1KKXA

Solution structure of the dna-binding domain of adr6
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
102
structure length
102
Chain Sequence
NNKQYELFMKSLIENCKKRNMPLQSIPEIGNRKINLFYLYMLVQKFGGADQVTRTQQWSMVAQRLQISDYQQLESIYFRILLPYERHMISQEGIKETQAKRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1H, 13C and 15N resonance assignments and secondary structure of ADR6 DNA-binding domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
molecule keywords Transcription regulatory protein ADR6
total genus 18
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2001-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 1kkxA00
2RQ5A 2JXJA 2LM1A 1IG6A 2EH9A 5CEHA 2JRZA 1KN5A 2EQYA 2OEHA 2YQEA 1KQQA 2KK0A 1KKXA 2CXYA 5K4LA 4LJXA 1C20A 1RYUA 2LI6A
chains in the Genus database with same CATH superfamily
3PSPA 4Z6EA 3OHAA 2JRZA 2HHSA 7ICTA 3H4DA 2XO7A 1KDHA 4JWNA 1IIPA 1XWLA 4RPZA 4NM1A 9ICIA 2IBKA 5J2CA 4DOBA 2P66A 4HAIA 9ICVA 3ONNA 7ICRA 1NZBA 4ED1A 4KLEA 3CNHA 2M0NA 4O9MA 2EANA 5KG4A 4RQ4A 1C7YA 2E5SA 4NL9A 5KFAA 4IRCA 5DQGA 1ZQXA 4RPXA 4Y2YA 4DQPA 3MR5A 3TADA 5CJ7A 2YTUA 5KFRA 3RJHA 9ICOA 4EBEA 3NVZA 3I1YA 4I2CA 4Q8FA 2DBYA 4ECWA 5KFCA 1L7PA 4PGYA 1RXVA 2UVVA 8ICKA 2E3TA 3PO4A 2WB1F 5DKWA 2ZIUB 1SL1A 1D8BA 9ICPA 1XSNA 9ICAA 2ZTCA 3L3FX 2H5XA 2XC9A 4ECVA 2BCQA 1GO3F 2XVTA 1S76D 2HHTA 5KG0A 4OJPA 1ZQBA 4ZH4A 2AGPA 1ZQGA 3AQFA 4F91B 3K1RB 2B0CA 2KNJA 4PL1A 8ICRA 2QKQA 4NLKA 2HMXA 3JPSA 2W43A 4JV2A 8ICPA 1ZQYA 2JHDA 4DFJA 5J0XA 3C23A 5J2FA 4FZNA 4M0AA 4Y2XA 2BCVA 5C0YA 4O3NA 3JPNA 3NRZA 7ICFA 3MC1A 5J2JA 1J2MA 2E1EA 4KLIA 2KD1A 2C2EA 1V38A 2R8IA 2HDOA 4M47A 1NK9A 3UQ2A 2DUYA 2LM4A 1BVSA 4BXOA 9ICFA 4CDGA 1KFTA 5AHXA 4C8MA 5KT3A 5KFUA 4DFDA 4F72A 2VJ4A 3C5GA 4DSFA 4UATA 1TE2A 5AIAA 5DGAA 4LVSA 5IIKA 4EYIB 4R65A 4DQSA 2RLTA 4J9RA 3MDCA 5KFOA 1DRGA 5AK4A 4J9LA 1KL9A 5HMLA 1ZRNA 2F1IA 5L1JA 2IHMA 4MF8A 2K4HA 4F8RA 5G5GA 4RQMA 3PMNA 3FM9A 5ALEA 4OD0A 3MR2A 4PH5A 5AK6A 3PW5A 1EXNA 9ICSA 4CF4A 2KE7A 3UXPA 3TKAA 3HWTA 4RQ8A 2WF9A 4Y2TA 4UW9A 2ZUBA 4J9OA 1Z3EB 4YR2A 2JH1A 1NJZA 2P6UA 1T4GA 3QUCA 4I2FA 4CF5A 1S0VA 1UT8A 3ISDA 1JALA 1V97A 2C2RA 2KIWA 2MSNA 5ALSA 5DGBA 5DB7A 1RPLA 3SI8A 2N1RA 4ECQA 2HBLA 2RP5A 3GFKB 2E8PA 7ICGA 4RNMA 5IINA 4UB4A 1NKBA 4YD2A 4IRDA 1ZD3A 1X9XA 2BDPA 2NV3A 1WWVA 4RQ5A 5E79U 3OTQA 4IQWA 2K60A 5DLGA 4B9UA 5J0QA 3BQ0A 1YT3A 7ICOA 3HJEA 4KITB 2NRWA 4I2HA 4F71A 5J0RA 5J0SA 3MGIA 4PGQA 4KLFA 3OPXA 3K75D 5L1IA 4YQWA 2Z7JA 5ALGA 4KLTA 5KTQA 3PSTA 3K4GA 2QARA 4UBBA 2MU2A 1Z00B 5AM1A 2YN4A 4OJOA 1V9PA 1RQNA 2PFQA 4TQSA 4M9LA 3HRDD 4DS4A 1UPHA 1BNOA 3QYPA 4C8NA 3EPGA 5KT6A 2KVSA 4Y2PA 1U48A 3CW2C 2ASLA 4KLQA 3KZXA 5DG7A 5AIBA 5DBAA 2JEJA 3PVXA 2IA6A 5KFVA 3MR3A 1L3SA 2OYYA 2G5IB 2HBKA 2NRZA 1ZD5A 3D2QA 3VCBA 3IP4B 2WAQF 5KFFA 1DGSA 2EH9A 4IR9A 4Y2RA 4UBCA 3AU6A 2KKVA 1WUDA 3I28A 3C28A 3LWLA 3QU2A 2HOIA 2K8AA 4EZ6A 2BCRA 3T5HA 1Q3UA 1TK0A 4DWIA 4FZLA 3GILA 4I29A 3J81j 4MFCA 4P4OA 5ALMA 2I6XA 1QSSA 1KFSA 9ICCA 3RR7A 3MFHA 5DQIA 5AM0A 4KN4A 2KICA 3A0HU 3QU5A 4QZGA 4CE6A 5KT5A 1SWWA 3WK8A 4DO9A 1SV0C 4O3PA 3M6ZA 1ZYQA 2H3FA 3SQIA 3ALRA 3F5AA 2DKZA 4GXKA 1ZQMA 4YFKA 3MABA 2HVIA 1A76A 1SL0A 3NS1A 2XI9A 5ALWA 5ALFA 4QZDA 5J2HA 2RDIA 2EQYA 4DL4A 2KSOB 4YN4A 1ZQTA 2RRDA 1T8EA 2HCFA 3NUQA 3GIKA 4YD1A 5CB1A 4F92B 2WB1C 1ZQ1C 1BPBA 3WK4A 2I9GA 2Y1IA 2CPRA 4KLUA 9ICQA 4U7CA 3AEVA 5AI5A 5DB6A 3WK9A 1ZOLA 3IN5A 3TI0A 5KG7A 2R8HA 3RB4A 3ORYA 2ZIWB 1L8LA 5J2EA 4M6WA 2MUTA 2R8GA 4C4RA 4R8UB 5AI8A 2BPGA 3T79A 3C5FA 5KT2A 4ELUA 8ICBA 2UVRA 3HKZF 1KW4A 2K8BB 4C8LA 2EZYA 1ZQUA 2QLTA 4BXOB 3ETLA 5CHGA 3BJYA 4JB3A 2CRXA 1NKCA 5HP4A 2YMMA 3H0LB 4DLGA 4DFKA 2EZZA 1S0MA 4TUSA 8ICZA 1DOQA 2ZIVB 4I2GA 4QWEA 4I2EA 5A0LA 1KN5A 1U47A 7ICVA 1S0NA 4QZHA 8ICNA 3V7LA 2I1QA 4J03A 1TFRA 1TK8A 2DPJA 1L8OA 2LKYA 2JEFA 3ZDAA 1M6YA 1WWUA 2EAPA 2KFZA 4PGXA 1T3NA 4EX7A 2JZBB 1NK8A 1TV9A 4O5CA 2BZFA 5DG9A 3A0BU 5DBCA 5DB8A 4UB8U 3PY8A 1PZNA 2V9WA 2I5HA 2VA8A 5DDMA 1BNPA 4DSJA 2KV2A 5F9LA 5AKHA 1UHUA 2IOFK 4JV1A 7ICPA 3HT3A 3Q8SB 4YMNA 2K4IA 1LB2B 2LYBA 2JZBA 3OJUA 1K1SA 5AK5A 4KX3A 1U49A 1NOMA 3LDAA 4JV0A 1ZQLA 4QIWF 1SV0A 4QWBA 5J8YA 4RPYA 2AH5A 4MEXA 1Z1VA 4PHAA 2A1JB 5KL1B 3AQEA 5J0WA 2E8NA 1NKEA 5KFJA 8ICMA 3TANA 2W7OA 1N63A 3TFRA 1U9LA 1ZRMA 3RBEA 5KFMA 2R8KA 3RFAA 1ZQWA 1X6JA 2LHTA 4X5VA 3BQ2A 4F5QA 3RAXA 2QB0B 4DEZA 2WF5A 3PSIA 4R8UA 2ZXHA 3C1ZA 4YP3A 4EBCA 5KFPA 4OJLA 1UT5A 4K4HA 3N7SC 4GXIA 2WHEA 2FLNA 2PFOA 5CRXA 3N97B 3I76A 1L3VA 5C5JA 5AKXA 4YMMA 4E0DA 3SAFA 2KEYA 2VANA 2AGOA 1NJWA 3H8MA 4RQ0A 1K1QA 1N62A 3QUQA 1FEZA 4M9GA 1Z4NA 1NK6A 3RH4A 3TAPA 5IIJA 2HBMA 1Y88A 2W8LA 2JGAA 4RQ1A 3M9OB 1F0MA 1PK1A 3QE9Y 5AICA 1J97A 1PK3A 1D9FA 5DLFA 3QU9A 8ICSA 3PX4A 4EELA 3RRGA 5KT4A 4PL2A 2YB1A 4CCHA 4BWMA 2ZTEA 5CR0A 4YXJA 1KTQA 1S97A 2E8MA 4C7ZA 2ZUCA 1ZQNA 2XCAA 2XY7A 5F9NA 3IV6A 1MQ2A 3KHGA 3PSFA 3OHBA 2JR5A 1U45A 1COKA 4OJ6A 4XA5A 3JPQA 2C22A 3GDXA 2PFPA 1B43A 2Q0ZX 5J2AA 5ALRA 5D49A 2ISOA 2PI5A 9ICRA 3NASA 1XO1A 2HHXA 1SL2A 3FC4A 2RHFA 1NJXA 1IG6A 3QX7A 2C2DA 1Z19A 4RQ3A 3RJKA 3L5KA 3QNMA 4AP9A 1COOA 2JXJA 1URJA 2ATLA 3RB3A 1S10A 1ZQPA 2D8CA 2M9NA 2KVCA 3UM9A 1XS9D 1QCKA 3TADC 2KFNA 4NLZA 3HPOA 4NWIA 3KZIU 3QZ8A 1QQ6A 5KFNA 5AK3A 3BS5A 3WKAA 2F3NA 5JTIA 5ALNA 2WF6A 3EUB2 3FAHA 5KFZA 1BGXT 4IRKA 4JMUA 5ALQA 2XCPA 3ZDBA 1CUKA 1KEJA 1X6IA 2DPIA 4P0QB 1MN8A 3CRXA 3PMLA 5EWGA 3F2BA 4O3OA 2V4QA 2YB4A 1XSLA 2XGPA 4O3RA 2A1JA 4M6WB 4R66A 1DXSA 4DS5A 4RNOA 1ECWA 4QJFB 4J9KA 4CNQA 2B21A 3SMVA 2YQEA 4ECYA 1TAMA 7ICEA 4FBUA 4NY8A 1ZQOA 4F5NA 4B9LA 3BQ1A 4G9BA 3N7RC 3LK9A 5KAFU 4Y2VA 5HR7A 5BOMA 1PK1B 7ICNA 3SYZA 4Q44A 1CEZA 2KJ8A 3EW9A 1ED1A 4YR3A 3L4PA 3N28A 3QEBZ 2BCSA 1ZD4A 4MHVA 5J0UA 5ALLA 3H4BA 1T7PA 8ICXA 9ICKA 1NK4A 1DK3A 2YMPA 3RAQA 4KLLA 3M9NB 4FO6A 2AGQA 1BPZA 2NYVA 4ED3A 5KG2A 3RJEA 5AKIA 3SENA 3AUOA 4RZRA 3RH5A 3QEAZ 1JXEA 4KLJA 2J6SA 2ZTDA 2EAMA 3QU4A 4P0PB 5KFTA 2AJQA 7ICLA 3T3FA 2W7PA 1X9MA 1VLBA 4I2IA 1JRPA 4DF4A 9ICBA 3F5EA 2PI4A 4F3OA 5HR6A 3NTUA 3B0YA 3RRHA 4UB2A 4R63A 2F1JA 2LMRA 2IOHA 1S8OA 3BS7A 4YCXA 2W9BA 4XRHA 3Q8RB 4WJ3B 3KKAC 2W9AA 3UXOA 9ICEA 5IIIA 9ICGA 2BPCA 1Q3VA 2YY6A 2ALZA 4QZFA 5KFGA 4LJXA 4UAYA 3RR8A 3KHHA 1F44A 3ZD9A 4C80A 4U6PA 4QW9A 4Y2SA 3GIMA 3F2CA 4BJQA 4IQUA 2FPKA 4ECXA 2KSOA 5AI6A 3KHLA 4B6JA 3TACB 5TISU 2XIDA 4IC9A 2FLPA 2KTQA 3EPIA 2YMQA 4TUPA 3B0XA 3WU2U 3N4MB 4GC6A 1NI3A 3KBBA 1ZQQA 2F8KA 1SIJA 3Q8LA 5KAIU 1JI7A 4KLDA 4GIBA 3SV4A 3SD7A 5J0TA 3NVWA 3LWMA 2UVUA 4K4GA 3GV5B 1KFDA 3OJSA 3NGDA 9ICMA 3NVVA 2JEGA 3WK5A 3DEEA 1FFVA 8ICUA 1RM6C 4CF3A 3MGVA 2HHUA 3SAHA 3ZDCA 3M8SA 5K4LA 1HUOA 2XGQA 1RQLA 2F77X 2W55A 3UPQA 1TAQA 1MC8A 5KG3A 1XNSA 1QLNA 2W3RA 3F2DA 4UAUA 4MFFA 2MAXA 4C4SA 4YMOA 1SB3C 8ICVA 5EWFA 5ALTA 3PX6A 1S5LU 4F4KA 4AYBC 3PNCA 3RB0A 2VJ5A 5JUMA 4KX5A 4M2YA 1HEKA 1OUQA 5L1MA 1RYUA 2BDUA 4YVZA 1QQ5A 2KJ9A 3GQCA 3IHQB 4F4WA 5AKYA 3TFSA 4M9NA 1PUZA 4PHDA 4LZGA 4KLMA 2DWQA 4FZMA 8ICFA 2ZXIA 4DOAA 4O5KA 1ZJNA 1S0OA 2AQ0A 1OW5A 4UAWA 1L7NA 1ZD2P 3WKBA 4DFPA 1ZQRA 8ICWA 2H3VA 3MR6A 1Z4OA 5AI9A 3WKEA 1LVHA 1Q46A 5KG5A 1Z00A 3PW7A 2QARB 3NVYA 2DF4B 2AU0A 2G08A 2KKPA 4UB1A 2KZMA 5CA7A 3IDWA 4B9SA 4O3MA 2FI1A 3G6VA 1F5SA 4HYKA 4NM2A 8ICLA 8ICYA 2O6KA 3RF9A 4FS1A 5AKEA 2VA2A 3GV7B 2FMPA 2G0AA 2WF8A 4Y2JA 4I2JA 5D46A 5ALUA 4TUQA 4MFAA 3QXGA 2VIXA 4PJ0U 2H3IA 1BPEA 5KFQA 1KKXA 1SKWA 4ZOHC 2W54A 1SZPA 5KL8B 3WKCA 2DKXA 4ED2A 1VJ5A 2DL0A 4C4TA 3UMGA 9ICUA 1TK5A 1L3TA 4Q45A 5BPCA 4F4XA 3BDPA 3T5JA 1NJYA 1SKSA 2G07A 3K1ZA 2IHNA 4ICAA 1QSLA 5AM2A 1ZQVA 1UQVA 5HNKA 3PW0A 2HVHA 4EENA 1N48A 5KFBA 4J9SA 4F5RA 2BQUA 1KQQA 4US8A 4FBTA 4RQNA 1T3QA 4ED6A 9ICTA 5KFKA 5J2BA 5ALVA 1FIQA 1NK0A 5ALPA 3HP6A 1ZETA 4B9TA 8ICQA 1S9FA 3LVVA 2OWOA 4M9HA 4IR1A 1A6SA 2WFAA 3U26A 1D8LA 1C20A 1SXEA 3H8WA 3TARA 8ICJA 4PHEA 4Q8EA 2KZ3A 5ALKA 2BR0A 3Q8KA 5FP0A 5GTHU 1HIWA 2FPMA 4Z6DA 2KIVA 3GU3A 4JWMA 2Y0SF 3SR6A 5KFDA 4C7YA 1NNLA 4BGDA 1OXJA 2ZG6A 1P7DA 4QZIA 2FLLA 3PV8A 3AL0B 4I2DA 4KN7A 4ACOA 3SZ2A 1L7OA 1O03A 5KFWA 1IV8A 2WTFA 1X40A 4UARA 3H8JA 4G3IA 5JRTA 4UB5A 3RTVA 4RQ7A 2W3SA 5AI4A 2A1AA 1H38A 2KN7A 4NL9C 5CP2A 1KLNA 5T14A 3SV3A 3ZDEA 4QIWC 4F93B 3EWAA 5CWRA 1XU4A 4C0ZA 5AKLA 2LI6A 1CRXA 3MDAA 2JMGA 2XY5A 1ZQHA 2VKQA 4NXZA 3BZKA 2Y1JA 4CGZA 3KFUF 1ZQZA 2KOBA 2F1HA 3UQ0A 2OCEA 5TZVA 2ZJAA 5AKJA 4DQIA 4GLXA 3C29A 4P0PA 3OSPA 4ED8A 1SKRA 3WKDA 1SZHA 4F5OA 2XY6A 2HI0A 4UASA 9ICHA 2QB1A 1VDVA 2OH2A 1TAUA 4F2SA 3VC8A 3R9KA 2J6TA 4XQ8A 5EWEA 4K4IA 4QNLA 3QUTA 4Y2UA 5J8YC 4RUAA 2ZIWA 2GLEA 4NLBA 4DL6A 7ICQA 4US9A 1X66A 3H40A 8ICAA 1MQ3A 2Y9UA 3H0MB 3V7KA 1ZQSA 2NRVA 1Q8KA 2KHQA 5B5EU 1X42A 3ZD8A 5DBBA 4R64A 1LKYA 1UA0A 4NLGA 4DL5A 4F4ZA 1BPXA 4O5EA 3D6JA 2ZIXA 5DQHA 1ZQFA 3O0FA 3MBYA 3C2MA 2E8OA 4FFDA 2WF7A 3DV9A 4TQRA 4DCCA 1JUDA 2OEHA 5JU5A 3B9JA 4Z6FA 1WYGA 2G5HB 2BCUA 1XO0A 5HHIA 1JX4A 2PKEA 2D6FC 2A3VA 1QSYA 1JN3A 3ZI4A 7ICHA 1N5WA 5ALIA 3C21A 2W9CA 4UAVA 5KFHA 4ELVA 2ZJ5A 2ZIVA 3E0FA 1PVPA 4DL2A 4DSIA 3G6YA 1NK5A 4QZEA 2ZJ8A 3PR4A 3BS5B 2XICA 2NRXA 4B9NA 5ALOA 4DF8A 4DOCA 4IL6U 3BQ7A 4RQ2A 3QUBA 2MRLA 3SAGA 4ED7A 5EE9A 9ICNA 1WCLA 1DGJA 1SXDA 1JMSA 4RUCA 2ISPA 2CXYA 2ZUDA 4YR0A 8ICIA 3E58A 3JPRA 3ISCA 4QWAA 3TAQA 4UAZA 8ICEA 7ICUA 4P2HA 4O3SA 3QZ7A 2PXIA 2R18A 3LYSA 4JUZA 1NK7A 4EEKA 4UB6U 5DDYA 4ELTA 4QWDA 8ICOA 4YG2A 1ZQDA 2F8LA 5HMMA 2LBOA 3CP8A 1MSWD 5KNIA 7ICKA 1NZPA 3RBDA 8ICGA 3V72A 4MEYA 5HHHA 3N7PD 5KFSA 3AN1A 2ES6A 1AROP 1CI4A 3FYHA 2W9CB 4DL7A 4I2AA 1QQ7A 1DK2A 2LYHA 1WCNA 2W11A 4NLNA 2C28A 4NV0A 4GC7A 1HUZA 4FE3A 9ICJA 2L5YA 3AU2A 5ALYA 4I28A 2HOQA 2UVWA 4ECRA 4QZ8A 1X9WA 1T94A 2G09A 2J6UA 4M9JA 1BPDA 2GOLA 4EBDA 5AM5A 3IG8A 1UA1A 5AKZA 3AM9A 3TQ1A 4DFMA 4QWCA 2W8KA 5KG1A 5B66U 1N2XA 1LKYB 3PR5B 1ZQAA 1A77A 4NJ8A 4IS7A 4BX9C 2EZXA 3FDSA 1KBUA 2NO5A 4KLOA 3RB6A 5J2DA 4CRXA 5AI0A 1SGGA 1ZQJA 4P4MA 2FMQA 1B4FA 4J9NA 7ICMA 1V85A 5J29A 4J9QA 1IXRA 1YZ7A 2EAOA 3M8RA 2AXTU 3H0RB 1PVQA 1RG6A 2ZIUA 9ICLA 1O08A 2DQNB 2FPLA 2D3DA 2LM1A 5IIMA 1N56A 3UXNA 4BUGA 5EE0A 2P35A 5KFEA 5EE3A 1L6NA 5KFIA 1HJPA 4J9PA 4KLSA 4A8EA 1JROA 2PFNA 2KJ5A 5IILA 1FO4A 1JIHA 4KTQA 4DSKA 4DL3A 1QH9A 5ALHA 2KZZA 2OHFA 2KP7A 5H2FU 8ICCA 1A0PA 2E1FA 2RQ5A 4F4YA 4B9VA 5D4BA 3MFIA 5ALDA 2FDRA 2KMDA 2W03A 4B9MA 5J2KA 3T5LA 2HBJA 4DQRA 2FE9A 4OJ5A 1YZ6A 3CYMA 2FMSA 4IQVA 5DG8A 2KHVA 3C1YA 3V6JA 3DDHA 2AHOB 5AM4A 4PPXA 2A19A 2BPFA 2H3ZA 1RYSA 2YMLA 4OCZA 2NO4A 2AQ4A 4RQ6A 2K8CB 3GIIA 2PMZC 3V6KA 5GTIU 4QZBA 4I2BA 1S77D 2HSZA 5J2GA 5DB9A 4FS2A 3BZCA 2RDJA 2CN1A 1JXLA 4NLCA 2W9BB 2GWSA 2YX8A 2EDUA 3F53A 3G6XA 2KK0A 5J0PA 3QU7A 1N5XA 2H3QA 4P0QA 2NRTA 3E2EA 1PVRA 2HOFA 1LV5A 3WK6A 3RJFA 3HKZC 1L5UA 2Q4TA 3Q8MA 4BDPA 2KG5A 3KKAA 3PW2A 4MF2A 3KD3A 1RXWA 4I27A 4RNNA 3GV8B 5J2IA 2JV3A 5ALXA 3OGUA 3IRUA 2HW3A 4BWJA 5KFLA 1RDFA 8ICHA 3IG5A 4XUSA 1SV4A 5L9XA 3JPPA 2K4EA 1D8YA 3UMCA 4RU9A 2B6GA 1D9DA 4TURA 2BQ3A 4DQQA 1KRPA 3C2LA 2R8JA 4Y2QA 4ECZA 2MUTB 2IMWP 3HW8A 4RT2A 5BOLA 3MGHA 3HILA 9ICXA 4GFJA 5IIOA 4F50A 2K89A 4QZ9A 3S6JA 1BPYA 3H8SA 2BGWA 1IM4A 3JPTA 2F2AB 1FFUA 2DFLA 4USAA 2ASJA 1N61A 4C8KA 2LPEA 2BQRA 5AM3A 1L3UA 2JEIA 5KFYA 5CEHA 1X9SA 4IQTA 2K4PA 1ZQKA 4EX6A 3H7IA 1X2IA 2F76X 2ASDA 4UB3A 1L7MA 3V7JA 3ISBA 5G5HA 2BKEA 4ECTA 4P4PA 4J9MA 4RT3A 2GO7A 4F2RA 5KFXA 4KMOB 3SEIA 4QW8A 4ED0A 2BHNA 4Z6CA 4JK1A 3ED5A 2PMZF 5AKKA 3ETRA 3PW4A 1N60A 5ALJA 4EYHB 4DSLA 4EZ9A 1SWVA 4F5PA 4M04A 8ICTA 3ZDDA 1XSPA 4O0IA 3HX0A 5EE1A 9ICWA 2JH7A 2DGZA 3RJJA 3V6HA 5F3XB 3KHRA 1TVAA 2ODGA 2G06A 4O3QA 1ZQEA 1MA7A 1ZXIA 1TKDA 3GZFA 2MA1A 1XC9A 3KTQA 4DSEA 2Y9TA 1B0XA 1B22A 3M1YA 4ECUA 3PO5A 5J0YA 1RZTA 3LVWA 1QTMA 4PZNA 1ZQCA 3M7DA 4UQGA 2QB0A 2P6RA 3IM1A 5L1LA 2GH1A 4PHPA 2OXOA 4GXJA 4C8OA 2HHQA 3C2KA 3JPOA 1U4BA 3KOOA 5KT7A 3GIJA 3RH6A 1WG8A 2LYAA 3EYZA 2IOFA 4Q43A 2VA3A 1RYRA 7ICJA 2W9MA 7ICIA 3NRWA 5J0OA 2V4RA 2HHVA 5KG6A 2ZIXB 3THVA 2ESEA 1ZQIA 3ICXA 3PZPA 3AMZA 2OM6A 4KLHA 3WK7A 3M6KA 3D2SA 5EOZA 2FJ6A 4KLGA 3Q8QB 4OO1J 4ECSA 4AYBF 5L1KA 4PZOA 2F44A 1KSPA 2WAQC 3M9MB 4QZAA 3UMBA 1AQ6A 1ZJMA 3BQTA 4DLEA 3EZ5A 1J2NA 1Z1BA 3RJIA 4QZCA 3D2NA 4LZDA 3T5KA 5ALZA 3RJGA 4YXMA 4EEYA 7ICSA 2W04A 3Q8PB 2Y0SC 4KMUA 1UCVA 1K5OA 5AKGA 3PX0A 2HHWA 3OSNA
chains in the Genus database with same CATH topology
2RQ5A 2JXJA 2LM1A 1IG6A 2EH9A 5CEHA 2JRZA 1KN5A 2EQYA 2OEHA 2YQEA 1KQQA 2KK0A 1KKXA 2CXYA 5K4LA 4LJXA 1C20A 1RYUA 2LI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQ5 A;  2JXJ A;  2LM1 A;  1IG6 A;  2EH9 A;  5CEH A;  2JRZ A;  1KN5 A;  2EQY A;  2OEH A;  2YQE A;  1KQQ A;  2KK0 A;  1KKX A;  2CXY A;  5K4L A;  4LJX A;  1C20 A;  1RYU A;  2LI6 A; 
#chains in the Genus database with same CATH topology
 3PSP A;  4Z6E A;  3OHA A;  2JRZ A;  2HHS A;  7ICT A;  3H4D A;  2XO7 A;  1KDH A;  4JWN A;  1IIP A;  1XWL A;  4RPZ A;  4NM1 A;  9ICI A;  2IBK A;  5J2C A;  4DOB A;  2P66 A;  4HAI A;  9ICV A;  3ONN A;  7ICR A;  1NZB A;  4ED1 A;  4KLE A;  3CNH A;  2M0N A;  4O9M A;  2EAN A;  5KG4 A;  4RQ4 A;  1C7Y A;  2E5S A;  4NL9 A;  5KFA A;  4IRC A;  5DQG A;  1ZQX A;  4RPX A;  4Y2Y A;  4DQP A;  3MR5 A;  3TAD A;  5CJ7 A;  2YTU A;  5KFR A;  3RJH A;  9ICO A;  4EBE A;  3NVZ A;  3I1Y A;  4I2C A;  4Q8F A;  2DBY A;  4ECW A;  5KFC A;  1L7P A;  4PGY A;  1RXV A;  2UVV A;  8ICK A;  2E3T A;  3PO4 A;  2WB1 F;  5DKW A;  2ZIU B;  1SL1 A;  1D8B A;  9ICP A;  1XSN A;  9ICA A;  2ZTC A;  3L3F X;  2H5X A;  2XC9 A;  4ECV A;  2BCQ A;  1GO3 F;  2XVT A;  1S76 D;  2HHT A;  5KG0 A;  4OJP A;  1ZQB A;  4ZH4 A;  2AGP A;  1ZQG A;  3AQF A;  4F91 B;  3K1R B;  2B0C A;  2KNJ A;  4PL1 A;  8ICR A;  2QKQ A;  4NLK A;  2HMX A;  3JPS A;  2W43 A;  4JV2 A;  8ICP A;  1ZQY A;  2JHD A;  4DFJ A;  5J0X A;  3C23 A;  5J2F A;  4FZN A;  4M0A A;  4Y2X A;  2BCV A;  5C0Y A;  4O3N A;  3JPN A;  3NRZ A;  7ICF A;  3MC1 A;  5J2J A;  1J2M A;  2E1E A;  4KLI A;  2KD1 A;  2C2E A;  1V38 A;  2R8I A;  2HDO A;  4M47 A;  1NK9 A;  3UQ2 A;  2DUY A;  2LM4 A;  1BVS A;  4BXO A;  9ICF A;  4CDG A;  1KFT A;  5AHX A;  4C8M A;  5KT3 A;  5KFU A;  4DFD A;  4F72 A;  2VJ4 A;  3C5G A;  4DSF A;  4UAT A;  1TE2 A;  5AIA A;  5DGA A;  4LVS A;  5IIK A;  4EYI B;  4R65 A;  4DQS A;  2RLT A;  4J9R A;  3MDC A;  5KFO A;  1DRG A;  5AK4 A;  4J9L A;  1KL9 A;  5HML A;  1ZRN A;  2F1I A;  5L1J A;  2IHM A;  4MF8 A;  2K4H A;  4F8R A;  5G5G A;  4RQM A;  3PMN A;  3FM9 A;  5ALE A;  4OD0 A;  3MR2 A;  4PH5 A;  5AK6 A;  3PW5 A;  1EXN A;  9ICS A;  4CF4 A;  2KE7 A;  3UXP A;  3TKA A;  3HWT A;  4RQ8 A;  2WF9 A;  4Y2T A;  4UW9 A;  2ZUB A;  4J9O A;  1Z3E B;  4YR2 A;  2JH1 A;  1NJZ A;  2P6U A;  1T4G A;  3QUC A;  4I2F A;  4CF5 A;  1S0V A;  1UT8 A;  3ISD A;  1JAL A;  1V97 A;  2C2R A;  2KIW A;  2MSN A;  5ALS A;  5DGB A;  5DB7 A;  1RPL A;  3SI8 A;  2N1R A;  4ECQ A;  2HBL A;  2RP5 A;  3GFK B;  2E8P A;  7ICG A;  4RNM A;  5IIN A;  4UB4 A;  1NKB A;  4YD2 A;  4IRD A;  1ZD3 A;  1X9X A;  2BDP A;  2NV3 A;  1WWV A;  4RQ5 A;  5E79 U;  3OTQ A;  4IQW A;  2K60 A;  5DLG A;  4B9U A;  5J0Q A;  3BQ0 A;  1YT3 A;  7ICO A;  3HJE A;  4KIT B;  2NRW A;  4I2H A;  4F71 A;  5J0R A;  5J0S A;  3MGI A;  4PGQ A;  4KLF A;  3OPX A;  3K75 D;  5L1I A;  4YQW A;  2Z7J A;  5ALG A;  4KLT A;  5KTQ A;  3PST A;  3K4G A;  2QAR A;  4UBB A;  2MU2 A;  1Z00 B;  5AM1 A;  2YN4 A;  4OJO A;  1V9P A;  1RQN A;  2PFQ A;  4TQS A;  4M9L A;  3HRD D;  4DS4 A;  1UPH A;  1BNO A;  3QYP A;  4C8N A;  3EPG A;  5KT6 A;  2KVS A;  4Y2P A;  1U48 A;  3CW2 C;  2ASL A;  4KLQ A;  3KZX A;  5DG7 A;  5AIB A;  5DBA A;  2JEJ A;  3PVX A;  2IA6 A;  5KFV A;  3MR3 A;  1L3S A;  2OYY A;  2G5I B;  2HBK A;  2NRZ A;  1ZD5 A;  3D2Q A;  3VCB A;  3IP4 B;  2WAQ F;  5KFF A;  1DGS A;  2EH9 A;  4IR9 A;  4Y2R A;  4UBC A;  3AU6 A;  2KKV A;  1WUD A;  3I28 A;  3C28 A;  3LWL A;  3QU2 A;  2HOI A;  2K8A A;  4EZ6 A;  2BCR A;  3T5H A;  1Q3U A;  1TK0 A;  4DWI A;  4FZL A;  3GIL A;  4I29 A;  3J81 j;  4MFC A;  4P4O A;  5ALM A;  2I6X A;  1QSS A;  1KFS A;  9ICC A;  3RR7 A;  3MFH A;  5DQI A;  5AM0 A;  4KN4 A;  2KIC A;  3A0H U;  3QU5 A;  4QZG A;  4CE6 A;  5KT5 A;  1SWW A;  3WK8 A;  4DO9 A;  1SV0 C;  4O3P A;  3M6Z A;  1ZYQ A;  2H3F A;  3SQI A;  3ALR A;  3F5A A;  2DKZ A;  4GXK A;  1ZQM A;  4YFK A;  3MAB A;  2HVI A;  1A76 A;  1SL0 A;  3NS1 A;  2XI9 A;  5ALW A;  5ALF A;  4QZD A;  5J2H A;  2RDI A;  2EQY A;  4DL4 A;  2KSO B;  4YN4 A;  1ZQT A;  2RRD A;  1T8E A;  2HCF A;  3NUQ A;  3GIK A;  4YD1 A;  5CB1 A;  4F92 B;  2WB1 C;  1ZQ1 C;  1BPB A;  3WK4 A;  2I9G A;  2Y1I A;  2CPR A;  4KLU A;  9ICQ A;  4U7C A;  3AEV A;  5AI5 A;  5DB6 A;  3WK9 A;  1ZOL A;  3IN5 A;  3TI0 A;  5KG7 A;  2R8H A;  3RB4 A;  3ORY A;  2ZIW B;  1L8L A;  5J2E A;  4M6W A;  2MUT A;  2R8G A;  4C4R A;  4R8U B;  5AI8 A;  2BPG A;  3T79 A;  3C5F A;  5KT2 A;  4ELU A;  8ICB A;  2UVR A;  3HKZ F;  1KW4 A;  2K8B B;  4C8L A;  2EZY A;  1ZQU A;  2QLT A;  4BXO B;  3ETL A;  5CHG A;  3BJY A;  4JB3 A;  2CRX A;  1NKC A;  5HP4 A;  2YMM A;  3H0L B;  4DLG A;  4DFK A;  2EZZ A;  1S0M A;  4TUS A;  8ICZ A;  1DOQ A;  2ZIV B;  4I2G A;  4QWE A;  4I2E A;  5A0L A;  1KN5 A;  1U47 A;  7ICV A;  1S0N A;  4QZH A;  8ICN A;  3V7L A;  2I1Q A;  4J03 A;  1TFR A;  1TK8 A;  2DPJ A;  1L8O A;  2LKY A;  2JEF A;  3ZDA A;  1M6Y A;  1WWU A;  2EAP A;  2KFZ A;  4PGX A;  1T3N A;  4EX7 A;  2JZB B;  1NK8 A;  1TV9 A;  4O5C A;  2BZF A;  5DG9 A;  3A0B U;  5DBC A;  5DB8 A;  4UB8 U;  3PY8 A;  1PZN A;  2V9W A;  2I5H A;  2VA8 A;  5DDM A;  1BNP A;  4DSJ A;  2KV2 A;  5F9L A;  5AKH A;  1UHU A;  2IOF K;  4JV1 A;  7ICP A;  3HT3 A;  3Q8S B;  4YMN A;  2K4I A;  1LB2 B;  2LYB A;  2JZB A;  3OJU A;  1K1S A;  5AK5 A;  4KX3 A;  1U49 A;  1NOM A;  3LDA A;  4JV0 A;  1ZQL A;  4QIW F;  1SV0 A;  4QWB A;  5J8Y A;  4RPY A;  2AH5 A;  4MEX A;  1Z1V A;  4PHA A;  2A1J B;  5KL1 B;  3AQE A;  5J0W A;  2E8N A;  1NKE A;  5KFJ A;  8ICM A;  3TAN A;  2W7O A;  1N63 A;  3TFR A;  1U9L A;  1ZRM A;  3RBE A;  5KFM A;  2R8K A;  3RFA A;  1ZQW A;  1X6J A;  2LHT A;  4X5V A;  3BQ2 A;  4F5Q A;  3RAX A;  2QB0 B;  4DEZ A;  2WF5 A;  3PSI A;  4R8U A;  2ZXH A;  3C1Z A;  4YP3 A;  4EBC A;  5KFP A;  4OJL A;  1UT5 A;  4K4H A;  3N7S C;  4GXI A;  2WHE A;  2FLN A;  2PFO A;  5CRX A;  3N97 B;  3I76 A;  1L3V A;  5C5J A;  5AKX A;  4YMM A;  4E0D A;  3SAF A;  2KEY A;  2VAN A;  2AGO A;  1NJW A;  3H8M A;  4RQ0 A;  1K1Q A;  1N62 A;  3QUQ A;  1FEZ A;  4M9G A;  1Z4N A;  1NK6 A;  3RH4 A;  3TAP A;  5IIJ A;  2HBM A;  1Y88 A;  2W8L A;  2JGA A;  4RQ1 A;  3M9O B;  1F0M A;  1PK1 A;  3QE9 Y;  5AIC A;  1J97 A;  1PK3 A;  1D9F A;  5DLF A;  3QU9 A;  8ICS A;  3PX4 A;  4EEL A;  3RRG A;  5KT4 A;  4PL2 A;  2YB1 A;  4CCH A;  4BWM A;  2ZTE A;  5CR0 A;  4YXJ A;  1KTQ A;  1S97 A;  2E8M A;  4C7Z A;  2ZUC A;  1ZQN A;  2XCA A;  2XY7 A;  5F9N A;  3IV6 A;  1MQ2 A;  3KHG A;  3PSF A;  3OHB A;  2JR5 A;  1U45 A;  1COK A;  4OJ6 A;  4XA5 A;  3JPQ A;  2C22 A;  3GDX A;  2PFP A;  1B43 A;  2Q0Z X;  5J2A A;  5ALR A;  5D49 A;  2ISO A;  2PI5 A;  9ICR A;  3NAS A;  1XO1 A;  2HHX A;  1SL2 A;  3FC4 A;  2RHF A;  1NJX A;  1IG6 A;  3QX7 A;  2C2D A;  1Z19 A;  4RQ3 A;  3RJK A;  3L5K A;  3QNM A;  4AP9 A;  1COO A;  2JXJ A;  1URJ A;  2ATL A;  3RB3 A;  1S10 A;  1ZQP A;  2D8C A;  2M9N A;  2KVC A;  3UM9 A;  1XS9 D;  1QCK A;  3TAD C;  2KFN A;  4NLZ A;  3HPO A;  4NWI A;  3KZI U;  3QZ8 A;  1QQ6 A;  5KFN A;  5AK3 A;  3BS5 A;  3WKA A;  2F3N A;  5JTI A;  5ALN A;  2WF6 A;  3EUB 2;  3FAH A;  5KFZ A;  1BGX T;  4IRK A;  4JMU A;  5ALQ A;  2XCP A;  3ZDB A;  1CUK A;  1KEJ A;  1X6I A;  2DPI A;  4P0Q B;  1MN8 A;  3CRX A;  3PML A;  5EWG A;  3F2B A;  4O3O A;  2V4Q A;  2YB4 A;  1XSL A;  2XGP A;  4O3R A;  2A1J A;  4M6W B;  4R66 A;  1DXS A;  4DS5 A;  4RNO A;  1ECW A;  4QJF B;  4J9K A;  4CNQ A;  2B21 A;  3SMV A;  2YQE A;  4ECY A;  1TAM A;  7ICE A;  4FBU A;  4NY8 A;  1ZQO A;  4F5N A;  4B9L A;  3BQ1 A;  4G9B A;  3N7R C;  3LK9 A;  5KAF U;  4Y2V A;  5HR7 A;  5BOM A;  1PK1 B;  7ICN A;  3SYZ A;  4Q44 A;  1CEZ A;  2KJ8 A;  3EW9 A;  1ED1 A;  4YR3 A;  3L4P A;  3N28 A;  3QEB Z;  2BCS A;  1ZD4 A;  4MHV A;  5J0U A;  5ALL A;  3H4B A;  1T7P A;  8ICX A;  9ICK A;  1NK4 A;  1DK3 A;  2YMP A;  3RAQ A;  4KLL A;  3M9N B;  4FO6 A;  2AGQ A;  1BPZ A;  2NYV A;  4ED3 A;  5KG2 A;  3RJE A;  5AKI A;  3SEN A;  3AUO A;  4RZR A;  3RH5 A;  3QEA Z;  1JXE A;  4KLJ A;  2J6S A;  2ZTD A;  2EAM A;  3QU4 A;  4P0P B;  5KFT A;  2AJQ A;  7ICL A;  3T3F A;  2W7P A;  1X9M A;  1VLB A;  4I2I A;  1JRP A;  4DF4 A;  9ICB A;  3F5E A;  2PI4 A;  4F3O A;  5HR6 A;  3NTU A;  3B0Y A;  3RRH A;  4UB2 A;  4R63 A;  2F1J A;  2LMR A;  2IOH A;  1S8O A;  3BS7 A;  4YCX A;  2W9B A;  4XRH A;  3Q8R B;  4WJ3 B;  3KKA C;  2W9A A;  3UXO A;  9ICE A;  5III A;  9ICG A;  2BPC A;  1Q3V A;  2YY6 A;  2ALZ A;  4QZF A;  5KFG A;  4LJX A;  4UAY A;  3RR8 A;  3KHH A;  1F44 A;  3ZD9 A;  4C80 A;  4U6P A;  4QW9 A;  4Y2S A;  3GIM A;  3F2C A;  4BJQ A;  4IQU A;  2FPK A;  4ECX A;  2KSO A;  5AI6 A;  3KHL A;  4B6J A;  3TAC B;  5TIS U;  2XID A;  4IC9 A;  2FLP A;  2KTQ A;  3EPI A;  2YMQ A;  4TUP A;  3B0X A;  3WU2 U;  3N4M B;  4GC6 A;  1NI3 A;  3KBB A;  1ZQQ A;  2F8K A;  1SIJ A;  3Q8L A;  5KAI U;  1JI7 A;  4KLD A;  4GIB A;  3SV4 A;  3SD7 A;  5J0T A;  3NVW A;  3LWM A;  2UVU A;  4K4G A;  3GV5 B;  1KFD A;  3OJS A;  3NGD A;  9ICM A;  3NVV A;  2JEG A;  3WK5 A;  3DEE A;  1FFV A;  8ICU A;  1RM6 C;  4CF3 A;  3MGV A;  2HHU A;  3SAH A;  3ZDC A;  3M8S A;  5K4L A;  1HUO A;  2XGQ A;  1RQL A;  2F77 X;  2W55 A;  3UPQ A;  1TAQ A;  1MC8 A;  5KG3 A;  1XNS A;  1QLN A;  2W3R A;  3F2D A;  4UAU A;  4MFF A;  2MAX A;  4C4S A;  4YMO A;  1SB3 C;  8ICV A;  5EWF A;  5ALT A;  3PX6 A;  1S5L U;  4F4K A;  4AYB C;  3PNC A;  3RB0 A;  2VJ5 A;  5JUM A;  4KX5 A;  4M2Y A;  1HEK A;  1OUQ A;  5L1M A;  1RYU A;  2BDU A;  4YVZ A;  1QQ5 A;  2KJ9 A;  3GQC A;  3IHQ B;  4F4W A;  5AKY A;  3TFS A;  4M9N A;  1PUZ A;  4PHD A;  4LZG A;  4KLM A;  2DWQ A;  4FZM A;  8ICF A;  2ZXI A;  4DOA A;  4O5K A;  1ZJN A;  1S0O A;  2AQ0 A;  1OW5 A;  4UAW A;  1L7N A;  1ZD2 P;  3WKB A;  4DFP A;  1ZQR A;  8ICW A;  2H3V A;  3MR6 A;  1Z4O A;  5AI9 A;  3WKE A;  1LVH A;  1Q46 A;  5KG5 A;  1Z00 A;  3PW7 A;  2QAR B;  3NVY A;  2DF4 B;  2AU0 A;  2G08 A;  2KKP A;  4UB1 A;  2KZM A;  5CA7 A;  3IDW A;  4B9S A;  4O3M A;  2FI1 A;  3G6V A;  1F5S A;  4HYK A;  4NM2 A;  8ICL A;  8ICY A;  2O6K A;  3RF9 A;  4FS1 A;  5AKE A;  2VA2 A;  3GV7 B;  2FMP A;  2G0A A;  2WF8 A;  4Y2J A;  4I2J A;  5D46 A;  5ALU A;  4TUQ A;  4MFA A;  3QXG A;  2VIX A;  4PJ0 U;  2H3I A;  1BPE A;  5KFQ A;  1KKX A;  1SKW A;  4ZOH C;  2W54 A;  1SZP A;  5KL8 B;  3WKC A;  2DKX A;  4ED2 A;  1VJ5 A;  2DL0 A;  4C4T A;  3UMG A;  9ICU A;  1TK5 A;  1L3T A;  4Q45 A;  5BPC A;  4F4X A;  3BDP A;  3T5J A;  1NJY A;  1SKS A;  2G07 A;  3K1Z A;  2IHN A;  4ICA A;  1QSL A;  5AM2 A;  1ZQV A;  1UQV A;  5HNK A;  3PW0 A;  2HVH A;  4EEN A;  1N48 A;  5KFB A;  4J9S A;  4F5R A;  2BQU A;  1KQQ A;  4US8 A;  4FBT A;  4RQN A;  1T3Q A;  4ED6 A;  9ICT A;  5KFK A;  5J2B A;  5ALV A;  1FIQ A;  1NK0 A;  5ALP A;  3HP6 A;  1ZET A;  4B9T A;  8ICQ A;  1S9F A;  3LVV A;  2OWO A;  4M9H A;  4IR1 A;  1A6S A;  2WFA A;  3U26 A;  1D8L A;  1C20 A;  1SXE A;  3H8W A;  3TAR A;  8ICJ A;  4PHE A;  4Q8E A;  2KZ3 A;  5ALK A;  2BR0 A;  3Q8K A;  5FP0 A;  5GTH U;  1HIW A;  2FPM A;  4Z6D A;  2KIV A;  3GU3 A;  4JWM A;  2Y0S F;  3SR6 A;  5KFD A;  4C7Y A;  1NNL A;  4BGD A;  1OXJ A;  2ZG6 A;  1P7D A;  4QZI A;  2FLL A;  3PV8 A;  3AL0 B;  4I2D A;  4KN7 A;  4ACO A;  3SZ2 A;  1L7O A;  1O03 A;  5KFW A;  1IV8 A;  2WTF A;  1X40 A;  4UAR A;  3H8J A;  4G3I A;  5JRT A;  4UB5 A;  3RTV A;  4RQ7 A;  2W3S A;  5AI4 A;  2A1A A;  1H38 A;  2KN7 A;  4NL9 C;  5CP2 A;  1KLN A;  5T14 A;  3SV3 A;  3ZDE A;  4QIW C;  4F93 B;  3EWA A;  5CWR A;  1XU4 A;  4C0Z A;  5AKL A;  2LI6 A;  1CRX A;  3MDA A;  2JMG A;  2XY5 A;  1ZQH A;  2VKQ A;  4NXZ A;  3BZK A;  2Y1J A;  4CGZ A;  3KFU F;  1ZQZ A;  2KOB A;  2F1H A;  3UQ0 A;  2OCE A;  5TZV A;  2ZJA A;  5AKJ A;  4DQI A;  4GLX A;  3C29 A;  4P0P A;  3OSP A;  4ED8 A;  1SKR A;  3WKD A;  1SZH A;  4F5O A;  2XY6 A;  2HI0 A;  4UAS A;  9ICH A;  2QB1 A;  1VDV A;  2OH2 A;  1TAU A;  4F2S A;  3VC8 A;  3R9K A;  2J6T A;  4XQ8 A;  5EWE A;  4K4I A;  4QNL A;  3QUT A;  4Y2U A;  5J8Y C;  4RUA A;  2ZIW A;  2GLE A;  4NLB A;  4DL6 A;  7ICQ A;  4US9 A;  1X66 A;  3H40 A;  8ICA A;  1MQ3 A;  2Y9U A;  3H0M B;  3V7K A;  1ZQS A;  2NRV A;  1Q8K A;  2KHQ A;  5B5E U;  1X42 A;  3ZD8 A;  5DBB A;  4R64 A;  1LKY A;  1UA0 A;  4NLG A;  4DL5 A;  4F4Z A;  1BPX A;  4O5E A;  3D6J A;  2ZIX A;  5DQH A;  1ZQF A;  3O0F A;  3MBY A;  3C2M A;  2E8O A;  4FFD A;  2WF7 A;  3DV9 A;  4TQR A;  4DCC A;  1JUD A;  2OEH A;  5JU5 A;  3B9J A;  4Z6F A;  1WYG A;  2G5H B;  2BCU A;  1XO0 A;  5HHI A;  1JX4 A;  2PKE A;  2D6F C;  2A3V A;  1QSY A;  1JN3 A;  3ZI4 A;  7ICH A;  1N5W A;  5ALI A;  3C21 A;  2W9C A;  4UAV A;  5KFH A;  4ELV A;  2ZJ5 A;  2ZIV A;  3E0F A;  1PVP A;  4DL2 A;  4DSI A;  3G6Y A;  1NK5 A;  4QZE A;  2ZJ8 A;  3PR4 A;  3BS5 B;  2XIC A;  2NRX A;  4B9N A;  5ALO A;  4DF8 A;  4DOC A;  4IL6 U;  3BQ7 A;  4RQ2 A;  3QUB A;  2MRL A;  3SAG A;  4ED7 A;  5EE9 A;  9ICN A;  1WCL A;  1DGJ A;  1SXD A;  1JMS A;  4RUC A;  2ISP A;  2CXY A;  2ZUD A;  4YR0 A;  8ICI A;  3E58 A;  3JPR A;  3ISC A;  4QWA A;  3TAQ A;  4UAZ A;  8ICE A;  7ICU A;  4P2H A;  4O3S A;  3QZ7 A;  2PXI A;  2R18 A;  3LYS A;  4JUZ A;  1NK7 A;  4EEK A;  4UB6 U;  5DDY A;  4ELT A;  4QWD A;  8ICO A;  4YG2 A;  1ZQD A;  2F8L A;  5HMM A;  2LBO A;  3CP8 A;  1MSW D;  5KNI A;  7ICK A;  1NZP A;  3RBD A;  8ICG A;  3V72 A;  4MEY A;  5HHH A;  3N7P D;  5KFS A;  3AN1 A;  2ES6 A;  1ARO P;  1CI4 A;  3FYH A;  2W9C B;  4DL7 A;  4I2A A;  1QQ7 A;  1DK2 A;  2LYH A;  1WCN A;  2W11 A;  4NLN A;  2C28 A;  4NV0 A;  4GC7 A;  1HUZ A;  4FE3 A;  9ICJ A;  2L5Y A;  3AU2 A;  5ALY A;  4I28 A;  2HOQ A;  2UVW A;  4ECR A;  4QZ8 A;  1X9W A;  1T94 A;  2G09 A;  2J6U A;  4M9J A;  1BPD A;  2GOL A;  4EBD A;  5AM5 A;  3IG8 A;  1UA1 A;  5AKZ A;  3AM9 A;  3TQ1 A;  4DFM A;  4QWC A;  2W8K A;  5KG1 A;  5B66 U;  1N2X A;  1LKY B;  3PR5 B;  1ZQA A;  1A77 A;  4NJ8 A;  4IS7 A;  4BX9 C;  2EZX A;  3FDS A;  1KBU A;  2NO5 A;  4KLO A;  3RB6 A;  5J2D A;  4CRX A;  5AI0 A;  1SGG A;  1ZQJ A;  4P4M A;  2FMQ A;  1B4F A;  4J9N A;  7ICM A;  1V85 A;  5J29 A;  4J9Q A;  1IXR A;  1YZ7 A;  2EAO A;  3M8R A;  2AXT U;  3H0R B;  1PVQ A;  1RG6 A;  2ZIU A;  9ICL A;  1O08 A;  2DQN B;  2FPL A;  2D3D A;  2LM1 A;  5IIM A;  1N56 A;  3UXN A;  4BUG A;  5EE0 A;  2P35 A;  5KFE A;  5EE3 A;  1L6N A;  5KFI A;  1HJP A;  4J9P A;  4KLS A;  4A8E A;  1JRO A;  2PFN A;  2KJ5 A;  5IIL A;  1FO4 A;  1JIH A;  4KTQ A;  4DSK A;  4DL3 A;  1QH9 A;  5ALH A;  2KZZ A;  2OHF A;  2KP7 A;  5H2F U;  8ICC A;  1A0P A;  2E1F A;  2RQ5 A;  4F4Y A;  4B9V A;  5D4B A;  3MFI A;  5ALD A;  2FDR A;  2KMD A;  2W03 A;  4B9M A;  5J2K A;  3T5L A;  2HBJ A;  4DQR A;  2FE9 A;  4OJ5 A;  1YZ6 A;  3CYM A;  2FMS A;  4IQV A;  5DG8 A;  2KHV A;  3C1Y A;  3V6J A;  3DDH A;  2AHO B;  5AM4 A;  4PPX A;  2A19 A;  2BPF A;  2H3Z A;  1RYS A;  2YML A;  4OCZ A;  2NO4 A;  2AQ4 A;  4RQ6 A;  2K8C B;  3GII A;  2PMZ C;  3V6K A;  5GTI U;  4QZB A;  4I2B A;  1S77 D;  2HSZ A;  5J2G A;  5DB9 A;  4FS2 A;  3BZC A;  2RDJ A;  2CN1 A;  1JXL A;  4NLC A;  2W9B B;  2GWS A;  2YX8 A;  2EDU A;  3F53 A;  3G6X A;  2KK0 A;  5J0P A;  3QU7 A;  1N5X A;  2H3Q A;  4P0Q A;  2NRT A;  3E2E A;  1PVR A;  2HOF A;  1LV5 A;  3WK6 A;  3RJF A;  3HKZ C;  1L5U A;  2Q4T A;  3Q8M A;  4BDP A;  2KG5 A;  3KKA A;  3PW2 A;  4MF2 A;  3KD3 A;  1RXW A;  4I27 A;  4RNN A;  3GV8 B;  5J2I A;  2JV3 A;  5ALX A;  3OGU A;  3IRU A;  2HW3 A;  4BWJ A;  5KFL A;  1RDF A;  8ICH A;  3IG5 A;  4XUS A;  1SV4 A;  5L9X A;  3JPP A;  2K4E A;  1D8Y A;  3UMC A;  4RU9 A;  2B6G A;  1D9D A;  4TUR A;  2BQ3 A;  4DQQ A;  1KRP A;  3C2L A;  2R8J A;  4Y2Q A;  4ECZ A;  2MUT B;  2IMW P;  3HW8 A;  4RT2 A;  5BOL A;  3MGH A;  3HIL A;  9ICX A;  4GFJ A;  5IIO A;  4F50 A;  2K89 A;  4QZ9 A;  3S6J A;  1BPY A;  3H8S A;  2BGW A;  1IM4 A;  3JPT A;  2F2A B;  1FFU A;  2DFL A;  4USA A;  2ASJ A;  1N61 A;  4C8K A;  2LPE A;  2BQR A;  5AM3 A;  1L3U A;  2JEI A;  5KFY A;  5CEH A;  1X9S A;  4IQT A;  2K4P A;  1ZQK A;  4EX6 A;  3H7I A;  1X2I A;  2F76 X;  2ASD A;  4UB3 A;  1L7M A;  3V7J A;  3ISB A;  5G5H A;  2BKE A;  4ECT A;  4P4P A;  4J9M A;  4RT3 A;  2GO7 A;  4F2R A;  5KFX A;  4KMO B;  3SEI A;  4QW8 A;  4ED0 A;  2BHN A;  4Z6C A;  4JK1 A;  3ED5 A;  2PMZ F;  5AKK A;  3ETR A;  3PW4 A;  1N60 A;  5ALJ A;  4EYH B;  4DSL A;  4EZ9 A;  1SWV A;  4F5P A;  4M04 A;  8ICT A;  3ZDD A;  1XSP A;  4O0I A;  3HX0 A;  5EE1 A;  9ICW A;  2JH7 A;  2DGZ A;  3RJJ A;  3V6H A;  5F3X B;  3KHR A;  1TVA A;  2ODG A;  2G06 A;  4O3Q A;  1ZQE A;  1MA7 A;  1ZXI A;  1TKD A;  3GZF A;  2MA1 A;  1XC9 A;  3KTQ A;  4DSE A;  2Y9T A;  1B0X A;  1B22 A;  3M1Y A;  4ECU A;  3PO5 A;  5J0Y A;  1RZT A;  3LVW A;  1QTM A;  4PZN A;  1ZQC A;  3M7D A;  4UQG A;  2QB0 A;  2P6R A;  3IM1 A;  5L1L A;  2GH1 A;  4PHP A;  2OXO A;  4GXJ A;  4C8O A;  2HHQ A;  3C2K A;  3JPO A;  1U4B A;  3KOO A;  5KT7 A;  3GIJ A;  3RH6 A;  1WG8 A;  2LYA A;  3EYZ A;  2IOF A;  4Q43 A;  2VA3 A;  1RYR A;  7ICJ A;  2W9M A;  7ICI A;  3NRW A;  5J0O A;  2V4R A;  2HHV A;  5KG6 A;  2ZIX B;  3THV A;  2ESE A;  1ZQI A;  3ICX A;  3PZP A;  3AMZ A;  2OM6 A;  4KLH A;  3WK7 A;  3M6K A;  3D2S A;  5EOZ A;  2FJ6 A;  4KLG A;  3Q8Q B;  4OO1 J;  4ECS A;  4AYB F;  5L1K A;  4PZO A;  2F44 A;  1KSP A;  2WAQ C;  3M9M B;  4QZA A;  3UMB A;  1AQ6 A;  1ZJM A;  3BQT A;  4DLE A;  3EZ5 A;  1J2N A;  1Z1B A;  3RJI A;  4QZC A;  3D2N A;  4LZD A;  3T5K A;  5ALZ A;  3RJG A;  4YXM A;  4EEY A;  7ICS A;  2W04 A;  3Q8P B;  2Y0S C;  4KMU A;  1UCV A;  1K5O A;  5AKG A;  3PX0 A;  2HHW A;  3OSN A; 
#chains in the Genus database with same CATH homology
 2RQ5 A;  2JXJ A;  2LM1 A;  1IG6 A;  2EH9 A;  5CEH A;  2JRZ A;  1KN5 A;  2EQY A;  2OEH A;  2YQE A;  1KQQ A;  2KK0 A;  1KKX A;  2CXY A;  5K4L A;  4LJX A;  1C20 A;  1RYU A;  2LI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...