1KL4A

An engineered streptavidin with improved affinity for the strep-tag ii peptide : apo-sam2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
120
structure length
120
Chain Sequence
b'GITGTWYNQLGSTFIVTAGADGALTGTYIGARGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords streptavidin
publication title Improved affinity of engineered streptavidin for the Strep-tag II peptide is due to a fixed open conformation of the lid-like loop at the binding site.
pubmed doi rcsb
source organism Streptomyces avidinii
molecule tags Peptide binding protein
total genus 25
structure length 120
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 1kl4A00
2RTJA 3WYQA 4Z2OA 1SLFB 2IZHB 3VGWA 3RDMA 5IRWA 1RXHA 1SWOA 2IZBA 2IZGB 2RTLA 1HQQA 2RTQB 3EW1A 3WZPA 4BCSA 1SWEA 1HXLA 1VWAB 1LCZA 2Y3FA 1SWSA 3MG5A 4BX5A 1SLGB 2RTGB 4Z2PA 2RTAA 4CPEA 4I60A 2FHLA 1SWAA 1VWQB 5CSEA 4U46A 1SWDA 4BX6B 1SWFA 3RY1A 1SWNA 2CAMA 4Z28A 1HY2A 3FDCA 1RAVA 1NQMA 5L3YA 1VWHB 1AVEA 2IZEB 1SRGA 2OFBA 2Y32A 4GDAA 1N9YA 1KFFA 3VHHA 3WZOA 1VWBB 1RSUB 2FHNX 1SREA 1HXZA 1NBXA 1N4JA 2OF8A 4YVBA 2IZKA 1MEPA 4BX7B 1VWEB 5B5GA 5IRUA 5IRAA 2A8GA 1DF8A 5CHKA 1SWBA 3T6LA 3SZIA 1Y55X 4BBOA 1IJ8A 5F2BA 1VWOB 3RE5A 1VWIB 1SRJA 3EW2A 3SZJA 1N9MA 1WBIA 2RTBB 3RDUA 3VHIA 1MK5A 3RY2A 1SLEB 1STPA 1SWGA 2A5BA 1KL5A 2IZLB 1STSB 2RTFB 1Y52X 4CPHB 4OKAA 3PK2A 2BC3A 4GGRA 1RXKA 1LCWA 2IZCB 2JGSA 1SRHA 2UZ2A 1I9HA 3WZNA 1SWRA 2IZDB 1SWPA 4Y5DA 1VWGB 2IZJA 4BX5B 3RDQA 3T2WA 2IZIA 2AVIA 3X00A 2RTHB 4BX7A 2OF9A 2RTNB 1VYOA 4IRWA 1SRIA 4JNJA 4BJ8A 2IZAA 1LDOA 1SWJA 1N7YA 1N43A 2RTEB 4GD9A 4JO6A 1SWCA 2Y3EA 3WYPA 4CPIA 1LUQA 2RTRB 2C1QA 2WPUA 1LELA 4BX6A 1KL4A 1AVDA 3RDOA 3RDSA 3RE6A 3T6FA 1VWPB 2RTKA 1MM9A 5K67A 2MF6A 1SRFA 2C1SA 2GH7A 4GGZA 1VWJB 2RTDB 1VWMB 4GJVA 1VWLB 1VWFB 2IZFB 4CPHA 2RTOB 1NC9A 3SZHA 1VWRB 1SWTA 5JD2A 4Z6JA 2UYWA 1NDJA 1KL3A 1STRB 2F01A 5K68A 1SWHA 1SLDB 2RTCB 3T2XA 1LDQA 1NQNA 1RXJA 1SWKA 1SWUA 4DNEA 1Y53X 1PTSA 4GJSA 5B5FA 1RSTB 2OFAA 4Z27A 2C4IA 1SWLA 1SWQA 4Z2VA 1VWDB 4EKVA 1VWKB 1VWCB 2RTMA 2RTPB 1MOYA 3MM0A 4Y59A 2ZSCA 2A5CA 3WZQA 2RTIB 4GGTA 3VHMA 1LCVA 2G5LA 1VWNB 4CPFA 4JHQA 2QCBA 3RDXA
chains in the Genus database with same CATH superfamily
5D8JA 1LFOA 2L68A 3U0DA 3RDMA 1RXHA 2ASNX 1KT4A 2BS6A 5HBSA 3VG3A 5B5FA 3IFBA 1SA8A 4LZVA 1QQSA 3P02A 2NP1A 2RTAA 1OEEA 1O8VA 3NQ9A 4DQ3A 3UEUA 3CQNA 1SWDA 4O4UA 5B27A 2K62A 1SWFA 1CBQA 1P6PA 1HY2A 1T68X 3FDCA 1GT3A 2W2FA 1W6FA 4O3YA 1NQMA 5L3YA 2IZEB 2OFBA 1PBYA 2Y32A 4I9SA 3KZAA 1KFFA 3WZOA 2X4MA 5F58A 4NV8A 4YH0A 3SOTA 2VDFA 1BLRA 3FR4A 1H91A 4L1NA 3U03A 1VYFA 2IZKA 2JMBA 2R73A 4BX7B 4YCHA 5IRUA 3EYCA 4U8UM 1OSPO 1A18A 1ZNDA 2W2AA 4EDEA 2KTDA 4HPAA 2PI3O 1HBPA 1SWBA 4NNSA 4NW4A 3T6LA 2FR3A 3B2JA 1CBRA 1MVGA 4A8ZA 4BBOA 5EEDA 5F2BA 5HAEA 1UYNX 5KICA 3AKNA 2I5VO 1SRJA 5EEEA 3SZJA 1G7NA 1HMRA 5B2AO 3ZI8A 4YGGA 1HQPA 3RDUA 3VHIA 4BQUA 1SLEB 2WEWA 3Q6LA 1EIIA 4MEEA 2FT9A 2G78A 2LBVA 3STKA 4IAWA 3BX7A 4K19A 1STSB 4CSBA 4NV7A 3JS1A 4CPHB 1BM5A 4OKAA 2M4LA 2DJFA 5LJGA 4GH7A 2X32A 1D2UA 4I6SA 4ML7B 1HMTA 1SWRA 2CM9A 1SWPA 3KVNA 5EDCA 1KZXA 1BSYA 1GX8A 2AT8X 3FW4A 1X89A 5H9LA 2IZJA 4BGFA 2RCTA 1BSOA 1LIFA 1YUPA 2KTSA 3T2WA 2AVIA 3DSZA 3WJFA 3X00A 5IXGA 2OF9A 5LJCA 4MVKA 3ZZVA 4IRWA 4QQ1A 1ADLA 1SRIA 4JNJA 1IIUA 2IZAA 4ON1A 4UU3A 5H8TA 1N7YA 1KOIA 3UEVA 4M7MA 4BVMA 4JO6A 3P6FA 2R74A 1DZMA 4CDFA 4KT5A 4QAEA 3PEDA 4KCAA 1LUQA 2RTRB 1BRPA 4FBRA 3EMMA 1KL4A 3RDOA 2MWHA 2OFMX 4FQBB 2DJGA 3G7XA 4OELA 1GX3A 5K67A 2Q2MA 3KFFA 2GH7A 4HWMA 4GGZA 4O49A 4ARHA 4AZRA 2Q2PA 1LIDA 1VWMB 5KIDA 1VWLB 5D45A 2IZFB 3WXQA 3FA6A 1IFBA 1E06A 3VG5A 4L3RA 1YP7A 1GX9A 1IFCA 1SWTA 5JD2A 1Y0GA 2UYWA 2FS7A 3FA9A 4YCEA 1KL3A 1ZRYA 5BVQA 3S5XA 2JOZA 4YKMA 5L8OA 4U8UO 4YFPA 1SLDB 5D47A 1RXJA 1OBUA 1SWKA 3APVA 1FDQA 4ZHDA 4IB6A 3VG2A 4ZHCA 5HCEC 2HLVA 1MX8A 1NGLA 1U18A 2RQ0A 4N7CA 3FMZA 4OEMA 4TJZA 3I0AA 1VWDB 3PH6A 1KT3A 1VWKB 1X8OA 1E00A 3NPOA 3BRNA 1VWCB 4UU2A 4U3QA 3E3CA 2RTPB 3FEPA 4D6AA 1T8VA 1ICNA 3APUA 2A5CA 3KFHA 4Y0SA 3WJBA 2LFOA 4GGTA 4XMDA 1KT5A 3PPTA 1EIOA 2JU7A 4ALBA 3O19A 2RTOB 3C76X 4MISA 4ZCBA 2RTJA 3B2HA 3FENA 4R0BA 2IZHB 3B2KA 3KFIA 4NYRA 5EPQA 3QQ2A 4IB7A 3WYQA 2IZGB 4ALOA 3WZPA 4B55A 1RBPA 4A1YA 1HXLA 1VWAB 2ALLX 1SWSA 2EU7X 2WEXA 1SLGB 1GT4A 2WQ9A 2AT3X 4MVEA 3CKGA 2OFRX 2ZAGA 2FLJA 1MX7A 3D96A 1KT7A 1PMPA 1S44A 2X34A 4XMEA 2GJ5A 4TLJA 2QOMA 4U8UN 2OY1O 5H9AA 2GC9A 1VWHB 1N9YA 1I04A 4IB9A 5HTDA 1VWBB 2CM4A 2KW1A 3I17A 3VG7A 1JJJA 2FHNX 1KZWA 1NBXA 1X71A 2OF8A 5FQ7E 3ZWEA 3D95A 3BX8A 3CMPA 2P8GA 5LKFA 2OYBO 3SLJA 3ZUOA 1TXLA 1G74A 2OY8A 3HK1A 5CHKA 3TZSA 1EW3A 2GTLM 2HKDA 4GETA 1FTPA 1QFVA 1Y55X 3Q34A 4EFGA 3ZQ3A 2O62A 1I05A 4OS3A 3ZW1A 3RE5A 4AYHA 1HMSA 1HBQA 1N9MA 1ALBA 3D4RA 3APXA 3OBLA 4GZVA 4QGXA 2L9CA 1WBIA 4QYPA 3TF6A 4AZQA 4O3XB 4EEJA 1MK5A 4GNWA 3RY2A 4ODDA 1SWGA 1JQPA 2IFBA 1PEEA 3S5VA 3HWDA 2VFCA 2A5BA 1AQBA 1AVGI 1D3SA 2FS6A 2IZLB 2RTFB 3CBCA 2XSTA 2JW1A 3VG6A 4COTA 2FKGA 1QY0A 1RXKA 1QY2A 1W5RA 2IZCB 2JGSA 1DZPA 2A3FX 2UZ2A 2IZDB 2YMSA 3BU1A 2W2BA 2X55A 1LIEA 5B11O 3WZNA 4OMXA 4QGVA 1YWCA 3PH5A 2WSJA 1A2DA 1W4TA 3IA8A 3OD9A 2A2UA 2Q39A 1OEKA 2Z4IA 5CE4A 1BSQA 5KHPA 2R56A 3OJYC 5CYBA 3U9PC 1K24A 4GRJA 4I3BA 2A0AA 4GK9A 3BSZE 3JSQA 1LDOA 4BJ8A 1FE3A 1SWJA 1SY2A 1X8QA 5AQ6A 4WBKA 2RTEB 4GD9A 2XKLA 1KGLA 1SWCA 3V8UA 4QZTA 1JJXA 4FBVA 5IO5A 1S7DA 1GKAA 4CPIA 1JZUA 2C1QA 4BX6A 2QO5A 5BVTA 1TVQA 5DPQA 3RE6A 1X8PA 2RTKA 4O3ZA 1MM9A 3NQ3A 2N93A 1SRFA 2Q4NA 3HWEA 4GE1A 1RLBE 1EI5A 4YGHA 4CDDA 4CK4A 3N91A 3O22A 4GU8A 1EALA 2LBAA 1B8EA 1U17A 3SZHA 1VWRB 4A60A 2ACOA 3PDFA 3RKGA 3HOLA 2BS5A 3P6EA 4XMGA 3FW5A 2QO6A 3NR3A 5K68A 1SWHA 3CKFA 5LJDA 2RTCB 3T2XA 4XMFA 1LDQA 2GTLO 5HTEA 4Z2OA 1ZNHA 3NADA 4GJSA 1FELA 1A3YA 3NQKA 4KH8A 2G7BA 3P6CA 1SWLA 1SWQA 2OY7A 4CDEA 2E4JA 4ES7A 4Z2VA 4RUNA 2AKQA 2WR6A 2AMMX 1TOUA 1BJ7A 2RTMA 4IAXA 4ZFXA 1MOYA 2OZQA 2POAA 1YP6A 3P6DA 1SY0A 4I95A 4Y59A 2ZSCA 3FR2A 4YKOA 5F1EA 2QMIA 2RTIB 3D9WA 1EQDA 3VHMA 3EM0A 1LCVA 2X8TA 4ZGFA 1ERBA 1G5WA 1VWNB 1GM6A 4ORXA 4FBOA 3SAOA 4JHQA 2QCBA 3RDXA 3UAQA 3ZW0A 4YBPA 3FIQA 5BVSA 4YGZA 2HNXA 3LTWA 3B2IA 4QNIA 1UZ2X 3CWKA 3T1DA 5IRWA 1CRBA 2IZBA 3VE1A 2RTLA 1HQQA 2RTQB 4BCSA 4DCBA 1SWEA 2F73A 3GE2A 1DV9A 3MG5A 4BX5A 4Z2PA 1DF3A 4I60A 2CZTA 1SWAA 1NP4A 1ZNKA 1GKAB 3OE3A 4TQ2A 1LNMA 4U46A 4BX6B 4KC8A 3RY1A 4INNA 3APWA 1ACDA 4IABA 1LF7A 2RA6A 1RAVA 4ZHFA 4HPDA 3ZUIA 2MJIA 4AZPA 1AVEA 5HCDC 4IB8A 3TGBA 1AB0A 2ANSA 2GTLN 3C77X 3CBSA 3NBXX 4O3WA 4JGLA 1RSUB 3F9DA 1CBIA 1HXZA 1LPJA 1ZNEA 1N4JA 3QKGA 4YVBA 4Y0QA 1MEPA 5B5GA 3UEXA 4QYNA 5LKEA 4ORWA 2A8GA 2OL7A 4IMNA 3EBKA 3FA8A 1KT6A 2LKKA 2X8FA 5IO7A 3SZIA 4MVLA 4C5PA 1T0VA 2A13A 2Q9SA 5DG4A 1VWIB 3EW2A 2QM9A 3BLGA 2OL8O 4IBAA 1PM1X 2FWVA 4NYQA 3HOEA 4OMWA 1KQWA 5B3MO 1STPA 1TOWA 5L8IA 3WJCA 1X8UA 2MO5A 1KL5A 1SXUA 3F8AA 1Y52X 5FFHA 3FEKA 1FJ1E 4GKCA 5L8NA 1SY3A 3F6ZB 3ZW0B 1OEJA 2BC3A 2K23A 2KD2A 4GGRA 4I3CA 4LKTA 4RUUA 1OPAA 5AJBA 3HWGA 2FKJA 3RBYA 2AL0X 4HPCA 4O4XA 3RWXA 1N0SA 3S26A 4BX5B 1BRQA 2FRSA 2IZIA 5FQ6E 2BSZA 4OS8A 3BDRA 1OBQA 4BX7A 2RTNB 4QGWA 3P6GA 5H9NA 1CJ5A 5LJEA 1JBHA 3FLLA 2WQAE 2YG2A 3BY0A 3GAQA 3WOVA 2OL6O 1DC9A 2G79A 5FENA 4HFOA 4WFVA 2A2GA 2L5PA 3WYPA 5HZ9A 3STMX 4TNNA 2WPUA 5HWZA 4AZNA 3WJDA 3RDSA 5B10O 4YFRA 3WJEA 3JQOA 2C1SA 2BHVA 2RTDB 2CBSA 4GJVA 3B2LA 4OS0A 2HYSA 4CPHA 4MIRA 4MVIA 1SY1A 1ZNGA 4Y0RA 4ZJ0A 5F6ZA 1NDJA 4YDAA 1GT5A 3WVMA 1UREA 2WWPA 3PQSA 2F01A 2HZRA 2I5ZO 2RN4A 1UYOX 4ORSA 2RCQA 1SWUA 1B0OA 2FTBA 4DNEA 1Y53X 3EC5A 2LB6A 1OPBA 1XCAA 2OFAA 3H3IA 3NP1A 3HWFA 2C4IA 2MM3A 5EDBA 3FA7A 4EQAC 1EUOA 1YWBA 3SLTA 1R0UA 2RD7C 3VPJE 4O4SA 1EXSA 2F09A 1JJUA 2Z4HA 1BWYA 1JYJA 4ZH6A 5LJHA 4I3DA 4O9SA 1TW4A 1YWDA 2CZUA 4NNTA 1FEMA 3AUMO 3VU1A 4ORUA 1VPRA 3DTQA 2QOSC 5LJBA 2AT6X 2X8SA 1JIWI 2G5LA 1I06A 4ID2A 4CPFA 3RSWA 1MDCA 5AEOA 4KC7A 2OVDA 1HN2A 1SLFB 4IMOA 1YIVA 3MVFA 3PQUA 4TKHA 1SWOA 3VGWA 3EW1A 3ZW1B 2JU8A 4GNYA 2Y3FA 1LCZA 4GUZA 2RTGB 3L4RA 2KT4B 3ELXA 4CPEA 2FHLA 2JN3A 1ZNLA 1VWQB 3VE2A 2MHDA 3MX7A 4ZHGA 4ZH9A 5CSEA 4CDCA 3SLOA 3WJGA 2G8CO 2NNEA 1SWNA 2CAMA 1BEBA 4M6SA 3VG4A 4Z28A 3KQ0A 4FGIB 4N7DA 5HZ6A 5HA1A 1QY1A 1SRGA 4GDAA 5FQ8E 3PECA 5B29A 3BU9A 3VHHA 1GXAA 2PY1A 1EPBA 4GDZA 4DQ4A 4WFUA 1SREA 1O1UA 1LKEA 1U0XA 3WBGA 5IO6A 3UEWA 3K3LA 4YDBA 1VWEB 1GGLA 4LQZA 5D48A 1Y9TA 4WHIA 1PBOA 5IRAA 1DF8A 1MUPA 1AELA 2HMBA 4ZHHA 1JMZA 2BT9A 2NNQA 1KQXA 1IJ8A 1VWOB 2OVSA 1LIBA 1G85A 4ORRA 4ORYA 3HTYA 4KIIA 4YBUA 1QWDA 1LICA 2RTBB 5HZ5A 1WUBA 1SXXA 1GT1A 1X8NA 4U9CA 1DZJA 2DM5A 3RZYA 1B56A 1VYGA 4A1HA 4QRLA 2AT0X 3FR5A 4O4OA 4D6BA 1ERXA 4TKBA 1OBPA 1LCWA 1SRHA 2ACPX 1I9HA 1EPAA 1E2TA 1QFTA 4Y5DA 1YWAA 1Z24A 2JU3A 1VWGB 4AW8A 4Y0PA 5BYPA 5EZ2A 4XMHA 3RDQA 4HPBA 2AT5X 2RTHB 4YFQA 3KFGA 1JV4A 1O1VA 1VYOA 5H9KA 2OVEA 3S60A 1K3BA 2BLGA 3O2YA 1FENA 3BS2A 4TKJA 1I4UA 2X46A 1ML7A 1N43A 2QO4A 5HA0A 4PJ2A 5HZQA 3FIDA 1QG5A 3CQRA 3ZW2A 1XKIA 2Y3EA 1E5PA 3EBWA 3FYFA 4YMYA 3NX2A 3TGAA 3P6HA 1Y9LA 1L6MA 1LELA 3D97A 4LKPA 1AVDA 3T6FA 2GTFX 1A57A 1VWPB 1JYDA 2HZQA 2MF6A 1SXYA 1E02A 1VWJB 1BBPA 4LZUA 4NLIA 1VWFB 3CR6A 3HPEA 4NLJA 4CV7A 4QZUA 1CBSA 1NC9A 1IW2A 3TGCA 3ELZA 1IKJA 3MBTA 5FAZA 3STNA 4Z6JA 4ZGUA 3LHNA 5HCCC 1NP1A 1SMPI 2AH7X 1STRB 2VFBA 2WUTA 2L67A 4I9RA 1DFVA 1ICMA 1JMXA 5F7GA 1I78A 1NQNA 2ZAIA 2AF5A 4XMCA 1PTSA 4BOEA 1RSTB 2FGSA 2X56A 4Z27A 1KXOA 4NP1A 3C78X 4EKVA 1B4MA 2CBRA 2NNDA 1QABE 3AKMA 4PSQA 4AZMA 5C0NA 5K06A 3LV4A 4ZR2A 3MM0A 2X45A 3FELA 5D4AA 1IKEA 1S2PA 2OY5O 3WZQA 2LA7A 5LJKA 5F6BA 5AJCA 4AZOA 3P24A 5JR8A 5HZ8A 4EXZA 1SXWA 2FR2A 3NX1A 1DZKA 3PP6A 3PK2A 2OVAA 3AEHA
chains in the Genus database with same CATH topology
2RTJA 3WYQA 4Z2OA 1SLFB 2IZHB 3VGWA 3RDMA 5IRWA 1RXHA 1SWOA 2IZBA 2IZGB 2RTLA 1HQQA 2RTQB 3EW1A 3WZPA 4BCSA 1SWEA 1HXLA 1VWAB 1LCZA 2Y3FA 1SWSA 3MG5A 4BX5A 1SLGB 2RTGB 4Z2PA 2RTAA 4CPEA 4I60A 2FHLA 1SWAA 1VWQB 5CSEA 4U46A 1SWDA 4BX6B 1SWFA 3RY1A 1SWNA 2CAMA 4Z28A 1HY2A 3FDCA 1RAVA 1NQMA 5L3YA 1VWHB 1AVEA 2IZEB 1SRGA 2OFBA 2Y32A 4GDAA 1N9YA 1KFFA 3VHHA 3WZOA 1VWBB 1RSUB 2FHNX 1SREA 1HXZA 1NBXA 1N4JA 2OF8A 4YVBA 2IZKA 1MEPA 4BX7B 1VWEB 5B5GA 5IRUA 5IRAA 2A8GA 1DF8A 5CHKA 1SWBA 3T6LA 3SZIA 1Y55X 4BBOA 1IJ8A 5F2BA 1VWOB 3RE5A 1VWIB 1SRJA 3EW2A 3SZJA 1N9MA 1WBIA 2RTBB 3RDUA 3VHIA 1MK5A 3RY2A 1SLEB 1STPA 1SWGA 2A5BA 1KL5A 2IZLB 1STSB 2RTFB 1Y52X 4CPHB 4OKAA 3PK2A 2BC3A 4GGRA 1RXKA 1LCWA 2IZCB 2JGSA 1SRHA 2UZ2A 1I9HA 3WZNA 1SWRA 2IZDB 1SWPA 4Y5DA 1VWGB 2IZJA 4BX5B 3RDQA 3T2WA 2IZIA 2AVIA 3X00A 2RTHB 4BX7A 2OF9A 2RTNB 1VYOA 4IRWA 1SRIA 4JNJA 4BJ8A 2IZAA 1LDOA 1SWJA 1N7YA 1N43A 2RTEB 4GD9A 4JO6A 1SWCA 2Y3EA 3WYPA 4CPIA 1LUQA 2RTRB 2C1QA 2WPUA 1LELA 4BX6A 1KL4A 1AVDA 3RDOA 3RDSA 3RE6A 3T6FA 1VWPB 2RTKA 1MM9A 5K67A 2MF6A 1SRFA 2C1SA 2GH7A 4GGZA 1VWJB 2RTDB 1VWMB 4GJVA 1VWLB 1VWFB 2IZFB 4CPHA 2RTOB 1NC9A 3SZHA 1VWRB 1SWTA 5JD2A 4Z6JA 2UYWA 1NDJA 1KL3A 1STRB 2F01A 5K68A 1SWHA 1SLDB 2RTCB 3T2XA 1LDQA 1NQNA 1RXJA 1SWKA 1SWUA 4DNEA 1Y53X 1PTSA 4GJSA 5B5FA 1RSTB 2OFAA 4Z27A 2C4IA 1SWLA 1SWQA 4Z2VA 1VWDB 4EKVA 1VWKB 1VWCB 2RTMA 2RTPB 1MOYA 3MM0A 4Y59A 2ZSCA 2A5CA 3WZQA 2RTIB 4GGTA 3VHMA 1LCVA 2G5LA 1VWNB 4CPFA 4JHQA 2QCBA 3RDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RTJ A;  3WYQ A;  4Z2O A;  1SLF B;  2IZH B;  3VGW A;  3RDM A;  5IRW A;  1RXH A;  1SWO A;  2IZB A;  2IZG B;  2RTL A;  1HQQ A;  2RTQ B;  3EW1 A;  3WZP A;  4BCS A;  1SWE A;  1HXL A;  1VWA B;  1LCZ A;  2Y3F A;  1SWS A;  3MG5 A;  4BX5 A;  1SLG B;  2RTG B;  4Z2P A;  2RTA A;  4CPE A;  4I60 A;  2FHL A;  1SWA A;  1VWQ B;  5CSE A;  4U46 A;  1SWD A;  4BX6 B;  1SWF A;  3RY1 A;  1SWN A;  2CAM A;  4Z28 A;  1HY2 A;  3FDC A;  1RAV A;  1NQM A;  5L3Y A;  1VWH B;  1AVE A;  2IZE B;  1SRG A;  2OFB A;  2Y32 A;  4GDA A;  1N9Y A;  1KFF A;  3VHH A;  3WZO A;  1VWB B;  1RSU B;  2FHN X;  1SRE A;  1HXZ A;  1NBX A;  1N4J A;  2OF8 A;  4YVB A;  2IZK A;  1MEP A;  4BX7 B;  1VWE B;  5B5G A;  5IRU A;  5IRA A;  2A8G A;  1DF8 A;  5CHK A;  1SWB A;  3T6L A;  3SZI A;  1Y55 X;  4BBO A;  1IJ8 A;  5F2B A;  1VWO B;  3RE5 A;  1VWI B;  1SRJ A;  3EW2 A;  3SZJ A;  1N9M A;  1WBI A;  2RTB B;  3RDU A;  3VHI A;  1MK5 A;  3RY2 A;  1SLE B;  1STP A;  1SWG A;  2A5B A;  1KL5 A;  2IZL B;  1STS B;  2RTF B;  1Y52 X;  4CPH B;  4OKA A;  3PK2 A;  2BC3 A;  4GGR A;  1RXK A;  1LCW A;  2IZC B;  2JGS A;  1SRH A;  2UZ2 A;  1I9H A;  3WZN A;  1SWR A;  2IZD B;  1SWP A;  4Y5D A;  1VWG B;  2IZJ A;  4BX5 B;  3RDQ A;  3T2W A;  2IZI A;  2AVI A;  3X00 A;  2RTH B;  4BX7 A;  2OF9 A;  2RTN B;  1VYO A;  4IRW A;  1SRI A;  4JNJ A;  4BJ8 A;  2IZA A;  1LDO A;  1SWJ A;  1N7Y A;  1N43 A;  2RTE B;  4GD9 A;  4JO6 A;  1SWC A;  2Y3E A;  3WYP A;  4CPI A;  1LUQ A;  2RTR B;  2C1Q A;  2WPU A;  1LEL A;  4BX6 A;  1KL4 A;  1AVD A;  3RDO A;  3RDS A;  3RE6 A;  3T6F A;  1VWP B;  2RTK A;  1MM9 A;  5K67 A;  2MF6 A;  1SRF A;  2C1S A;  2GH7 A;  4GGZ A;  1VWJ B;  2RTD B;  1VWM B;  4GJV A;  1VWL B;  1VWF B;  2IZF B;  4CPH A;  2RTO B;  1NC9 A;  3SZH A;  1VWR B;  1SWT A;  5JD2 A;  4Z6J A;  2UYW A;  1NDJ A;  1KL3 A;  1STR B;  2F01 A;  5K68 A;  1SWH A;  1SLD B;  2RTC B;  3T2X A;  1LDQ A;  1NQN A;  1RXJ A;  1SWK A;  1SWU A;  4DNE A;  1Y53 X;  1PTS A;  4GJS A;  5B5F A;  1RST B;  2OFA A;  4Z27 A;  2C4I A;  1SWL A;  1SWQ A;  4Z2V A;  1VWD B;  4EKV A;  1VWK B;  1VWC B;  2RTM A;  2RTP B;  1MOY A;  3MM0 A;  4Y59 A;  2ZSC A;  2A5C A;  3WZQ A;  2RTI B;  4GGT A;  3VHM A;  1LCV A;  2G5L A;  1VWN B;  4CPF A;  4JHQ A;  2QCB A;  3RDX A; 
#chains in the Genus database with same CATH topology
 5D8J A;  1LFO A;  2L68 A;  3U0D A;  3RDM A;  1RXH A;  2ASN X;  1KT4 A;  2BS6 A;  5HBS A;  3VG3 A;  5B5F A;  3IFB A;  1SA8 A;  4LZV A;  1QQS A;  3P02 A;  2NP1 A;  2RTA A;  1OEE A;  1O8V A;  3NQ9 A;  4DQ3 A;  3UEU A;  3CQN A;  1SWD A;  4O4U A;  5B27 A;  2K62 A;  1SWF A;  1CBQ A;  1P6P A;  1HY2 A;  1T68 X;  3FDC A;  1GT3 A;  2W2F A;  1W6F A;  4O3Y A;  1NQM A;  5L3Y A;  2IZE B;  2OFB A;  1PBY A;  2Y32 A;  4I9S A;  3KZA A;  1KFF A;  3WZO A;  2X4M A;  5F58 A;  4NV8 A;  4YH0 A;  3SOT A;  2VDF A;  1BLR A;  3FR4 A;  1H91 A;  4L1N A;  3U03 A;  1VYF A;  2IZK A;  2JMB A;  2R73 A;  4BX7 B;  4YCH A;  5IRU A;  3EYC A;  4U8U M;  1OSP O;  1A18 A;  1ZND A;  2W2A A;  4EDE A;  2KTD A;  4HPA A;  2PI3 O;  1HBP A;  1SWB A;  4NNS A;  4NW4 A;  3T6L A;  2FR3 A;  3B2J A;  1CBR A;  1MVG A;  4A8Z A;  4BBO A;  5EED A;  5F2B A;  5HAE A;  1UYN X;  5KIC A;  3AKN A;  2I5V O;  1SRJ A;  5EEE A;  3SZJ A;  1G7N A;  1HMR A;  5B2A O;  3ZI8 A;  4YGG A;  1HQP A;  3RDU A;  3VHI A;  4BQU A;  1SLE B;  2WEW A;  3Q6L A;  1EII A;  4MEE A;  2FT9 A;  2G78 A;  2LBV A;  3STK A;  4IAW A;  3BX7 A;  4K19 A;  1STS B;  4CSB A;  4NV7 A;  3JS1 A;  4CPH B;  1BM5 A;  4OKA A;  2M4L A;  2DJF A;  5LJG A;  4GH7 A;  2X32 A;  1D2U A;  4I6S A;  4ML7 B;  1HMT A;  1SWR A;  2CM9 A;  1SWP A;  3KVN A;  5EDC A;  1KZX A;  1BSY A;  1GX8 A;  2AT8 X;  3FW4 A;  1X89 A;  5H9L A;  2IZJ A;  4BGF A;  2RCT A;  1BSO A;  1LIF A;  1YUP A;  2KTS A;  3T2W A;  2AVI A;  3DSZ A;  3WJF A;  3X00 A;  5IXG A;  2OF9 A;  5LJC A;  4MVK A;  3ZZV A;  4IRW A;  4QQ1 A;  1ADL A;  1SRI A;  4JNJ A;  1IIU A;  2IZA A;  4ON1 A;  4UU3 A;  5H8T A;  1N7Y A;  1KOI A;  3UEV A;  4M7M A;  4BVM A;  4JO6 A;  3P6F A;  2R74 A;  1DZM A;  4CDF A;  4KT5 A;  4QAE A;  3PED A;  4KCA A;  1LUQ A;  2RTR B;  1BRP A;  4FBR A;  3EMM A;  1KL4 A;  3RDO A;  2MWH A;  2OFM X;  4FQB B;  2DJG A;  3G7X A;  4OEL A;  1GX3 A;  5K67 A;  2Q2M A;  3KFF A;  2GH7 A;  4HWM A;  4GGZ A;  4O49 A;  4ARH A;  4AZR A;  2Q2P A;  1LID A;  1VWM B;  5KID A;  1VWL B;  5D45 A;  2IZF B;  3WXQ A;  3FA6 A;  1IFB A;  1E06 A;  3VG5 A;  4L3R A;  1YP7 A;  1GX9 A;  1IFC A;  1SWT A;  5JD2 A;  1Y0G A;  2UYW A;  2FS7 A;  3FA9 A;  4YCE A;  1KL3 A;  1ZRY A;  5BVQ A;  3S5X A;  2JOZ A;  4YKM A;  5L8O A;  4U8U O;  4YFP A;  1SLD B;  5D47 A;  1RXJ A;  1OBU A;  1SWK A;  3APV A;  1FDQ A;  4ZHD A;  4IB6 A;  3VG2 A;  4ZHC A;  5HCE C;  2HLV A;  1MX8 A;  1NGL A;  1U18 A;  2RQ0 A;  4N7C A;  3FMZ A;  4OEM A;  4TJZ A;  3I0A A;  1VWD B;  3PH6 A;  1KT3 A;  1VWK B;  1X8O A;  1E00 A;  3NPO A;  3BRN A;  1VWC B;  4UU2 A;  4U3Q A;  3E3C A;  2RTP B;  3FEP A;  4D6A A;  1T8V A;  1ICN A;  3APU A;  2A5C A;  3KFH A;  4Y0S A;  3WJB A;  2LFO A;  4GGT A;  4XMD A;  1KT5 A;  3PPT A;  1EIO A;  2JU7 A;  4ALB A;  3O19 A;  2RTO B;  3C76 X;  4MIS A;  4ZCB A;  2RTJ A;  3B2H A;  3FEN A;  4R0B A;  2IZH B;  3B2K A;  3KFI A;  4NYR A;  5EPQ A;  3QQ2 A;  4IB7 A;  3WYQ A;  2IZG B;  4ALO A;  3WZP A;  4B55 A;  1RBP A;  4A1Y A;  1HXL A;  1VWA B;  2ALL X;  1SWS A;  2EU7 X;  2WEX A;  1SLG B;  1GT4 A;  2WQ9 A;  2AT3 X;  4MVE A;  3CKG A;  2OFR X;  2ZAG A;  2FLJ A;  1MX7 A;  3D96 A;  1KT7 A;  1PMP A;  1S44 A;  2X34 A;  4XME A;  2GJ5 A;  4TLJ A;  2QOM A;  4U8U N;  2OY1 O;  5H9A A;  2GC9 A;  1VWH B;  1N9Y A;  1I04 A;  4IB9 A;  5HTD A;  1VWB B;  2CM4 A;  2KW1 A;  3I17 A;  3VG7 A;  1JJJ A;  2FHN X;  1KZW A;  1NBX A;  1X71 A;  2OF8 A;  5FQ7 E;  3ZWE A;  3D95 A;  3BX8 A;  3CMP A;  2P8G A;  5LKF A;  2OYB O;  3SLJ A;  3ZUO A;  1TXL A;  1G74 A;  2OY8 A;  3HK1 A;  5CHK A;  3TZS A;  1EW3 A;  2GTL M;  2HKD A;  4GET A;  1FTP A;  1QFV A;  1Y55 X;  3Q34 A;  4EFG A;  3ZQ3 A;  2O62 A;  1I05 A;  4OS3 A;  3ZW1 A;  3RE5 A;  4AYH A;  1HMS A;  1HBQ A;  1N9M A;  1ALB A;  3D4R A;  3APX A;  3OBL A;  4GZV A;  4QGX A;  2L9C A;  1WBI A;  4QYP A;  3TF6 A;  4AZQ A;  4O3X B;  4EEJ A;  1MK5 A;  4GNW A;  3RY2 A;  4ODD A;  1SWG A;  1JQP A;  2IFB A;  1PEE A;  3S5V A;  3HWD A;  2VFC A;  2A5B A;  1AQB A;  1AVG I;  1D3S A;  2FS6 A;  2IZL B;  2RTF B;  3CBC A;  2XST A;  2JW1 A;  3VG6 A;  4COT A;  2FKG A;  1QY0 A;  1RXK A;  1QY2 A;  1W5R A;  2IZC B;  2JGS A;  1DZP A;  2A3F X;  2UZ2 A;  2IZD B;  2YMS A;  3BU1 A;  2W2B A;  2X55 A;  1LIE A;  5B11 O;  3WZN A;  4OMX A;  4QGV A;  1YWC A;  3PH5 A;  2WSJ A;  1A2D A;  1W4T A;  3IA8 A;  3OD9 A;  2A2U A;  2Q39 A;  1OEK A;  2Z4I A;  5CE4 A;  1BSQ A;  5KHP A;  2R56 A;  3OJY C;  5CYB A;  3U9P C;  1K24 A;  4GRJ A;  4I3B A;  2A0A A;  4GK9 A;  3BSZ E;  3JSQ A;  1LDO A;  4BJ8 A;  1FE3 A;  1SWJ A;  1SY2 A;  1X8Q A;  5AQ6 A;  4WBK A;  2RTE B;  4GD9 A;  2XKL A;  1KGL A;  1SWC A;  3V8U A;  4QZT A;  1JJX A;  4FBV A;  5IO5 A;  1S7D A;  1GKA A;  4CPI A;  1JZU A;  2C1Q A;  4BX6 A;  2QO5 A;  5BVT A;  1TVQ A;  5DPQ A;  3RE6 A;  1X8P A;  2RTK A;  4O3Z A;  1MM9 A;  3NQ3 A;  2N93 A;  1SRF A;  2Q4N A;  3HWE A;  4GE1 A;  1RLB E;  1EI5 A;  4YGH A;  4CDD A;  4CK4 A;  3N91 A;  3O22 A;  4GU8 A;  1EAL A;  2LBA A;  1B8E A;  1U17 A;  3SZH A;  1VWR B;  4A60 A;  2ACO A;  3PDF A;  3RKG A;  3HOL A;  2BS5 A;  3P6E A;  4XMG A;  3FW5 A;  2QO6 A;  3NR3 A;  5K68 A;  1SWH A;  3CKF A;  5LJD A;  2RTC B;  3T2X A;  4XMF A;  1LDQ A;  2GTL O;  5HTE A;  4Z2O A;  1ZNH A;  3NAD A;  4GJS A;  1FEL A;  1A3Y A;  3NQK A;  4KH8 A;  2G7B A;  3P6C A;  1SWL A;  1SWQ A;  2OY7 A;  4CDE A;  2E4J A;  4ES7 A;  4Z2V A;  4RUN A;  2AKQ A;  2WR6 A;  2AMM X;  1TOU A;  1BJ7 A;  2RTM A;  4IAX A;  4ZFX A;  1MOY A;  2OZQ A;  2POA A;  1YP6 A;  3P6D A;  1SY0 A;  4I95 A;  4Y59 A;  2ZSC A;  3FR2 A;  4YKO A;  5F1E A;  2QMI A;  2RTI B;  3D9W A;  1EQD A;  3VHM A;  3EM0 A;  1LCV A;  2X8T A;  4ZGF A;  1ERB A;  1G5W A;  1VWN B;  1GM6 A;  4ORX A;  4FBO A;  3SAO A;  4JHQ A;  2QCB A;  3RDX A;  3UAQ A;  3ZW0 A;  4YBP A;  3FIQ A;  5BVS A;  4YGZ A;  2HNX A;  3LTW A;  3B2I A;  4QNI A;  1UZ2 X;  3CWK A;  3T1D A;  5IRW A;  1CRB A;  2IZB A;  3VE1 A;  2RTL A;  1HQQ A;  2RTQ B;  4BCS A;  4DCB A;  1SWE A;  2F73 A;  3GE2 A;  1DV9 A;  3MG5 A;  4BX5 A;  4Z2P A;  1DF3 A;  4I60 A;  2CZT A;  1SWA A;  1NP4 A;  1ZNK A;  1GKA B;  3OE3 A;  4TQ2 A;  1LNM A;  4U46 A;  4BX6 B;  4KC8 A;  3RY1 A;  4INN A;  3APW A;  1ACD A;  4IAB A;  1LF7 A;  2RA6 A;  1RAV A;  4ZHF A;  4HPD A;  3ZUI A;  2MJI A;  4AZP A;  1AVE A;  5HCD C;  4IB8 A;  3TGB A;  1AB0 A;  2ANS A;  2GTL N;  3C77 X;  3CBS A;  3NBX X;  4O3W A;  4JGL A;  1RSU B;  3F9D A;  1CBI A;  1HXZ A;  1LPJ A;  1ZNE A;  1N4J A;  3QKG A;  4YVB A;  4Y0Q A;  1MEP A;  5B5G A;  3UEX A;  4QYN A;  5LKE A;  4ORW A;  2A8G A;  2OL7 A;  4IMN A;  3EBK A;  3FA8 A;  1KT6 A;  2LKK A;  2X8F A;  5IO7 A;  3SZI A;  4MVL A;  4C5P A;  1T0V A;  2A13 A;  2Q9S A;  5DG4 A;  1VWI B;  3EW2 A;  2QM9 A;  3BLG A;  2OL8 O;  4IBA A;  1PM1 X;  2FWV A;  4NYQ A;  3HOE A;  4OMW A;  1KQW A;  5B3M O;  1STP A;  1TOW A;  5L8I A;  3WJC A;  1X8U A;  2MO5 A;  1KL5 A;  1SXU A;  3F8A A;  1Y52 X;  5FFH A;  3FEK A;  1FJ1 E;  4GKC A;  5L8N A;  1SY3 A;  3F6Z B;  3ZW0 B;  1OEJ A;  2BC3 A;  2K23 A;  2KD2 A;  4GGR A;  4I3C A;  4LKT A;  4RUU A;  1OPA A;  5AJB A;  3HWG A;  2FKJ A;  3RBY A;  2AL0 X;  4HPC A;  4O4X A;  3RWX A;  1N0S A;  3S26 A;  4BX5 B;  1BRQ A;  2FRS A;  2IZI A;  5FQ6 E;  2BSZ A;  4OS8 A;  3BDR A;  1OBQ A;  4BX7 A;  2RTN B;  4QGW A;  3P6G A;  5H9N A;  1CJ5 A;  5LJE A;  1JBH A;  3FLL A;  2WQA E;  2YG2 A;  3BY0 A;  3GAQ A;  3WOV A;  2OL6 O;  1DC9 A;  2G79 A;  5FEN A;  4HFO A;  4WFV A;  2A2G A;  2L5P A;  3WYP A;  5HZ9 A;  3STM X;  4TNN A;  2WPU A;  5HWZ A;  4AZN A;  3WJD A;  3RDS A;  5B10 O;  4YFR A;  3WJE A;  3JQO A;  2C1S A;  2BHV A;  2RTD B;  2CBS A;  4GJV A;  3B2L A;  4OS0 A;  2HYS A;  4CPH A;  4MIR A;  4MVI A;  1SY1 A;  1ZNG A;  4Y0R A;  4ZJ0 A;  5F6Z A;  1NDJ A;  4YDA A;  1GT5 A;  3WVM A;  1URE A;  2WWP A;  3PQS A;  2F01 A;  2HZR A;  2I5Z O;  2RN4 A;  1UYO X;  4ORS A;  2RCQ A;  1SWU A;  1B0O A;  2FTB A;  4DNE A;  1Y53 X;  3EC5 A;  2LB6 A;  1OPB A;  1XCA A;  2OFA A;  3H3I A;  3NP1 A;  3HWF A;  2C4I A;  2MM3 A;  5EDB A;  3FA7 A;  4EQA C;  1EUO A;  1YWB A;  3SLT A;  1R0U A;  2RD7 C;  3VPJ E;  4O4S A;  1EXS A;  2F09 A;  1JJU A;  2Z4H A;  1BWY A;  1JYJ A;  4ZH6 A;  5LJH A;  4I3D A;  4O9S A;  1TW4 A;  1YWD A;  2CZU A;  4NNT A;  1FEM A;  3AUM O;  3VU1 A;  4ORU A;  1VPR A;  3DTQ A;  2QOS C;  5LJB A;  2AT6 X;  2X8S A;  1JIW I;  2G5L A;  1I06 A;  4ID2 A;  4CPF A;  3RSW A;  1MDC A;  5AEO A;  4KC7 A;  2OVD A;  1HN2 A;  1SLF B;  4IMO A;  1YIV A;  3MVF A;  3PQU A;  4TKH A;  1SWO A;  3VGW A;  3EW1 A;  3ZW1 B;  2JU8 A;  4GNY A;  2Y3F A;  1LCZ A;  4GUZ A;  2RTG B;  3L4R A;  2KT4 B;  3ELX A;  4CPE A;  2FHL A;  2JN3 A;  1ZNL A;  1VWQ B;  3VE2 A;  2MHD A;  3MX7 A;  4ZHG A;  4ZH9 A;  5CSE A;  4CDC A;  3SLO A;  3WJG A;  2G8C O;  2NNE A;  1SWN A;  2CAM A;  1BEB A;  4M6S A;  3VG4 A;  4Z28 A;  3KQ0 A;  4FGI B;  4N7D A;  5HZ6 A;  5HA1 A;  1QY1 A;  1SRG A;  4GDA A;  5FQ8 E;  3PEC A;  5B29 A;  3BU9 A;  3VHH A;  1GXA A;  2PY1 A;  1EPB A;  4GDZ A;  4DQ4 A;  4WFU A;  1SRE A;  1O1U A;  1LKE A;  1U0X A;  3WBG A;  5IO6 A;  3UEW A;  3K3L A;  4YDB A;  1VWE B;  1GGL A;  4LQZ A;  5D48 A;  1Y9T A;  4WHI A;  1PBO A;  5IRA A;  1DF8 A;  1MUP A;  1AEL A;  2HMB A;  4ZHH A;  1JMZ A;  2BT9 A;  2NNQ A;  1KQX A;  1IJ8 A;  1VWO B;  2OVS A;  1LIB A;  1G85 A;  4ORR A;  4ORY A;  3HTY A;  4KII A;  4YBU A;  1QWD A;  1LIC A;  2RTB B;  5HZ5 A;  1WUB A;  1SXX A;  1GT1 A;  1X8N A;  4U9C A;  1DZJ A;  2DM5 A;  3RZY A;  1B56 A;  1VYG A;  4A1H A;  4QRL A;  2AT0 X;  3FR5 A;  4O4O A;  4D6B A;  1ERX A;  4TKB A;  1OBP A;  1LCW A;  1SRH A;  2ACP X;  1I9H A;  1EPA A;  1E2T A;  1QFT A;  4Y5D A;  1YWA A;  1Z24 A;  2JU3 A;  1VWG B;  4AW8 A;  4Y0P A;  5BYP A;  5EZ2 A;  4XMH A;  3RDQ A;  4HPB A;  2AT5 X;  2RTH B;  4YFQ A;  3KFG A;  1JV4 A;  1O1V A;  1VYO A;  5H9K A;  2OVE A;  3S60 A;  1K3B A;  2BLG A;  3O2Y A;  1FEN A;  3BS2 A;  4TKJ A;  1I4U A;  2X46 A;  1ML7 A;  1N43 A;  2QO4 A;  5HA0 A;  4PJ2 A;  5HZQ A;  3FID A;  1QG5 A;  3CQR A;  3ZW2 A;  1XKI A;  2Y3E A;  1E5P A;  3EBW A;  3FYF A;  4YMY A;  3NX2 A;  3TGA A;  3P6H A;  1Y9L A;  1L6M A;  1LEL A;  3D97 A;  4LKP A;  1AVD A;  3T6F A;  2GTF X;  1A57 A;  1VWP B;  1JYD A;  2HZQ A;  2MF6 A;  1SXY A;  1E02 A;  1VWJ B;  1BBP A;  4LZU A;  4NLI A;  1VWF B;  3CR6 A;  3HPE A;  4NLJ A;  4CV7 A;  4QZU A;  1CBS A;  1NC9 A;  1IW2 A;  3TGC A;  3ELZ A;  1IKJ A;  3MBT A;  5FAZ A;  3STN A;  4Z6J A;  4ZGU A;  3LHN A;  5HCC C;  1NP1 A;  1SMP I;  2AH7 X;  1STR B;  2VFB A;  2WUT A;  2L67 A;  4I9R A;  1DFV A;  1ICM A;  1JMX A;  5F7G A;  1I78 A;  1NQN A;  2ZAI A;  2AF5 A;  4XMC A;  1PTS A;  4BOE A;  1RST B;  2FGS A;  2X56 A;  4Z27 A;  1KXO A;  4NP1 A;  3C78 X;  4EKV A;  1B4M A;  2CBR A;  2NND A;  1QAB E;  3AKM A;  4PSQ A;  4AZM A;  5C0N A;  5K06 A;  3LV4 A;  4ZR2 A;  3MM0 A;  2X45 A;  3FEL A;  5D4A A;  1IKE A;  1S2P A;  2OY5 O;  3WZQ A;  2LA7 A;  5LJK A;  5F6B A;  5AJC A;  4AZO A;  3P24 A;  5JR8 A;  5HZ8 A;  4EXZ A;  1SXW A;  2FR2 A;  3NX1 A;  1DZK A;  3PP6 A;  3PK2 A;  2OVA A;  3AEH A; 
#chains in the Genus database with same CATH homology
 2RTJ A;  3WYQ A;  4Z2O A;  1SLF B;  2IZH B;  3VGW A;  3RDM A;  5IRW A;  1RXH A;  1SWO A;  2IZB A;  2IZG B;  2RTL A;  1HQQ A;  2RTQ B;  3EW1 A;  3WZP A;  4BCS A;  1SWE A;  1HXL A;  1VWA B;  1LCZ A;  2Y3F A;  1SWS A;  3MG5 A;  4BX5 A;  1SLG B;  2RTG B;  4Z2P A;  2RTA A;  4CPE A;  4I60 A;  2FHL A;  1SWA A;  1VWQ B;  5CSE A;  4U46 A;  1SWD A;  4BX6 B;  1SWF A;  3RY1 A;  1SWN A;  2CAM A;  4Z28 A;  1HY2 A;  3FDC A;  1RAV A;  1NQM A;  5L3Y A;  1VWH B;  1AVE A;  2IZE B;  1SRG A;  2OFB A;  2Y32 A;  4GDA A;  1N9Y A;  1KFF A;  3VHH A;  3WZO A;  1VWB B;  1RSU B;  2FHN X;  1SRE A;  1HXZ A;  1NBX A;  1N4J A;  2OF8 A;  4YVB A;  2IZK A;  1MEP A;  4BX7 B;  1VWE B;  5B5G A;  5IRU A;  5IRA A;  2A8G A;  1DF8 A;  5CHK A;  1SWB A;  3T6L A;  3SZI A;  1Y55 X;  4BBO A;  1IJ8 A;  5F2B A;  1VWO B;  3RE5 A;  1VWI B;  1SRJ A;  3EW2 A;  3SZJ A;  1N9M A;  1WBI A;  2RTB B;  3RDU A;  3VHI A;  1MK5 A;  3RY2 A;  1SLE B;  1STP A;  1SWG A;  2A5B A;  1KL5 A;  2IZL B;  1STS B;  2RTF B;  1Y52 X;  4CPH B;  4OKA A;  3PK2 A;  2BC3 A;  4GGR A;  1RXK A;  1LCW A;  2IZC B;  2JGS A;  1SRH A;  2UZ2 A;  1I9H A;  3WZN A;  1SWR A;  2IZD B;  1SWP A;  4Y5D A;  1VWG B;  2IZJ A;  4BX5 B;  3RDQ A;  3T2W A;  2IZI A;  2AVI A;  3X00 A;  2RTH B;  4BX7 A;  2OF9 A;  2RTN B;  1VYO A;  4IRW A;  1SRI A;  4JNJ A;  4BJ8 A;  2IZA A;  1LDO A;  1SWJ A;  1N7Y A;  1N43 A;  2RTE B;  4GD9 A;  4JO6 A;  1SWC A;  2Y3E A;  3WYP A;  4CPI A;  1LUQ A;  2RTR B;  2C1Q A;  2WPU A;  1LEL A;  4BX6 A;  1KL4 A;  1AVD A;  3RDO A;  3RDS A;  3RE6 A;  3T6F A;  1VWP B;  2RTK A;  1MM9 A;  5K67 A;  2MF6 A;  1SRF A;  2C1S A;  2GH7 A;  4GGZ A;  1VWJ B;  2RTD B;  1VWM B;  4GJV A;  1VWL B;  1VWF B;  2IZF B;  4CPH A;  2RTO B;  1NC9 A;  3SZH A;  1VWR B;  1SWT A;  5JD2 A;  4Z6J A;  2UYW A;  1NDJ A;  1KL3 A;  1STR B;  2F01 A;  5K68 A;  1SWH A;  1SLD B;  2RTC B;  3T2X A;  1LDQ A;  1NQN A;  1RXJ A;  1SWK A;  1SWU A;  4DNE A;  1Y53 X;  1PTS A;  4GJS A;  5B5F A;  1RST B;  2OFA A;  4Z27 A;  2C4I A;  1SWL A;  1SWQ A;  4Z2V A;  1VWD B;  4EKV A;  1VWK B;  1VWC B;  2RTM A;  2RTP B;  1MOY A;  3MM0 A;  4Y59 A;  2ZSC A;  2A5C A;  3WZQ A;  2RTI B;  4GGT A;  3VHM A;  1LCV A;  2G5L A;  1VWN B;  4CPF A;  4JHQ A;  2QCB A;  3RDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...