1KLFB

Fimh adhesin-fimc chaperone complex with d-mannose
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
279
structure length
279
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHAPERONE PROTEIN FIMC
publication title Structural basis of tropism of Escherichia coli to the bladder during urinary tract infection.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/adhesin complex
total genus 51
structure length 279
sequence length 279
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature
pdb deposition date 2001-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00419 Fimbrial Fimbrial protein
B PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 1klfB01
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 1klfB02
2W07B 4AUUA 4X5QA 3ZL2A 3BWUF 1TR7A 4J3OH 3BFWA 4XOBA 2J2ZB 2VCOA 5IQMA 5IQNA 3ZL1A 1N0LB 5IQOA 4XOCA 3BFQG 1N12A 4CSSA 3JWNG 3JWNE 4AUYA 5FLUA 4XOEA 4AUJA 4ATTA 3MCYA 2WMPB 4AVHA 3ME0B 4X5PA 4XO9A 4J3OF 5LNEA 5AAPA 4X50A 5AB1A 4J3OG 5CGBA 4AV4A 4XODA 5F2FA 5ABZA 4AVIA 5FX3A 3RFZA 2XG5B 1ZE3H 1KIUB 4XOAA 4XO8A 3SQBB 1KLFB 5F3FA 2UY7B 5AALA 1UWFA 2JTYA 5LNGA 1PDKB 4CA4A 5FWRA 4BUQA 1QUNB 5JQIB 2UY6B 3JWNH 5FS5A 3ZPDA 4AV0A 4CSTA 2XG4B 4AVJA 4AV5A 2JMRA 4LOVA 4AVKA 4X5RA
chains in the Genus database with same CATH superfamily
4OLZH 3HS8A 5L4JA 5MI0B 5MI0C 4UZUA 1AGEB 5DEFA 1YO4A 3Q2WA 4HEME 2R0WH 4IIZA 4PJFF 5LWYH 1SJEB 4XCEA 3TCLB 5CP7A 2CIIA 1ZIBA 2Y1YA 4YDZA 5FYJH 2XXCB 4AQZA 1AD9B 5AUMA 1WGOA 3RLSA 4GSDH 1YSOA 3WTSA 2RCSL 1CFTA 4LDLB 2HA1A 2R0KL 5EUOA 1KPRB 4G59C 3SDXE 3B8YA 4NZRL 4AC4A 4HC1A 2W59A 3J07A 4JAMA 4WUUE 4PG2A 5B21A 3WY3A 4OD1L 5I9QC 4K5OA 5I9QB 2ATPA 3A4FA 2OQJB 3QQ3B 5EPMA 5D1QD 3Q2CA 4JGMA 3L5HA 4B9YA 2OR7A 3PGDA 4Y9FA 2GJJA 4PJHB 2IQ9H 2R23A 5DUPH 2ED8A 3PP3K 2VGLM 3RGVC 3RGVB 3DXAA 4E9YA 4DIXA 4F7KA 2WLJA 3B9DA 2NCMA 2W94A 1MFBL 2X2YA 3ULUH 1XH2A 5D5MB 1B2YA 1E0OB 1KOAA 1LEKB 4OTXH 2ZCLL 1NM9A 3RAJH 1AQKL 2X41A 4QT5B 5AG9A 4M6ML 1XF2B 1S5HB 5EFIB 5D9SA 4C4KO 4ZUUB 1SHXA 4JZOB 5IOPA 3KYKL 1AC0A 3DO7B 1RSFA 5ISZA 1BJ1H 4LLQB 1DUZA 3WELA 1PFCA 2P7TA 2P8PA 5E8DH 4CC0A 4J2QA 4LSUH 2Z8VC 3BFOA 5DRZB 1SXNA 3K4AA 3T3MF 2PCFA 3DOSA 4PGCB 1PVHA 5JPNC 5JPNB 4NXKA 1UD5A 3FB7B 2PYED 1JV5B 43CAA 5J7CC 1BYPA 1BGXH 3ISWA 4A6YL 5LQBH 1XCQA 3C5SB 3LSOB 3BD4A 3TNMA 3QNYB 3SDCC 4CVXB 4TQHA 1RK1B 4CBZA 2YD0A 1KYOJ 1QSFB 2RMNA 4YSSA 3IJ7A 2OMTB 1PLGH 1TPXC 1TPXB 1GGBH 3CSGA 4PYHA 5SWQB 5E6UB 2LGNA 2GUOB 4NC1C 5C07E 4LLVA 1TVHA 1V8HA 1QPPA 3TONA 2R59A 3U1QA 5AD0B 2BWQA 4FG0A 2FO4B 3VG0H 2AK4A 4WEBL 3H0TA 1G0XA 4X5RA 5LG6A 5ID0B 3DPBB 2VLLA 4NZUL 1ADQL 4P2AA 5D2LF 5EO9A 2IDFA 1J5OL 1WJ3A 3A6BL 3NSCA 1OSPL 2A9MH 5F3BA 2EC8A 1G1KA 3HNSL 3EFOB 4W68A 2ZWYA 3U30C 3T1FB 3PAYA 3U30B 2XWRA 2J88H 4J3UA 4OV5A 2W60B 1J0IA 1ZHNB 2UXTA 4FX5A 5FOBA 5CN1A 1A02N 3ARBD 5T33L 5HDWA 1UWXH 2NSQA 2G3ZA 5BS0E 5B1JC 1RH8A 4WDIA 2BNRB 1N0LB 3E0GA 4XNQB 4WGKA 2PLTA 3ARFD 4DW2H 5GGSA 2VDLH 1RKRA 3KCPA 5DRNA 2R27A 3O6ML 1FIEA 3Q5OA 1P69B 5F1OB 1P5VA 4JB9L 3NJFA 4F37K 1LYQA 1XGTA 5AB0A 2B2XL 2IFGA 2WXHA 3ZR6A 1CDJA 2DQ6A 1PY9A 4JJHA 3B2UD 4IDLA 4UNUA 2GJ6E 3L3HA 3VM5A 2D0GA 4RFEA 5ETUB 5KSVA 1U8MA 5D7KE 2ZAIA 1SZNA 4BEIA 4XP6H 5DYOB 4AGNA 4FJYA 3KPQB 3L3DB 1HNYA 3BMVA 3IJEB 2DQFA 4OZFA 3T0EB 2DQTL 2YD4A 5I17B 3QA3A 1T83A 2VJ8A 3H9HB 2F7OA 3P9WB 4JHAH 3QEQA 3TO4A 3CXDH 1FN4A 4JRXE 3AZUA 2G75A 4KJWC 3MLUL 1ZE3H 3FT3A 4MQSB 1IKOP 1YDPB 3JV0A 5DZLA 4CSPA 1P5UC 1P5UB 3R0NA 2FJGB 1I85A 2APSA 5KWYC 4O2EB 3O3DA 1ZLWK 3NABH 1UA6H 5D7LA 4JRWA 2XQ0A 4A6YA 3VGAC 3BVUA 2YD8A 4DP1X 4H26A 1OTUD 2BVPB 4NAJA 1C8QA 1RVFH 2DKMA 1J0HA 3EO9H 1U42A 4HK3N 5FK9B 1VACB 1XH0A 1KY7A 5INCB 5LDUA 4ERSH 3WNMA 4OZIF 3SE6A 3PE9A 1KPUB 4JZNA 3TOPA 3F7RA 3V6OC 3OKDA 4RVBA 2QQKH 3QZOA 4RCAA 1WSST 2WO4A 1Q1JL 4BJLA 4JCWA 5IMLA 4TUJB 3L7FB 3BKCH 3BO8A 3WG7B 1V10A 5I8KL 4HP5A 3LNFA 4PBDA 4MMYB 1G7QB 3N85H 4MNGB 3T4AC 3ZQWA 5JHLH 3EG9B 1ADQA 2QQNL 5I16A 1U92A 4J8RA 3QUMB 3WY1A 5I5IA 1BZDA 3D0LA 1DN2A 3MXWL 1KLGB 5IBLC 2VDNH 5J6SA 4EI0A 2VRKA 1NGQH 2NXYC 2NXYB 2FATL 3RL2A 4R7XA 5HPMB 4YNYA 2EDQA 2VMDA 3BZ4B 4IDJL 3LVTA 2OYPA 4BFRA 1H8SA 1OAYL 1V3LA 3O6FD 3ZU8A 5JW4R 4LVHC 4LVHB 4L23A 4JVPA 4AM0B 4NWTL 3BSZA 5FOJA 1RHFA 4HKZB 1BF2A 3PWJB 4GBXC 3LYRA 3TEWA 2I7OA 4JO2L 1DE4B 4WTQA 1NOLA 4XAKD 1H3VA 1JPFA 2CMRH 3L3KB 3QJQB 4U1JB 2NY5H 4M9PA 4XXCA 4WKXA 3QS3A 4AC2A 2N1TE 1MFNA 2VLKA 3DV6B 3SGEI 5E9DD 3VXPA 4X8GA 1ZXQA 1F18A 3JYBA 1X5FA 4JANA 1PMYA 3D12B 1PYWB 4PJ5A 1CE1H 1GPOL 1F02I 2VLMD 3PAZA 3QNXA 4HCGA 4YHPB 2CK0H 3SGKA 4KQ3L 2OULB 3AS3A 4R8WL 1I7TB 4RX4A 4F1ZA 2OMVA 3QO1A 3S5ZA 4KROD 2B1AL 4UM8A 2WXNA 5E1AB 3UTTE 4FEIA 4AMKL 3FO1A 4WNQB 4PJEA 1BEYH 3KVPA 3L3OC 2VKXA 4ZS7H 5C0AE 3WSQL 2ISDA 4CILA 3UDWA 4ZO9A 1I1YA 1I8LC 1E4WL 3L5XL 1R1CA 4JGJA 3OD3A 1FFNA 3K6SA 3LXCA 5H94B 2Y07H 3ATAA 4YDMA 5C0GB 2OL3B 4KHXH 2ZXWB 1WAAF 4K7PX 1G9EA 2HRLA 3EO0A 1XXDC 3L9YA 1DSYA 2HLAA 2A38A 1IJNA 2C4FU 4YPGA 5F1NA 5GS0D 2DWSA 3CJJA 3KYMA 5T3XH 4QTFA 2IANA 3LN9A 3DIVA 5IIEA 4N5ED 1MVUA 4IMKA 1ILSA 4PJDE 4M1DL 3B9VA 4DERA 1QRNE 2ZWKA 1Q0YH 2ATAA 3H3BC 3APDA 1MELA 4XGZB 5DK3A 5TDOA 3N91A 4TRPH 5IFAH 5A6LA 1HHIA 5F44A 2C8NA 1QFPA 4JN2B 2IDCA 2UZXB 4TSAH 3T4YB 4O2CB 5EU6E 4YXKL 5IGXH 4HW6A 3GKZA 2BZCA 3U1SH 4EMZA 1JZ8A 1JDAA 1N59A 1NANI 3AW5A 1DN0B 4M5TA 4OF6A 1NICA 3C5ZC 5C0EA 4U1LB 3AXLA 3EYSH 1BQSA 3MR9A 3N40F 1IFHL 4Q6IA 1HIMH 3AU1B 1A21A 3CK0L 1VEMA 1YYLH 5E70A 2BSSB 3PWUB 2QLVB 4RAVA 4ZXBC 4NDMA 2AABL 4ZXBB 2QGEA 3IFNL 2ZT9C 4RGOL 5BPPA 4LRIA 2PPFA 4Y1AD 3SKNA 1O6VA 3JTSB 2F7PA 1BVNT 2L7JA 5GS1A 4YR6A 4ADGA 3SKJL 4N2LA 1IEBA 4Z7NE 5ID1B 3IJSA 1BDYA 4BFIA 3FHAA 1QSED 4BE6A 4YZFE 3ETBF 2GCYA 1E2VA 4F7EA 5JPMB 5DVOA 3GLEA 3QIWD 1AHKA 2R1XA 3WJLC 1M7DA 3OHMB 5I1EH 2X9XA 1HI6A 2Z3FA 4GAJL 1C7SA 5B7EA 3G5ZA 2KUTA 4P4RB 2VLJD 4MA8L 1JUFB 5JXED 3ARDB 4N0FB 1FUNA 4X5PA 4YHKH 2V3EA 4YDIL 1X9RA 4MAYD 3RWFA 2ZCKL 5F9OL 3IB4A 1MI5D 2GAZA 4RSVA 4AL8C 2FJFA 4AYEC 3GSOB 2HFEA 4KXAA 3UL4A 2B08A 4Z95L 3S3DB 3BW9A 1GYUA 2J4WL 2IALB 3OKMA 3OWRA 2OZ4H 3C8DA 1Y1UA 2VZSA 1DCEA 1ND0B 2Z31D 3I2CH 5BV7C 5BV7B 3EJJX 4ZFFA 2R56L 4W9LC 4P5MB 3VSUA 2I9TB 1B3JA 3ZDWA 2ADFH 1QUNA 1RULH 3G7TA 4AYFA 1HZHH 1TTBA 4H8WL 1AI1L 3S5LG 1G7LB 3TTSA 5BRZD 3LNDA 2XQYA 1LO4H 2P8MB 1Y6MR 3VFGH 3JVGC 2IPTL 2YKLH 3S4SB 1ML0A 2H32B 3ML9A 2PO6B 4X4ME 4W81A 4MD5B 2ZONA 2ZOUA 4KK6C 4FULA 2NY6C 5DR5H 2DW5A 1E5AA 4IHOB 3QARA 3P3SA 3JT0A 2IBBA 2BNQE 4Y19B 1T4KA 3U4KA 1J1OL 2DLGA 4FABL 4OAWB 1MNUH 3LZQA 4Y4KB 1IC7H 3HC4L 2J1YA 4I77H 1YLBB 3BXNB 4G80B 3ASNB 5IZ7A 3HHMA 3CNKA 2VABA 1TKWB 2YD5A 4NNXA 4UTBA 3NSXA 5BXFA 5IROC 2XIBA 4PQXA 3ATDA 3QR0A 3KPLB 4NKMB 4K9EH 4LPVA 3BP5A 4HFWA 4X4MA 3TZVD 5K9QG 3GXTA 2GTWA 1ROWA 1NIBA 2PMZA 1DBAH 2ZP9A 5EEVA 4FQQB 3WIHL 2J8UE 5D5MF 3WS6A 2EKJA 3NFPB 4G9FB 2AI0L 4H25A 5IHWA 1RP9A 5ITFA 1ZLUK 3U0TB 1NCGA 5FC9A 4HUWB 4RFOL 3V0EA 1Q9KA 1KGIA 1GGCH 2Q2LA 5C08D 5DDHB 1F41A 4FTVB 2J2ZB 1EDYA 1JL8A 4Q2ZA 1I4FB 2Z4TA 4ZO8A 4ZUSA 1G9MH 1N5YL 1XCTA 1OTSD 4LL1A 4NB7A 4W4OA 5HVHC 3KL0A 3REVB 4M7JH 5J0BA 2ADYA 4L4VE 1IL1A 1WC7B 1KN2L 5AYUH 1F6AA 1A7NL 2MRYA 2VDOL 2X42A 5TDPA 3HC3L 3HZKA 1KIPB 2KQMA 2R4SH 3FQRB 1UFUA 1WFIA 3BH8A 5F21B 4LQFH 5CN2A 5T1LB 4BKTC 1J0KA 3HZVA 3MCYA 1E8WA 4PJGA 2FQFA 2FH6A 1KV7A 3DHJA 2FX7H 3ME0B 2YMXH 4AW7A 4JRYD 4ZD3L 4RWYH 5KVEH 5HD8D 3W2DL 2N0KA 3P3TA 2CU9A 5CSGA 4RGNE 3UTSD 2HVBA 1LNUB 4MNQD 4KFMA 4L4VA 3FMGL 3GZKA 3IGAA 1MIML 4HPOH 2OM5A 4MX7B 4OIFA 3MBED 2D3NA 1MQKH 4TF4A 3VSQA 2EYRB 5IG7B 5L88H 4JZJC 4Y2NA 2WK2A 1BVKB 3U4AA 4KWUA 5JLZB 1D5XA 1JHKH 2ZXEB 2Q6WB 1VSCA 4WW2B 3P3YA 1RLWA 4KPHL 4X6CF 4E9SA 5T1KD 4WF7A 4UZSA 1AAJA 3WXVH 1HKLL 3HN8A 2ZSWA 2ZJSL 3F58L 3MA9H 3MO1A 4Y2DA 2DJSA 3HVDA 3VI3A 3O2VH 2VTFA 4HKJA 5BVPH 3OKNA 4P46B 1AR2A 1K6QH 1S3KH 4BWWA 5D7EA 1I7UA 1NAMA 3VYPA 4WJG3 3DRTA 1KEGH 1NBYA 2MMXA 1R24B 1QKZL 1NDGA 4K3DH 4JY5H 1A47A 5D7JB 3SKUD 1F4WH 4UT9A 1KXVA 1SDYA 3FFOA 1FVCA 1P53A 4GO6B 5B1KA 4PRID 4UQDA 3O3AA 3PJSA 2E7DA 2Q76B 2CO7A 5KSUA 2DLHA 3ATFA 1ET5A 3IU4L 2QADD 4LMQE 4XPAL 1PG7L 2W9EH 4HUXA 3OLIA 5CGYD 2FBJL 3VNZA 1VKXA 3MUZ1 5FCSH 1JWMB 1U21A 1NQBA 4JG0L 5DRXB 4WO4A 5SWZD 3WUZA 1U91A 5AOIA 3Q3GB 2W88A 4E41B 4JKWA 3QIUC 2WBXA 3A24A 4IIQA 4E5XG 4YPJA 3V5HA 2Y06L 1O75A 3FB6A 4RMVA 4LFHD 5C0FB 1A4KB 2VZ3A 2Y2TA 3VXOA 4ZMYA 1FGNL 1FFQA 3B9EA 3HA0A 2J57A 3DX7B 2XTLA 2JK5B 3TT3H 5C09B 2VL4A 3HB3C 1KT2B 1E40A 2IH1B 2B1OA 3P40A 1WBZA 4K94C 3HMWH 4OGYL 1AGBB 4G8AC 1A4CA 2YPKA 3TA3A 3BFQG 4N26A 1QEWB 2FL5B 1F1AA 4HMDA 4IHBA 5TE7L 3FNKA 4KY1L 5I6PA 1NZRA 4G2AA 2AJ3A 2V3FA 2PPDA 2Z7YA 3HC0B 1HDMA 3QCVL 2OZNA 3QDMB 2NNAB 5TPWL 2DB8A 1CLOH 2OMBA 4ZTPH 3QDJE 1PIFA 1NANH 2OX5B 1O9WA 4XXWC 1OXYA 2EQDA 1N6VA 4LPXA 4UILL 2MQ0A 2XKUA 3DSFH 3SN6N 4MHHG 3M8OL 2DMCA 3OZ9L 4L29A 1ADWA 4G7VH 4IS6A 2Z8RA 3GSUA 4Q58C 4DVRH 4Z3JA 2D7NA 1JFHA 4PJCB 1RFDH 4GB9A 1E4XH 3IBOA 4HT1H 2A73A 1DLHB 3D4GA 3II2A 2XKNA 4FN0A 4XNXH 4UDTA 4CVUA 5E9NA 3U36A 4N5UA 4DGVH 32C2A 4H20H 1DQML 4AXWB 1B6DA 2A6KB 3V79C 2EVFA 4GG6E 2H9GB 4OLXH 1SEQL 3RDTD 5DHEA 5A7BA 1K9TA 4JHZA 3ZLQC 1C5CL 3O3EA 4HK0B 5DHVH 4ZBJA 3H7LA 1ZSDA 4POUB 4EVNB 1MFEH 5BJTB 3ZDZE 4PB0H 3P3RA 4I9XA 4Y4HA 1GIGL 1SJVA 5D1QE 3CVIL 3IPEA 5DRWB 3MRDB 1C5DB 2R69H 3H6JA 3SE8L 3SY6A 1CLZH 5CCHE 1CLYH 3RNQA 4JFDE 3WKYA 1KEML 1T5XB 2YMTA 3MV7D 4P3CH 3D9AL 3OTTA 3A5VA 3OXRA 4XVUD 2DTML 3G3LA 4Z78B 2VDML 4Y5VA 3GSXA 3GXUB 1NPNA 2GBVA 4HX1B 5GGTH 3F7QA 4PRNA 1KJ3L 1UXWA 5E5LA 4UT6H 2WVTA 4OF3A 3VRJB 5ESVA 4PAZA 3WDJA 1KJ2H 1S9YB 1T5KA 2WAQA 5DJZA 1PKQB 1P4BL 1JPST 4FD0A 5HXMA 4J4PC 4F7CB 3DRQA 2XWCA 4S11A 1JPEA 3MRMB 5DJYB 2KZKA 1WWCA 4G8GD 3NK4A 4JFDA 1T2JA 4LKXB 4F33B 1H3PH 5DO2C 3ABGA 3FCSB 3V9FA 1IKFL 3BP6A 3VCLB 4DCQA 1N70A 2EYTB 5FEBA 1ZSHA 1CFSB 5CJQH 1WS7A 2VXSL 4DETA 3MXVH 4IKKA 3FF8A 5K59F 4JDVA 2F74A 2MQ3A 3CSYA 4ODHL 4R96B 3SCMA 3KJ6L 3L4UA 3MU3A 5EIIB 5AOJA 1KBVA 1N18A 1L3NA 1H5BC 2CRMA 4TTDC 4YVUA 5DURD 1KTDA 5ICXB 1U58A 3BDBA 4FOMA 1AXIB 3AS0A 4OB5L 5CLWA 3EZJB 2F1BA 4P3DA 5CMAA 5HVWA 3OF6A 1S7QA 3QORA 1U3HB 2LFGA 4UCFA 5EO0A 3VXSA 3AT8A 1AHMA 4UIMB 1WV7T 2XWJA 4DESA 2HTKD 2VO5A 1BP3B 4U0QB 4WSKA 3W82A 3QDGB 2WQAA 2EJ1A 3EJPA 4UINH 4ZUTA 4NOBA 1XF5B 1QSVA 1HXKA 2WOYA 2CGRH 3K72B 3W0WE 4RDBA 2OTWB 2ZSVA 1YNTA 1UM4H 4A66A 1FI8C 2RBLA 1P9MC 3GT6A 3RGBA 1ZJAA 3GIVA 5HVFB 4ALAC 2PYFA 5JR1H 4IJTA 1JF1A 4WUKL 2IQAB 3DUSA 4NJAH 4HH8A 3TM6A 4X9HA 1KELH 2Y4SA 1OY3B 3B2VH 5AW8B 1L3WA 1PZ5A 1RLBA 3OXSA 4JFED 4P2RA 4X9YA 2B14A 4L8BA 5GSVA 5HHNA 4JCMA 2D2CC 1S7RB 4Y5YC 2WZ0A 4GXFA 5HYQB 1MCOL 4PJAB 1PLAA 3W0WA 1UATA 2ZOKA 4ELDA 4L8SA 1NM4A 3LIUA 2V2XA 4K23H 3TPKA 2OK0H 3U7YH 1LMKA 1T20A 1BA9A 4U1NB 2WWNA 1RK0B 1M6OA 3QXTA 3WEAA 1FFPA 2YARA 4FP8L 4RZKA 2K6WA 2MOQA 3QXDB 1G7HB 5I1JL 3MROB 2F8XC 4P23A 1E9OA 3NUKA 5J5EA 2J56A 4A7SA 1K85A 4ZMQA 2DN7A 4D9LH 4GRMA 4JFXB 1H6UA 4JPQA 4K9JA 4A04A 5GGQH 4HUVA 2X3BA 4ODUA 5E2WH 2Q7AA 2HVJA 2XQBL 3SPVB 3UERA 5JIMA 3ZJAA 2AERT 4FCHA 2X5PA 2P3YA 4X5WB 3VFOB 1W8OA 4NPYB 2DKUA 3LZFH 2P24B 4JFQA 1M3IA 1XGPB 1PEWA 4GOSA 1U93B 3ULUC 1BX2B 4XBGB 3TFKC 2PW2A 4KXZI 2R1YA 2ZXAA 3WLWC 3P4OB 1IAIL 2C9RA 1F11B 3PL6A 3WEOA 4ANXA 1DQDH 3VI4B 5DUMH 4PJ8D 4YHZL 5I6OA 5EB9A 4UT7L 4ZW8A 2OTUA 2DV6A 1XGYL 3MA7A 2OV0A 4IYKA 3H55A 2ZX5A 4OLUH 5F7NC 2SEBA 5IR1A 3QUYA 3UG3A 1ETA1 3L3IA 3C9NB 1UM6H 3CFJB 3HG2A 2D7QA 5E7BA 3E9UA 3DK2A 2J5LC 2J5LB 4HJUA 3TJEL 5JOFB 1JHLH 3RX8A 3L2MA 3MRHB 5ANMA 2V9RA 4N2GA 3BZFB 3S37H 3QDAA 3IXTA 5F9WB 1K72A 3EYUL 4WU7A 2HX8A 4HSCX 4OFQA 2VITA 1G6RH 5B3NA 5I19H 5GS0L 1HL8A 1XH1A 1UEYA 4PVMA 2UY7A 4KO5A 2AQ2A 3FPXA 3B1UA 3EDJA 3S3PA 4A2GA 1CD1A 2FQEA 3E8UH 5FECA 2Y36L 4N8PA 2ZNWA 3OKLA 4OZHB 1IAKA 5D1XB 1KXQE 2GSIB 2I5YL 1CGYA 5CEXB 4DUVA 4JFHD 3VAEA 2HUHA 3H56A 1U8KA 5I75B 2X6VA 2CSPA 3H4FA 2OJEB 4NSKB 5FUOL 1JK9B 1KXTA 5FIEA 5C0RL 3LN4A 1R19A 4HZLB 4OGAD 5DLMH 4XAKE 3H6AA 4NRZB 4QD2E 3G6DH 3UPAA 1JXKA 3SDCD 3VFNB 1TFHA 3UCRA 3QHZH 1L6PA 2NR6A 4WY7L 3WFZA 2ED9A 1S5IH 1W72A 1JN6A 4K7FB 5G55A 1NWPA 4NYLA 5DMIH 3HR5B 1JPSL 4PJ9C 4R0LA 5EC2B 3D85B 1LJMA 3JWOC 1EWHA 2YXMA 4NAQA 2E8ZA 2P45B 2NRDA 3N55A 1YG9A 2XU9A 4GXVH 3HJEA 3CUPA 1JF5A 4UQ9A 2VDLB 2NLJA 5FKPA 4NQSB 3MQIA 5C2BL 4GKZB 5J3HD 5G4OA 1X5KA 3FL7A 1IM3A 4U0RB 3HFMH 3QQDA 1DEEA 1TZHA 3NCXA 1UACL 1AH1A 3UACA 4MAZA 4PS8A 3DSNA 2H2PC 3V4VH 1SJHA 2JCCF 3GXMA 4HS8L 3LNIA 1TO5A 4QGYA 2Z1KA 3LB6D 4PP1C 4MJIE 3L95B 1YEGH 2FD6L 4KK9C 5JW4Q 5B1BB 2JIXB 4FQHA 4GRLA 3X12B 3SO5A 1ZE3C 1MHEA 2K78A 1MWAL 4OY9A 4QGTA 2VAAA 5CLTA 1NLBH 1SRDA 2CJUL 2VR7A 3LQMA 1IBGH 1BFOA 1J87A 3S7GA 3VSTA 3KE0A 1A4JA 2XVLA 4YHIA 1W0VB 1MH5B 4CDGC 3ARGC 3ARGB 4OJCA 4LEXL 4FZEL 4ZX5A 4XO9A 3BEVA 4MQ7A 3DYMA 3FQNB 4MJIA 5FO8A 3VU1A 1ED3B 1AKJA 2HYMA 3WUWB 4QTHA 5HDOA 3UYPB 2RCSH 4KHTL 3CAFA 2X1PA 2R0KH 4Q6YA 2EDDA 2VL5B 4NZRH 5FA4B 5JHDD 3WTTA 2ZXDA 1CGXA 3TH2T 5KYWB 5KSBA 4AQAA 3FAWA 3MAWA 1T7VA 1BBJA 3N1FC 4OD1H 1PTZA 1R5WA 4HBQA 3M88A 4I0PA 3FQ1A 1T66C 4HJTA 3NFNB 4QYOB 1S7SA 2BOBA 3Q1SL 1QSEE 1E9PA 2GJZA 4Z3TA 1FFTB 2WKLA 4NHCL 3BVNA 2WBJA 2VDNB 4JFOA 3TYFB 1E5CA 5TH2A 4JFWA 4Y9CA 4PLKC 4ZSOA 5F7BA 2CZNA 2JXMB 1MFBH 3DROB 3H2WA 4IRSB 1EEQA 1WFTA 4HSQA 2ZCLH 4U05A 5IVXB 1AQKH 4M6MH 2H1PL 2V7NA 4YFEA 1E28B 3IDUA 2BVQB 1EJOL 3KYKH 5TGBA 3DMMB 5LNGA 1KCKA 3GMNB 4OZFH 1V55B 4RBPK 4KUCD 1ACXA 1CB4A 4WVRA 1IBBA 3L4XA 4YSEA 4MQTB 4PJFE 4AY0A 5ICZA 4GQPH 5HPOA 1JE6A 4NQCB 4Y16C 4Y16B 3QZWG 2XYCA 1A2YB 4O4YL 5CU9A 3NP3A 3MLYL 3ZHNA 2NY5C 1HESA 3VX1A 5IB1B 1B0GB 1NFKA 4M3KB 3WGVB 1EFXA 3SKMB 4BFGA 3L48A 3D39E 3V9CA 3W9EA 3N1PC 1IVTA 4PJ7A 4A6YH 4N86A 2QVTA 4JFSA 1T1ZB 2BVEA 4MJ4A 3I75B 4XRCB 2F5BL 3LPWA 1TTUA 3F04A 2M83A 3PQYB 2FGWL 4M4PA 4Y0GA 2E7LC 1LXMA 4XBPA 3SPHA 1T3FB 2A6IA 4FTDA 3QJRB 2EDKA 4X6DB 4F2ME 5DEJA 4E68A 1U95A 1NGZA 4Z3IA 1GY2A 2FWOA 1N67A 5IJKA 5GGUB 2Q3XA 1CDUA 1DANT 4QRTA 2H8PA 3D39A 4BSVA 1MXGA 4APQA 5FV2A 4ODWB 1BPLB 5D6CB 4WEBH 4GBXD 3VXTA 3UAJC 5BW7A 3EH3B 3TBTB 4DO5A 4NZUH 1ADQH 1IAOA 3EHBD 1DFBL 3DJSA 2K7PA 3B43A 3KLAB 5IHBA 1J5OH 3A6BH 3PHOA 2NUPB 4HEPG 3HNSH 4IU2A 4J3WA 1UH2A 4CVWA 2CHDA 1BLNA 3K0WA 1QQDB 1OL0A 1MJUL 5CD5C 3I9GL 5LKNA 4F2MA 1MUJA 2YOCA 4XPTL 4ZS6C 4GYBA 3T3ME 4Z7QB 2OLDA 4BBWA 5IP4A 4L9LA 2RACA 2YGOA 5T33H 1LO5B 4NP9A 4KKLC 5FA3B 2VRQA 4WGWB 4X8CA 2ARJQ 4KRMB 1LQBC 1N0XL 4DZ8A 3UZVB 1OCZB 5EO1A 4KGJA 5FX3A 2ZD0A 1KZQA 4ISVB 1AO7A 3QNZA 4NO2B 5C08E 3RPIA 4P2YA 3PFQA 3RZCA 3O6MH 1C12A 4EO5A 1KPVB 3II3A 3C09B 4NKIL 2HFFA 4JB9H 1D5ZA 3MGTA 4TQIA 4U7MA 2CLRB 4R2GC 1F5WA 2B2XH 4HIHA 2P80D 1RJYA 2X70B 2DWEB 1KSRA 3CLFL 4ZDHB 3UYOD 3TNNA 5F7EL 5DYFA 3OL2A 1QVOA 5K9KA 4KKCD 1MCRA 2IXQA 1CL7I 4JUTA 1KB5A 4ZAKA 4L4TB 4XNUL 4V2BA 1FC1A 4QRUA 2QTEA 2DQTH 1M9WA 2B8OT 2JQZA 5D2LE 1NOAA 1KGCE 5DEGA 1HH9B 1AXSB 2CKBA 1WBYA 4JM2C 4JM2B 3UAEA 2YJLA 4P2QB 3MLUH 3K91A 4CVZA 1NCWL 3SKOA 4S2SB 3TF4A 4MNQE 2CJTA 2F2HA 5F7DB 1ET7A 2QFPA 3W39A 4C4KT 1N10A 3DBXA 3NVQA 3AS2A 3S3JA 3C5ZD 3K8LA 4X5LA 4FA8A 3MV9B 4PI2A 3HRZA 2UX6A 3OHXB 5AZEL 4N6RA 4YZWA 4ZG1A 4KKQA 4NZDA 1UH3A 2WM0A 2ZKMX 2WXKA 3MRCB 4XMPL 4F7MA 1CDYA 2NXZD 3TBWA 5DFWH 2X1OA 3UOAB 3FZUC 2Y7OA 3MRBB 4X98A 4PJIE 1T0MB 2K45A 4WENB 2HG0A 4Z5RB 3STBA 3UTZA 1SYVA 4LGPB 2AANA 1A3QA 1Q1JH 3DX8B 2DWDA 2X6MA 2FJUB 4XNYL 3GMQA 5I8KH 1BBDL 4BSWA 4ODVL 3I6KB 5AAWA 1FZMB 1OT1A 3WNPA 2QQNH 2BSTB 3QQ9C 1M7XA 3II1A 3KYOA 2C9SA 3IAPA 3MXWH 4PJAF 1HXMB 4BFKA 1X7QA 4GLRI 1K2DB 5IV2A 1QI4A 3EADA 2FATH 3LZPA 1YA5A 1W8EA 2XYBA 2ZOWA 4QTIL 4XC1L 1NEZA 5SWZE 4E9QA 1OGAB 4GQQA 4IDJH 3G5VA 1OAYH 2BFGA 4NO0B 2G5BA 4Y9GA 4NWTH 4QR7A 3NIGE 3TA4D 4FGMA 4Y9BA 2I07A 2XZAL 4B9GA 4JO2H 3I6LD 2X44D 4HH9A 4K9EC 2JJSC 1QFWI 2XVBA 3HG1B 4HUNB 2YQ2A 4YSDA 4ZJ9A 2DQEL 3QP3A 4V1DB 3BH4A 3ET9F 3V0FA 2IGTA 3VXUB 1ZWIB 1O6SA 2BNUA 3HS9A 3LKQA 3ULUF 3CFTA 4PWKA 1A9BA 4X83A 3C60B 1GPOH 3RX7A 1QABA 4JPIA 4KQ3H 4KK6D 3X3FL 2ZUQB 2Y6SC 2BLFA 2NY6D 2XACC 3BJ91 1X5LA 3FT4B 2OA9A 4R8WH 4WTXA 5HHQB 2B1AH 1GJIA 1C8PA 1FSKC 3LAFA 5FWRA 3A3YB 4NKQB 4IRJA 4AMKH 5J56B 1K4CB 1CG9A 2P47B 2XWBB 3CFCL 5DVMA 2Y5QA 4GAYA 1FRGL 1VCAA 1FP5A 3WSQH 4GUPA 3E6FB 1X4YA 3HG4A 5L0QC 3VA2C 5TE4L 5L0QB 1E4WH 1GRWA 3SE3A 1GC1L 2ESVD 1JZIA 3L5XH 2F1EA 4OZIA 4HHAB 4DN3L 2P49B 2QVMA 2VM4A 2OPCA 4PR5A 1NBVL 3GUFA 3AREC 4LE8A 4EI5D 4JQVC 3L6FB 5CZVL 1IKNC 2RD0A 3W3BA 5E8OB 1HCYA 3MODL 2DWXA 1LLAA 3I02B 3VWKC 2DIEA 5KS9B 3EBHA 3IDXL 3N41F 4JE0A 4TL4A 1PZ2A 4JGUA 5J6HB 4M1DH 5I71C 1QFUL 5I71B 1JV2B 3US9A 3EGDB 2C9XA 1I1AA 3RVUD 5A3ID 3ZE0B 4OZHF 5IHUL 1EHNA 3AFLA 3ROOB 5FB8A 3W9DA 3H9SD 3PV7A 1KYOK 5B8CA 4YXKH 4PW3A 2VM3A 1KDJA 3EJZC 1O7DC 1B9ZA 1P2CB 3MV7E 1H3UA 2A1WL 3MZTA 1SXAA 4AUYA 3RU8L 5A2FA 1AGDB 1NUFA 3IDGA 5BO1L 3AAZA 2IOIA 1NKRA 3ALXA 3IMVA 3ML8A 1MW0A 1IFHH 4WW1B 5F71A 3INOA 4FFYL 4LHUD 4XH2B 3CK0H 1EA9C 2DBLL 2IGFL 2PXYC 2DEYX 2NQDA 4Z1PA 1EO8L 2AABH 1T80A 3IFNH 3OB8A 2FNBA 3QQ4A 3ARPA 3D07A 4RGOH 1N2RB 1CXEA 1R47A 3QSKB 5EULV 1NCCL 3HZYA 4M4RA 4HJIA 5I1CL 4N90E 5HHVL 1JWSB 3MFGB 4AYDC 4Q8BA 1K5NA 1SJXA 1WAAE 4UU9B 5DWUL 2X1QA 1Z3RA 4I13B 3X14A 1Y0LB 4M43L 4QRRB 3FS9A 2O61A 3GBDA 3FUJA 3RKDD 3WJMB 4HS6A 3JZYA 4GO9A 3OSVA 2UXGA 1VFAA 3WD5L 5CWSA 4GAJH 2G3MA 3RVVD 3V5KB 4KH9A 3NMEA 4HJ1A 1AP2B 2EICA 4MA8H 2FR4B 3M1BA 1PZAA 3WTWA 5A2KH 1Y7VA 2NW2B 3C6LD 5JW5B 4YDIH 1R0AL 2KZBA 3X13B 2ZCKH 5F9OH 4IBLT 2N59A 3GEFA 2AQPA 3SIKA 1S78D 1WAAA 1XF3A 2O5ZL 1FBIL 3RBGA 4NWUL 4Z95H 3ILQD 2J4WH 5KSAA 5LBSA 3SOTA 5E6YA 3HI5L 2ZWZA 1JGIA 3PWNA 3LXBA 3IDNB 2R56H 4M61B 4BM7A 3MDJA 3AC0A 3MX0B 3QI9C 5HDBB 4H8WH 1AI1H 1Q72L 4JPSA 3WJJA 4PRDA 2BWIA 2CO2A 3O9WA 3Q9QA 2IPTH 3UTQA 5I1DA 1VRSA 3FQXA 2JI1A 1MFCL 4GSXA 5IMMA 1YZZA 1ZIAA 4F15B 3LKSA 5GJSL 5HHOD 5DD5L 1TCRB 4ACTA 1I3UA 4U1GC 1DUYB 2QQLL 4U1GB 3UMTA 4JFEE 1QFHA 3OZLA 1ZDSA 1J1OH 3BIKB 4FABH 3F64A 3NEEA 2Q86A 5AG8A 1URIA 1MREL 3HB3D 3HC4H 3K81A 3RWDB 1ORQB 4AQ1B 2QSVA 4U7KA 3IXAB 5GIRA 3UJTL 1LTXA 4N8UA 4AT6B 4PGDB 4HGWA 1A1NB 1F3JB 4N0CC 1SDDB 5DC2A 4BCXA 2F53D 1WICA 4FG6C 3HAEG 4EN3C 4A2HA 5DHVB 2KMWA 3PP3H 3ARRA 5FCUL 4BQBA 4Z77B 1ACZA 5EBWA 3VGDA 3HJ0A 3WIHH 1NGYA 2CHWA 4DQAA 3POHA 2AI0H 3QXAA 5FYKL 4HWEL 3VJ6A 3KPRD 3SY0B 4RFOH 4FFVD 4RIRA 4E9LA 3BUYB 2VW4A 1ZA6B 4U6YB 25C8L 3FOLB 3A67L 1X6LA 1N5YH 1QI3A 3B9KA 3RIAF 1AVAA 4I18C 2XTJB 1FCCA 2E7HA 2QSTA 3Q2NA 4UANA 2X7LB 1KN2H 3M45A 1A7NH 2VDOH 3BAWA 1KJ2B 2Y1VA 3HC3H 4YDVA 2E7MA 2WXIA 4HIJA 2A7BA 3LRKA 5F70A 4J1UB 4TULL 5AVWB 2DYPB 1AHWA 4PGEA 1CI5A 4LLYB 1T0PB 4Z76A 5EU7C 5HDLA 3ULVD 4ZD3H 2E74C 1AGEA 3HUJF 3W2DH 1VCBC 2E9GA 1KV3A 2D73A 1SJEA 3CX2A 5DQDL 3TCLA 5DJAA 1IM3D 2FT7A 2BDNL 3FMGH 4ZMZA 1MIMH 3S98A 4WJ5B 4GLRH 1AD9A 1FH5L 2W0FA 5DD1L 5HYJB 4LVOB 4OLEA 2NY3D 4WI8A 5K93A 4L8CA 4CSTA 3S5LB 5LVEA 3KDMB 1TVBB 2YPVA 4KPHH 3HPLA 2NY2D 1HKLH 3CWGA 3CCHB 2ZJSH 3F58H 1IAII 1CZ8L 1CIDA 2WYZA 2VB5A 2LQRA 1YUKB 3QQ3A 3QBTB 2JQMA 8FABB 4KQ4L 3BKYL 4WFED 5T1MB 4JFHE 4DAGL 4IBVA 1GVIA 5DO2D 2XWEA 1WIUA 5D1ZC 4MQXC 5D1ZB 4Z7QF 3RGVA 3VFRB 1YN6A 1B4TA 1QKZH 2F58L 3R06A 4M56A 4Q9BA 1P7HL 4U4BA 5FYKE 5GGSY 3DPDA 5D5MA 3UADA 1LEKA 4RMRA 1FL6A 2YMOA 4QT5A 1XF2A 1M7IB 1S5HA 2NTSP 1MFUA 5EFIA 3RY4A 2ICEC 2ICEB 3D3VD 3MRRA 4ZUUA 3IU4H 3QFDB 3DO7A 4K71C 4XPAH 1PG7H 4LLQA 4RAUB 2FBJH 3CZKA 1WH0A 4TTDD 4JG0H 2ZYHA 3BAKA 5DRZA 5AVVB 1NC4D 4JHVA 4Z3EA 2XJLA 2WINB 2YD6A 4IEFA 4PGCA 2Y06H 2EDTA 4HZAA 2QGDA 5JPNA 1OARL 2C9PA 4DVBB 4N1EA 1JV5A 4S1DD 2FT8A 1XDTT 4UQEA 4X6CE 2KZWA 1QTSA 3C5SA 1ZLEA 3LSOA 4X50A 3TESA 4CVXA 2CXKA 2IAMB 5BQDA 1RK1A 2J3SA 1HEZB 2EXWC 4M8UA 1B9KA 4P9HC 2OSLA 4JM2F 4OGYH 4B6ZA 4DK3A 3I9AA 4ZTOL 1RPKA 2OMTA 5SWQA 5TE7H 2ZX8A 4KY1H 4U7SA 1A7PL 1CXKA 2SODB 5HGAB 5AD0A 5IM7B 1KG0B 2E6JA 1L9MA 1HQ4B 4ONFL 3KBHE 3QCVH 3OVUB 5TPWH 3K8MA 2QPDB 3HE7B 4IGBD 4X6CA 1JK8A 1MVYA 2XPGA 3ECUA 5ID0A 4E9WA 4ZFZB 4ELME 2NY0C 2NY0B 2DQUL 2WGXA 2UX7A 5MEOB 4LARL 1XF4B 3C5JA 1QTYT 1G9HA 5KANI 4FXGC 4FXGB 5A2BA 1KGXA 4UILH 3WHXA 2WTRA 3DJ9A 3EYQD 3M8OH 1MZZA 1RIVL 3OZ9H 3P2BA 1C9SA 3T1FA 4Y4FD 5HBBA 3OKYA 5C7XL 1NMCB 1OP3K 4NFDA 2W60A 4KX7A 1ZHNA 5E95B 1Z66A 1EX0A 4XMZA 1AJ7L 3AQZA 4QWWD 1TITA 2IG2L 2BWDA 2J55A 1DQMH 3L4WA 4NQDB 3LH8A 4PSRA 1HHKB 1SEQH 4UNVA 3WL9A 2BNRA 3LZLA 5CEZL 1N0LA 4LHQB 1C5CH 2W07B 4J8QA 3Q9PA 1RQ5A 1UH4A 2IVFC 4U3XA 3CIQA 4LBEB 4PV8B 2NSMA 2VW6A 1ZLVH 1BZ8A 1GIGH 1G6RB 3OM3B 3CVIH 4OIBA 4MS8C 3NRFA 3SE8H 2H1XA 3VYNA 4UM9A 5DFTA 4F5CE 3TFKD 4KJYB 1KEMH 2OP4L 1WWAX 3CC5B 5EUOB 1S8DB 2RTTA 3D9AH 5DFAA 4WHYG 1PIGA 2VCOA 2DTMH 3LZOA 4J3BA 5A1AA 2VDMH 3KBFA 1FDLL 4O58L 1Z9SB 3AWGA 5EBMB 1NFIB 5DYOA 2WVVB 1HJCA 4RQQA 2ATPB 1KJ3H 3KPQA 3L3DA 1UZGA 1DVQA 3IJEA 4M1CC 2R8SL 3T0EA 2QVFB 1L6ZA 1BXUA 3V95A 2Y7SA 4IK6A 1ZLDA 1ACYL 3KWWB 3PGDB 3H9HA 4A2EA 1TCMA 1P4BH 3Q5TA 1G43A 3MLVL 3MLWL 3V6OE 4MD0B 3VXNB 1U2YA 4FMVA 4X8XA 3CBKB 2C1PB 3L81A 3KZ8A 1YDPA 4ZQKB 1EAPA 1P5UA 3SDXB 2FJGA 4O2EA 2ADIA 4WUUB 3QWOA 3TCXA 3BHBA 2LV4A 3AU0A 1IKFH 1YEWA 3B7RL 4F3FB 2AVFA 3JV5A 5DJDB 2QL1A 5IOPB 4JW3A 2BY0A 2BVPA 5CZRA 2VXSH 3DHPA 5EEUA 5FK9A 2AV7B 2C4XA 5INCA 4ODHH 1M6UA 5CEYB 3KJ6H 4XHJC 3FB8A 4AEHL 3FUNA 2H41A 1KPUA 2XN9D 4XVJL 3V6OA 1Q9OB 3CFMA 4JREB 2YRLA 4WJKB 4WNJA 1XCXA 4WWPA 4QLRA 4OB5H 3T3PF 3BMWA 4TUJA 2X4TA 1XCQB 1NBCA 5EG6C 4JX0A 1G7QA 2NW3B 4MNGA 3QIBC 3TNMB 5CEZE 4HFUL 3T4AA 3V4VB 5KS9F 2BHFA 1HSBB 1IC4L 2NY7L 2YRPA 3UZQB 1U2CA 2EXSA 4OFVA 3K6FA 1YECL 2HTLD 3T2OA 2GIYA 4N20A 1G0DA 1PDKB 1TVHB 4P07A 4PJ9D 3UG5A 5HPMA 2C9QA 3BZ4A 3MRGB 1J1XL 5FFGA 4NN6B 1VHPA 1Y6KR 3PHAA 5D93C 4WUKH 3H0TB 4AM0A 4WZ9A 1ZY9A 4Y7MA 3GF8A 4DEPC 5EUKB 4DTGL 1DANU 3LRSA 5EO9B 3VVWA 3PWJA 3AROA 3V6BR 5C0BD 1DE4A 4GPVA 5A16A 1QLFA 2Q7YB 4OCMC 2QSQA 1COBA 1MCOH 1W8NA 3PWPD 4UAOC 4UAOB 5JO5B 6PCYA 1JD7A 2A9NH 4LZKA 1J5DA 1HC1A 5C07B 2J8HA 4WV1B 3PUCA 2NYKA 2PWFA 4PYGA 4KU1A 1PYWA 5KG9B 1AZVA 4C56D 4ODSL 4FP8H 1CR9L 4YHPA 4X9IA 1NGPL 3ZN6A 1D9KC 2ZX6A 4AL8L 5I1JH 2LHAA 1WZKA 5DD3L 2EUXA 2LU7A 1I7TA 3EUUA 3WO4C 3WO4B 4F20A 5GGSB 2P52A 4RAHA 3NJKA 1GH7A 1PLCA 2O6EA 4WNQA 1MJJB 2F6AA 2ZG2A 3FU6A 3L3OA 4GG8B 3RNKA 1HCFX 2N0MA 1MRCL 1I8LA 4G3YL 2DQHL 4YE4L 5F6HI 2ICCA 2W95A 3VXRD 2JNZA 1RURL 1O7SA 4KO6A 3KPNA 5C0GA 3VRLF 2OL3A 4BZ1A 1P1VA 2MCG1 3TASA 4QHKI 5BS0B 1S9VB 1IAIH 2DKSA 1T2QL 1SLVA 3LXAA 2X4OB 3R7QA 2OAAA 2DQFB 3F8UB 4OZFB 1GJWA 4YHYC 4ENZA 4YHZH 1Y6NR 4UT7H 2ZUYA 4UOW1 1BIIB 4X7SL 3ZKMD 1XGYH 1FN4B 4LFHG 2K9UA 4RMWA 1E5BA 5DCCA 1SQ2N 2CDGA 4XGZA 4KNQA 2J6WA 1HILB 3IJHB 3SBWC 2GJ6B 5EBLB 4JN2A 3TJEH 2UZXA 2AV1B 3O3DB 4WHTB 3T4YA 3I9IA 5KZCB 3AQDA 4J12A 4XMKL 4A6YB 2G2RB 4HYTB 2F7QA 2O1AA 4H13C 2UZIL 4YEEA 2EXTA 1DN0A 3EYUH 5IVOA 2EDXA 5CS7A 3CN2A 3K8KA 4BV1A 1X7TA 3TURA 4D9RD 3KPSD 5JYMA 1UXMA 1R34A 5ERWB 4IMLA 5GS0H 3UBXG 2OR9L 2V9UA 3AU1A 4YSOA 1OSYA 4JRXB 5CINL 3PWUA 3SBQA 1E2ZA 1Z2KA 2X40A 3LRLA 2ZXBA 3LPOA 1JP5A 2HT2C 2Y36H 4ZXBA 3VFUA 1XFPA 4ZPTA 5DZ9A 4D94A 4YLBA 5DJ2B 1FVDA 3V8CA 2I5YH 4PRHD 5ID1A 2MPAL 3LNEA 4G71B 1KGYE 4JDZB 2PR9A 5I28A 3MNDA 5IUCA 1TZOA 3U0PB 5JPMA 4J8RB 4M02A 1XB8A 4UMGA 5C1MB 5FUOH 3D0LB 3ABMB 3WJLA 4W9IC 4LSSL 2DDQL 4HAFA 4FAAB 5C0RH 1RZGB 3AQYA 3I6LE 1HTYA 4P4RA 2X89A 1SOXA 3GO1L 3S35X 1JUFA 5LBGA 4YNYB 3IMBA 1GOFA 3M07A 4N1CA 4WY7H 4EEEA 1DJHA 1JPSH 4FE9A 3ZW3A 5GZOC 1BFSA 2XKSA 4TUUA 2YBRB 3DHUA 5I0VA 5I8EB 3AG1B 4GEIA 3GSOA 4PIBA 1DLFL 2E3VA 3VFSB 1T0NA 3OG6B 4K5MA 1U8QA 1NJ9A 2IALA 5MHSD 1TTFA 3LIZL 1ND0A 5FYKU 3CH1A 5C2BH 1OZTG 1KBGL 3UAJD 2AMUA 4P5MA 2I9TA 4FERA 4XMWA 4JANB 1UACH 1BV8A 5DJ0B 3S48A 1DJGA 2ESVE 3X2QB 1G7LA 5LNEA 4HS8H 1D7CA 2IJ0C 3S4SA 2H32A 5E8PB 3QO1B 4ZS6D 2LOEA 2RR3A 4UM8B 4HWBL 4MD5A 2FD6H 5ES4B 3FO1B 4DSYA 4PJEB 3N1GC 2CO4A 4OZ4A 3WO3B 4QRPD 3QNFA 4U2ZA 3OAZK 4Y19A 4G7YL 4IOFC 4DGYL 1AR1C 1MWAH 1OOAA 4TNEA 3HKFA 1FFNB 4OAWA 2CJUH 2VLRD 3E9TA 4Y4KA 4JQIA 1OWRM 4DKTA 3BXNA 3KLHD 1MCDA 4G80A 4I88A 1J9RA 4P0DA 3FBQA 3HCVB 3SQBA 3E3QC 1G5AA 1KBWA 3H9SE 1B4JL 4FZEH 4LEXH 2HLFC 1SN2A 4NKMA 3KPLA 5IROA 1EQWA 1A7BA 1SY6L 4UOQA 3UTTB 4AK1A 2EVHA 4UUJA 4UB0L 3MRFA 4FQQA 3ZKSD 4KVCL 4KHTH 5C0AB 4M93C 2NOYA 3NFPA 4G9FA 5T5NG 2X9ZA 3KPOA 4JY4A 4HJGB 3O6LL 3U0TA 3ENEA 3TVMC 3X1EA 5F7KC 1C5BL 1OT4A 1OEZW 3MJ6A 5DDHA 1OM3L 1OLZA 1JRHI 3BAIA 4FTVA 4PBVC 3CFDB 4L05A 3CVCA 3HW7A 3RBSA 1I4FA 2OMZA 3MBWB 4PJBE 3TEYA 1MDTA 5B4MC 2JCCE 1N6QL 3JWDC 1PS3A 1RZFL 2COVD 3MFFB 4UQCA 3Q1SH 4K94L 4ZW3A 3UAAA 1WC7A 5HGBA 5IB3B 4Q6IB 4QKTA 2WZPA 2MIZA 4N1HB 2YN5A 4NHCH 4EKJA 2J12B 4PJDB 5DZJA 4J3OD 4R3SB 3RWIB 1QRNB 2BY3A 3FQRA 4RAVB 4NQED 1M3JA 2AITA 4QOKD 1FIGL 4QXUL 2ZKWA 5C86A 4B95C 4L48A 1SEBA 2H1PH 3J7HA 3ME0A 5I1AB 4DKFL 3PLYA 5LGJA 4A63A 1EJOH 1IARB 3GZPA 4RGMB 5EU6B 5HTSA 3EYFB 3DTDA 3D34A 3C6SB 1CI3M 2JCCA 4JFFE 1Q9LB 5F9DC 1LNUA 5FPIA 3WTUA 5LJYH 2YC1B 3WIAA 4O4YH 4MX7A 1M7DB 3MLYH 1GCYA 4LSTL 1M9SA 4GP8B 5IG7A 4JZJA 1QRKA 1BVKA 5DMJB 5JLZA 2GFBB 5HHME 2Q6WA 1IGIL 3RRQA 1TSRA 4WW2A 1UJ3C 1ZT1B 3MLTB 3OSKA 3DX6B 4ZMVA 2XZQL 2BSBA 2WXOA 1EMTL 3EBGA 3L1OL 4AYID 5BZXA 2F5BH 3TGXA 4Z7NB 4ZZKA 4JK0D 5SWSD 3LEVL 2FGWH 2FQDA 2GAZB 4C4UA 5IMKB 2FJFB 1P7QD 1E9QA 3ULVL 1M2VB 4JFFA 4P46A 1AYOA 1CGTA 3IK2A 1RUML 4IBSA 5IVZB 3OPZL 1UOLA 4ICWA 3VFTA 3KLKA 4A1RA 2Z8SA 5HHOE 3EJTA 5CHNB 3RG1C 3RX9A 4N3TA 4AYFB 3QR1A 3RVTD 1NIAA 1RZIB 1U8JA 2I85A 1DFBH 4HU8A 2DQJL 4KZEL 4QEGA 2VR6A 4EIZC 4E36A 1DVFD 2WCPA 5ACLA 5KVDL 1NCDL 1JWMA 4P5TD 5CJXC 1VFMA 1MJUH 2HJKB 3I9GH 4FYTA 5F7AA 2NZIA 2DJMA 1E6OL 1QBML 2DQCL 1JGVL 4XPTH 2JWYA 4E41A 5IMOB 3QIUA 2GK2A 5AKRA 5CLYA 3TCTA 2K8QA 4NNYA 1HYSC 2QVKA 5TF1L 2KHAA 2VW7A 1A4KA 4ZFGL 1JNNL 1N0XH 4LEEA 1WUZA 4X4YA 1IAIM 2VZTA 2P46B 2BP5M 2DI9A 3DX7A 4WNSA 2JK5A 5CKAA 1EAQA 4YHML 4LKCB 1KT2A 3KBEA 2HFGL 4LDOB 5D7HA 1XGRB 3T0XA 1NOFA 1UOKA 1IM9D 1YAIA 4R90L 5F0PB 1AGBA 3WKPA 4BK5C 4YBHA 4NKIH 4NI6A 2FL5A 4OFPA 2CPCA 3FTUA 4TN9A 3M7FB 3SDXF 2BNQB 4TQPA 4H25B 3BVWA 5ITFB 2BY1A 2Q20A 3CLFH 4X42A 3HC0A 1XTLA 5F7EH 3ULSA 3ZKXB 3QDMA 1JYWA 1Q9KB 4XCNB 1EEUA 3EDEA 3KS0J 4M7LL 2GTZB 1MG3C 3SE4C 4XNUH 3BQUC 3BQUB 5DJ6B 4ZUSB 2EDFA 1XCTB 3PHQB 2OX5A 1CWVA 3EUDA 4AGQA 3ULVE 4XXWA 1PJ9A 3B6SB 4EIGB 3OKEB 2O6DA 5FW7A 3OWEA 3D08A 4TSBL 2QSCL 3JTBA 3K7UA 2HLEB 4PWGA 5C9KA 3ISRA 3HZKB 1NCWH 3ARYA 3V4UL 1NC2A 5J57B 2J8UB 3EJZD 1E42A 2E76C 4G6AC 5L8JB 4HJEA 3BH8B 5AEAA 5DVNA 2WZAA 3RVWC 2IIJA 1U8HA 5GZND 2B5IB 3HZVB 4GY4A 5CKGA 4ALAL 3MJ9L 3GLAA 2X6CA 1QSFD 4N2EA 2J1WA 4A2FA 3MMEB 5CILL 2H9GA 4OJAA 5AZEH 1T6WA 2HP4A 3L4VA 3BH9B 5BZDA 3BRFA 2IH3B 3Q6GL 2HCZX 4HK0A 1AFVL 4M03A 3T6ZA 4XMPH 5AOZA 1J88A 4D7PA 3QFJE 5CO1A 1OP5H 5BJTA 5KVDE 4L4VB 4Z7VE 1HXYB 4NUQA 3KDPB 4N8VB 4OQTA 3VE0B 2Z91B 5KBPA 1DFXA 5DRWA 2YS4A 1C5DA 3MRDA 2DQMA 1FFOB 5HDRA 4WFEE 5ABAA 4PVLA 3EH5B 5C0NC 3KYNB 1T5XA 2NNCA 4RNRA 4XN8A 4P4KD 2BSRA 2YKKA 4XNYH 4QRQA 3TV3L 1BBDH 4H8WC 1G94A 2ZSWB 4ODVH 1KIUA 4C4BA 3CZNA 5FV1L 4D8OA 1FNFA 1ODUA 4UZGA 3VRJA 2WVUA 2HMID 3ZTJH 2AF2A 4HKJB 1S9YA 4RGNC 2ZIDA 4RGNB 3OKNB 4XZ4A 1UUSA 3UGUA 1PKQA 3AGVA 3H8NA 3QFJA 2QZ5A 2FZ3B 1I7UB 2CLVB 1WHPA 1YQ2A 3RJQB 3L13A 3V0VB 4FFZL 4J4PA 4F7CA 3FKUS 1DJXA 3GLDA 3QYCA 2WW8A 3MRMA 4XPHL 5E6IC 5E6IB 4AZUA 1NDGB 4QTIH 4XC1H 5I76B 1BXVA 3IGKA 2AQQA 1HH6A 4F33A 4RLDA 2JTYA 1DVTA 1FVCB 3FCSA 1QP1A 1FAKT 3ISYA 3FQ4A 3O3AB 3VCLA 2VXQL 2EYTA 3HG5A 3APNA 2P48B 3UPRA 2XZAH 1CFSA 1VFOA 4HUXB 4QNPF 4ZUWB 2P44B 1VKXB 3K74B 4QUOA 5DJXB 4CN1A 2DQEH 5CNHA 4WO4B 4K8RD 4YGVB 4H1LA 3A6CL 3RWCB 5EIIA 4IIQB 2X3CA 5EZOL 4HCIA 3VH8A 4S0TD 4KRLB 3TN0D 3J27A 5H37G 1IC1A 5E9AA 4DP8X 1S2EA 3GIZL 1E43A 3VW3L 3EYVB 3X3FH 3F3HA 4KOBA 5EF3A 3DI3B 4UIMA 2V7HB 3WNKA 4U3SB 3PXJA 3VWJC 1FG2A 1WBZB 3QDGA 4FF9A 2P8LA 3CFCH 1HWHB 1ZHKB 2R15A 1E5UI 4H8PA 4CGTA 1XF5A 1FRGH 1ZD6A 2VDOB 2YPKB 3GMPB 3TA3B 1OCRB 2OTWA 5TE4H 2OCFD 4R4FL 4XB3A 3GMMB 1GC1H 3A22A 5C8JB 1P6FA 4L5FL 3EO1A 2XBTA 4DN3H 5CSZB 2AAVA 3DVFA 2AJ3B 2WOBA 1P9MA 2JCWA 3MLSL 3QVAA 5IQ9B 5H35A 1NBVH 1NWOA 2MSPA 4KKAC 3HFFA 5IBUB 4XWOD 5CZVH 1RY7B 2IQAA 4WK4B 1UD6A 3MODH 4QIRA 1KCUL 3QHTC 1KCSL 1OF2B 3QUKB 4I3SL 3IDXH 2XV6B 5KVFL 5AVSB 3MHZA 1S7RA 1QFUH 2WKOF 4JG5A 4Y5YA 4PJAA 4YBLC 5T5FL 4JVUA 4BH7B 1RPUA 3FT2A 3M17B 2I27N 5IHUH 1PZUB 2BCMA 5E99L 2XKNB 2R0LL 1KIRB 2KDYA 2V5TA 3U7WL 4XN9A 2D3VA 4U1NA 32C2B 1RK0A 2OJZL 7PAZA 3QXDA 4R9HA 2A1WH 4QJ5B 3MROA 3JWOL 3RU8H 3QDJB 5AVQB 4L1BA 5BO1H 3MKGA 4HKBB 3ECVA 4JY6B 3SJVE 1ZSDB 3TEXA 1NCAL 1T7YA 4JFXA 4FFYH 1OGPA 3AABA 2NMSA 5EV7A 1A7OL 4F8QA 2DBLH 2F8VA 2IGFH 1OAQL 2Y2WA 2Y3AA 1EO8H 1N68A 4FFZA 3BD3A 4JO1L 4L0ZA 3VFOA 4CMHC 5TE6L 5KJ7E 1KJMA 2XZZA 5TDNB 1JTPA 2PR4L 1NCCH 3AY4C 5I1CH 1XGPA 4BE5A 5HHVH 4BKSC 1G0YR 3H53A 1R5VB 1BX2A 1JTTA 4G6FD 4XBGA 5L4FA 3SZ6A 3GSXB 4U6XA 4FNLL 5DWUH 1K8IB 2H6PA 4GG6B 2WLMA 2VSDA 2VXQA 3QRBA 5JDSB 4TOYL 4M43H 1JVKA 5I6XC 3WS3B 1W9XA 5ESVB 3O3BB 3SJVA 4ELKB 5DJZB 2E86A 4YFDB 3ZDZB 4BQCA 3WD5H 4JFUA 5SX5H 4X9BA 4MCZB 1GGTA 5D1QB 5DD0L 3MJGX 1OAUL 1TTGA 4L5FE 1KN4L 1DBJL 1SF5A 4JFDB 5JIPA 4O9HL 1ZPUA 3GBML 3ZKND 1R0AH 1IGTB 2XN9E 5JOFA 2MNWA 3MRHA 5ABDE 2ERJC 1BECA 3VXMD 4DCQB 3ALWA 1F86A 2Y1AA 2KYIA 2O5ZH 3V2AR 1FBIH 1QHQA 4NWUH 5DC0A 3GTVA 2DEWX 3C2AL 3CSYB 2CE6A 5KVFE 4CNIB 1TQUA 3HI5H 1WO2A 1H9VA 4XOCA 2WYTA 2E6PA 4YEFA 1KTDB 3GQFA 2JB6B 4R7DA 4JM4L 5EZPA 4ABUA 3N9GL 4F2FA 2Y6TE 4CC4C 4OZHA 2NYYD 1OALA 1Q72H 2YD7A 1DQVA 5CBEB 1TETL 3I50L 2Z0BA 1ZHBA 4CSZA 2XWJB 1MFCH 1FV1A 1RZJC 1LK2A 2OJEA 3UP1A 5ACZA 5GJSH 5DD5H 5IY5B 3H7BA 3VNYA 2QQLH 4HZLA 2YGNA 5C0BE 1AG6A 3L3JB 5G2NA 4GSRA 5T5FA 3EXJA 4NRZA 4PLNC 4J3VA 2A9AA 1MREH 1Z32X 3PF2A 3PWPE 2JKTM 3JT2A 4K7FA 3TFBA 3UJTH 3RQ3A 5AVRB 2GK0A 3HR5A 1URLA 5EC2A 3ZTEA 3S3BB 3VUAA 1LE9A 3KM1A 4HHWA 2VO8A 1N4XL 4P06A 1A6TA 2X53A 5FCUH 4L8BB 4NQUA 4PJDF 1JVLA 4NQSA 4NNPL 2WB7A 2FYYB 2XBDA 2N56A 4RA0C 3LEXA 4XNZC 4PS3A 3W0WB 5FYKH 4Z7AA 4HWEH 1C16A 1DTUA 3RILA 3GS0A 3D0VA 1T20B 1IGYB 4EBQL 5D4HA 2VDMB 25C8H 3A67H 3IFPB 2R39A 3L45A 3ARBC 3ARBB 4ICXA 4P23B 2Z7UA 2Y5EA 1J10A 1WAEA 3IN2A 5L8LB 3MRJB 1R3LB 2J6EL 3VFWB 2W8CA 3RTQD 3L95A 3SDAD 1KCLA 4J3XA 3ARDD 2HZHA 1MAJA 1AY1L 4ODUB 3UO1L 3W37A 1ZLSL 3ARFC 2ZUWA 1A5FL 2VQTA 3ARFB 4W6XB 1UD4A 3X12A 1K8DA 4TULH 2AEPL 4Z7NF 3O4OB 3U46B 5F7YC 4YZFF 4LPTA 3B2UC 1CFBA 1MH5A 2CK2A 4QHLA 3ARGA 5DQDH 1CVSC 4O2FB 1P7KA 5EA0L 3X1BA 3B34A 3KW7A 4HCRL 2BDNH 3NFSL 3FQNA 3N1MC 4X0KA 1ED3A 5T3ZD 2VUYA 1FH5H 3B5HA 3MA7B 1W15A 2YAOA 5DD1H 3N44B 5AZUA 5B38G 2SEBB 3UIYA 3QUYB 1YJDC 3UYPA 5IR1B 4D9RE 3KPSE 1QHOA 4OV6F 1HU8A 2VL5A 4FI7A 5FA4A 1D5IL 2PO6D 5KYWA 4JS7A 1URZA 4M1CD 2JI3A 3NJVA 4RSYA 5L6YL 3F01A 1CZ8H 4GI6A 3ZGHA 4MS6A 4W9JC 1GXEA 5E24E 2ZCZA 3QZMA 5LCVL 4KQ4H 4QYOA 4WU7B 1FO0L 3BKYH 4UIKL 2MCAA 4K5LA 2VITB 4BH8B 4DAGH 3C2SA 1OTUC 3UP6A 1V54B 3TYFA 4R7NA 1YYLL 5F9AC 2F58H 4F1SA 2AXGB 4B41A 5C6PB 1OZUA 1PY4A 2CBMA 5CJOL 2QKIC 3DROA 5FECB 4TLTA 2HJLA 3D09A 5C3IA 3OKLB 4IRSA 2X12A 3MUUA 5IVXA 2GIMA 4OJDH 3BPLC 3BPLB 2WGNB 1BAWA 2BVQA 2IH9A 3GMNA 1DDHA 1U8KB 2KS0A 1GL4B 3BVDB 3HUJE 3T1WA 4NQCA 1CS6A 1CQYA 4MJ5A 4Y16A 1A2YA 5IB1A 1ID5I 4S1RL 2X0VA 5KEZA 1B0GA 1YPZE 5E6SB 5FKAB 1OARH 2XV2A 3OMAB 2IC2A 3CVHL 3QIBD 5J12C 3PCYA 2EKSB 3O4LE 1T1ZA 1JN6B 1SLWA 4KKNA 4XRCA 4N0RA 4R0LB 2WKGA 4LHUG 3SDDD 1NMBL 3O6FB 3ZQ9A 2L4OA 3V7MA 3GD1C 2E7LA 1T22B 1DSWA 1T3FA 2J6EA 4ZTOH 5FDWB 5T1LD 3HE6C 5AW5B 3O11B 5ELIA 1AS6A 2H2SD 1A7PH 2PABA 5F96L 2EO9A 3S96B 3OBAA 1Z9OA 4ONFH 1XD0A 4G6JL 4MZ2A 4QRPE 1WZ1L 3WAKA 4PY8I 4TLKA 4ODWA 1XZWA 1S7VB 5GS3A 1DSFL 3CPLB 4FQLL 1BWWA 3BSHA 2H1LM 3GSRB 3O4LA 2IFFL 3TBTA 1JCVA 2VLRE 2DQUH 4LARH 1UQSB 3KLAA 5CJ5A 2CH8A 3FU8A 2ZWNA 2WO2B 3TLRA 3UGEA 1TXKA 3UABA 1BD2D 4XX5A 4EQ2A 1RIVH 1QQDA 3AB0C 3N06B 4OI7A 4RRPG 4B9PA 5C7XH 1INDL 3EOAB 4GRLB 4KROC 3J2PA 4WFHD 3U2JA 2Z35A 1AJ7H 3LKRB 1D9KD 2X6BA 4P2OD 1LO5A 4KI5D 5LN4A 2VAAB 2IG2H 3MYJB 4U1SA 3ZDYE 3PABB 5BCAA 5FA3A 1ZT7A 1BFOB 3CHOA 3QEUA 5D4IA 3UZVA 5CEZH 2VERA 4NO2A 2X2UA 1S7TA 2C1OA 2OR8A 3BEVB 4MQ7B 5LCVA 5D2NC 3WEXB 1FO0A 5D7JD 5FO8B 4MJIB 5HI4D 2CHZA 5F89A 4YK4B 2XNAB 2V5MA 1T6VN 5MEND 5GS0C 1RERA 3THML 4UF7C 2DF3A 4OM0L 4OD2B 2DWEA 2OP4H 4F91B 4YFLF 1NEPA 2ALWA 4N5EC 2N7SA 3DJZA 5LDSA 4JL1A 4ZDHA 1OB0A 5CBAA 5IQLA 3K4DA 3SODB 3B2MA 3S97C 1HZKA 1AMXA 1FDLH 4O58H 3RDJA 4NQEE 4E42B 3VVVA 3OMZA 4L4TA 2H26A 3I85A 4OBRA 1T03L 2R8SH 4L37B 4I0PB 4ZX4A 3HC2A 3IFOB 1HH9A 1ACYH 1EFQA 3QR2A 3V6FB 1XTMA 1E9PB 2AQSA 2GJZB 3QPQD 4ZMNA 3NG5A 4JM2A 5E4AA 4AEIL 3MLVH 3MLWH 2WBJB 2BO0A 1EZLA 1LP9F 5I8OL 4S2SA 4S0HA 2V2WB 5C09D 3VD1A 3TU6A 2AJSL 5F7DA 3LHAA 2BINA 3QUGA 5FO2A 4DPBX 1AZUA 3GZOA 1MCHA 3WBDA 3WNIA 2WZ5A 2XV3A 1A14L 3OHXA 1SYSB 1J9QA 5TGBB 1IZJA 3VO0A 2DD8L 5A40E 5F1KC 2AXHA 2Z6FA 4AJVA 1M71B 3CU7A 3MN8A 3MRCA 5SWSE 3VA6A 4AQ8C 2WANA 2BMKB 1OANA 1QSEB 2NT1A 5EZLB 5INDB 3MRBA 3O8XC 4AEHH 3NSYA 1T0MA 2PKDA 2OZ4A 2EYSB 4XVJH 3HTLX 3QIWC 2JMRA 3WTXA 2CBOA 4AVKA 1WS8A 3IEAA 3FQUB 3KVQA 3MGAA 2EH8L 1TQCB 1YN7B 2APWA 1BQHG 4IBTA 1DBKL 3PUUA 4D8PB 5FW6A 5I6MA 3V0DA 4HFUH 2ETWA 1FZMA 2D2OA 3JV6A 3NCBB 1IC4H 1TR7A 2NY7H 1QW9A 3WHE1 4MAYC 4MAYB 2B9BA 4PJFB 1CIUA 5F7HA 1HXMA 4BFJA 1YECH 4ZZFA 2YD9A 3UTOA 1K2DA 3LHPL 5CCKL 1U95B 1NGZB 2AQTA 3DO4A 5C0CD 3ZMRA 5IWLC 5EH1A 3ABKB 3ASWA 1OGAA 4QRTB 1J1XH 1MWAB 2H8PB 2K0RA 3D39B 2Z31C 2Z31B 1MHCB 4HUCA 4NO0A 4XO5A 5E1IA 4APQB 3A21A 4N2CA 2B3IA 1IAOB 2CWRA 5FLUA 4DTGH 5D96C 3PHOB 3TX4A 2APVA 4PV9A 3HPJB 4ANWA 1PW3A 1XEUA 4L3ED 2JJSA 3HG1A 3MRPB 2Z93B 1T7XA 2E9WA 2VMCA 4F2MB 1MUJB 4V1DA 3DVNA 3MV8D 1WGVA 3TPUB 3VXUA 1ZWIA 4D9QE 4PCYA 4D0BB 2YOAA 3WFHB 3IGFA 3I9PA 4TTGA 2FE0A 4ODSH 2BSEA 1CR9H 2APTA 5MEPB 4DZ8B 4OW6A 5F8RC 1NGPH 1SLXA 3T3PE 3WFCL 4AL8H 5DD3H 1PG7W 2KL6A 2LTQC 4M00A 1XIWD 1A3RL 3FT4A 1FPTL 4HIPA 3BPNC 3BPNB 3RPIB 2YHGA 4NKOB 1XD1A 4XNBA 4DK5A 1I82A 1K4CA 1TZ8A 2DQDL 1RD6A 2B4CC 2TAAA 2XWBA 4GINA 4IOSA 2H5UA 2BIPA 4XOAA 2HFFB 1MCQA 1D5ZB 3MGTB 1MRCH 2XXGA 1F3RB 1UWYA 2IDSA 4PGBB 4C59B 4L4JA 3PPEA 4X9FA 1NFDF 4Z7WE 2CUAA 4G3YH 2DQHH 4YE4H 3TZVB 2C4FT 3HKZA 4HHAA 3T3MB 1RURH 1P4LB 4PH8A 3GRWL 4APXA 4DJMA 4OI8A 3OB0K 5K9KB 2LE9A 3AREA 4ZMLA 4WWKD 1CFQB 2HX7A 1T2QH 2AQ3A 3L6FA 4JQVA 1NH6A 2ZX7A 5K39B 5E8OA 2ED6A 3S8WA 4GQ9L 2CDEA 4N2NA 4RA3A 2B0SL 3I02A 5C08B 3VWKA 3ZKQD 2XWXA 5KS9A 1MRDL 3GSQB 4M3HA 1RI8A 4X7SH 3VX0A 5J6HA 4ODXB 3EZ8A 1JV2A 3EGDA 3B3IB 4LPWA 3SKOB 4AKOA 1U3HD 1LO0L 2IMMA 2XOTA 4XN2A 3ZZQA 1SJMA 5EOCJ 1UYWL 3DBXB 4YOKA 1EHLL 4KNTA 1UB5B 2ITFA 3MVSA 4XMKH 4BD4A 1P2CA 3O6KL 2EVGA 2E9BA 2NZ1A 2UZIH 5DO8A 1X44A 4KVPA 3F00A 3ATBA 1GZQB 4I3RL 3FTSA 2JB5L 2CG9X 5D2LB 4K73A 3D0AA 2FVNA 1GA2A 2MCPL 2J1XA 3NCCB 2OR9H 5HD8C 1B4RA 3FYEB 4HIIB 5CINH 2PXYA 2EXYD 2CNZA 5KAQG 1DZBA 4Y89A 4MNQB 4ZFOL 4B9CA 1N2RA 5ACMA 2GUYA 1AOHA 4UTAL 3IETB 1DJYA 1Q1PA 2ZOLB 3MBEB 3MBEC 4GO8A 3ZL1A 3GHBL 2VDQL 4GT7A 3ZE1F 4MXWL 2GEQA 1MCIA 2MPAH 3EFFB 4OJEH 5E00B 5T1KB 4QRRA 5SV3A 2PWEA 3COOA 3QG7L 3WJMA 3AXIA 4LSSH 2DDQH 1HVXA 3HS0B 3HS0C 4JHUA 3IRZA 3M7OA 3I3BA 4PJIB 3BLPX 2WN3A 3VD4A 3P1VA 3V5KA 2ZUUA 1AP2A 3D4YA 3GO1H 2FR4A 2XN1A 3HI6L 5FHAL 2NW2A 4NEHB 3X13A 1AGCB 2BM3A 2G5BB 2UXVA 2HT3D 2VRAA 4U49A 1FE8L 1F0LA 5DK0B 4LCUB 3DC0A 4I0CC 3ESPA 4NO3B 3D87B 5BRQA 4EIBA 3C6EA 1SHMA 1DLFH 5GRVL 1U30A 2WWKO 1AOZA 2X4NB 1T4WA 4LCCB 3FCGA 3LIZH 1X5AA 2QADC 2QADB 4H8QA 2CCVA 3QFGA 4KMQA 2FBRA 3D25B 2B59B 1J18A 1KBGH 5CGYC 1A4BA 4FQXD 1O6SB 2BNUB 2B1HL 1R46A 1IX2A 5HYIA 5SWZB 4L0PB 1UFGA 3LJ3A 3MX0A 3TBVB 3QI9A 1TQWA 4NFCA 4O00A 4UOJA 2FEDC 4GP4B 2NY1C 4Z6AT 3BVTA 5JW4M 3S88L 4GRWF 3NIGB 2C26A 2BRRL 1AQDB 2WLZA 3F7PC 3L4TA 1I8MB 1QX1A 4L8DB 3HZ3A 4HWBH 1JERA 3FU7B 3HHSB 4DO6A 3N44F 1TCRA 4GAYB 1ETZB 4GUPB 3DVGB 4G7YH 2PCPB 3MUJA 2CA3A 3ZSTA 4DGYH 4AVJA 4DP5X 5HJBA 5L2KD 2FWUA 3BIKA 1CYXA 4NS0A 5DS8B 4LCVA 4NPKA 1UOVA 1ORQA 4AQ1A 3EAKA 3FH5A 3IXAA 4QI3A 4JJ5A 2Q2EB 4AT6A 4XZUB 4PGDA 1U4FA 4HV8B 3RY5A 1F3JA 1CF1A 3FUIA 3UBXB 1B4JH 2DQIL 1KWGA 2VERN 1TNNA 4EN3A 2ZG3A 4PJXF 5DHVA 4Q6KA 4LOEA 1NCUA 4WHDA 1SY6H 3SE9L 4Z77A 4KY2A 4UB0H 5D1XD 2VR3A 4KVCH 1I1RA 1U3ZA 4FFTA 4QLWA 3GLZA 2V2TB 5GXBB 1G4RA 2R69A 2XA3A 3MJ7A 3CZSA 4FXKC 5HGGS 4ZFOA 3O6LH 3V0WL 1TJIL 4OFYA 1CN4A 3SY0A 2AXJA 3DO3A 5EU7E 1C5BH 5HSFA 4PRPE 3W9DB 1OM3H 3BUYA 1ZA6A 2VN3A 1V3MA 3FOLA 3QUZD 4IW4C 1Y18A 2HKHL 3U4BL 4Z3HA 5GGTA 1N6QH 1RZFH 3IDGB 4BKLB 4P9HL 4K94H 3OV6A 4Q0XL 2G9HA 4UT6A 2BX5A 2X7LA 3CSTA 5IF0B 3RDTB 3CHRA 1KJ2A 1SFDA 4B96A 5CUSL 2APXA 3DX3A 3NA9L 1VIWA 2XT1B 3I6GB 3QJFB 4TXVB 3V8OA 5IW6B 3GRBA 2EDLA 2AKRB 3D85D 1IC0A 5JQHC 4QXUH 1FIGH 4M4RB 5D6DA 5KW9L 4LLYA 1PNDA 1KGUA 4DKFH 5E1GA 1FYTE 1GMEA 4RH4A 2WTPA 3MV7B 4XVUC 2VUKA 3O2DL 2IEPA 3NPSC 3NPSB 3X14B 2P1YA 2UV3A 4W9EC 2GJPA 2P5PA 3VXME 35C8L 3ZHFA 2O61B 4A37A 5C0ND 3VFMB 1SPDA 4WJ5A 3PHSA 3R19A 3S8FB 4Q9QL 4LSTH 2C3VB 1GKOA 5HYJA 3S5LA 4H8HA 1IGIH 3KDMA 1TVBA 3F84A 3FO9A 4AWJC 2WJ5A 2XZQH 3G5YB 5K33A 5A2CA 1EMTH 1YQVL 3L1OH 2V5RA 3QYMA 1CBJA 4NCDA 3CCHA 3X1NA 1FYTA 2MOGA 3LEVH 1X5HA 2JIXD 1MLCB 1XF3B 3NJHA 4HDIB 5EWIL 5LGKA 3ULVH 4X7FC 2ZOTA 2DM7A 4FQCL 1S6NA 3LD8B 4C58B 5T1MA 1EH9A 1RUMH 3BSGA 4PCTA 3SGJA 1VADB 4AYMC 5D1ZA 3OPZH 4MA7L 5JIDA 3VGGA 3VFRA 1F4AA 3PWNB 1XVSA 2XFGB 2ZXCA 4LU5L 5DA4A 3IYLW 4UOZA 4EZKA 4TS6A 5I30L 1M7IA 1UWGL 1RAMA 1AG0A 3QRLA 2ICEA 4PRDB 3O9WB 3QFDA 2DQJH 4KZEH 2EEDA 1PY0A 3PAUA 3DTXB 4ZOAA 3A0OA 4RAUA 1MLBB 4BQ8A 2DMHA 5KBKA 3KNBA 5KVDH 4TVPL 1NCDH 4QF1B 3LKSB 1VEOA 3L5WB 1E6OH 1QBMH 2DQCH 1JGVH 4H5SB 5HHXL 2H4EA 2Z65C 2FQGA 2WINA 3FUHA 3OAYH 3ZZ1A 1I85C 2W0PA 2ZWSA 4DVBA 1I8UA 5TF1H 4B53A 2BIMA 4EF3A 2EZ0D 3VMPA 5IQNA 1JNNH 2PTTB 1G9NC 4ZFGH 2WXPA 2ZCHL 3CZEA 3BGFC 1JXGA 4YHMH 4HGWB 5FFLA 4JL2A 2IAMA 2JF1A 3I6SA 3VGEA 1WTGT 3EYOA 4G5AA 1HEZA 2HFGH 2WZ6A 3P02A 4MA1B 4R90H 3EJYD 2G4GA 4JKMA 2CRIA 4H1LH 3UTPD 3V52L 7FABL 2XN0A 3C8HA 5AFAA 3RVXD 3DX0A 4N4YB 4NRXB 4EXKA 5HGAA 4JFEB 3DMMD 3VJ6B 1BVLB 1KG0A 3WNOA 3KXFA 1HQ4A 1T5WB 4LASL 1UWXK 4M7LH 1LVEA 4HHGA 3EGSB 2QJDA 1E8XA 1A7RL 2AVGA 5MEOA 3B9KB 1DVZA 1XF4A 3LZNA 5GHWL 4JVWA 4AV4A 4FXGA 2R7EB 3GEWB 4TSBH 2QSCH 1H9DA 1FQ9C 3GNML 4YDVB 1R3HB 2DZEA 2IADB 3V4UH 4HIJB 2X2JA 3IDYB 1EZVX 5B22A 3PQYD 2WP3O 4JMNA 2Y5TB 4KK5C 3FC8A 3CVBA 2JKXA 1QASA 4PGEB 3UROR 2NX5E 3MJ9H 4ALAH 4Y9EA 3TIDA 1P7BA 5CILH 2NY4C 3FONB 2XETA 3MNMA 3Q6GH 1RPQA 2W07A 1AFVH 4AMXA 4D2NA 7CGTA 4MYPA 2VE6B 4LBEA 4PV8A 4TVPE 5DJAB 2OCCB 4ZPVB 2CALA 5E8NB 3BC9A 4QKXB 2VMJA 1G6RA 3N50A 2W0FB 5JQIB 5E6ZA 3IDMB 1ZGLP 4D7BA 4PJ8C 4PJ8B 5GQBA 4L8CB 4KJYA 1E3FA 5E03A 4Q9RL 3CC5A 4HS3B 1H3GA 1S8DA 1B88A 2GQHA 5FFOA 3HPLB 1F00I 4JEGB 3S5YA 4CBPA 2NX5A 4M9OA 5IW3A 3TV3H 3QUXD 4BWTA 4ONHA 5T3XD 1UZ6E 1P4IL 3FFCE 1Z9SA 4QHNB 5EBMA 1NFIA 2WVVA 3ZGIA 5LGHL 4HOWA 3DIDA 1A4AA 4HEMA 1E67A 1SN5A 3INUL 4ZUVB 3Q05A 2CGYA 3QJHB 4FDWA 4WFGD 3KWWA 4E5XA 1ID2A 1PZBA 3NTCL 3OG4B 1J8HE 5HJ3B 4FFZH 4MCMA 2P5EE 4XB7A 4XPHH 1YN6B 3GK8L 1UHVA 2XN2A 3OKOB 4MD0A 3VXNA 3R06B 5BQ7B 4ZRGA 5ALBL 2C1PA 1PGRB 4ZQKA 1L0XA 1TEFA 3SDXA 1FL6B 3DDFA 2EO7A 5DGRA 1SXSA 4WUUA 4FNQA 1QBBA 3DUUB 3GM0A 4W9ZA 2PN5A 2LR4A 2VXQH 4F3FA 3MRRB 5BO0D 3FFCA 5DJDA 3MRQB 2YSSB 1J05B 4RISL 4RRPM 4GKSA 4NN7C 4JNXA 1EEYB 1NCHA 1V7ML 4X2UA 3LS4L 5AENA 2YO3A 2AV7A 1MRFL 2UUDH 1R75A 5CEYA 1J9TA 2KQNA 2NQCA 1J8HA 3A6CH 5EDXA 1CICD 2EVIA 2BVUA 3RB7A 1MOEA 1XSKA 1CFMA 2P5EA 3CN3A 4DEWA 5EZOH 1FH2A 1Q9OA 4IEFB 2VOTA 4GQZA 4TNWK 4UDUA 1XHHA 2YPLD 1EJ8A 2F54D 3OJDB 2OYKA 1A22B 4H44C 4MSWB 4B27A 5JMRA 6CGTA 3DOHA 3GIZH 2Q8AL 4OGAC 3VW3H 2ALAA 3KGTA 5JHMA 3GSNL 2NW3A 1WFJA 3QEHA 4P2QD 4I0KA 3SDCB 3R4RA 3V4VA 5FO9B 3V5DB 3T08A 1DJZA 4Y7OC 1HSBA 4J3OG 5D7IE 5ADOL 2BHUA 1MCLA 3RIAK 3UZQA 2F8IA 4YBQD 2OSLB 4CU8A 1WG3A 1E50A 3P9MB 4Y8AA 1GW6A 1JMZA 1TOXA 3MV9D 1PDKA 4R4FH 5DVPA 1NCTA 3VGBA 3W11D 1BD2E 4L5FH 5I23A 1MCSA 4JFYA 5KBDA 3MRKB 3MRGA 3MLSH 2NDFA 1FNEB 3K80A 4WFHE 4LCIL 4AIOA 4WFFD 3D69B 1KLUB 4X6CB 1JK8B 5J3HC 3DX9B 2XPGB 4IQHA 4QCIB 3UH8A 4KI5E 4W70A 5CAYB 2J43A 4MAUL 2QR0A 5EUKA 2GIXA 1CTNA 1SM3L 1UA7A 3C5JB 1KCUH 1KCSH 1SBBA 4I3SH 5CFAA 1UWFA 3WHXB 3NDYE 1JG9A 4QNPE 2WTRB 3AUVA 2B7DT 3D30A 5KVFH 4Y2OB 2Q7YA 5JUEL 1TZGL 1HX0A 4KUZL 5T5FH 2CR0A 5JO5A 3LB6C 5C07A 1H6FA 2QMKA 4WV1A 5E99H 2R0LH 3U7WH 3QAZC 3QAZB 5MENE 3CFNA 5IHZB 3US0A 3ZL4L 3D2UA 4HETA 2OJZH 5KG9A 2OBGA 3GMRB 4IRZL 4RMSA 2YUVA 4JLRA 1E2WA 2PWHA 3WL9B 3GBNL 3JWOH 1WA2X 4ELMB 4BK4A 1BQRA 1V27A 2BY2A 4Y8DC 1GGYA 2DIAA 1F3DJ 4W9HC 1NCAH 1V3JA 3QO0B 4DP7X 3QXUA 3ZXAC 2G60L 2NPLX 3CSFA 4EXPX 3UJJL 3F2LA 1MJJA 2ZKXA 4PJIF 1A7OH 3P77B 4GG8A 2FK9A 2FO1A 1OAQH 3BN3B 1RJZB 1R9FA 4B5EA 4NZ8A 4UM9B 4JO1H 2HKFL 3BZDA 5TE6H 1AXTL 3W1ZA 2PR4H 4X6FA 3B2DC 1BSIA 2H6OA 4QHUB 4LLAA 1LEGB 5BS0A 7PCYA 1S9VA 1BZEA 3Q2LA 1FL3A 4FNLH 4N2FA 4GAGL 1BHGA 4P8QA 4RQQB 2GTQA 4TOYH 3MJ8B 4HU2A 2X4OA 3FN3A 2FCBA 1E8YA 3WEBA 4Q4EA 1D6VL 1U8CA 1CK0L 1BIIA 1NKGA 3C60D 5CD3B 5DD0H 1EGJL 1OAUH 1S9WB 2X9YA 4B3VA 1KN4H 1DBJH 4O9HH 1HILA 1EAPB 3GBMH 3IJHA 4C8XA 2NYZA 4K5PA 3SBWA 2GJ6A 5EBLA 3FCTA 2ADIB 4POZC