D3DA 2BPFA 1B4FA 2KVSA 3ZD8A 1NZBA 2WB1C 4JMUA 4ICAA 4DSLA 3TARA 1J2MA 4KLIA 2YMQA 1NOMA 1ZD5A 5ALMA 3NVVA 3RB6A 4F50A 3TI0A 3S6JA 3QEAZ 1IG6A 8ICAA 2ZG6A 4NM2A 3V6KA 3SEIA 2OXOA 2I1QA 5KG7A 9ICIA 4Y2RA 4YXMA 3GIJA 1ZD4A 2F77X 2JHDA 4A8EA 1NJWA 1XU4A 4YP3A 3F5EA 5J0YA 1Q3UA 2PMZC 4CF5A 2NRVA 1BPXA 4RQ7A 1UT8A 2AHOB 3C29A 2BCSA 2BQUA 3M9MB 4ECVA 4GLXA 3BQ0A 4I2GA 2Q4TA 1L3UA 3BJYA 5ALQA 1PUZA 1RXVA 2EAOA 1BNPA 4P4OA 4TUPA 5KG2A 1JXLA 4DF4A 3N7RC 3WKDA 5F9LA 1TE2A 3OJUA 1XWLA 3UMBA 2PI4A 1DRGA 3JPTA 5EE1A 1WWUA 5KFGA 2KHQA 2AH5A 1ZQAA 2LYAA 3JPQA 5ALZA 3H0MB 4IR1A 4DLEA 1FIQA 1BNOA 2GO7A 2W3RA 1KFSA 3ZI4A 2NO5A 4O3PA 1SWVA 3PR5B 4P0QA 1ZQEA 4Y2PA 5KFIA 5KL1B 5DKWA 5KFLA 5ALJA 3PX6A 2E8MA 1DK3A 3KZXA 2E8PA 1NK0A 2EAPA 5KFWA 5AKEA 1Z3EB 3KHLA 1DGSA 4ED0A 4KLFA 5KFKA 5J2JA 5AKGA 4ED1A 1ZQFA 3HRDD 1DOQA 2RP5A 4UARA 2G5IB 4P4PA 1Z4NA 3V7JA 4QNLA 4I27A 7ICHA 3ETRA 1VDVA 2FPKA 5AHXA 7ICRA 7ICVA 2IOHA 5AIBA 5ALTA 2XCAA 1U9LA 4RQNA 3PR4A 3RTVA 7ICUA 9ICMA 1NI3A 4IC9A 1KW4A 4QJFB 3OSPA 4M47A 4IQUA 4QW9A 1D8YA 2R8JA 4AP9A 1F44A 1PVQA 5HR6A 4TQRA 4J9OA 2WFAA 5KFBA 4RUAA 7ICGA 9ICCA 4KMOB 4GXKA 3F2CA 2ZUBA 2KIWA 3PSIA 5A0LA 1ZQSA 3RJFA 3WKBA 9ICOA 4OD0A 4R65A 5DLGA 1ZQRA 3U26A 2W9BA 2DKXA 1WCLA 1ZQPA 4KLQA 1RZTA 5KT7A 4FFDA 5J8YC 5KFJA 5KFEA 5KFZA 5BOLA 4CCHA 4M9GA 8ICBA 2LBOA 5J2HA 7ICNA 2G0AA 3VC8A 5B66U 3SZ2A 1MQ2A 4EX7A 3PW5A 4YMMA 4IQWA 5J2DA 2W8KA 2W9CA 1B22A 3QX7A 5TISU 1JALA 4JV0A 2ZTCA 1JIHA 1Y88A 1PVRA 3GIMA 2FLNA 3HPOA 3V7KA 3JPOA 5KNIA 1ZQJA 1KQQA 2KMDA 8ICEA 1L7PA 5ALGA 2E5SA 2ES6A 1QSLA 4PZOA 3OJSA 3Q8LA 4ZOHC 5JU5A 1V97A 5J0RA 4KLJA 2WAQF 4DQQA 1ZOLA 2QARA 5ALLA 5ALWA 4IQVA 3Q8PB 1RG6A 1EXNA 3WK8A 2MRLA 3KZIU 3HT3A 4C7YA 5EE0A 3PO5A 1KKXA 1ZD3A 3BZKA 1NJZA 2ZTDA 8ICGA 4DCCA 3PMNA 1X9SA 3PW2A 3AL0B 3RJEA 3HJEA 4ECZA 2W7OA 1PK1A 3TADA 1WWVA 5CJ7A 3QU7A 1XSPA 1Q3VA 4Q43A 2DUYA 4R8UB 4KX3A 4PJ0U 4NV0A 3F2DA 1KSPA 5IIJA 5AKLA 4FO6A 1NK6A 4NLCA 1X6IA 2WAQC 1K5OA 2BPCA 4M9HA 1SZPA 3EZ5A 4FS2A 1YZ7A 3B0YA 3RJIA 3ICXA 4F5RA 4M6WA 1LB2B 2OM6A 2AJQA 3GIIA 1NK7A 2HI0A 4RQ0A 3TKAA 1Z1BA 3QU4A 5HMMA 5KFDA 2HHUA 3HKZC 3EYZA 2Y1JA 2JEGA 2JH1A 5AI8A 4KMUA 5KG0A 4O0IA 4RQ6A 1O08A 4NLGA 4ED3A 1L5UA 3BS5A 3N28A 3EWAA 4J9KA 2V4QA 1BVSA 4PPXA 2HDOA 4I2EA 3T5KA 1JRPA 4KN7A 3O0FA 4F5OA 4FS1A 3KHGA 9ICQA 3ORYA 4RNMA 3ZDDA 4YR0A 3D2SA 1N60A 4J9QA 4EYHB 4J9RA 5IINA 3AN1A 3LWLA 4ED8A 3JPSA 2AQ4A 5JTIA 5F9NA 4YR2A 5L1IA 2W3SA 1L3VA 2F76X 7ICQA 3PSPA 4J9LA 1TK0A 3ZD9A 2OHFA 1N48A 4UB8U 4Z6DA 5AKKA 3RJKA 4PL1A 4Y2UA 4DFMA 2KD1A 1S9FA 4Y2SA 4PZNA 1QSYA 5DG8A 1HEKA 4UAUA 4KLUA 3UMCA 2Y9TA 3T5LA 1AQ6A 1QQ5A 4DL4A 2IA6A 7ICIA 3LK9A 4R64A 2Z7JA 1S0NA 2DPIA 5AKYA 1D8BA 1L3SA 2JGAA 3M9NB 1NKEA 2EH9A 1ZRMA 1S0OA 3GV5B 2F3NA 5ALVA 2FLLA 2KKPA 2F1HA 1ZQ1C 1OUQA 3ED5A 1OXJA 3PW0A 1ZXIA 5EWGA 4QWAA 1ZQKA 2PFQA 1COOA 4US8A 5K4LA 1CEZA 4DSKA 1ZD2P 1VLBA 1KL9A 9ICTA 3QE9Y 4ECTA 7ICJA 8ICYA 5KFVA 3OGUA 2W9BB 5AI6A 2UVUA 2HHXA 1ZQLA 7ICSA 1U49A 3PNCA 1S8OA 4F4XA 1WYGA 2RQ5A 2K4EA 3L3FX 2HHWA 4ED7A 1UCVA 3MC1A 3LVVA 3V7LA 1N2XA 3OSNA 1D8LA 2AXTU 1X9XA 4MF2A 3WK9A 4C0ZA 4C4SA 4KLEA 4UATA 2UVRA 2M0NA 4ELTA 3TADC 1PVPA 5IIOA 4DL3A 9ICAA 1V9PA 2ZIXA 3IRUA 5D46A 5ALUA 4PHAA 4C4TA 1RYSA 3H7IA 2ZUDA 1B0XA 4I29A 4HYKA 1JI7A 4JK1A 9ICHA 4GXJA 4BJQA 3H8WA 3D6JA 3IM1A 3AQEA 5KT5A 2XGQA 2NV3A 2IOFK 2QARB 2KZ3A 4CF4A 1XSLA 2MUTB 2QB0A 4JUZA 2A1JA 1B43A 2JRZA 1ZJMA 2OH2A 5FP0A 5IIMA 4XQ8A 3C5GA 2AGQA 3MGVA 2K8CB 3GILA 4K4HA 3NGDA 2NO4A 4MEYA 4MHVA 1COKA 4QZDA 1KBUA 2F8KA 1K1SA 4EELA 3QXGA 2KEYA 4Z6FA 2W03A 5CP2A 1PK1B 4UB5A 1XNSA 4PL2A 4RQ3A 3TANA 5HMLA 3DDHA 1BPEA 2BCRA 5AM0A 5HP4A 4AYBC 2FJ6A 2NRXA 5J8YA 1BPDA 2BQ3A 4M6WB 1JMSA 4XRHA 5J0XA 3RB0A 4YD2A 5E79U 2HW3A 9ICVA 4F2RA 4OCZA 2PMZF 2KIVA 3SAFA 1U48A 4UB3A 5BOMA 8ICMA 1Z1VA 2ASJA 3H8MA 3BS5B 1T94A 4P4MA 2LM4A 4R8UA 1SV0A 4G9BA 3SENA 1MSWD 3UMGA 2IBKA 1ZQBA 1X2IA 3HW8A 2BQRA 2BDPA 3TACB 4C8MA 3KHHA 1UQVA 4YG2A 4FZMA 5AI5A 3HWTA 3PVXA 4P2HA 2P6RA 5AM4A 1L8LA 5AKJA 2BCVA 5AM1A 2GLEA 1ZQIA 4YXJA 2EZZA 4F5QA 2ZIVA 2CXYA 3M9OB 3MR3A 4IRKA 3CRXA 1TAMA 4QZGA 1S0MA 2VANA 5EWFA 4MFFA 4RT3A 2PFPA 5CHGA 4EEKA 4I2AA 3M1YA 7ICKA 4USAA 5L1JA 4DL2A 2L5YA 3NRZA 4RPZA 1JN3A 1LKYB 4G3IA 2KFZA 4HAIA 2AQ0A 4QZEA 2MA1A 1DGJA 5J2GA 4F4WA 2JH7A 4C80A 4O3NA 4UQGA 8ICXA 9ICEA 5KT4A 1ZQZA 2H3VA 4KLMA 2AGPA 1RDFA 4J9PA 1ED1A 3IDWA 3K1RB 4BGDA 8ICJA 1BPZA 4OJ5A 3PV8A 2JZBA 2HSZA 4EBDA 4F92B 4UBBA 4DSIA 2LKYA 3RH5A 4GC6A 5ALXA 1PZNA 4EBCA 4I28A 1KDHA 2C22A 4B9NA 1JUDA 3I1YA 4QWEA 2GWSA 1U47A 4Q8EA 4K4GA 1J97A 2VA2A 2G5HB 3QU2A 4KITB 1JX4A 3NS1A 7ICOA 1X9MA 5KFPA 2FPMA 2AU0A 4DFKA 1ZQGA 2P66A 4TQSA 4ELVA 2DFLA 4ZH4A 9ICSA 2EDUA 2WF9A 1N5XA 4ECSA 5DB6A 3Q8RB 1CUKA 4KN4A 4ELUA 3AUOA 3RFAA 3HX0A 5AICA 4MF8A 2ZIXB 2F2AB 5G5HA 4DL7A 3OHBA 3C28A 4K4IA 1Q46A 2Y0SF 4F4ZA 2KOBA 5AI9A 4NWIA 4O3MA 1TAQA 2ESEA 4NJ8A 1UT5A 4F2SA 3MBYA 3MFHA 8ICVA 3MR2A 1P7DA 2ALZA 2YB4A 4DF8A 2YB1A 4UAZA 5KG6A 4EENA 5TZVA 2D6FC 2XIDA 2LI6A 1QCKA 3NRWA 4WJ3B 1RYUA 2ZJAA 2QB0B 2YMMA 2VA3A 4Y2YA 4RU9A 1WCNA 2A1JB 1TFRA 2GOLA 4YQWA 3TQ1A 7ICPA 1RM6C 3K75D 3BDPA 5KFQA 3Q8MA 1A77A 1SGGA 4C4RA 1FO4A 2LMRA 4NL9C 1T3QA 1XC9A 1Q8KA 5KFTA 3CYMA 3N97B 4DL6A 3DEEA 9ICBA 4J03A 4RQ4A 1V85A 4QZBA 1SV0C 1NKBA 1S10A 5J2BA 7ICLA 4I2JA 2BZFA 1U45A 1ZQWA 5DG7A 2I6XA 2Y0SC 2E1FA 2P6UA 1KRPA 1T3NA 4DQIA 5CR0A 5KFSA 3RJJA 1L3TA 3MDCA 3JPRA 1YZ6A 4NXZA 3QU5A 1FFVA 2KK0A 3NVZA 3BQ1A 3GFKB 4BUGA 8ICZA 2MUTA 2HBJA 9ICWA 2BCQA 2JR5A 1IM4A 4UW9A 5AIAA 2ZIWB 5AK4A 2DQNB 4Z6CA 3HKZF 8ICNA 3A0BU 4RQMA 1X42A 2N1RA 3QYPA 4CF3A 2ASLA 2DKZA 3QZ8A 5JUMA 5KFHA 4I2IA 2YMPA 3C1ZA 2HOFA 5F3XB 5EOZA 3RAQA 5T14A 5KT2A 4C8NA 2ATLA 3SV4A 2CPRA 3K1ZA 4RUCA 3Q8SB 2EANA 2HHVA 3AU2A 5KFYA 2LHTA 1KFDA 4Y2VA 1L7NA 1S5LU 1RPLA 1ZQXA 4F3OA 8ICCA 3E2EA 1L8OA 2JEIA 3WKEA 4J9SA 2ZXIA 4U7CA 3OPXA 3JPNA 3PX4A 1D9DA 2QB1A 3PO4A 2LYHA 3L5KA 4I2BA 2W11A 2K8AA 2FDRA 2ZIVB 4M9JA 3FDSA 1F5SA 4IL6U 5AM2A 4RNOA 2HHSA 5D4BA 4GFJA 4DLGA 4NLKA 1SXDA 4ECQA 3AMZA 3IP4B 2XY7A 4EYIB 4YVZA 2BHNA 1SZHA 3IV6A 4O3SA 3ISBA 3EPIA 3M8RA 2C2EA 2B21A 1BPYA 3QUTA 7ICFA 3C1YA 5KAFU 5AM3A 2NRTA 3WK6A 2HVHA 4QWBA 5B5EU 3GV7B 4YN4A 2W9MA 2KN7A 3AEVA 5KFCA 2R8GA 4BXOA 4LJXA 9ICJA 1MN8A 4CGZA 3BQ7A 2JZBB 9ICUA 4RZRA 2IHNA 5CWRA 2QLTA 2XI9A 2WHEA 5AK5A 3ZDBA 1GO3F 5BPCA 2W7PA 4ACOA 4QW8A 1NK4A 4LZGA 2XC9A 2XY6A 1LKYA 4OJLA 3OHAA 2K89A 3NTUA 5ALNA 4M0AA 1S97A 2KJ9A 2FI1A 2KZZA 1Z19A 5ALEA 4O5CA 2O6KA 3AM9A 2RLTA 2K8BB 3GU3A 5C5JA 1QQ7A 3ZDCA 5ALYA 2R8KA 3TAQA 2EQYA 4DS4A 1F0MA 4B9UA 2W9AA 4UB1A 3F2BA 5HHIA 5DBBA 5C0YA 2YN4A 4JB3A 4Q45A 1KN5A 4PHDA 4MFCA 3G6VA 4LZDA 4NLNA 4KLDA 2QKQA 1M6YA 2J6UA 3C21A 4QZHA 3RH6A 1NJXA 3ISDA 5KAIU 5AKIA 2ODGA 5IIKA 3C2KA 3BQTA 2B6GA 1WG8A 1SKWA 2W8LA 3BQ2A 2XCPA 5JRTA 2ZIUB 3SV3A 3M8SA 3RRHA 2R8IA 4Y2JA 3RAXA 3MGIA 8ICIA 1X40A 4JWMA 4NLZA 3KTQA 3IG8A 3H4DA
chains in the Genus database with same CATH topology
2KK0A 2JRZA 2JXJA 2EH9A 2EQYA 1KQQA 2CXYA 2LI6A 1RYUA 2OEHA 1C20A 2LM1A 1KKXA 2RQ5A 5K4LA 1KN5A 2YQEA 4LJXA 5CEHA 1IG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KK0 A;  2JRZ A;  2JXJ A;  2EH9 A;  2EQY A;  1KQQ A;  2CXY A;  2LI6 A;  1RYU A;  2OEH A;  1C20 A;  2LM1 A;  1KKX A;  2RQ5 A;  5K4L A;  1KN5 A;  2YQE A;  4LJX A;  5CEH A;  1IG6 A; 
#chains in the Genus database with same CATH topology
 2H3Q A;  4C8O A;  1T8E A;  4PH5 A;  4QZ8 A;  2UVV A;  4UB6 U;  3GQC A;  1FFU A;  4QIW C;  4RPX A;  3T5H A;  1ZQN A;  1XS9 D;  2E8N A;  3KKA C;  1S76 D;  2IHM A;  3QUQ A;  1Z00 B;  3UM9 A;  2V4R A;  3NVY A;  1JXE A;  4UAW A;  4FBU A;  2DGZ A;  3D2Q A;  5EE9 A;  4M2Y A;  1MC8 A;  2RDJ A;  5DB9 A;  4Q8F A;  4AYB F;  3HP6 A;  1PK3 A;  5KFA A;  3KHR A;  4DQR A;  1Z4O A;  2HHT A;  1NK8 A;  3SR6 A;  3RR7 A;  2HBM A;  4RQ8 A;  4R66 A;  4DEZ A;  2F44 A;  3RJG A;  2FMQ A;  2XO7 A;  3V6H A;  4F91 B;  1RQN A;  5L9X A;  2KZM A;  4JV2 A;  3SAG A;  1FEZ A;  1CRX A;  3UQ2 A;  3MR5 A;  1SIJ A;  3Q8K A;  5GTH U;  1O03 A;  2LPE A;  4CE6 A;  4F4Y A;  4C8K A;  2WF8 A;  5AI0 A;  7ICE A;  2IMW P;  3LWM A;  4Y2T A;  3F53 A;  4B9V A;  4O3Q A;  2M9N A;  2KKV A;  1HIW A;  1VJ5 A;  3I28 A;  4YCX A;  2KJ8 A;  5CB1 A;  5HHH A;  4BDP A;  4UB4 A;  1V38 A;  3JPP A;  3PX0 A;  3C23 A;  5KT3 A;  3G6X A;  5CRX A;  2Y9U A;  4ED2 A;  8ICF A;  4DO9 A;  5EE3 A;  2UVW A;  2ZIW A;  4DOB A;  4EX6 A;  5DBC A;  4OJ6 A;  5J2C A;  3RBD A;  1KTQ A;  3QUC A;  3GDX A;  5DB7 A;  4UAS A;  3PW4 A;  2P35 A;  2KHV A;  4MEX A;  2G07 A;  8ICT A;  4NL9 A;  5KFU A;  3SQI A;  1TK8 A;  2JEF A;  3BS7 A;  5CA7 A;  3MAB A;  3UPQ A;  1HJP A;  2WTF A;  3ZDA A;  8ICH A;  3CNH A;  5HR7 A;  1BGX T;  2PXI A;  8ICU A;  2RHF A;  2CRX A;  2G09 A;  3ETL A;  2FPL A;  4DL5 A;  1XO0 A;  2CN1 A;  2GH1 A;  5AI4 A;  2K4P A;  4B9L A;  2AGO A;  5ALD A;  5DDM A;  3V72 A;  1ECW A;  3R9K A;  5J2I A;  4OO1 J;  3MGH A;  1NNL A;  1DXS A;  4TUQ A;  8ICW A;  1SB3 C;  4ECR A;  2BDU A;  4OJP A;  2OWO A;  4BXO B;  4OJO A;  4GXI A;  3HIL A;  1DK2 A;  4DSJ A;  8ICO A;  3G6Y A;  3THV A;  4KLG A;  3C2L A;  4M9N A;  4JV1 A;  1KFT A;  5DBA A;  2W54 A;  4ECW A;  1ZQU A;  3GZF A;  2XVT A;  4BWM A;  2HBK A;  2JXJ A;  2K4H A;  3B0X A;  5L1L A;  2H5X A;  5D49 A;  2C28 A;  3H0L B;  4DFD A;  2NRZ A;  2J6S A;  3VCB A;  2NYV A;  4P0P A;  4O9M A;  1T4G A;  2YTU A;  2C2D A;  1HUO A;  3TFS A;  1URJ A;  3N7P D;  5J0Q A;  3IG5 A;  3IHQ B;  1U4B A;  1SWW A;  1SKS A;  4F5N A;  4R63 A;  1SV4 A;  2E1E A;  2I9G A;  5EWE A;  4YFK A;  1TV9 A;  3WU2 U;  4J9M A;  4XA5 A;  2ZUC A;  3SAH A;  2BCU A;  4U6P A;  2FMP A;  4I2D A;  1YT3 A;  2G06 A;  1K1Q A;  3NUQ A;  1T7P A;  4DQS A;  4QWD A;  1SL1 A;  2HBL A;  1N63 A;  5AKX A;  2OYY A;  5ALP A;  4YR3 A;  3AU6 A;  4TUS A;  2W04 A;  4B9S A;  5ALH A;  3GIK A;  3SI8 A;  4PHP A;  2G08 A;  4F72 A;  3QU9 A;  4X5V A;  5L1K A;  3M6K A;  1ZJN A;  4Y2Q A;  4KLO A;  3TAP A;  4DSE A;  5J0U A;  2HMX A;  5DGB A;  1QSS A;  2MSN A;  4BX9 C;  5DDY A;  5KL8 B;  8ICK A;  3T5J A;  2HCF A;  2OEH A;  1ZQV A;  3Q8Q B;  5KFO A;  1H38 A;  5ALI A;  1SL0 A;  2H3Z A;  4KLL A;  1UHU A;  3PY8 A;  3SYZ A;  4ECU A;  2YML A;  3N7S C;  2K60 A;  2B0C A;  1X9W A;  1NK9 A;  5J29 A;  1HUZ A;  4DQP A;  2ZIU A;  4KX5 A;  4RT2 A;  1KLN A;  2BGW A;  3UQ0 A;  2FLP A;  1ZQH A;  2EZY A;  2HVI A;  2KSO A;  4EZ9 A;  1N56 A;  4KLT A;  4E0D A;  5DQI A;  5G5G A;  2IOF A;  2HHQ A;  4CRX A;  2HOI A;  2XGP A;  1RXW A;  4XUS A;  2PFO A;  2KFN A;  3MDA A;  1A76 A;  4UBC A;  2I5H A;  3DV9 A;  4M04 A;  1Z00 A;  2ZXH A;  2LM1 A;  3N4M B;  2R18 A;  5KG3 A;  3F5A A;  4EZ6 A;  4O5E A;  2VKQ A;  2KNJ A;  4O5K A;  2FMS A;  4FE3 A;  4IRC A;  3I76 A;  4US9 A;  1RQL A;  5J2F A;  5KFM A;  2JEJ A;  3QNM A;  3C2M A;  4YMN A;  1ARO P;  4B6J A;  2LYB A;  3B9J A;  1IV8 A;  4IQT A;  1CI4 A;  3V6J A;  4B9M A;  4PGQ A;  2XY5 A;  3PSF A;  3SD7 A;  4RNN A;  4QZI A;  2ASD A;  4F8R A;  5DQG A;  4GC7 A;  3T3F A;  4FZL A;  2D8C A;  2PFN A;  2ZTE A;  3PST A;  1ZET A;  4ECX A;  3KFU F;  2BPG A;  5J0O A;  3KD3 A;  9ICX A;  5KG1 A;  3QEB Z;  5DGA A;  3KKA A;  4ECY A;  2PI5 A;  5HNK A;  3UXO A;  4F71 A;  1UA1 A;  4QZA A;  3CW2 C;  4YD1 A;  8ICQ A;  4QZ9 A;  1SKR A;  5J2K A;  3EPG A;  4F4K A;  1N5W A;  4RPY A;  4RQ5 A;  4DSF A;  2DWQ A;  2VJ4 A;  4LVS A;  1BPB A;  9ICL A;  4UAY A;  4C7Z A;  2ISO A;  1IIP A;  4IRD A;  2MAX A;  4DFP A;  1NZP A;  2ISP A;  5GTI U;  2C2R A;  2W55 A;  3D2N A;  1C7Y A;  3LVW A;  4M9L A;  1SXE A;  5IIL A;  2H3F A;  2DF4 B;  3ISC A;  1ZQM A;  5KFX A;  8ICL A;  7ICT A;  1N62 A;  2W43 A;  1D9F A;  2WF6 A;  4CDG A;  2ZJ8 A;  5L1M A;  5ALR A;  4Q44 A;  4DOC A;  4PHE A;  2KE7 A;  3K4G A;  2KTQ A;  1JRO A;  2KJ5 A;  2DPJ A;  9ICN A;  4GIB A;  4P0P B;  5DG9 A;  1NK5 A;  2Q0Z X;  2KV2 A;  1TAU A;  4FBT A;  3TFR A;  3CP8 A;  2MU2 A;  2Y1I A;  2NRW A;  1S0V A;  2ZJ5 A;  2YX8 A;  3SMV A;  4NY8 A;  5KFN A;  1UA0 A;  9ICR A;  1ZQY A;  4QZC A;  3IN5 A;  9ICF A;  3PML A;  5ALK A;  3H40 A;  8ICR A;  4DWI A;  4EEY A;  4BWJ A;  3WKC A;  4P0Q B;  1KEJ A;  2FE9 A;  2RRD A;  3M7D A;  3WK4 A;  5DQH A;  1TK5 A;  1J2N A;  2PKE A;  2YY6 A;  4RQ2 A;  4KLH A;  2F1I A;  1LVH A;  5CEH A;  1LV5 A;  1WUD A;  3LDA A;  2V9W A;  2R8H A;  3KBB A;  2KP7 A;  1SL2 A;  3OTQ A;  3QZ7 A;  5AK3 A;  1QH9 A;  3QUB A;  2A19 A;  4MFA A;  5AKH A;  9ICG A;  5J2E A;  2E3T A;  1L7M A;  2VA8 A;  3ZDE A;  1QTM A;  1XSN A;  3C5F A;  4FZN A;  4DFJ A;  4B9T A;  4I2C A;  3ALR A;  4I2H A;  4QIW F;  1X6J A;  4KTQ A;  4J9N A;  3RB4 A;  3EUB 2;  8ICP A;  5AKZ A;  5KG5 A;  3PZP A;  4C8L A;  4UB2 A;  3PW7 A;  5H2F U;  4NM1 A;  1L7O A;  1C20 A;  3MFI A;  1NJY A;  3E0F A;  1A0P A;  4KLS A;  3WKA A;  5DB8 A;  5KFR A;  5KT6 A;  5J0T A;  1ZQD A;  3MR6 A;  2KSO B;  2WF5 A;  3FYH A;  3GV8 B;  4IR9 A;  4PGX A;  5J0S A;  5ALO A;  3RF9 A;  2WF7 A;  4Z6E A;  3WK7 A;  4F5P A;  1XO1 A;  2F8L A;  2BKE A;  5KG4 A;  1TVA A;  3UXN A;  3A0H U;  2EAM A;  4ED6 A;  3E58 A;  3NAS A;  4QZF A;  4JWN A;  2W9C B;  1ZQO A;  2J6T A;  2H3I A;  3UXP A;  4Y2X A;  4O3R A;  3LYS A;  5J2A A;  3RRG A;  2KIC A;  1ZRN A;  3FM9 A;  3AQF A;  4NLB A;  2A3V A;  1ZYQ A;  5DLF A;  3M6Z A;  2JV3 A;  4TUR A;  2VIX A;  1ZQT A;  9ICK A;  2E8O A;  1NKC A;  3T79 A;  2OCE A;  1RYR A;  3RB3 A;  2F1J A;  3KOO A;  2KVC A;  3RBE A;  4RQ1 A;  3FC4 A;  5ALS A;  5AK6 A;  7ICM A;  1TKD A;  4F93 B;  4DOA A;  1N61 A;  4I2F A;  1QQ6 A;  4QWC A;  5III A;  1MA7 A;  2WB1 F;  2HOQ A;  5KTQ A;  3ONN A;  5KFF A;  3NVW A;  4CNQ A;  8ICS A;  3RH4 A;  3RJH A;  2DBY A;  3BZC A;  2BR0 A;  3H8S A;  3L4P A;  3J81 j;  2A1A A;  2RDI A;  4DS5 A;  4O3O A;  1IXR A;  2JMG A;  4YMO A;  5J0P A;  1ZQC A;  3FAH A;  3WK5 A;  2KG5 A;  4PGY A;  1MQ3 A;  3EW9 A;  4UAV A;  1S77 D;  1A6S A;  4EBE A;  9ICP A;  2XIC A;  1L6N A;  5ALF A;  3RR8 A;  3H8J A;  4IS7 A;  3H4B A;  2YQE A;  3H0R B;  2K4I A;  2VJ5 A;  1OW5 A;  1ZQQ A;  2DL0 A;  5AM5 A;  5J0W A;  1X66 A;  1QLN A;  2EZX A;  1UPH A;  2D3D A;  2BPF A;  1B4F A;  2KVS A;  3ZD8 A;  1NZB A;  2WB1 C;  4JMU A;  4ICA A;  4DSL A;  3TAR A;  1J2M A;  4KLI A;  2YMQ A;  1NOM A;  1ZD5 A;  5ALM A;  3NVV A;  3RB6 A;  4F50 A;  3TI0 A;  3S6J A;  3QEA Z;  1IG6 A;  8ICA A;  2ZG6 A;  4NM2 A;  3V6K A;  3SEI A;  2OXO A;  2I1Q A;  5KG7 A;  9ICI A;  4Y2R A;  4YXM A;  3GIJ A;  1ZD4 A;  2F77 X;  2JHD A;  4A8E A;  1NJW A;  1XU4 A;  4YP3 A;  3F5E A;  5J0Y A;  1Q3U A;  2PMZ C;  4CF5 A;  2NRV A;  1BPX A;  4RQ7 A;  1UT8 A;  2AHO B;  3C29 A;  2BCS A;  2BQU A;  3M9M B;  4ECV A;  4GLX A;  3BQ0 A;  4I2G A;  2Q4T A;  1L3U A;  3BJY A;  5ALQ A;  1PUZ A;  1RXV A;  2EAO A;  1BNP A;  4P4O A;  4TUP A;  5KG2 A;  1JXL A;  4DF4 A;  3N7R C;  3WKD A;  5F9L A;  1TE2 A;  3OJU A;  1XWL A;  3UMB A;  2PI4 A;  1DRG A;  3JPT A;  5EE1 A;  1WWU A;  5KFG A;  2KHQ A;  2AH5 A;  1ZQA A;  2LYA A;  3JPQ A;  5ALZ A;  3H0M B;  4IR1 A;  4DLE A;  1FIQ A;  1BNO A;  2GO7 A;  2W3R A;  1KFS A;  3ZI4 A;  2NO5 A;  4O3P A;  1SWV A;  3PR5 B;  4P0Q A;  1ZQE A;  4Y2P A;  5KFI A;  5KL1 B;  5DKW A;  5KFL A;  5ALJ A;  3PX6 A;  2E8M A;  1DK3 A;  3KZX A;  2E8P A;  1NK0 A;  2EAP A;  5KFW A;  5AKE A;  1Z3E B;  3KHL A;  1DGS A;  4ED0 A;  4KLF A;  5KFK A;  5J2J A;  5AKG A;  4ED1 A;  1ZQF A;  3HRD D;  1DOQ A;  2RP5 A;  4UAR A;  2G5I B;  4P4P A;  1Z4N A;  3V7J A;  4QNL A;  4I27 A;  7ICH A;  3ETR A;  1VDV A;  2FPK A;  5AHX A;  7ICR A;  7ICV A;  2IOH A;  5AIB A;  5ALT A;  2XCA A;  1U9L A;  4RQN A;  3PR4 A;  3RTV A;  7ICU A;  9ICM A;  1NI3 A;  4IC9 A;  1KW4 A;  4QJF B;  3OSP A;  4M47 A;  4IQU A;  4QW9 A;  1D8Y A;  2R8J A;  4AP9 A;  1F44 A;  1PVQ A;  5HR6 A;  4TQR A;  4J9O A;  2WFA A;  5KFB A;  4RUA A;  7ICG A;  9ICC A;  4KMO B;  4GXK A;  3F2C A;  2ZUB A;  2KIW A;  3PSI A;  5A0L A;  1ZQS A;  3RJF A;  3WKB A;  9ICO A;  4OD0 A;  4R65 A;  5DLG A;  1ZQR A;  3U26 A;  2W9B A;  2DKX A;  1WCL A;  1ZQP A;  4KLQ A;  1RZT A;  5KT7 A;  4FFD A;  5J8Y C;  5KFJ A;  5KFE A;  5KFZ A;  5BOL A;  4CCH A;  4M9G A;  8ICB A;  2LBO A;  5J2H A;  7ICN A;  2G0A A;  3VC8 A;  5B66 U;  3SZ2 A;  1MQ2 A;  4EX7 A;  3PW5 A;  4YMM A;  4IQW A;  5J2D A;  2W8K A;  2W9C A;  1B22 A;  3QX7 A;  5TIS U;  1JAL A;  4JV0 A;  2ZTC A;  1JIH A;  1Y88 A;  1PVR A;  3GIM A;  2FLN A;  3HPO A;  3V7K A;  3JPO A;  5KNI A;  1ZQJ A;  1KQQ A;  2KMD A;  8ICE A;  1L7P A;  5ALG A;  2E5S A;  2ES6 A;  1QSL A;  4PZO A;  3OJS A;  3Q8L A;  4ZOH C;  5JU5 A;  1V97 A;  5J0R A;  4KLJ A;  2WAQ F;  4DQQ A;  1ZOL A;  2QAR A;  5ALL A;  5ALW A;  4IQV A;  3Q8P B;  1RG6 A;  1EXN A;  3WK8 A;  2MRL A;  3KZI U;  3HT3 A;  4C7Y A;  5EE0 A;  3PO5 A;  1KKX A;  1ZD3 A;  3BZK A;  1NJZ A;  2ZTD A;  8ICG A;  4DCC A;  3PMN A;  1X9S A;  3PW2 A;  3AL0 B;  3RJE A;  3HJE A;  4ECZ A;  2W7O A;  1PK1 A;  3TAD A;  1WWV A;  5CJ7 A;  3QU7 A;  1XSP A;  1Q3V A;  4Q43 A;  2DUY A;  4R8U B;  4KX3 A;  4PJ0 U;  4NV0 A;  3F2D A;  1KSP A;  5IIJ A;  5AKL A;  4FO6 A;  1NK6 A;  4NLC A;  1X6I A;  2WAQ C;  1K5O A;  2BPC A;  4M9H A;  1SZP A;  3EZ5 A;  4FS2 A;  1YZ7 A;  3B0Y A;  3RJI A;  3ICX A;  4F5R A;  4M6W A;  1LB2 B;  2OM6 A;  2AJQ A;  3GII A;  1NK7 A;  2HI0 A;  4RQ0 A;  3TKA A;  1Z1B A;  3QU4 A;  5HMM A;  5KFD A;  2HHU A;  3HKZ C;  3EYZ A;  2Y1J A;  2JEG A;  2JH1 A;  5AI8 A;  4KMU A;  5KG0 A;  4O0I A;  4RQ6 A;  1O08 A;  4NLG A;  4ED3 A;  1L5U A;  3BS5 A;  3N28 A;  3EWA A;  4J9K A;  2V4Q A;  1BVS A;  4PPX A;  2HDO A;  4I2E A;  3T5K A;  1JRP A;  4KN7 A;  3O0F A;  4F5O A;  4FS1 A;  3KHG A;  9ICQ A;  3ORY A;  4RNM A;  3ZDD A;  4YR0 A;  3D2S A;  1N60 A;  4J9Q A;  4EYH B;  4J9R A;  5IIN A;  3AN1 A;  3LWL A;  4ED8 A;  3JPS A;  2AQ4 A;  5JTI A;  5F9N A;  4YR2 A;  5L1I A;  2W3S A;  1L3V A;  2F76 X;  7ICQ A;  3PSP A;  4J9L A;  1TK0 A;  3ZD9 A;  2OHF A;  1N48 A;  4UB8 U;  4Z6D A;  5AKK A;  3RJK A;  4PL1 A;  4Y2U A;  4DFM A;  2KD1 A;  1S9F A;  4Y2S A;  4PZN A;  1QSY A;  5DG8 A;  1HEK A;  4UAU A;  4KLU A;  3UMC A;  2Y9T A;  3T5L A;  1AQ6 A;  1QQ5 A;  4DL4 A;  2IA6 A;  7ICI A;  3LK9 A;  4R64 A;  2Z7J A;  1S0N A;  2DPI A;  5AKY A;  1D8B A;  1L3S A;  2JGA A;  3M9N B;  1NKE A;  2EH9 A;  1ZRM A;  1S0O A;  3GV5 B;  2F3N A;  5ALV A;  2FLL A;  2KKP A;  2F1H A;  1ZQ1 C;  1OUQ A;  3ED5 A;  1OXJ A;  3PW0 A;  1ZXI A;  5EWG A;  4QWA A;  1ZQK A;  2PFQ A;  1COO A;  4US8 A;  5K4L A;  1CEZ A;  4DSK A;  1ZD2 P;  1VLB A;  1KL9 A;  9ICT A;  3QE9 Y;  4ECT A;  7ICJ A;  8ICY A;  5KFV A;  3OGU A;  2W9B B;  5AI6 A;  2UVU A;  2HHX A;  1ZQL A;  7ICS A;  1U49 A;  3PNC A;  1S8O A;  4F4X A;  1WYG A;  2RQ5 A;  2K4E A;  3L3F X;  2HHW A;  4ED7 A;  1UCV A;  3MC1 A;  3LVV A;  3V7L A;  1N2X A;  3OSN A;  1D8L A;  2AXT U;  1X9X A;  4MF2 A;  3WK9 A;  4C0Z A;  4C4S A;  4KLE A;  4UAT A;  2UVR A;  2M0N A;  4ELT A;  3TAD C;  1PVP A;  5IIO A;  4DL3 A;  9ICA A;  1V9P A;  2ZIX A;  3IRU A;  5D46 A;  5ALU A;  4PHA A;  4C4T A;  1RYS A;  3H7I A;  2ZUD A;  1B0X A;  4I29 A;  4HYK A;  1JI7 A;  4JK1 A;  9ICH A;  4GXJ A;  4BJQ A;  3H8W A;  3D6J A;  3IM1 A;  3AQE A;  5KT5 A;  2XGQ A;  2NV3 A;  2IOF K;  2QAR B;  2KZ3 A;  4CF4 A;  1XSL A;  2MUT B;  2QB0 A;  4JUZ A;  2A1J A;  1B43 A;  2JRZ A;  1ZJM A;  2OH2 A;  5FP0 A;  5IIM A;  4XQ8 A;  3C5G A;  2AGQ A;  3MGV A;  2K8C B;  3GIL A;  4K4H A;  3NGD A;  2NO4 A;  4MEY A;  4MHV A;  1COK A;  4QZD A;  1KBU A;  2F8K A;  1K1S A;  4EEL A;  3QXG A;  2KEY A;  4Z6F A;  2W03 A;  5CP2 A;  1PK1 B;  4UB5 A;  1XNS A;  4PL2 A;  4RQ3 A;  3TAN A;  5HML A;  3DDH A;  1BPE A;  2BCR A;  5AM0 A;  5HP4 A;  4AYB C;  2FJ6 A;  2NRX A;  5J8Y A;  1BPD A;  2BQ3 A;  4M6W B;  1JMS A;  4XRH A;  5J0X A;  3RB0 A;  4YD2 A;  5E79 U;  2HW3 A;  9ICV A;  4F2R A;  4OCZ A;  2PMZ F;  2KIV A;  3SAF A;  1U48 A;  4UB3 A;  5BOM A;  8ICM A;  1Z1V A;  2ASJ A;  3H8M A;  3BS5 B;  1T94 A;  4P4M A;  2LM4 A;  4R8U A;  1SV0 A;  4G9B A;  3SEN A;  1MSW D;  3UMG A;  2IBK A;  1ZQB A;  1X2I A;  3HW8 A;  2BQR A;  2BDP A;  3TAC B;  4C8M A;  3KHH A;  1UQV A;  4YG2 A;  4FZM A;  5AI5 A;  3HWT A;  3PVX A;  4P2H A;  2P6R A;  5AM4 A;  1L8L A;  5AKJ A;  2BCV A;  5AM1 A;  2GLE A;  1ZQI A;  4YXJ A;  2EZZ A;  4F5Q A;  2ZIV A;  2CXY A;  3M9O B;  3MR3 A;  4IRK A;  3CRX A;  1TAM A;  4QZG A;  1S0M A;  2VAN A;  5EWF A;  4MFF A;  4RT3 A;  2PFP A;  5CHG A;  4EEK A;  4I2A A;  3M1Y A;  7ICK A;  4USA A;  5L1J A;  4DL2 A;  2L5Y A;  3NRZ A;  4RPZ A;  1JN3 A;  1LKY B;  4G3I A;  2KFZ A;  4HAI A;  2AQ0 A;  4QZE A;  2MA1 A;  1DGJ A;  5J2G A;  4F4W A;  2JH7 A;  4C80 A;  4O3N A;  4UQG A;  8ICX A;  9ICE A;  5KT4 A;  1ZQZ A;  2H3V A;  4KLM A;  2AGP A;  1RDF A;  4J9P A;  1ED1 A;  3IDW A;  3K1R B;  4BGD A;  8ICJ A;  1BPZ A;  4OJ5 A;  3PV8 A;  2JZB A;  2HSZ A;  4EBD A;  4F92 B;  4UBB A;  4DSI A;  2LKY A;  3RH5 A;  4GC6 A;  5ALX A;  1PZN A;  4EBC A;  4I28 A;  1KDH A;  2C22 A;  4B9N A;  1JUD A;  3I1Y A;  4QWE A;  2GWS A;  1U47 A;  4Q8E A;  4K4G A;  1J97 A;  2VA2 A;  2G5H B;  3QU2 A;  4KIT B;  1JX4 A;  3NS1 A;  7ICO A;  1X9M A;  5KFP A;  2FPM A;  2AU0 A;  4DFK A;  1ZQG A;  2P66 A;  4TQS A;  4ELV A;  2DFL A;  4ZH4 A;  9ICS A;  2EDU A;  2WF9 A;  1N5X A;  4ECS A;  5DB6 A;  3Q8R B;  1CUK A;  4KN4 A;  4ELU A;  3AUO A;  3RFA A;  3HX0 A;  5AIC A;  4MF8 A;  2ZIX B;  2F2A B;  5G5H A;  4DL7 A;  3OHB A;  3C28 A;  4K4I A;  1Q46 A;  2Y0S F;  4F4Z A;  2KOB A;  5AI9 A;  4NWI A;  4O3M A;  1TAQ A;  2ESE A;  4NJ8 A;  1UT5 A;  4F2S A;  3MBY A;  3MFH A;  8ICV A;  3MR2 A;  1P7D A;  2ALZ A;  2YB4 A;  4DF8 A;  2YB1 A;  4UAZ A;  5KG6 A;  4EEN A;  5TZV A;  2D6F C;  2XID A;  2LI6 A;  1QCK A;  3NRW A;  4WJ3 B;  1RYU A;  2ZJA A;  2QB0 B;  2YMM A;  2VA3 A;  4Y2Y A;  4RU9 A;  1WCN A;  2A1J B;  1TFR A;  2GOL A;  4YQW A;  3TQ1 A;  7ICP A;  1RM6 C;  3K75 D;  3BDP A;  5KFQ A;  3Q8M A;  1A77 A;  1SGG A;  4C4R A;  1FO4 A;  2LMR A;  4NL9 C;  1T3Q A;  1XC9 A;  1Q8K A;  5KFT A;  3CYM A;  3N97 B;  4DL6 A;  3DEE A;  9ICB A;  4J03 A;  4RQ4 A;  1V85 A;  4QZB A;  1SV0 C;  1NKB A;  1S10 A;  5J2B A;  7ICL A;  4I2J A;  2BZF A;  1U45 A;  1ZQW A;  5DG7 A;  2I6X A;  2Y0S C;  2E1F A;  2P6U A;  1KRP A;  1T3N A;  4DQI A;  5CR0 A;  5KFS A;  3RJJ A;  1L3T A;  3MDC A;  3JPR A;  1YZ6 A;  4NXZ A;  3QU5 A;  1FFV A;  2KK0 A;  3NVZ A;  3BQ1 A;  3GFK B;  4BUG A;  8ICZ A;  2MUT A;  2HBJ A;  9ICW A;  2BCQ A;  2JR5 A;  1IM4 A;  4UW9 A;  5AIA A;  2ZIW B;  5AK4 A;  2DQN B;  4Z6C A;  3HKZ F;  8ICN A;  3A0B U;  4RQM A;  1X42 A;  2N1R A;  3QYP A;  4CF3 A;  2ASL A;  2DKZ A;  3QZ8 A;  5JUM A;  5KFH A;  4I2I A;  2YMP A;  3C1Z A;  2HOF A;  5F3X B;  5EOZ A;  3RAQ A;  5T14 A;  5KT2 A;  4C8N A;  2ATL A;  3SV4 A;  2CPR A;  3K1Z A;  4RUC A;  3Q8S B;  2EAN A;  2HHV A;  3AU2 A;  5KFY A;  2LHT A;  1KFD A;  4Y2V A;  1L7N A;  1S5L U;  1RPL A;  1ZQX A;  4F3O A;  8ICC A;  3E2E A;  1L8O A;  2JEI A;  3WKE A;  4J9S A;  2ZXI A;  4U7C A;  3OPX A;  3JPN A;  3PX4 A;  1D9D A;  2QB1 A;  3PO4 A;  2LYH A;  3L5K A;  4I2B A;  2W11 A;  2K8A A;  2FDR A;  2ZIV B;  4M9J A;  3FDS A;  1F5S A;  4IL6 U;  5AM2 A;  4RNO A;  2HHS A;  5D4B A;  4GFJ A;  4DLG A;  4NLK A;  1SXD A;  4ECQ A;  3AMZ A;  3IP4 B;  2XY7 A;  4EYI B;  4YVZ A;  2BHN A;  1SZH A;  3IV6 A;  4O3S A;  3ISB A;  3EPI A;  3M8R A;  2C2E A;  2B21 A;  1BPY A;  3QUT A;  7ICF A;  3C1Y A;  5KAF U;  5AM3 A;  2NRT A;  3WK6 A;  2HVH A;  4QWB A;  5B5E U;  3GV7 B;  4YN4 A;  2W9M A;  2KN7 A;  3AEV A;  5KFC A;  2R8G A;  4BXO A;  4LJX A;  9ICJ A;  1MN8 A;  4CGZ A;  3BQ7 A;  2JZB B;  9ICU A;  4RZR A;  2IHN A;  5CWR A;  2QLT A;  2XI9 A;  2WHE A;  5AK5 A;  3ZDB A;  1GO3 F;  5BPC A;  2W7P A;  4ACO A;  4QW8 A;  1NK4 A;  4LZG A;  2XC9 A;  2XY6 A;  1LKY A;  4OJL A;  3OHA A;  2K89 A;  3NTU A;  5ALN A;  4M0A A;  1S97 A;  2KJ9 A;  2FI1 A;  2KZZ A;  1Z19 A;  5ALE A;  4O5C A;  2O6K A;  3AM9 A;  2RLT A;  2K8B B;  3GU3 A;  5C5J A;  1QQ7 A;  3ZDC A;  5ALY A;  2R8K A;  3TAQ A;  2EQY A;  4DS4 A;  1F0M A;  4B9U A;  2W9A A;  4UB1 A;  3F2B A;  5HHI A;  5DBB A;  5C0Y A;  2YN4 A;  4JB3 A;  4Q45 A;  1KN5 A;  4PHD A;  4MFC A;  3G6V A;  4LZD A;  4NLN A;  4KLD A;  2QKQ A;  1M6Y A;  2J6U A;  3C21 A;  4QZH A;  3RH6 A;  1NJX A;  3ISD A;  5KAI U;  5AKI A;  2ODG A;  5IIK A;  3C2K A;  3BQT A;  2B6G A;  1WG8 A;  1SKW A;  2W8L A;  3BQ2 A;  2XCP A;  5JRT A;  2ZIU B;  3SV3 A;  3M8S A;  3RRH A;  2R8I A;  4Y2J A;  3RAX A;  3MGI A;  8ICI A;  1X40 A;  4JWM A;  4NLZ A;  3KTQ A;  3IG8 A;  3H4D A; 
#chains in the Genus database with same CATH homology
 2KK0 A;  2JRZ A;  2JXJ A;  2EH9 A;  2EQY A;  1KQQ A;  2CXY A;  2LI6 A;  1RYU A;  2OEH A;  1C20 A;  2LM1 A;  1KKX A;  2RQ5 A;  5K4L A;  1KN5 A;  2YQE A;  4LJX A;  5CEH A;  1IG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...