1KLFB

Fimh adhesin-fimc chaperone complex with d-mannose
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
279
structure length
279
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHAPERONE PROTEIN FIMC
publication title Structural basis of tropism of Escherichia coli to the bladder during urinary tract infection.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/adhesin complex
total genus 51
structure length 279
sequence length 279
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature
pdb deposition date 2001-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00419 Fimbrial Fimbrial protein
B PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 1klfB01
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 1klfB02
4X5RA 3RFZA 5FLUA 4CSSA 4XOBA 4XOCA 3JWNE 4XODA 1KIUB 4AV0A 5AALA 1QUNB 4AUJA 5FS5A 4CA4A 4AVHA 3JWNG 2WMPB 4XOAA 2J2ZB 3ZL2A 4J3OF 1TR7A 4J3OG 1UWFA 5LNEA 5CGBA 3ZPDA 5IQOA 4AUYA 4AV5A 4XO9A 4XOEA 3BFQG 4X5QA 4AV4A 4AVKA 5LNGA 5FX3A 3JWNH 2XG5B 1ZE3H 4X50A 4BUQA 4J3OH 3BWUF 3ME0B 2UY6B 2JTYA 5AB1A 1N0LB 2XG4B 4X5PA 1KLFB 3SQBB 4AVJA 4XO8A 5IQNA 2JMRA 5AAPA 1PDKB 5F2FA 5ABZA 5IQMA 4CSTA 2VCOA 1N12A 5JQIB 4LOVA 5F3FA 2W07B 3MCYA 5FWRA 4AUUA 4ATTA 4AVIA 2UY7B 3BFWA 3ZL1A
chains in the Genus database with same CATH superfamily
4ELME 1WFOA 1HEZA 4M6NH 4Y2LA 1KJ2H 4XP6H 5D1XE 5JPMB 2HT2D 3MOQA 2H6UA 4U3SA 3QDMA 1A7OL 3CZFA 4PJ7A 1IGIL 3EYQC 4F8TA 1CLOL 1DO6A 2X44D 5A2FA 4EDWL 3MNDA 4JCWA 3MRCA 1UACL 2G2RB 4OGAC 3G04B 3BRFA 3U2IA 2HLAA 1CGVA 2AVGA 2H2PC 2X6MA 3QJFB 4JRYB 3CE1A 4NNPL 5GS0L 3KNBB 2XIIA 5HXMA 3CVDA 1V05A 4UBDC 3QIBC 1IKOP 4B9IA 2AFNA 4JFEE 2BWQA 3PP4L 4FNUA 3SDCB 4Z7NB 2CCLA 4OQTA 5BS0B 2NYYC 3KBPA 5EBLB 1D5IH 2ZIDA 2P3YA 3MREB 5D7JA 4M03A 3Q3GB 4ZI8A 5KSAB 1J5IA 4PTTA 2R2EB 5LUMA 2EKSA 3UTSE 1G7QB 4M61B 4ACTA 3F12B 2ADYA 4MHHG 1UB6A 2CRMA 2ODIA 1Y1UA 2F6AA 2J1ZA 2UXFA 2Y69B 3POHA 3LS4L 4PJ8C 5IFHL 2XXFA 3EH5B 4TLTA 5D5MA 4PJXF 1H0DA 1WF5A 5J1AA 4YBQD 1LDSA 1WC7B 2HVKA 2NT0A 1NGYB 2QSQA 1GKOA 4E9XA 1BF5A 2ZUXA 2ZUQC 3HNVL 3A5VA 5FO9B 4MTMA 4HA1A 1J86A 1MLBB 2LU7A 4P9HL 4ZUWA 2WP3O 4QCIB 1HESA 4XN9A 4K3JL 2ROYA 3BT2L 2VLKD 4G8GA 3HPJA 5DHXB 2DYPA 2VE6B 4S1QH 1GXEA 2ZOLB 3D18A 3RWDA 4W4OA 3T0BA 1MCRA 1DJWA 1MEXH 1F58H 1RUKL 1T66D 1JHKH 1S4IA 4LBEA 4WWKB 3WFCH 5LWYL 3X1BA 1OP4A 2R0WH 3DMMD 1W9XA 4MLIA 4Y89A 3QNFA 5B1CA 1NUNB 2WQ8A 1BAGA 4X4KA 4H0LC 3QUYA 1JPEA 3BUQA 4BH8A 3CFBA 3QNZA 1HEZB 5FYKE 4F92B 2R9HC 3P2BA 3CJJA 4H2CA 4Q4EA 3QDMB 3CZFB 4PJ7B 3T8VA 1BM3H 4Z7NF 4PIBA 2ED9A 2YKLL 5EOCJ 5JQIB 3MRCB 3R4DA 3DX2A 1HHKA 3CFKA 3AWFA 4LCIH 3WFBL 2HLAB 4ADIA 2CJ3A 5AENA 5AL0A 2BCKB 1ACCA 2ZXGA 5FWQA 3IJ8A 5AW9B 5JOPE 3FQWA 1G9HA 3QAQA 3BH8A 5IMOA 2WZPA 3H42L 5D7JB 1VZIA 1ZA3A 2I69A 1C1EL 3APCA 4XMWA 1SLWA 2EKSB 2WZ5A 4N0FA 1GJWA 1OTUD 1PMYA 4YQXH 3IS0X 5AOLA 1SRDA 4W9DC 3ROOA 3ZW3A 5HTSA 4P04A 5AOKA 3T6VA 1WA2X 3LZOA 1RMFL 5IFAL 1RJYA 1W16A 4H40A 4UOJA 1H0DB 4QAWA 5J1AB 2E7CA 4P4KA 5SWSD 3I50L 2JE8A 1YEIL 2AJZA 4WW2A 5SX4H 3C5XA 4QT5A 4HH9A 2YZ1A 3F7LA 3TLRA 4Y4KC 5IK3A 3X3GL 3EYUL 2GBAA 3PRZA 4ZTOH 3DX3A 3C5ZA 2YBRA 1FCCA 5CLYA 4R7DA 2AEIT 2Y22A 3OJMB 4ZUWB 1KCWA 3MKKA 5DMGD 5I71C 2JI2A 1UGNA 1WWBX 1P4BH 3T08A 3DROA 3HPJB 3QHFL 4G8GB 4PJ7F 2DYPB 3KYKH 3WJJA 3D18B 3V2AR 4BFEA 1MZZA 4NQCD 5KOMC 3RWCA 3NK3A 4N2LA 4YJZL 3N1FC 4H13C 4LBEB 3CZSA 2MNWA 2O93L 3VTMA 3WTTA 2F8XC 2KERA 2NY2B 2X7LA 5C0DA 4LCWA 2WIIA 3QUYB 4XMUA 2NSQA 4BH8B 3D9AH 3CFBB 3QNZB 1YCSA 4KTDL 2IAND 4IM8A 5L8LB 1JGLL 4BZ2L 3SQRA 3MLYL 3VGBA 1M7UA 3L2LA 2A4CA 4XCFH 1LHZA 4GRLD 2FX8L 1YEWA 3M86A 5GSVA 1F56A 3UMTA 1I7RA 4OFYA 1HHKB 3CFKB 4HGWA 1CD0A 1U0QA 4GNKB 4D9QD 3SDDC 1A4KA 4QYOA 5JYLA 3RB5A 1MVUA 2H1PH 2Q8BH 5C0CD 3L3OA 4JHWL 4KUCF 2XKNB 4KXBA 3U30C 2Y1VA 2F7IA 1QRKA 3AQXA 1GPOH 3K6DA 4IRZA 1VF5C 2CCWA 3FQWB 3U48A 5KBNC 2V33A 3BUBA 4J3BA 4TQEL 3BH8B 4Y7MA 5IMOB 1WBZA 4HIJA 4DEPB 2D31A 1ZA3B 1NJ9A 2VR9A 3VXSA 3MMEB 3N1QC 4TTDD 4N0FB 4ICWA 3S36X 1EGJA 2FEDC 3I3DA 4RIRA 3ROOB 2OMNA 1XGQA 4P2RD 3S37X 3GDBA 5CD5D 5EH1A 2VMJA 2G3XA 4NS0A 4KHXH 1RJYB 1PW3A 1RZKH 2FWSA 1UG9A 4F2ME 2R23A 2CA3A 4Z7OE 2JSFA 4P4KB 3GPSA 4DKFH 4PRHE 3ZO9A 2DF3A 4HOXA 4J7RA 1UH2A 2AJZB 4XC3L 1R5WA 4QT5B 2ADFH 4YDVA 4HH9B 5I73C 5IJCC 5ERWA 5IK3B 3FUMA 3C5ZB 1OSPL 3VH8G 2YBRB 3DECA 3VG0H 4EIGB 1M9WA 4R7DB 3ARBB 4KKRA 4XP6L 2WLIA 1MCNA 3IFPA 2VMCA 4DN4H 1DE4A 3DROB 5KZCD 3S3DB 1S7VA 3RWCB 3K4ZA 3PGDA 5KS9E 5D72L 3E7JA 1KCUL 2XTJD 4L2LA 3T4AC 4YSDA 2X7LB 1KB9J 5C0DB 2WIIB 5CJ5A 1FAKT 2M2DA 3MGTA 5I5IA 5I1HH 5EORH 3NT0A 2F5AH 1IBGH 1YQVH 2FJSA 3TA4D 2J5LC 3OWRA 4ACPA 4R5TA 1XF5A 1DBKL 4Y1SA 2CHXA 5GSVB 4EI5A 1JS4A 2YD4A 4HSCX 4BQ8A 1I7RB 4HGWB 3FB7A 5AKTA 4EZKA 2IMMA 1A4KB 4QYOB 4Y5XA 1MVUB 2ITDA 1AKJD 1ASPA 4KI1A 1I9IH 3HJ0A 4ONHA 2KMWA 1ZHKA 2DQHH 4L4VD 5T3ZD 4DGWC 1B0GA 1X5ZA 1DJGA 2XTJC 4YEEA 2W59A 1WBZB 4HIJB 2D31B 3EBHA 4Y88A 1AZUA 1JD9A 1NJ9B 3CLEH 3VXSB 2IAAC 2WBKA 3HBZA 4KBPA 5DS8A 1NL0H 4OJEH 4RIRB 1XGQB 5LJYH 1T1WA 5AB0A 4IU2A 4HLEA 4N0RA 3RBGA 3BAWA 3AS0A 3KPSE 1W8OA 4FQHA 1JPGA 5CLTA 3VFOA 2W94A 1I31A 1MFEH 4XRCA 4OM1L 1W8EA 1CLZH 1PZ3A 2R23B 4S1QL 3CZNA 1MEXL 1YO4A 1DBJH 1KUMA 1ULVA 1R5WB 2GSGA 4YDVB 2R0WL 2Z6FA 5GJSL 3QVAA 5E9AA 1PKQA 4D9LH 4F37K 1EDQA 2X09A 5MP6L 2J56A 3IGAA 5IVZA 2BNQD 4N5ED 2CZNA 2WLIB 3GS7A 3IFPB 2WD0A 5GS2D 1Y6KR 5DJCB 3P9WB 4W9CC 1KB9K 1KDJA 4DQAA 5KVFE 1KBWA 2A9ML 1S7VB 3T1FA 3PGDB 4YVNA 3H9SA 4PRIE 4OI8A 4MMXA 1EJFA 4DVBA 2J1YA 4LCIL 3D25A 2D3NA 3FFCA 4AUUA 3LKPA 3MGTB 4C4KT 4DPRA 1QKZH 3MRFA 3UO1H 3CH8A 3ARSA 5FDYA 4AW4A 3NEOA 4TMPA 4XZ4A 4K4KA 4EI5B 2A6IA 3CXFA 4A7VA 3DX7A 3ULSA 1ZTXE 4MNQE 3RVUD 4YQXL 3WUWA 4Y5XB 2YAQA 3X1GA 5LDSA 2ITDB 3ETSA 5I75C 5BW7C 2CUIA 3NIDE 3I84A 4K73A 4ONHB 1WAAF 1X7QA 1LQSR 2CWRA 1ZHKB 2I7SA 3IU4H 3QFJE 4WUUA 2X4SA 1B0GB 1VZHA 4NOFA 1T04A 5DCCA 4CKQA 4R97B 1KBKA 3FQYA 2GBTA 2DKSA 5DS8B 2YQ3A 1AJ7L 1U93A 1T1WB 1MH5B 4L4TA 5F1SA 5KBDA 4OLEA 1LEIA 3L5WA 1Z9OA 4FQHB 3E3QC 3VFOB 4K7FA 1JPGB 4J3OC 1QHOA 4XRCB 4PWFA 2RR3A 3L4TA 3KYKL 1ZLEA 1U58A 4LO9A 4WI3A 1KENH 2GSGB 4GG8B 3ZHNA 3KXFB 1PZ5A 2IALA 1FF5A 1CQKA 1TF4A 1UVQA 1FV1A 2EE2A 3MGOB 5H37G 1WD9A 3IGAB 3D9AL 5IVZB 1ZA6A 5KVGH 2BWDA 5LN8A 2XYBA 2DDQL 4G5AA 4L5FH 1VFBB 5L2KD 1I9EA 1NGWA 3IWVA 3MUJA 4QOKD 2JTDA 3T1FB 7PCYA 4HF5H 3H9SB 3GK8H 4MMXB 3WNLA 5EZJA 4GPVA 4DVBB 4EBQH 4BFIA 5CU5A 3D25B 3FFCB 4C58B 3LKPB 3ULVE 2Q8BL 1FZJA 3MRFB 2COVD 3K72A 5IJBC 2R0LH 1RP8A 4Y0GA 2EE3A 1WWWX 2QL1A 1BZ7A 3CTTA 4M5SA 2VSKB 5T1KA 4M00A 4J12A 2A6IB 3ZZLA 1TJHH 2ZYHA 3DX7B 3ULSB 4LDCA 1B4RA 3WUWB 1MQKH 5TFSH 1HZKA 4WO4A 1G0XA 2WNXA 4FC3E 2WNWA 5C9JB 1X7QB 4WUUB 3SKNA 2IH3B 3GRWH 2X4SB 3P9MB 3J2PA 3L2NA 3EDKA 3R06A 4KHXL 1RZKL 1WFMA 1N4XH 2H1LM 4M7LL 3ZTNH 5KW9H 1T04B 3KE0A 2GTZA 3BZDA 2E56A 1A6UH 4DKFL 2DMBA 2PR9A 2ADFL 4NAQA 5DRXA 1TMQA 3RVWC 1OL0A 2EXSA 4ONFH 4W6XB 4L4TB 5LLIC 3HMXA 5TDNA 4KZEL 3V0JA 4YBHA 3VG0L 1ORQA 1CLCA 3NA9L 4JGJA 5I1DA 1LEIB 3L5WB 5ALBH 5IMLA 3TONA 4K7FB 4DN4L 3PHAA 4HULB 5I1CH 3QDHA 3PJNA 1YEJH 4FQJH 5B7EA 9PCYA 2IOMA 1U58B 3UPAA 2G75B 4IIZA 4LRNL 1JV5A 1PZ5B 2IALB 1P1ZA 4RBPH 3V6OE 1S7TA 1UVQB 4CSPA 1FV1B 4JQIA 1L0PA 1ZA6B 2QFPA 3DURA 4GLRH 4HP5A 2F5AL 3LIUA 1IBGL 3QPKA 1NGWB 1TSHA 4G7RB 4KKLC 2IBZY 4G80A 1GY2A 1JZGA 3HG1E 5KYWA 2N7AA 1TITA 5E95B 2WQVA 5EZJB 3NJHA 4LKCA 3NCFB 3CHSA 1XCXA 1RJCA 3TN0D 3DYOA 4BFIB 4P3CL 5F6IB 3MN8A 1XR8B 1FZJB 4JG0H 4NYLA 4P2AA 2YD0A 1I9IL 1JPFA 3K72B 2OFQA 1OOAA 1AZVA 2EDLA 1DLHA 1BZ7B 5D6DC 2CKBL 5T1KB 2DLIA 4WHTA 5TF1H 1KJVA 1DQMH 3CLEL 2Q8AH 3EJYD 5BVJA 3DLQR 1HSBA 1Z3RA 4L1LA 4BFGA 5J6HA 5CZXC 4HIXH 1NPJA 3AAZA 3AU1A 2IF7A 4WO4B 2J7LA 2X2JA 4BD4A 4C4BA 3SKNB 2ZE0A 2N1KA 3GS4A 1GSMA 3QNYA 5ESAA 3R06B 4AMXA 3FSVA 1MFEL 3QFDA 1CLZL 2JCCE 2XOTA 2MRYA 2GTZB 5E8NA 1UYWL 1H5BC 4MJIE 1F90H 3VRLE 4O00A 5DS2A 4B53A 5DRXB 4L0ZA 2VDOB 3O6LH 5FM5O 2ZXDA 3A21A 1XGYH 2GK0A 2X4OA 5TDNB 4CBZA 4M9PA 4W1TA 3K6IA 1ORQB 2C9AA 2E4FA 3QEQE 5HI5C 3NIGE 4K23H 5I1DB 4Y2OA 3HZYA 3WO3B 2CR0A 1JWSA 5F7BA 2F74B 1E5YA 5K33A 5SWQA 2ERJB 4O2CA 3RGHA 4AITA 4JZOA 2Q7NA 4YEFA 1FO0L 2K6WA 4NFCA 2AQ1A 1JV5B 1WIPA 3BWAA 5TF0A 3SYOA 1P1ZB 4IIQC 1S7TB 5E1GA 4YSAA 1ZEAH 1TNMA 2N1TE 3DI2B 3WUZA 4KJPC 4R2GB 3I75A 2A77H 3DURB 1E2VA 1QKZL 1X5KA 1ZS8A 2W81C 3BFWA 3GD1C 3NZ8A 4MBOA 5D1XC 5C0BD 3U4BL 4BA8A 2P8LA 3ARWA 3BN3B 1YQ2A 2K7QA 1XGTA 1E7VA 2VYRE 3WY3A 3LQAL 5KYWB 3UZQA 2J21A 4LKCB 1FBIH 4XX1G 1CD9B 1A4JA 2WNKA 5GRZA 4FKKA 2Q10A 3MBXH 4YDLB 1L9PA 4PLNC 1KJ2A 2ZXAA 1EO5A 1JPFB 1I1FA 1XT5A 1M9SA 3IU4L 2ARJQ 2ZXCA 1DLHB 1BWMA 3LDBB 2WCPA 4PHZA 1XIWD 2AJ3A 4WHTB 4PRAA 1K6QH 1KJVB 5A2CA 2M1KA 3FCSA 5BVJB 3QEUA 5D2NE 1HSBB 4JM2A 5J6HB 3AAZB 3AU1B 5JIMA 2RGSA 2NY0C 2ZWZA 5FYLL 3TWYA 4GXUN 4ZG1A 2RJMA 4NRYA 1JNNH 4EKXA 4G5ZL 1G9MC 2ENPA 3DIVA 2X53A 4GRWH 4Z7WA 4WI4A 3QNYB 2B9AA 3QQDA 5ESAB 3KW7A 1AMYA 2MSPA 3EGSA 5L8JB 1S7UA 1XV8A 3QFDB 3RDTA 3GTTA 1JIBA 5F6HJ 4R4NC 5E8NB 4OSUH 1KENL 4NUMA 2VMFA 1M1XA 2AABH 3W82A 4R4BA 5B39G 3BZEA 1DEEA 1G6RL 3U36A 3FCGA 2GK0B 4LRIA 2YBGA 5E1AA 5MI0B 3MLXH 5E9DD 3RIAF 1E3XA 4Y2OB 5KVGL 3SOBL 3HZYB 5B8CA 2WCGA 4I0PC 3MDJA 4L5FL 4NZ8A 4ENEC 1JWSB 4BFJA 3HAEA 1QI3A 5SWQB 4O2CB 4PJXE 3KPRD 4NO5A 3F04A 5TQ2L 4HF5L 5FDWA 3EJPA 3GK8L 3WAJA 2XN2A 3BWAB 2O26U 4JREC 2FIKA 1EAOA 4XCCH 4EBQL 1NICA 1MCKA 1DL7H 3I75B 1Q94A 3V0HA 1NM9A 4L05A 3OSKA 2KYIA 1UWEH 3GLAA 3NZ8B 1VESA 5K39B 4LNRA 4JCMA 2P8LB 1U3YA 2R0LL 4BFKA 4FRWA 3TBSA 1UXWA 2IPTH 1SMOA 2F19L 1XGTB 2WTRB 3UZQB 3BDBA 1DJZA 1X5HA 1TJHL 3QARA 1A4JB 1XSKA 5CBEA 4JFOA 2AEWA 3IGUA 1ZT1A 1GYWA 2XG5A 3HCVA 1MQKL 1KYFA 4JRYE 4KVNH 3GXDA 5I15L 5E00A 3WFHA 1A65A 4XE0A 1KJ2B 1I1FB 1LD9A 1A9BA 3CHPA 3GRWL 1K8IA 1OLZA 1K3IA 3CSYA 3ZDXB 3B43A 2HKFH 3X11A 3ZTNL 2ZYIA 2AJ3B 2P44B 5GRVL 4Z7NE 5J12B 5BS0E 5KW9L 4TUJA 2YGOA 3FCSB 3NUKA 1A6UL 2LU4A 3QEUB 4MXWH 5I1LA 1KPVB 4JM2B 2FK9A 3PWUB 4KKBD 4OUOA 3AXLA 2W0PA 2XRAH 5L8KB 4MMZA 1FFOA 3S97C 12E8H 1AKPA 4GXVL 4NRYB 2X4PA 3GSUA 4Z7WB 1CU4H 4NN7C 4OB5H 3QQDB 2GJJA 3H0TA 5ALBL 4W9LC 3EGSB 3WY4A 1S7UB 4HEPG 1D2OA 3RDTB 5I1CL 1N5YL 5K9QI 1YEJL 4FQJL 4KZ0A 2VJ0A 2VAJA 5TE4H 3QORC 4U6HA 1M1XB 3RGVC 1E27A 4LLWA 4R4BB 3BZEB 4C54A 4KK8C 1DEEB 4FDWA 3U36B 1HS6A 2FGWH 3RUGB 2CK0H 4N0UA 1KB5H 4QHMA 3HS0A 5E1AB 5SV4A 35C8H 4UNIA 3VFWA 5I0WA 1SVCP 3Q2LA 2F58L 2C9VA 5B8CB 4Y19D 2AK4E 4BKLA 4KKBC 1NFIA 3A3YB 4NO5B 4E42B 2WXGA 5FDWB 5C7ZA 4GAJH 1B2WL 2EVGA 2YD2A 1A9VA 4K5PA 4XO5A 2FIKB 1XEUA 4BSVA 1VEMA 2NUTA 5I0ZA 3OQ3B 3BCFA 4UIMA 1Q94B 3VM5A 1DN2A 4ISVA 3MJWA 2WZAA 4PGEA 3WS3A 4MXQC 2KS0A 2ALWA 3P73A 4LNRB 2I25N 3ZDXF 3FUHA 2BOBA 1UXWB 4OGQC 3TBSB 4PJ7E 4ANXA 5FFLA 3DBXA 4N2BA 4XC1L 3VXOB 2YAPA 2YMXH 1A0QH 1DVSA 3TEUA 4CN1A 1GCYA 4BIKA 4JM2F 2Q8AL 5FCUH 5CBEB 4JFOB 3ATEA 5E8PA 1AG6A 1UHVA 2XG5B 1DTUA 4FCHA 4EI6A 3RTLA 3QWOA 1TENA 2NX5D 5E00B 2Q87A 3WFHB 4Z7WF 4ZX6A 3V0EA 3WSQH 1LD9B 1A9BB 4KRNA 2JCWA 1K8IB 1HAWA 4XNXH 3CSYB 4F7KA 1O7DE 1IQWH 3DI3B 3X11B 1NZRA 2H0FA 2KT6A 3FO9A 4XMLH 1JZIA 3L4XA 3OHXA 4PGCA 4TUJB 4JO3L 3UERA 2ZNXA 3S0PA 1F90L 3C87A 3UIYA 3AXLB 2QVFB 4MMZB 2FX7H 4MCMA 3T09A 4H0IA 4E0RB 3RUGF 2X4PB 3GSUB 1XGYL 2IDCA 5IQ9A 1NKGA 1UJ3A 5FAAA 4HMEA 5JQ6H 1HIML 3H0TB 1SN2A 4Q6KA 4KTEL 3BGFC 4Y8DC 43C9A 4BSWA 3W56A 4EI0A 5J11B 2AEQH 4U6HB 3D51A 4KI5C 1E27B 4FG2A 4LLWB 4NAJA 1ZEAL 1JZ2A 4N0UB 3HC2A 3HS0B 2A77L 4QHMB 1FI8C 1LO2H 1H6EA 1MCWW 4GQZA 2CO6A 1IEBB 1Y0LA 5EUOA 3TBTA 2HMID 2C4FU 1KEGL 2VW6A 5IROD 3ILDA 4G8GE 1NFIB 4XPBL 2Y7OA 5DGRA 4OQ1A 4YHZH 3GSWA 1FVDA 4K3GA 4BSVB 3WAKA 2NUTB 2G30A 4UIMB 3IMRA 3MBXL 2WAQA 2G3NA 2WLZA 4ISVB 1ZV2A 4PJBB 4PGEB 1AR2A 3NCYS 3WS3B 3P73B 1A6PA 3M88A 2BOBB 1OZTG 2J8UA 5DTFB 3DBXB 5JPNA 3WENA 4NZRH 2XBTA 4N8CH 3QJUB 1KT2B 1EFXD 1INQA 1NFDE 4CN4A 5BUAA 5E8PB 1SFDA 3ZYZA 4EI6B 4XMKL 3QWOB 1JNNL 3QFGA 2PW2A 4Q97A 5ADPH 3VSQA 1NMCB 1SLXA 3INUH 4QGTA 2WQRA 3TCXA 1F3DJ 3FO9B 4GFXA 1UXLA 3OHXB 4K71C 4PGCB 4ODTH 5I82A 5BV7C 4BWWA 4TN9A 2DIBA 1V7MH 1JOIA 4M6MH 4OSUL 4LZKA 2QGCA 1PGRB 2J1XA 3VJ6A 5GRUL 3KLAA 1TTUA 2DY2A 2J20A 5IQ9B 3LNEA 1UJ3B 4G8IA 3DARA 2J4WH 1E42A 4UT9H 3MLXL 4YHMH 3S4SA 3L4YA 4JO5A 2O6CA 4ODXA 5J8OA 2DAVA 5FR3A 3UDWC 2P49B 2PWHA 3RWHB 1G43A 43C9B 4PRBA 2CPCA 1RY7B 2D03H 1F4XH 2VLRA 2JKSA 4GOSA 4BSWB 2EVHA 1NCHA 4JFZH 5KYYA 6TAAA 1GYUA 2GEEA 4XCCL 1EZVX 1DL7L 2CRIA 3R19A 2Q2LA 5EUOB 4PJBF 2CO6B 1Y0LB 3TBTB 1UWEL 3BSGA 2IPTL 4XVUD 2FIRT 3CU7A 2VRAA 2E5EA 3V0GA 3GSWB 1FVDB 2A3TA 2BRQA 2X6UA 3BW9A 5DC4B 5HJBA 5J4MA 3CDGA 5EC2B 3K6SA 1CB4A 1QWHA 4IRSA 4KVNL 5D2LB 1AO7A 4JO2H 4ZXBA 3P77A 1QI4A 3IJHA 3P54A 4L48A 4N1CA 2GPZA 1N5AA 5JPNB 2HKFL 4UQIM 2R56H 5C2BH 4MJ5A 4HJIA 4HS8L 1INQB 1WHPA 1QYGH 2CJSA 2XRAL 5D1ZA 1IAIH 12E8L 1K5WA 5DR5H 4PI2A 2PW2B 3NCBB 4G7SB 1CU4L 4G8FA 5C0FB 3EIFA 1BIIA 1X5GA 3TBYA 5HVHB 1CFQA 3GHEH 1KTJA 4LARH 1J8HD 3SBWA 1AH1A 4WQOA 1PNCA 2WVVA 1X4ZA 5TE4L 1PQZB 2P48B 2Y2WA 2ZKMX 2F53A 2IOIA 3OD3A 3KLAB 4LHUD 1A7PL 5BUGA 1X5IA 1ZWIB 1XGPA 2FGWL 4JRXA 4G8IB 1SXZA 1OTTD 5EUOF 1B4LA 35C8L 4EN3D 3S4SB 2I27N 1WAAE 3BUTA 5BRQA 4ODXB 2VXUH 5DS1A 1DBMH 3IMVA 1BD2A 1MCBA 1PG7H 1WAEA 1CI5A 2VLRB 3L3DA 4MZRA 2OXHB 3VGHA 5KYYB 1INEH 4AIOA 2YEVB 1IM3A 2QDWA 3CZLA 4GBXB 3VXUD 3FU0A 3TA3A 4AYID 5CLWA 4IKIA 1MNNA 1NDTA 5DK3A 1JNLH 3MV01 3QQXA 4GUPA 5D2LF 1FL6A 3RHWF 5DI8B 3CFQA 4XPAH 4HS3A 2HKHH 5IT2H 3MLVL 1QABA 3LNDA 4MJ2A 2O5ZL 3T0ED 3BW9B 5TTRA 2HG0A 2VC2L 4MXVF 3CDGB 5FCUL 3K6SB 1MFCH 4E9QA 1HWHB 3EXLA 4N90D 2RB8A 4IRSB 3ULVC 1GS7A 3T6QC 2ZCZA 3A4EA 1WK0A 1CF8H 5DA4A 4DPCX 1AO7B 4ZXBB 3P77B 3IJHB 3WSQL 2CJUH 4G72B 4WRLA 3TV3H 1KYUA 4HIEA 4XMLL 2W38A 4MJ5B 2OCJA 3O0RL 3OXRB 5LN4A 3S8GB 3R7RA 4P5TC 5D1ZB 5DA0B 2FX7L 5D9SA 4OUUB 1IAIM 2JFCA 4AT6A 4AENA 2BOLA 1MELA 1MREH 4G8FB 4PWIA 5FA4A 2X3BA 1NTDA 3TBYB 3W2DH 1CFQB 1BEXA 1UFGA 3JTBA 4AQZA 2WVVB 3KGTA 3HE7A 2AEQL 2F53B 5TD4A 4J3SA 1UM6H 1CZ8H 3CXHJ 4MB3A 1RZPA 3WN5A 1GAFH 1XGPB 1HXMA 4JRXB 5GRJH 1MQ8A 4PR5B 4YPGA 2P52A 4U2ZA 3R4RA 5H37H 3TVMC 4DEWA 1N19A 5PCYA 1X6LA 1ITCA 1BD2B 4HEME 2GFBA 3L3DB 4WSJA 3T2LA 1L4IA 1QFPA 4M93B 1I1AA 2QTVA 1KACB 3BLKA 5E6IC 4N2GA 5CM1A 1IM3B 2QQNL 4IU3A 3KXFE 3KLHC 1C8PA 1LJMA 1L9SA 3TA3B 3R7QA 3U1SL 1SF3A 4YBLC 4GUPB 3WTWA 1FL6B 1WYJA 3GMMA 4JG1H 2BERA 2BP5M 2NY1C 3IAGC 3ZKXC 2G2PA 1G84A 3EHBC 4HS3B 3MLSH 2XZAH 4K3EL 4XGZA 1HZLA 2C1OA 1AHWC 2Y1ZA 2JKLA 1URIA 3H9SE 2Y5QA 1QP1A 4NZRL 4AM0A 1AS6A 3LVEA 5I0VA 1GJUA 3CFJA 3IEAA 3QIWC 2XACC 1JPTH 3FFCE 5E51A 1JGDA 5D6CA 3S34H 3O6FA 1TZ8A 5ADPL 3LEXA 1UOKA 3INUL 1YMHB 3ALXA 2MQCA 3HLAA 1Z0NA 3ESMA 3WHE1 4HIEB 2ZUWA 2XC8A 3E2HB 3PAYA 3ZX1A 2DOCA 4ODTL 2K4WA 5GS1B 3Q8CA 3N42B 1V7ML 4M6ML 5BVPL 1I1RA 1ZVHA 3BMVA 3JYBA 2CA4A 2VERN 2X9WA 3PPSA 4TLKA 4YSPA 5D9SB 4R96A 4NO3A 2X89A 4AENB 2AK1L 5FA4B 1OAUH 4YHML 3QC5X 4FEMA 4GQQA 3CXHK 3P4MA 4AH2A 3C6LA 5ACMA 3NJMA 1U8PB 4JKWA 1R9FA 3RZWA 3GSNA 4BKSC 5LCVH 3SDAD 3HE7B 4JFZL 4TNVF 2YOAA 1NCBH 1A1NA 3ISRA 4BCZA 3KL3A 3BAYA 4OCXH 3WN5B 1IKFH 1HXMB 3QIUD 4EXKA 1UATA 4L4TE 1HC1A 4C59B 4HCFA 4M7KH 4YPGB 2J12B 3AWEA 5CP3H 2XBZA 1BVKA 1AAJA 2GFBB 1EEYA 4FN0A 4NN6C 1I1AB 1P0SE 3HE6D 3LZPA 4FFVD 4OGYL 4IU3B 4PBVC 4RFOH 2BZDA 3NG5A 2F2HA 4M7ZB 4HWNA 3SGKA 5HSFA 4JJHA 1MVYA 4NO0D 4UU9A 1F5WA 3UP1A 2D7OA 3GMMB 1SNRA 4JO2L 5FWRA 4XN5A 3TZVD 1NGPH 3HBPA 5IGXH 3PWPD 1FWXA 3SDAC 4PVMA 5K59E 4XGZB 2C1OB 3H3BC 4E9LA 3MVSA 1NDMA 2R56L 4FXKC 4XBMA 4AM0B 3N42F 2L7EA 1MJUL 2FL5B 1QYGL 4UCFA 5CIPH 1IAIL 4QRAA 3N0PB 4KKQA 1ZV5A 4PRPA 5DR5L 1JGDB 5D6CB 3O6FB 4Y4HA 3VXPA 4QUOA 2LVEA 2Q9OA 1AR1C 4R9HA 3AGWA 3GMLA 3LEXB 2ZXEB 5AW7B 3P0GB 2ORBH 3HLAB 2CDFA 2JQAA 2V5SA 3GBDA 4Y8AA 4YSQA 1RH8A 1L7IL 3D39A 3GHEL 3KPLA 3WEMA 4LARL 3QUZB 1ML0A 1RSYA 2OX5A 4FFZA 5D2NC 3OLGA 3BPNC 1CXKA 4R96B 2X3AA 4NO3B 3RNQA 1YEDA 3DA0A 4FQLL 1GS8A 3DOIA 3VI4A 2CNYA 2JJSA 1KXQA 3QP3A 3P4MB 1OCZB 4AH2B 3C6LB 2VXUL 3D07A 3VXMA 1DBML 3RURA 3UOAB 4NC1E 4S1SL 3IU3A 1R46A 1A1NB 1SXBA 2B16A 2QGEA 3EBIA 3HJEA 4Y16C 4GW4A 3HR6A 1T7WA 3G5YA 3CFMA 1TJIL 2P8MA 3O3DB 2ATPA 2IDQA 4WFHE 4YHYB 5IUSA 4X80H 4EXPX 2EVIA 3EH1A 3IGLA 2JJTA 4HCRL 3C5SA 4XPAL 4JZNA 1BVKB 1MY5A 2Y06L 1EEYB 5D7HA 1FN4A 3ZRFC 1HOCA 1UZGA 3BX7C 5IBLD 1QFUH 3K74B 1QBML 3IYLW 3FKUS 1MFCL 5J06A 2MCMA 2H7WA 2UZIH 5A3ID 3IFLH 4UU9B 1E4KA 3PHOA 1SYVA 2P24A 4F80A 5FHAH 2EICA 4TQIA 2EXTA 5DO2C 5JPMC 3JWOL 1CXHA 4FNRA 5H94A 4EMZA 2CJUL 3TV3L 2MNUA 1ET7A 3ARDA 4YHKH 1Z7JA 1IGFH 3D50A 4JFQA 1NDMB 2V2XA 4GYBA 3WFDL 1S46A 3TEZA 1S6NA 4J3XA 2A9BA 4YAQA 5L2JA 3U0PB 1TYEB 3AU0A 5M94B 1YJDL 5ABZA 4TS6A 4Y4HB 5F7KC 3L95A 3VXPB 1EPFA 4M4RA 3GMLB 1SM3H 3OKKA 2JKXA 2CDFB 4OLUH 3W2DL 4WJKB 3SDCC 3KPLB 3D39B 4DUWA 3K4AA 1Y6MR 4WEUD 1RHHB 1RULL 2OX5B 5KSAC 3GB7A 4AYGA 4GS7B 1JN6A 4Y4FA 3IDMB 3P3SA 4N6RA 5LBSH 3RNQB 1GAFL 1YEDB 3NSCA 2FJUB 2N7BA 2YWYA 4QRQB 2LW3A 5GRJL 3U1QA 3VI4B 4ZMXA 3RYMA 2NR6C 1U6AL 4H25A 3LIZH 3WNMA 4NWUH 4RFNB 4I88A 1FFNA 5ICUA 2EDQA 1JFHA 3D2UA 3QDMD 1XH2A 3IU3B 5IVXA 1FRGH 4AW7A 2G9KA 4GW4B 4B9KC 1WD8A 3WTUA 2ZWKA 3G5YB 2HX9A 2P8MB 2Z1PA 3Q43A 1KGCE 2BVQA 3VFWB 1LWHA 1G6VK 4FABH 4JG1L 3K91A 4GRWB 3C5SB 3O11A 4X6CA 1R0AH 1IILE 4JZNB 3FOMA 5ISZE 4ODUA 1MCLA 2EH8H 4Z5RA 1FN4B 4WWKC 1QFWH 1I85A 1HOCB 1Q0XH 2XYCA 2ZWLT 3X17A 4U3CA 1JL8A 1CK0H 3BZ5A 5K9OA 2DB8A 5D7JD 4U1MA 1HE8A 4H5SA 1JPTL 3PHOB 4BFNA 1SYVB 1YLBB 1E4XH 2BK8A 1CFTA 3S34L 1KB5A 2VXQH 4JFDB 5H94B 2NDFA 5KYNA 1VFMA 4XOEA 3EO9H 5GZOA 5J0BA 2FNWA 4K8RL 4JFQB 2V2XB 5DURB 4AGPA 2CMRH 2AI0H 3TNNA 3PAZA 4YAQB 4AE0A 3T3MB 5L2JB 4OF8A 1F4HA 4LHQB 4LCCA 4UOZA 2X9ZA 3VI4F 1NAKL 1BM7A 3L95B 4YR6A 5GGTH 5LO7A 2DQJH 4M4RB 3ULUD 4X50A 4XMXA 5EF0A 3OKKB 1O7DC 4IGBB 1E65A 4L3EA 5JDSA 4LAQL 3OTTA 4LSPH 1OGPA 5D7JC 3GB7B 2GJ6B 4R4FH 2OS7A 5SV3A 3B9KD 3GKZA 5JXAH 1JN6B 4Y4FB 3OSVA 4N6RB 1LWRA 1QFHA 4OCXL 1IKFL 3B5TA 4M7KL 5E1HB 4Z7WE 3ILEA 3J7HA 4ODWB 1RIUH 2PW1A 3QUYD 4GRWF 1D5MA 4Y2DD 4H25B 4DP1X 2JMRA 2OSWA 4XMTA 2VQTA 1LWJA 1FIGH 2G0KA 1ZHNA 4RRPG 4KOBA 4HMCA 4WWOA 4QRSA 5BUPA 3D2UB 4YC2B 5IVXB 3MCLH 1NC2A 4GQ9H 4KQ3H 1HCVA 4LP4A 4QR7A 5C08A 1QMUA 5ICZA 1ZVSA 2BVQB 4JQVA 3RUGE 1JUFA 4P2YA 2B2XH 5CEXA 1CXLA 3O45A 4E0RA 2X3CA 3O11B 3V4PH 1DLFH 4F1SA 5JXED 1NGPL 5IGXL 3T77A 4X6CB 2O5YH 3FOMB 4ODUB 3NEEA 4ZAKA 4WEMB 4Z5RB 1KN4H 5L9DH 5DZAA 1QTPA 2F18A 2GKIA 4RBPK 1AP2A 1OK0A 3MNVA 4MS8D 3T3MF 2NY2C 5K9OB 4OIBA 3QUYC 4U1MB 4H5SB 3CVBA 3P1VA 1CFTB 1NOLA 3S3CB 2WXIA 1KB5B 2CRYA 5DVMA 4JFPA 4I87A 4KPHH 5JHLH 2NQCA 4IOIA 3Q8AA 3NQIA 5EU6A 2ORBL 4HKBA 3RQ3A 1U3HA 1U3NA 4NLHA 2JKNA 4A7SA 4HIQA 5I23A 5ID1A 5AOJA 4BDVA 3TNNB 3VNYA 2DICA 3UABA 4BYHA 3W9EA 4LCCB 2Q3AA 2ZT9C 1QLEH 4FYTA 3JWNG 1CVSC 1YHPA 3ZL2A 4YR6B 4KJYA 1Z0MA 1R5IA 4S10A 3C5ZD 4JUTA 1CICA 4L3EB 1GGCH 5JDSB 3FTZA 2ZJSH 1QBLL 1L3NA 4UF7C 4DEPC 2SODB 1Q9LA 4N1HB 3BQUD 2OQJA 4MGXA 4O02H 1FFRA 5IVXF 3WXWH 1T22A 4MQTB 3BH4A 2NW3A 3FRPG 5JZ7C 5I28A 4KH9A 1W72H 4X80L 1QVOA 4LCWD 2PW1B 3FTVA 4ZS7H 1D5MB 3CFIC 3ELAT 2P42B 1OW0A 4X6CF 5HHNA 3I3BA 4HXAH 4P2OD 3A6OA 2WN2A 5JYMA 4A68A 4P4KC 1UFUA 2ZSVA 4QRSB 2VQUA 4NQVA 1MCSA 1OALA 2XI9A 1QFUL 4BBWA 2NY6D 1NC2B 5C08B 3VGAB 3JV5A 3N3EA 5ICZB 1L9QA 1ZVSB 2FJGA 3C5ZC 3ESUF 2UZIL 3WIIH 3IFLL 4KK5D 1JUFB 4TUUA 1KYDA 1GJIA 5FHAL 3ARBC 1Y7VA 3O45B 5CEXB 4BFRA 4UT9A 1GHFH 4YFLF 3ZOAA 3T77B 2DQFA 1GGUA 3KLLA 4Q6IA 4ZAKB 3WJJC 4CGUB 1QSEA 4YHKL 1JZJA 1E67A 2FT7A 5IOPA 1OCOB 4LSVL 5JHDD 4XXWA 1AP2B 3MNVB 3CDFA 5D71H 1F42A 3VMOA 1U3ZA 3O4LB 3PQYA 2L4OA 3FO1A 3UTPD 1MI5D 1TCMA 2HYMA 4PWGA 4M9OA 4M7LT 1R33A 4PJBE 3P3YA 4JFPB 4GAYA 3W5NA 4QRPD 5FYKU 3BE1H 4IOIB 1A3QA 3OHMB 1SM3L 3W37A 2J88H 1NGQH 5EU6B 4E41A 3MXWL 2CKNA 4HKBB 1VGKA 1U3HB 4OLUL 2P5PA 5LAPA 2VISA 3E0GA 4UV7H 5ID1B 5ECJE 4PB9L 4BDVB 4ZMQA 1TOXA 1I75A 3W9EB 5EEYA 2GJPA 2ILLA 4KNUA 1PD1A 2BIHA 1EUUA 1IAKA 5T3ZH 4FADA 4TRPH 4KJYB 1XAKA 5IM7A 1R5IB 1J5DA 4ZZFA 3M8OH 3KMDA 2E27H 1CICB 4KROB 4NWUL 3LPWA 3UBXI 1Q9LB 3P4OA 2OQJB 3MRQA 1I8AA 5C07B 3MHZA 1MCWM 5AALA 2CLRA 4Z7QB 1T22B 2NW3B 2PO6D 1IVTA 4K7PY 2IOOA 4TSAL 1QVOB 3JV6A 4CVZA 3VD4A 1KIQA 3F2LA 3UX9B 4LHUG 5HHNB 4B3VA 1HWGB 1R0AL 4Q4IA 3CFTA 4J23A 4KGJA 2EH8L 2HFEA 1QFWL 3AUWB 4PJHA 4NQVB 1Q0XL 4RMVA 4N8PA 3L48A 3LB6D 4M8VA 1AZBA 2NY5C 4K5MA 2DM4A 2FJGB 2ZCKH 3HC4L 3MU3A 5GS2H 4MB1A 2HWZH 3PV7A 1YYLH 1E4XL 1LMKA 2PP7A 3QUXD 2VXQL 2PPFA 1TLKA 5I1IH 2DQFB 3MLZH 4Q6IB 1I8UA 1QSEB 3EO9L 4XCYA 3LNFA 1ZLUH 5IOPB 3S8FB 2YPVA 4XNBA 5DQ9A 4NPKA 3MBEA 3QJHA 4RETB 3SGEH 2Q86A 4GP8B 4B9GA 3PQYB 3FO1B 4WTXA 1BPVA 3WJLC 1Y18A 5K1JA 1UKQA 5D2LE 5F72S 4GAYB 5GGTL 2DQJL 5KVEH 4J3OH 4E41B 1EFQA 1VGKB 3SGJC 3W3BA 2VISB 4LSPL 4EI5C 3KPMA 3TJEL 2CBOA 1P2CA 1F1DA 2ZICA 1CGXA 4MXVE 3OF6D 4Q9QH 4Z7QF 2OMWA 5KG9B 5JXAL 4Y5XC 1ID2A 3OZ9L 1IAKB 2RACA 3ATAA 1P4LB 4GIAA 3VD2A 5IM7B 1K4CA 3SDXA 1RIUL 2ID5A 1XF3A 3FCUB 4W9FC 2OR7A 4J6RL 1L9TA 3BAKA 3MLRH 1WUZA 1FIGL 2Z64C 3QA3A 5MEOA 2YD7A 1NM4A 3P4OB 1MIEH 4R97C 4X99A 4H1LH 3C8DA 4H8UA 2CLRB 1SN0A 4YO0A 3MCLL 4KQ3L 3TBVA 4GINA 3V0WH 4U4BA 1WS8A 1EXGA 1BQHG 3JV6B 2KKQA 1KIQB 3I6LE 3R8QA 4UZSA 4GSQA 3V4PL 1DLFL 4KQ4L 4W68A 2DI8A 3ILPA 4ZO6A 4FQXD 1PNDA 2J43A 2O5YL 3B2MA 4JBSA 4G42A 5C0RH 2VLRE 1EA9C 2HFEB 3H53A 1KN4L 3NP4A 1RZ7H 4KJQD 4PJHB 3ZIMA 5L9DL 3QI9D 4F15B 5JORA 1E28A 2WJ7A 2AJXH 4TOYL 2ICWJ 5DZLA 4HAKA 4PRNB 4PGDA 2XIDA 2YMTA 1BGXH 3S5YA 5JR1H 5H37A 4L18A 4XVTH 4XCYB 3NAAH 4WTQA 1N8OE 4MMXC 5DQ9B 1ITBB 3MBEB 3QJHB 2V9RA 5B1AB 1YECH 4Z7AA 3C60D 2AZUA 5DDHA 2Q86B 3VFRA 3GBML 1E40A 2IPUG 4D8PA 5B1BB 2NY4B 3HLKA 4P07A 2WVSA 1AO7E 2XCMC 3C6SA 4ZFOL 4G6KH 2EKJA 1OCCB 1FLRH 2ZJSL 3V4VH 1T1ZA 3ALPA 1KPUA 3CCHA 3KPMB 3X1FA 5KOVC 5J6SA 4HV8A 4KXZI 3LH2H 1MDAA 4XB7A 3IJ9A 3L1FA 4RDQF 5DHYA 3F3HA 5KJ7E 3HB3D 2OMWB 3PDDA 3WXWL 5IHBA 1ROCA 2CALA 4HMDA 5E23A 4H2AA 5FA3B 3ZDWA 1BVOA 1UM5H 4ZFGH 2DJMA 3EFDL 5T1LD 1K4CB 2R1WA 3SDXB 3FOLB 2YC1A 1XF3B 4PCSA 2R0KH 1TQWA 1MRCL 5MEOB 3QA3B 3F01A 4C83B 4Y9FA 1HYSD 4PJHF 1TTGA 5F9JA 1KXHA 4I48A 3K8MA 4U3HA 3STZA 3TBVB 3U4KA 1E9PA 2ZOUA 3LEYH 4JRXE 3WIIL 1Q8MA 2E7LA 5CKAA 2WQAA 3EJZC 3LXUX 1GHFL 4YE0A 1OLLA 3ILPB 4R6UA 1F8TH 5JW4Q 1G7IA 4A67A 5IHHA 4G42B 5CEZD 1VPOH 3FAXA 4KKAD 4MD4A 3L1GA 4GSXA 5JORB 1E28B 3Q44A 3WE1A 5LCVA 4XI5D 1CURA 5EOQH 2XLLA 5D71L 5F21B 4P0DA 4RGND 3VXTA 2EEXA 3TYGH 4PGDB 2ZP0T 4OCYH 2OL3H 2B3RA 3BE1L 2D7MA 2EO9A 2ZF9A 3LNHA 2DQTH 5C3LD 1CDHA 3NCWA 1I7ZA 2F54D 4UV7L 1PZ2A 5J89A 4IKNA 2R0ZH 4P2CG 5EEVA 5DDHB 3SHSA 3HBQA 1OGAA 2WLMA 4LPUA 5F6IC 4D8PB 1W80A 3ZHDA 4TRPL 3BVNA 5KVGE 3QJXA 3SDXF 1HE7A 3NGBB 4P9HC 3M8OL 2E27L 3T71A 4L5FE 4WWPA 3C6SB 4XI5C 4ABQA 1T1ZB 3CCHB 1KPUB 2DKMA 3QB7C 4HWZA 4KKCC 4LEEA 3WU1A 1Z2KA 4HV8B 3BXNA 1L0XA 1JTPA 1D5ZA 1N8ZA 5DHYB 5CXPA 2VXTH 3HG3A 3BH9A 2Q1EA 4PN6A 2VDPL 4WO4C 1B6UA 3ARGA 4UB0H 3V79C 4PHXA 1R19A 4OLYH 1WE5A 5IQ7H 1I9RH 3FSWA 1F13A 2R1WB 1DCLA 3CZKA 2O4EA 4XBGA 1E6JL 2YC1B 2CH8A 1NIAA 2BLFA 2J8OA 2X1OA 4UQ9A 4L0PB 4NC1C 4FF9A 3KYNA 1DZ0A 4Y2NA 5F9JB 4Y1TA 4YSSA 2VR3A 1UWFA 1AY1H 4I48B 4S1DD 3STZB 3ZPDA 2ZCKL 1J8SA 1E9PB 2YLHA 3GF8A 3APNA 1YYLL 4XMPL 3RZCD 1FYTA 4OCSL 3U25A 3GLDA 1CYGA 1MHHA 4AQAA 4PH8A 3QHTC 5I1IL 5JW4R 1G7IB 3SKMA 2ERJC 3MLZL 3NFNA 4F20A 4NXKA 5I6KA 5BJTA 3A6BH 4A66A 2Y6TE 5DFTA 4MD4B 5C9KA 4EIZC 3HNTH 4RMTA 1PIFA 5HHOA 4UTAH 1YNLH 3VXTB 5HHPA 5D70H 3CWGA 4GG6A 4R2GC 3AQZA 5FM5M 2IBGA 1DVXA 3I3EA 4ALAH 2V7NA 3NBNA 1U8JA 4XN8A 1X4YA 2ESVA 1I7ZB 3QRGH 3ARVA 2LQRA 4AGNA 4ZW3A 3CDCA 3U9WA 1G7MA 3U79A 4XWGH 2A4ZA 1M2VA 3FW6A 4LAJH 4Q9QL 4NEHB 5DFVD 4X9FA 4HWBA 4YDLC 3LKRA 1G87A 3BVNB 2Y07L 4RX4D 4AQ1A 2BS9A 3B7TA 2FUTA 5AWNH 3WIFB 4DK6A 3QW9A 3LDBC 4AI7A 3MLRL 4NDMA 1FHNA 4LDOB 4HWZB 4X7CC 3MV7D 4IBWA 3BXNB 5IB3B 3MNMA 1D5ZB 1N8ZB 2FH6A 2Y5EA 5EU5A 2VJXA 4M5ZH 1MIEL 1SLVA 2E46A 3BH9B 1R3LB 1U33A 4JDZA 3OV6A 5FYKD 3ARGB 1OAKH 4NQDA 3V0WL 1J0HA 2XN0A 2C4XA 3HRPA 4DF9A 2XKSA 2YR3A 3NSFA 4OLZH 4R5XA 1YMMD 3ZUNC 1IBBA 2H4EA 3JZ7A 3JVGA 3VX0A 1FG9C 1KTBA 3KYNB 5C0RL 4IBVA 4Q9RH 4GB9A 4Y1AD 2EXWC 4AKOA 2AJXL 3BCDA 3PUCA 3WFCL 2FO4A 1P69B 5LBSA 3CX2A 2ICWI 5MI0C 2V8LA 1FYTB 1P4UA 3FN9A 5F93C 4AQAB 4WI9A 1MHHB 2VTFA 3I2CH 1BGXL 5JR1L 1AGFA 3AM8A 3QCVH 2OTWB 3LIZA 2DEXX 3H6JA 3NFNB 5EBMA 1T4WA 3HZMA 4XVTL 2O5XH 3NAAL 5BJTB 4URTB 3RKDC 4HAFA 4KOCA 5HHOB 4I1PA 5JO5A 5E08H 5CO1A 2NXZB 3L9EA 3NJFA 3SDYH 5HHPB 4GG6B 3QJSB 4GP5B 1ET5A 4JM2D 4JKPH 2C1PB 2LU3A 3WFEH 1J7VR 2V7NB 3Q5YA 2VLKA 1MZYA 5DWPA 5LNEA 1U8JB 1T03L 4Q7DA 1KGJA 4B9ZA 2FHFA 3F85A 4G6KL 1JZ4A 3E6FA 4P5SA 1CE6A 3DMMA 4NRZA 1KJMA 4QRRD 2HVJA 4XX5A 4JY5H 3LH2L 1G7MB 1RPQA 4IRJD 1M2VB 2GHWB 3MV8D 3PGCA 4WW1B 1R17A 4W81A 4ORGA 4U1JA 4ZQTA 3LKRB 4K3DH 2B3IA 5EO9A 7CGTA 3DGGA 4ZFGL 4H8WH 4KK9C 3TIDA 4AQ1B 2H41A 1E9OA 4PCTA 2EYSA 2R0KL 4KTYA 2GCYA 3FZUD 3MRPA 4NDMB 5J12C 3S3JA 4HOWA 4TNWK 2MTAA 4NM4H 1TVHA 2QBWA 3W57A 4JM2C 4PSRA 3F5WA 1K5NB 4HZAA 2ZAIA 3OMZA 4JDZB 3GWJA 1MWOA 4NQDB 3U9UA 3LEYL 1RURL 2A0LD 2YQGA 3MRNA 4E9VA 3PYCA 1T83A 1KXQE 5GGTA 1EBAA 4NKIL 2B5IB 4YFEA 3RDTC 1QTYT 1GTFA 1JK9A 2C3VB 3T8MA 3UG5A 1VPOL 5LGKA 3LRSB 1JDAA 3VWJD 1ET8A 4B5ZA 4MSWA 3HHSA 5BXFA 5EOQL 3KPTA 4GG6F 3F7RA 3MUZ1 2FO4B 2CIKA 3D08A 1WLHA 1ID5I 3TYGL 4OIIH 1ZK9A 4LRIC 2AF2A 4JFWA 4WK0B 4OCYL 1LO0H 5B8CC 2OL3L 4GMTH 4GRWE 5CILH 1AGFB 4FHKA 3U7WH 5SWSA 4N0CD 5EBMB 3U46A 4GI6A 2Q2EB 1OE3A 3IRPX 3CBRA 4WJG3 3DHPA 5JO5B 3F65A 5KAQF 4MS6A 4YDMA 2DZEA 3IWUA 4OZHA 4FZEH 4Q9CA 5LNDA 2VLKB 4JFDE 1SXAA 2VW4A 4NQCA 3MRBA 4NCC2 1OIOA 3A4FA 3MPCA 2IWEA 3E6FB 1CE6B 3DMMB 1OF0A 4NRZB 4BH7B 1KJMB 2HVJB 4HK0A 4FYQA 1GYVA 4GQRA 3F7YA 3PGCB 3O41A 2FE0A 3T3ME 1E0OB 4ZO9A 4ORGB 4PMFA 4HVBA 1WUNT 2VZ1A 1T5KA 1T0PB 4HOMA 3EZJB 2IANA 2RFXA 1QSFD 4UB0L 4NHCH 1XCTA 4OLYL 5EO9B 3RVVD 1SLUA 3DGGB 3NCJH 1BEYH 3TIDB 2FYVA 4GRLA 4X4ZA 1E9OB 3B34A 3IJYA 5JHLA 5T1DH 2EYSB 2FJFA 5CCKH 2R29A 2VR4A 2DL9A 1KXVA 3MRPB 5M95B 3K7UA 4N20A 5AZ2H 4APQD 1G5AA 1TVHB 1WIUA 3AGVA 2GJ6E 3F5WB 4MMZC 5C0CA 1AY1L 1AHKA 3RU8H 4DK3A 2EDKA 3MRNB 4I7ZC 5AW0B 3MLPA 4XAKE 5F7AA 1SZNA 1JK9B 2WINA 1TZHA 4MDIA 2HJLA 1YPZA 2X0UA 3AQDA 3FMGH 3N06B 3RGBA 5J11C 4MSWB 3HNTL 4KRPD 2OBGA 4UTAL 3HHSB 4O02A 3D09A 4P2RA 3LSOA 4B9YA 1QRND 2CIKB 2ED7A 2OULB 5CAYB 2QHLA 3HN3A 3HS0C 4LQFH 4WNSA 1QHPA 5CNHA 4ALAL 3OG4B 3V4LA 1W72A 4FQIH 3D3VD 3KVPA 1L3WA 4M43H 4Y7OC 5F89A 4LSTH 5FIEA 3ZZ1A 4W4NA 3OZLA 5MERA 4X6CE 5SWSB 3U46B 5AVRB 3IAQA 3MRRA 5BV7H 1IARB 1AI1H 1KGIA 3LNGA 2AC0A 2FQFA 1UT2A 1FNSL 4RSYA 1T7XA 2CLVB 2OW7A 2W60A 1KCLA 3ZTDC 3FU7A 5FGCE 4EPSA 1PFOA 4YLQT 1WZ1H 1USZA 2OTPA 4OZHB 3QR2A 1JPSH 2HB0A 4NQCB 3MRBB 5AWNL 3KYMA 2YD9A 3K8LA 4A2DA 1HCZA 4HK0B 2HKAA 4G7VH 2OMTA 3QPQC 3F7YB 2OJEA 3O41B 4M5ZL 3VFSA 4U31A 3IJEA 4JO4H 1XFPA 2IANB 1OAKL 2RFXB 1XCTB 4H20H 2LR4A 1LLAA 4LMQE 2JI3A 1JTOA 1P5VA 4GRLB 1NMCC 3IJYB 1UA3A 3ZY7A 2FJFB 4LVHB 4L3EE 2WIMA 1DQDH 4HYTB 3OHXC 5GS3A 3ARUA 4LVEA 4Q9RL 3HS9A 2PUQT 4N2HA 2QVTA 5C0CB 5DEJA 1YG9A 3SCMD 3TPKA 1AKJA 5DD0L 1RZJC 3ZTJG 1QLEB 1PY4A 1UJ3C 4F58H 3D4ZA 4L4VA 4LL1A 3TS8A 3HMWH 1FNEA 3I2CL 3KJ4B 1BZEA 1D3CA 4FNLH 3QCVL 1XBRA 2K3HA 1TZHB 4MDIB 2HJLB 5FW8A 1YPZB 2O5XL 3BKCH 2VO5A 2KDYA 4AVHA 5BPPA 2FSDA 1O5DT 4O02B 4ES9A 4P2RB 5E08L 3LSOB 5KBPA 1PLBA 3RL2B 5E2UL 3ECBA 4OZHF 4JKPL 1W72B 2CGYA 5F89B 4AZ8B 4JFHD 1WDAA 5AZEH 1BFVL 2I5YH 1RZKC 5DLMH 2HG5A 4Z3TA 3PL6D 3C8HA 2Q0ZX 4I13B 4ZS6C 4U7SA 4Z23A 1FNGA 3MRRB 2SEBA 2ENQA 2DH2A 3VGDA 3LEVH 4XHQA 2QFRA 4JY5L 1QWUA 1XZWA 3U0TA 4IDJH 3O4LE 1PKOA 3FU7B 4Q6YA 4UV4H 3VDCA 5C71A 1PIGA 4K3DL 2X4RA 2TRYA 1MJ8H 5F96L 5KZCB 4H8WL 5EA0L 3NIFB 2CO1A 5EU6E 3KYMB 4U1LA 5JPNC 2XA8L 3II3A 4P05A 3U6XA 2Q76A 1Q1JH 3QXWA 4NM4L 2EJ1A 2K3TA 2OMTB 3S5LG 2OJEB 3VFSB 5C3TA 3MODH 3GJFK 4JKNA 3S35X 1P7KA 2L3BA 1OP3H 2EDWA 3OKOB 1AHMA 2HFGL 1P5VB 2PNDA 1PS3A 4XTRC 5DD1H 4JN2A 4FG6C 2CRZA 3EJSA 3GIZH 3OLEA 3FULA 5HVHC 3U0WL 1MY7A 3ARED 1L7TH 4WI8A 4YGVA 1MWAH 1YPZF 4DOHB 1HNGA 2H2SD 3VQMA 4G6AD 3DHUA 5B4MC 3DJRA 4N4YB 5C07E 3LPOA 1DN0A 4Z7QE 1AKJB 4WTZG 1A9EA 4AEIL 2FUQA 4OIIL 1NBVL 1OO2A 1DVFD 3D30A 4L4VB 1AOZA 1MW3A 4Z76A 4U4IA 1CDUA 1FNEB 4IRSD 5CZVH 3QDGD 2IBZX 5CILL 5AYQA 3U7WL 3IRZA 4GAFB 4MCYA 4ATTA 3STBA 1WWCA 5KJRH 4K9JA 1U8NA 4RWYH 3BESR 4KY1L 4GBXC 5AVZB 2IDUA 2ZOTA 2GT9A 1RZQA 5KJ4A 4OZIA 3GNMH 3NIFF 4KH2A 2HG5B 2A83A 1QSEE 1FNGB 2SEBB 4JPVH 2B59A 1NEZG 1J48A 1OCRB 3EF4A 4TNEA 1S3KH 3U0TB 5A6IA 5IT2L 2BNQB 2KH2B 4IRSC 2BZ7A 3CHRA 2DMCA 5F9OH 2X4RB 4NHCL 5L2KA 1IGJA 2QADD 4ZXBC 3NCJL 2VDKB 1BZDA 5ALCL 3FU5A 3CLFH 5T1DL 1C5BH 2IO5A 2YZ8A 1B9KA 4U1LB 4E41E 3OAZK 5CCKL 4FQPA 3VFTA 3LHAA 2Q76B 3NTCH 1YY9D 4JANA 2BOCA 2HPOA 5D1ZC 5F97E 2FYYA 5AOZA 4ELKA 1JFQH 4MD0A 3HBGA 1OWWA 2VERA 1P7KB 4GMSH 5MEQA 1AQDA 3GXUB 1MNUH 1GGTA 5E7BA 3TA3D 3DK0A 4JN2B 3TT1H 4UOW1 3MUY1 4YL4A 5I76B 4GEJA 2QTEA 1WFTA 1A2YA 4YGVB 5A2JH 3V4VA 1S5IL 3P40A 2EZ0C 5AEAA 9CGTA 3HFMH 3WXVH 3FMGL 2FQGA 5LKNA 1DN0B 4FG0A 4HIHA 3CHOA 2FLRT 1Q90A 4PWEA 4PWHA 4FQIL 4LSRH 1CLVA 5D7IA 1WPCA 4MCYB 1YY9C 1D5XA 2GK2A 4JHUA 3D48R 1OM3H 2JKWA 1IC7H 2YA1A 3EOTH 4M93C 2WWNA 4PJHE 4OM0H 5BV7L 4S11A 1U8NB 4PI0A 2V3FA 3B3BA 4ZUVA 3TA3C 3ZHKA 2YXWA 3SE4A 1H15A 1ZY9A 3B9DA 4ZK8A 2K1MA 3CU1A 1UUSA 5IQNA 3W39A 1WZ1L 3FONA 2EYRA 2IQ9L 1TLMA 2DPKA 1F1GA 1JPSL 2WXHA 1XXDC 2HT4D 5L88H 1EZLA 4OD2A 2A83B 5JMOC 2HH0H 1JG9A 1NOFA 5SWZE 4XP1H 2B59B 1SXSA 3SPIA 2PWFA 3FQUA 2XVBA 3CVHH 3EBGA 1RIVL 4FMKA 4G7VL 1DVYA 1UD5A 4H8HA 1KDIA 1BBDH 3QEQD 3KH3A 2G3ZA 1IBYA 4H20L 5L2KB 1V55B 1IGJB 1N0LA 2ROXA 4UMSA 3KZ8A 1TJGH 4QOKB 3KWUA 3AWGA 2Q20A 2MQ0A 1V3KA 1YUHA 1DQDL 3E2HC 3VFTB 5KVFL 3DTDA 4P06A 4YXHL 1CYXA 1HWWA 1F3RB 1TETH 2UVEA 4FNTA 5GS1C 1AXTH 1YEEH 4EQ3A 4JANB 2BOCB 1FGVH 5DHDA 2FYYB 4ELKB 2V5TA 2ATAA 3HTLX 1VKXB 2HT4C 1ZANH 1AQDB 5MEQB 4F58L 3V7AG 4DP4X 4F7MA 4WGWB 3SDXE 4XNAA 3HMWL 1MJJA 3O2DH 5I6MA 2G5BB 5GXBB 2CR6A 4ANUA 2I85A 2DQIH 1A2YB 3V4VB 3P3RA 3N40P 3BKCL 3HE7C 3VA2C 4L3CA 1VFAA 2RCSH 2VRQA 3EH3B 4ODHH 3WN5C 4GJTB 5CN3A 1P9MA 3PXJA 3O2VH 4HIHB 3L1OL 3T6WA 4I9WD 5IWLA 4KK6D 5D7IB 2DIEA 5AZEL 1MXGA 2I5YL 3NESA 5DLML 4ANVA 3BAIA 5CLZA 1JD7A 5B7MA 1A7QL 1I1AC 5F3BB 3ABGA 4IBTA 2VDMH 3LEVL 1HYRC 2P9RA 1IIIA 4DZBB 4M7ZC 1PZBA 3FHEA 4U1HA 4ZUVB 1H15B 4H88L 3W39B 3FONB 4UT6A 2ZAGA 2EYRB 4RMRA 1MJ8L 1DQJA 1JAEA 3PWNA 2X89D 4OD2B 5ANMA 5AYUH 5I6XB 5ICYA 1A6ZA 4QJ4B 4BE5A 2NTFA 5EZOL 2WPGA 3B8YA 3FQUB 1U30A 1IC0A 4JR9H 3Q2CA 3D7PA 5EWIL 3C6LD 4M1DH 1Q1JL 3WD5L 4JGUA 5HDLA 4UTAA 1J18A 3LZNA 3HUJA 2H6PA 3EOBA 3MODL 4KK6C 3MOBH 4IHOA 2AQRA 5C0BA 1HCYA 2P80A 3DX0A 1N0LB 3O6FC 1KLFB 1JNJA 5F7MC 3RVXD 4L3AA 1G7JA 5DD1L 4Y9EA 4KHTH 4N3TA 2QPDB 5T8IA 1YUHB 4PCYA 5G4NA 4BK5A 3QCUL 1KV7A 1M6OA 3QUZC 1MWAL 1KV3A 1OB0A 3TN0B 3FUIA 3NVQA 4JL2A 3LZQA 1BECA 1XHHA 3AG2B 3UG3A 4F7PA 25C8H 3CFDA 3L16A 5FUOL 3ULVL 3FK3A 4R8WL 4MVBD 5GGVH 5HGGS 4F7MB 1MJJB 3M17A 5CZVL 5D7IF 4JFUA 1XIWA 3BZFA 3C6LC 3OWEA 3P69A 4QXWA 4M6OH 2PN5A 1GGIH 3BYTA 2GEQA 3PGFL 1LEKA 4HK3N 1J0ZA 1ETB1 1RUMH 3BFOA 1BQKA 2GQHA 2XWDA 1QAWA 2BSTA 3S36H 3TO4D 4RCAA 4X5RA 5KJRL 3GUTB 1X5MA 4RWYL 1VFAB 5IIEA 2C4FT 3S37H 1GKEA 1AMXA 2AJUH 2FJHA 2QDVA 4QGYA 3RVXC 1UTDA 2FRGP 3UJJH 2K0RA 2DRUA 4YHYC 2PF6A 2VZOA 2QQKH 1OM9A 2ADGB 1YVLA 2FDBP 5KBKA 3GNML 4PRPD 4XXCA 4Y4HD 5T5FH 1TYJA 4K3HA 1H6TA 3KGSA 3BGAA 4DP8X 1IE5A 1KSRA 5HVWA 4JPVL 3MCG1 5E8EA 4AL8H 2XVLA 3VO0A 1S3KL 3K46A 4OR1A 4U1HB 3V95A 4J28A 3SGKC 3BUYA 4IBYA 5E9DA 5CN1A 3N2JA 1CBVH 5F9OL 4F7CA 1DQJB 1NIDA 3CBJB 3SY0A 2PPCA 3PWNB 1L9OA 4X9GA 3FT9A 4LSUH 5ICYB 1KMGA 3JV4A 1A6ZB 4S0TD 2NTFB 2X4TA 3NZUA 5EC1A 1NBYB 3FQ2A 3NTCL 2GJZA 3VXMD 1DR9A 3HUJB 2H6PB 1JFQL 2VAAA 3EOBB 3THMH 4CJ1A 3V6FA 3DYPA 4IHOB 2UXVA 5C0BB 4GMSL 4IMKA 4Y4HC 1MNUL 4JPWH 1ZSDA 2AQ2A 3MGAA 1VEOA 5FFGA 2DBLL 5AW1B 5EIQA 3TT1L 2Z93A 4FJ6A 2MIZA 4OVVA 1UOLA 3L45A 1M6OB 5DVNA 3IS1X 4PJCA 4W6YB 1N59A 4GS7C 2CO3A 2PCFA 2C9PA 5FF6B 4F7PB 4YHOH 4BA0A 3CFDB 2WP3T 2R39A 4JRLA 1ROWA 5F7UA 2B1OA 2DD8H 4YLBA 2Y3AA 2JJSC 4JHAL 3L5IA 3MA9H 4KV5F 3M17B 1FE8L 2N0KA 1XIWB 3LN5A 4LSRL 3BZFB 2E59A 1LEKB 2LV4A 3A47A 4RFNC 2YRPA 4JFTA 5FW7A 4DGUA 5LG1A 2FWOA 1IC7L 2BSTB 4NENA 5E0FA 4BXVA 1VENA 3AJ7A 3ARDD 4LEXH 5IIEB 5GISH 3KDPB 2FJHB 1W15A 3CN4A 5DK2A 4W9GC 2OYLA 3MJ9A 3GJEA 4IBZA 3PE9A 1PAZA 5DQDH 1QX1A 2JJTC 2IH1A 2EDTA 4KNSA 1O9VA 3FHQA 1UKSA 3CDZA 4K94H 5L88L 1NLDH 5KUMA 2HJKA 3IMBA 2HH0L 1U92A 4J3TA 4XP1L 5E8EB 1IGML 4IS6B 1JYWA 4NP4H 2JNZA 5I1KH 3R8BB 3G6AA 3HUJF 5CGMA 1D5RA 1NCUA 3BUYB 5E9DB 1BBDL 1E4KC 2LLGA 4Y19A 4QKTA 4F7CB 1MCPH 1CDIA 2WYIA 4MAUH 3VD0A 5DZ9A 4MJ6A 1OKEA 3SY0B 1A22B 4POZC 4BE6A 5L6YH 4CU6A 3JV4B 3CC1A 2QVKA 2X4TB 3CFCH 3OKNA 1WG3A 2DWDA 3GXIA 5EC1B 1O7SA 2GJZB 1TETL 4P57A 2E6JA 3LQZA 1AXTL 4NI3A 1FZMA 1FGVL 1QPXA 2VUOA 4PP1C 2VAAB 3LPPA 4L9LA 3V6FB 3ULUH 3GSQA 2UWEA 1ZANL 4XX1E 4A1RA 5DJ8A 3WNJA 1ZSDB 1KF9B 2WWMD 3O2DL 3IBEA 4ZUSA 4IGBC 3KEDA 2VZUA 3TWCH 4DSYA 2FD6H 4PJCB 1T0NA 3FYEB 2XY1A 3S3SA 3OAUL 1N59B 2CK2A 3Q0HA 4X4YA 1KTCA 1JXKA 3AMKA 3EJQA 1EHXA 4Y4FC 2NX5A 3PPEA 4ODHL 1RVFL 5ABAA 4NPYA 3O2VL 1BPLB 4O2EA 2H47C 3MRJA 3RL1A 8CGTA 2ITEA 2KLRA 5IUCA 3M1OA 4B95C 2FWOB 3N9GH 5BOZG 1FPTH 2VDML 4G7YH 4YC2C 1KYOJ 3RKPA 2G2NA 1XR9A 2XY2A 2BH0A 5DK2B 2O30A 4RRPA 3RDJA 3L9BA 2D7TH 3GJEB 2BNUA 2KLTA 5EBWB 3WTYA 3QQ4A 2IH1B 5AVWB 1S9KC 3K2UH 5HYEA 1J0KA 1GW6A 3CDZB 3Q7JA 2HJKB 2JJWA 1AC6A 4PY8J 3FB8A 4PBDA 1I85C 1ANUA 4JM4L 2MCPH 4FGMA 4M1DL 5HGBA 1OVZA 3NACH 4GKOA 4YHPA 3TJHC 1VGEL 2QSTA 4X42A 4Y19B 3MOBL 3QO0A 2XQYG 2BMKA 2XXMB 5IROA 3ZDZB 4MJ6B 5EU7C 3KWWA 4QTHA 4QI3A 5GZOC 4KHTL 4QWWC 3OKNB 3ZKNC 3LN4A 2DWDB 2JIXA 1M3IA 3ATBA 4KVPA 4M5TA 3EUDA 2PYEA 4PJCF 4Y9BA 1WJ3A 3LQZB 4Z0XB 1IL1A 1FZMB 3ZE0B 3DGCR 2K78A 1N9PA 3CSBA 4LCCC 4MCZA 1WBYA 3MLWH 4ADJA 4Z3JA 4F8LA 5DJ8B 3IE4A 5GGVL 3H55A 2UY6A 1NMBL 1UEMA 4ZUSB 5IB1A 5AG9A 4M6OL 4RNRA 1GGIL 4KKNA 1ZLWH 4QHPA 1EFXA 1RUML 1T0NB 2UV3A 3S36L 3TEXA 3VFVA 1YDPA 4X4YB 1U8IA 3S37L 5TQ0H 2NX5B 2EC8A 2HAZA 3TF7C 5HYFA 4NPYB 3A4AA 4LESA 4O2EB 1ZS2A 3VQLA 3GXNA 5FB8A 3PABA 2ZSWA 1KLUA 3MRJB 4OY9A 3FRPA 3RL1B 4JKKA 2O6EA 5IW3A 4AL8L 2AQNA 1U3HD 1CGSL 1XR9B 1T4KA 2AITA 3VGAC 1HK6A 1ETA1 4HHGA 1EAPA 1TIUA 5GGRY 1IZJA 4JQVC 1IC4H 2BNUB 3STLA 1CBVL 3H1ZA 2IAMD 3JSSA 3QQ4B 1K2DA 3ZDZF 1DBAH 1NA8A 1CPUA 3A4DA 3JUYA 5FM4A 4CVUA 5SWSE 2AJSH 4ZAKC 4B5EA 3ZMEA 4NKMA 3V7MA 1Q4NX 3FB8B 5EV7A 2PXYD 5E2VH 4YDIL 4PIRF 5HGBB 3ZE0F 4YHPB 3BLPX 3FCBA 3HHMA 3U1PA 3UYRH 4Z77A 1KOAA 3GBLA 4OJFH 2D73A 3QO0B 4P23D 4OZHE 1QD0A 2KZKA 1OPOA 3BN9C 1XMWA 3KWWB 4U6VH 4JVPA 3LXBA 4OH2A 2ZUTA 4NQCE 5MENE 3NK4A 1DJHA 3DWTA 1CFMA 1U3HC 4BFBD 1WO2A 3LN4B 1RZ8A 3LCYA 4PLJD 4IBSA 4TYUA 2J2ZA 2XTSA 3KGRA 1IL1B 4HT1L 4MCZB 1WBYB 2EIMB 4YHOL 2IANE 1PEZA 3NZSA 2X9YA 2DD8L 5JIPA 4HKZA 5ESVA 5BOJA 2UY6B 3MA9L 4F33A 3VW3L 5IB1B 1CICC 2Y7LA 4KROC 1G1OA 1U9KA 4X4MA 3OLIA 3AADB 2GYSA 1EFXB 2NY3D 4EJ1C 4A2LA 3M45A 2VGLM 2DLFH 1YDPB 1NWPA 2WQUA 2D8KA 1C5CH 4LEXL 4D9QE 4L37A 2JKJA 3IMSA 4RSVA 5C0CE 5FUZH 5BZZA 2VDQB 1OT4A 3KYOA 2Z0UA 3FDWA 4OZFG 1J8KA 1NCIA 4GH7B 5LGHH 3LMJH 4NNYA 3VU1A 5FB8B 1NCDH 3PABB 1EBPA 2ZSWB 4NQSA 1OW0C 1KLUB 1J8HA 3FRPB 5AVUB 1NLDL 3IKKA 4OQTL 5DJYA 5CGYC 4LHUA 4NP4L 1SVZA 2Z31A 1QW8A 1T4KB 5I1KL 1CL7H 1EAPB 3B6SA 4EN3A 4KMQA 3STLB 5EUKA 1ONQA 2A6DA 4K55A 2KQMA 1K2DB 3WLWD 1UKTA 3Q1EA 4P5MA 5CUSH 1H3PH 3L54A 1SJHA 2Y6SC 4Q6IC 4NKMB 3CFCL 1NSNH 1O6VA 3DYMA 2RA1A 3JT2A 3VXUA 3S96A 2I7OA 3KYAA 4NUJB 2VDNH 4Z77B 4JMNA 3ULUL 3GT6A 4FQ1H 2NCMA 2F15A 2VQ1A 1EO8H 3QDJD 1AZRA 3VFUA 1B9ZA 3SO3B 2QQLH 3NIFE 4OLVH 5HDQH 4MDJA 5GGSA 3T0EA 1RZ8B 2FD6L 1HINL 2XTJE 3JTSA 1I8MA 1AD0A 3IE9A 5DHVH 4OD1H 5FGBA 3GLEA 1XCQA 2J2ZB 5I8KL 5I8OH 1J0YA 5AKVA 4DAGH 3H6AA 5J3HC 3N44B 4I8DA 3MQIA 1ZKAA 4XN7A 4Z3FA 4TVPD 2IWKA 1Y1DA 4MAZA 4HKZB 5ESVB 5AQ0A 1AGBA 3TJPA 4QIRA 4F33B 4LOUC 2BFVH 4C56A 2K8MA 1A3LL 4QDGA 1N67A 1E7UA 4IYKA 1E9QA 2K7PA 2ZCLH 1SUJA 3NH7H 3N9GL 4G7YL 5FYJL 4L37B 5A2AA 5F1NA 1U2CA 4ILDA 3EGXB 4B0MB 2BJMH 4POYA 2D7TL 2FBRA 5IFJA 2Z7YA 4L4VE 5T3ZE 1BA9A 4NNYB 3GXFA 4XNDA 2NNAB 1IJNA 3ECWA 3OAYH 2NY4D 1J8HB 3K2UL 4PS3A 3S48A 4E9SA 4FG4A 3K0YA 1BQHA 2GJRA 3AUVA 3G5XA 5DJYB 2W5PA 2OJZL 1VACA 3OC5A 3ZMRA 4F15C 4LHUB 1UQSA 4WCYH 2Z31B 4YIQB 3ZTEA 2MCPL 5IB5A 3MRGA 2ZTBA 3MV9A 3NACL 1DVZA 3B6SB 3QJTB 4HQQL 5FEBA 2X6VA 5FHBH 4EN3B 4UI2A 5EUKB 4KNTA 1ONQB 1BFTA 4HKJA 2CIIA 1SDYA 4P5MB 3QZNA 4KY2A 3WNIA 2FB4H 1SJHB 1X3DA 1FC1A 3CUPA 1QR1A 2NSMA 2BZCA 2DM3A 1DEDA 3MLUL 3VXUB 3CN2A 2B08A 3MBEC 4BRJA 4LCYA 3S96B 1R4XA 1AQ8A 1GS6X 3N44F 4PWKA 4FD0A 2BNQE 3HR5A 2BVEA 3MLWL 4N25A 5GS0D 4LOVA 2AQTA 2NY4C 3DHMA 2ITFA 2XIBA 3EDDA 2BHZA 2VQ1B 2OZ4A 4M29A 3VFUB 2VWEE 1DJYA 1RLWA 3G9AB 2R1YA 5HYSB 2VO8A 5GGSB 3T0EB 3WLBA 3ZKMD 2FVNA 5EEWA 3JTSB 4BV1A 3UMNA 1AD0B 4ANWA 3RFZA 1I8MB 3SE3A 4YSOA 1XCQB 4E68A 5IZ7A 3C2AH 1FJ1A 2FLBT 3CVHA 4NM8H 3RPBA 5TQ0L 3NRFA 1XGRA 2CR3A 1WTLA 3ABMB 3FU8A 1QR4A 5FC9A 1AGBB 5C86A 2NCEA 5FOBA 1HZHH 2EXYD 3E3QE 4UM8A 3TM6A 3MRLA 5KVEE 3CXDH 1E9QB 2OXGA 3FSOA 1DANT 3ZK0A 1A8ZA 2XWJA 4OT1H 4R7XA 1ACYH 2HTKD 3UGXA 1IC4L 1RAMA 4AK2A 2YD6A 5CEZH 4IRZL 1DBAL 3O2DA 4FS0A 2LT9A 1BQHB 3G6JA 3G5XB 4M1CD 1VACB 3AFLA 3DO4A 1UQSB 5IB5B 4OF3A 5C0EA 3MRGB 2EDNA 4PW3A 3QIUA 5EIIG 3VRIA 1EGJL 3UYRL 3VFGL 5DJ2A 5KUKA 1NBQA 4YN3A 4JDEB 4HKJB 2CIIB 2VN6A 3ML8A 4I18B 4MZ3A 3LYRA 4PV1C 4U6VL 1OE2A 3BUPA 4A2GA 3EYOA 3EOYG 1MW2A 3CUPB 3SE9L 1QR1B 3HE6A 5E9NA 1ZIBA 2YGQA 4HXBL 3DETD 5I18L 1GY1A 1DQQA 5KSBE 4LCYB 4IKJA 4NUGH 2MOQA 1FH2A 2R69A 4HC1A 1SPDA 3KR3H 4FLSA 1M6UA 1KGXA 2E9JA 3HR5B 4UDTA 4TUOA 5BZDA 3HMXH 5C0NC 3TZVA 5L2KE 3PWPA 2BSSA 1TQTA 3NGBC 4QOKE 2XQBH 3W0WA 2MEJB 2R1YB 1CFVH 1S7QA 3TFKD 3WLBB 4A39A 3RVTC 3RFZB 4JZJA 1PY9A 2UYLA 2W9LA 3Q8FA 2Z9TA 4KC3B 1FJ1B 1TO5A 1X9UA 1C5CL 3CVHB 1J1PH 1VA9A 1XGRB 4TUKH 5JW4M 1MG3C 3GUFA 5KYXA 4PS7A 2OPCA 4QD2E 5FOBB 3LMJL 4Z7UA 1H3VA 4DP6X 5LGHL 1EHLH 1NCDL 2ICCA 4UM8B 1RK1A 3MRLB 3Q9PA 4LOEA 3CAFA 4UINL 1P7BA 5L7XH 2BP0A 4BHUI 2DJ4A 1TTRA 5HGAA 4HX1A 3CGTA 1CL7L 4X83A 2DWEA 5J6GA 2DMHA 3MV11 2YIHA 2E7LC 2PCPA 2XU9A 3PLYA 1OGAD 1O5PA 2A73A 2Y25A 5CUSL 3MC0A 4HUVA 1H3PL 3KD4A 1YZZA 3I9AA 3G6JB 4FNSA 4OFPA 4QHUA 5SX5K 5IESH 5C0EB 3QIUB 2OLDA 1S7SA 4PVNA 3VRIB 3H9YA 3V0DA 4XN1A 3P30H 5DWUH 1UWXH 1FNAA 2VDNL 5DJ2B 1LO3H 3J07A 4KUZH 5EF3A 4WU5A 2MFNA 1SBSH 4FQ1L 4ONOA 5DUPH 3ARGD 1EO8L 1KCSL 4YOKA 5AVTB 3EYOB 2YUVA 4UZGA 4AEEA 2QQLL 2DW5A 5CU9A 1BG9A 3HE6B 4OLVL 5HDQL 5T5FA 4XOAA 1DQQB 2KL6A 1X5XA 3FU6A 5E99H 1JP5A 2DLGA 4QXTA 2BINA 3V10A 3OKYA 1SMDA 4DAGL 4N28A 4NO0B 3GHBH 4UDTB 1OHQA 4ZO7A 3SE8H 4HAGA 3PHQB 4TUOB 4X7EC 5BZDB 3WS6A 3TZVB 3PWPB 2BSSB 2VR5A 4U1NA 4UMGA 4X9BA 4H44C 5GZND 5ISZD 3UG4A 4PP2A 5E4EB 1FYTD 2BFVL 3ZT7A 1DUZB 1P53A 2UYLB 4YX2L 4H26A 2NZ9D 5FYKH 5J13B 4DETA 1P84J 1XH3A 3B7YA 3GSOA 3A0OA 3ARGC 1XGUA 2BJML 5HHOD 1N6QH 4X8CA 5KYXB 1FORL 4Z7UB 3W11D 1JJUA 3KG5A 1RK1B 2VZTA 5K69A 4MQXD 3G6JF 4MZIA 4ODSH 5CBAA 3RA7H 2E75C 1L5GA 2BP0B 5HGAB 4HX1B 1A6WH 2ESVD 4L1BA 4EVNA 4WCYL 4UOQA 5HGDA 4CBPA 4AZ8A 3F6LA 3QWRD 5AB1A 3GTVA 5J6GB 1PYWA 2PCPB 3WY2A 2E6QA 2D0GA 4B96A 3GSVA 4KV5E 2A73B 5I1EL 3P4NB 4HUVB 1IMHC 1T2QH 4BCYA 1NANI 2X2IA 4NI6A 4QHUB 1AGEA 4PLKC 3COOA 4TPRH 2MTPA 3EFFA 1S7SB 1K72A 5BO1L 4BEIA 4OLWH 2NXZC 15C8L 3KHQA 4KX8A 4CADA 3W11C 4KDTA 4OTXL 1WITA 5KSVA 1D7FA 4WU5B 4ZX3A 4NNXA 4KQ0A 1DQLL 1CLYL 2VH5L 1BQUA 4NQDD 3VTAA 2X2YA 3B2VH 4ZMAT 3O3UN 2OMZA 3V8CA 3BT0A 3RNKA 1YYCA 2W88A 1ZJBA 3QQ9D 5A2LH 4QXTB 2YPLD 4XOBA 4L1DA 3C2AL 3VWKD 4NM8L 3HUJE 1G7PA 1TJMA 1UXSB 2HT2C 5C0BE 2FCBA 3NOIA 1PX8A 1AYRA 4U1NB 1P84K 4AQ1C 4Z7UF 4PP2B 3DV4B 3ZT5A 4YZWA 4BFFA 2WWKO 3HAEH 3DXAA 4A6YA 2QEJA 2QVIA 4H26B 3T65A 3HI1A 3GS0A 2GIXA 1XH3B 5CINL 2VLMD 2AW2A 4DGYL 2W8CA 1XGUB 5I1JH 2ZXBA 4DJMA 1MFMA 4G8EA 5G55A 3D52A 5D7LE 3AMLA 2B5IC 4E9TA 1HEJC 5CBAB 1UGKA 3CHQA 3JVGC 5ES4B 4JEGB 4JB9L 5TE7L 2UUDH 1L5GB 3B56A 2NNXA 3B9KA 3PU7A 4EVNB 3NSJA 1ADQH 3EYSH 5HGDB 4G2AA 3T2NH 2E47A 4EIUA 5I16A 4Y2DA 1ZXQA 3O8XD 2F7QA 2MQGA 3L8QA 1HVXA 3GSVB 3GYRA 4AVKA 4KXAA 1EMTL 3AM8C 2Q7YA 4YBQC 2R4SH 1UD4A 5F7EL 3WGUB 3VXRE 4U3SB 5AD0A 1WFIA 2XSKA 5E6ZA 1AGEB 2E7MA 2BSCA 3QRBA 4LCUA 3ZJAA 2FECL 1J9TA 1OD9A 3EFFB 4NUGL 2ICES 4P5KA 4CADB 1G1YA 3KR3L 4FZ8H 3DJZA 2VDOL 5E9DE 5KSVB 1LDPH 2AANA 4CW1A 2G9HA 3ECQA 4NNXB 4X7DC 4HALA 5I9QB 3HMXL 1UM4H 2NZIA 5JXEA 3ALWA 3ARFD 2X42A 3KPRE 2WSKA 2XQBL 2XWXA 4M62H 1T66C 3AW5A 1CFVL 2OMZB 1EANA 3RNKB 1IU1A 1HL5A 1UD6A 3DMMC 4K0OA 2ADJA 2OA9A 2XZZA 3GEWB 1YN7A 5H2BA 3KBFA 4PTTB 5JQHC 2IG2H 3TT3L 3NZHH 5EF2A 4K7PX 4JQIL 4TUKL 2XN9A 4JUSA 3WMPA 1UB6B 4ZRGA 3HS8A 4J27A 3PFUA 1AGDA 3JQOB 3S2CA 3BSHA 4HPYL 1DYZA 3VFNA 1E8ZA 1WTGT 3DXAB 4NKDA 5D5MB 3DRQA 3PWVA 3T65B 5L7XL 4PJCE 1BYNA 2HVKB 5L4IA 3HI1B 1OAXH 4HPHA 1BQ5A 4GIOA 5TDPA 1QBAA 4FFYH 4L1SA 1RZGA 2WHVA 3HN8A 2J72A 4G8EB 2GY5A 4G43A 1TTAA 1T83C 1XF4A 1JGVH 1M53A 5KWYC 1XTLA 2UZYA 2VW7A 1MCJA 3BQUA 4Z1PA 1QUPA 1OTUC 3RWDB 3B9KB 3UYPA 3T4YA 5E56A 1H3XA 2MNJB