1KLMA

Hiv-1 reverse transcriptase complexed with bhap u-90152
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
538
structure length
537
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unique features in the structure of the complex between HIV-1 reverse transcriptase and the bis(heteroaryl)piperazine (BHAP) U-90152 explain resistance mutations for this nonnucleoside inhibitor.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 142
structure length 537
sequence length 538
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1klmA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1klmA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1klmA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1klmA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1klmA05
4Q8FA 2KZZA 2OPSB 4WFYA 3VQQA 4RW7A 5F8NA 2G8FA 3TR8A 4Q5VA 3TARA 3SCXA 4BWJA 2P5OA 3MFHA 2VG6B 4CK3A 4N76A 1KCFA 4J9PA 4J9QA 4CK1A 2JEFA 2JEIA 1SKRA 1I6JA 1WLJA 2W8LA 4NCBA 4WZMA 3SJJA 3TQ1A 5C42A 5C24A 4TLRA 4MH8A 4ECQA 3AA4A 2R8KA 4I2PB 1RYRA 1BISA 3MEDB 2FJXA 4Y2CA 1DLOA 1XR7A 4RNMA 3L2QA 2B6AA 4KHYA 2EX3A 3LP1B 5KG0A 3O4QA 3UR0A 3NF9A 2OZSA 2EC0A 4NLXA 1QTMA 3QO9B 3HPGA 3DI6A 4DF8A 4ZTFA 4JRPA 4LSLB 3V9SA 1UA1A 3BSCA 3BGRA 4CEBA 1NJZA 3T5KA 3TAMB 2FBYA 3ALYA 2ZD1B 1NJXA 1FXXA 5KFPA 1GX5A 3M8QB 4XIUA 3VQPA 4HVJA 1OS5A 3OHBA 1RILA 4B8CA 3LALA 4CGGA 3I0SB 2WHOA 2OPPA 1TK5A 4YR3A 4FS2A 1FKPB 3NBPB 4F3OA 3P1GA 5HBMA 2R2RA 4ZPBA 4Z4FA 1JIHA 4RW8A 4B3OB 3V9WA 3VQAA 1I39A 3RTVA 1QE1B 3TAPA 1DTQB 2FBXA 3KLGB 1ZBLA 1SL2A 4PWDB 4DSJA 1C1BA 1J9AA 1C0UA 4RU9A 2VG7B 3MEGA 1JLCB 1S1VB 3CM5A 4CGHA 1L3VA 3GILA 3G6XA 4NLQA 4NLOA 5KFGA 3TVKA 4FZXC 5DGBA 2PYJA 3UQSA 2IAJA 1TVRB 4QW8A 4Y3CA 3NGZA 1U09A 3E51A 1KLNA 1ZBHA 1S1TA 4YR2A 4QPXA 3HJFA 4MK8A 4FJ5A 4M94A 1T05A 1BQMB 2HNZA 4CHQA 3G6YA 4Q0BA 3ZSRA 1TL1A 3DI6B 4B08A 5DLGA 3THVA 4HUGA 1D9DA 3ZCMA 2NUBA 4M42A 4DSLA 4NLPA 3K5OA 1JXEA 4DTSA 1C1CA 2PY5A 4F50A 2DFEA 3Q8RB 1IKWB 5KFWA 2QKKA 2XCAA 3ZSVA 2UVRA 3TAMA 4CJ3A 4DU1A 4ICLB 3RMBA 2OPSA 3OS1A 2OPRB 1QSLA 1VSHA 1L3TA 2ATLA 3ZSWA 5KI6A 1JXLA 4DSKA 1LWEB 5KG2A 4DFMA 2B5JB 3HVWA 3I0RB 3IGVA 2IJFA 4KTZA 2XC9A 5JS1A 3C94A 4BE2A 1R0AA 4OLBA 4EBDA 3NL0A 3CJ5A 3BJYA 4DFKA 5DGAA 3SQ4A 3PX0A 4WFXA 4U7CA 3S3NA 2BRLA 1RTDA 1QSSA 2VWKA 3PW7A 1BCOA 3D45A 4CFDA 4J2BA 3DLEA 1NK7A 1S1XA 4O44A 1MU2B 3CO9A 4CF2A 5L1JA 2C2RA 4CF8A 4EP5A 2I5JB 2UVUA 4LY7A 1UOCA 2FLLA 1XHZA 3OS0A 1XWLA 2HNDB 4CHNA 2C22A 3P83D 3FFIA 2HHXA 2G8KA 4IRCA 5HP1A 3V4IA 4CGIA 4LQ3A 5KFHA 2D0AA 3F9KA 4RG8A 4ECTA 4FLUA 4W5RA 2RDIA 1JKHA 3SFUA 4CEAA 2X6NA 1VSDA 3NH0A 2G8VA 2I1RA 3OYDA 2IC3A 3QINA 3HK2A 5KFCA 3BR9A 3OYFA 3QLHA 3QETA 2R8IA 3M8RA 1J5OB 1EETA 3V1OA 4O3QA 3VQ5A 4LSNA 2FVRA 4M45A 4OVLA 1K1QA 4FJLA 3MR6A 4JV0A 1LW0A 4EZ6A 3CQ8A 4CEZA 2R2TA 1HMVA 5C5JA 1JL1A 1FK9A 2DPIA 4EO6A 2DFFA 3RMAA 1RBVA 3DRSA 5F8GA 2AGQA 4FJKA 1RTHA 1C1CB 1NK4A 3QEXA 4NCGA 4W5TA 2KW4A 4G1QA 4TY8B 5HROA 1J53A 1KFDA 1N6QA 4ED3A 2C2DA 3MXJA 3VQ6A 3AV9A 3DOKA 3OYIA 3PW4A 1YVUA 4LQ9A 1TAQA 3LZIA 4GMJB 1IKXA 1RT1B 5C25B 5KFKA 3NDKA 3I0RA 3GIKA 3HYFA 4QWEA 3RR7A 3KLFA 4E1MA 4ZPDA 1JL2A 5DQHA 3K58A 3H5SA 4DQQA 3JYTB 1S10A 2HNDA 3I5CA 5T7BA 4WFZA 2F8EX 3V9UA 3AVLA 1IKXB 1LAWA 1JLQB 3OLAA 4BDZA 2W9BA 4DL6A 3M8PA 4J9RA 1ZETA 1I3AA 2P1JA 1HNIB 4O0JA 3RB4A 2VG6A 1VSEA 2FLNA 2ASJA 5FDLA 1QHTA 4IRDA 3V1RA 4FW1A 4F4XA 1S1XB 1RT4A 1BIUA 1C6VA 4CJRA 4K4UA 4RW9A 1MU2A 3EYZA 2FC0A 4CERA 2IC3B 3ZSXA 4NYNA 3RMDA 3AVKA 4K4TA 2FVSA 3OYMA 2YNFB 1RT2A 3BSAA 2UVVA 3JSMB 3SPZA 4PY5A 3AVGA 3G0ZA 3CDEA 3MEEB 5HP1B 1S0NA 2OH2A 4PQUB 2W7OA 4M3ZA 4NLTA 1GOCA 4ED7A 4DSEA 3CIZA 3CG7A 1RBUA 1IKVA 1IKYB 4IFYA 1JLQA 5EUHA 5KFFA 4CJLA 1IO2A 4CIEA 4J9SA 2HWIA 3E01B 4I2QA 2V9WA 4CEQA 3MR3A 3LP0A 4AHUA 2JGUA 1FKOA 4F2SA 4GVMA 3T19A 4CJUA 1S6PB 2P51A 1S5JA 3HP6A 2BDPA 3Q8PB 3ZT0A 3QEWA 4HCBA 1HYZA 1JLBA 1RBSA 1T03B 4FK0A 4KO0B 5KT4A 2E6LA 1WNSA 5KFOA 3DLHA 4CE9A 4DG1A 3I5BA 4ELTA 2DTUA 2Q3SA 2WRMA 1HPZA 4E7IA 4CK2A 2A1RA 4N5SA 1CZ9A 4KV8A 4IBNA 3DRRB 5J2PA 4KFBB 4RW6A 4B9VA 4KO0A 3OS2A 4EBCA 2YKNB 3M8SA 2XY6A 3OYKA 1NJYA 3PO4A 2GUIA 4QWCA 1RT1A 3NGDA 1JLEB 4NYFA 2F8TA 4O4GB 5KFXA 3LWMA 4H4OB 4OGEA 1HJRA 4I7FA 3RAXA 2KQ2A 3KLGA 4BDPA 4FS1A 3QEPA 4CF9A 2XY5A 1CXQA 1X9MA 1TK8A 1C0UB 4YMEA 5JS2A 3AVNA 4ECYA 1KFSA 4WE1A 3V6HA 4H4OA 1VSMA 2PYLA 3H59A 2BQRA 4I9LA 2IJNA 2G8IA 1JX4A 4QOZB 3V6JA 1SUQA 5KFVA 3AVMA 5KFNA 1WAJA 4E7KA 1S9EA 2KZMA 4NLWA 5C25A 5DQGA 3HP9A 5CYMA 1VRTA 4NLYA 3UIQA 2RN2A 4IG0B 5F9NA 5CZ1A 3QNNA 4GC6A 3DM2B 3I5AA 3AA3A 3HSTB 2DPJA 3M8QA 1D1UA 4TY8A 3KLIA 3M9NB 3HKWA 3AVBA 4C8MA 1SH0A 2JEJA 4DFPA 2Y1JA 4FBTA 3I0SA 4WXOA 4CF1A 3C6UB 3HL8A 4DTJA 4ID1A 2HVHA 4EBEA 1UWBA 4KTWA 3OYGA 1ZBFA 3M8PB 3KK3A 3H98A 4FLXA 1X9WA 4MIBA 4ZMMA 1VSIA 1N5YA 3KK1A 3Q8QB 3BSOA 4L8RB 3JYTA 4FJJA 4HKQA 2W9CB 3ITHB 3H5XA 3LP0B 3SQ1A 4G3IA 2AJQA 4QAGA 4CJVA 4OKJA 2IM0A 4DL7A 3AVCA 3KHHA 2E4LA 4CF0A 2A1SA 4ECXA 1JLFA 3IG1B 2R7YA 1T03A 1RT6B 5J2QA 3PUFA 1Z26A 1T94A 1A5XA 1BQNA 1D0EA 2G8HA 5J1EB 4IR9A 3SUNA 4KB0A 5HBMB 2X74A 1T8EA 4R8UB 4FVMA 2YKNA 3NH1A 4DSFA 3ULDA 1VSFA 4Z4IA 4M3WA 1RDAA 3FQLA 3KKRA 2D3ZA 1X1PA 1RT5B 4ED6A 3QYYA 4DTUA 5FROA 2UUTA 3K2PA 4CGJA 3HXMA 2P5GA 1ZTTA 3DOKB 2G8WA 2D5RA 3SUPA 2HMIA 4UQGA 4EYHB 4C8LA 3M9MB 5FRMA 4FYDA 1TVRA 5J2QB 4ECRA 1T3NA 4LH5A 1U04A 4BE1A 4Q43A 3DMJB 1FKOB 2HHVA 1SL1A 2XHBA 1TL3B 3OSPA 2UVWA 2O4GA 1RNHA 4F2RA 4EO8A 3T5LA 4RNOA 3FDSA 1LW2A 4E7JA 3O3GA 3BQ0A 4IFVB 3WNEA 3KIOA 4CFBA 3KK1B 3L2VA 1N4LA 5KT5A 4B9NA 5DLFA 3OY9A 1GOAA 4FJ8A 4FJMA 4OJRA 1NK5A 5KFEA 3GV7B 4GW6A 2QE5A 3L2RA 1TK0A 4N47A 3K57A 4RNHA 4YFUA 4DQIA 4TQRA 1S49A 1VRUA 4C8OA 3T3FA 3QZ8A 1QAJA 3NGYA 2ITGA 3HPHA 5KFZA 3MAQA 2IBKA 1SH3A 1RYSA 3TAFA 1Q9XA 1G15A 4O4RA 3SV3A 1RTHB 4FJIA 4FLWA 1S9EB 3SUQA 3H2LA 3VQSA 4EYIB 3RBEA 4J2DA 3RAQA 1X9SA 3GIJA 2VG7A 3D28A 5KT3A 4W5QA 5EU7A 3HVRA 1S1VA 4CJ5A 3MECB 2YNHB 3DLGA 4DL3A 3SPYA 3IN5A 2V4QA 3CFRA 1BCMA 5KFMA 1B92A 1HNIA 2JEGA 4KHRA 4O3NA 4ECSA 3ZT1A 4FJ7A 3H5UA 2JC1A 3HVAA 2JLEA 1W0HA 2R8GA 4Z4EA 2J6UA 2W9CA 3GQCA 4ZPCA 1WSHA 4PWDA 4RW4A 2YNFA 1JLAB 3D5MA 1TKXA 2FLPA 1WSFA 4M3RA 3IRXB 2AU0A 4ZTJA 4FJ9A 5KG7A 3PVXA 3O3FA 2E6MA 4KTQA 3M9OB 4H54A 4BWMA 3T1AA 5FDLB 2ZE2B 1WSIA 5F9LA 1SKSA 4KREA 1F21A 4EZ9A 1J5OA 3OSNA 1QS4A 1RTJB 4FZZA 1NOZA 1C1AA 1SV5A 2DFHA 3N6MA 2FBVA 1T05B 1BI4B 5KT2A 4Q44A 2HHUA 1YTAA 4Z0UA 4CEEA 3CFOA 3RMCA 1MMLA 2Y1IA 2IGIA 1JKHB 1VRTB 4DTNA 3MTKA 2HMIB 4AHCA 4ZPAA 3QERA 2XGPA 3NF7A 3NBPA 2XRIA 4KHQA 2AGOA 1NKCA 3OYAA 3U6FA 2IM1A 2HHQA 1C0TB 1RA7A 2GC8A 3HPOA 1VK0A 1NNDA 2RDJA 4MK9A 4OGCA 4FK4A 1S9GB 1RT3A 4ED1A 4FLZA 4ECZA 3AVJA 1TKZA 4FZYA 3MR5A 4CIFA 3QIPA 2E9ZA 2HHWA 1C1BB 3AO5A 3KJVB 4KRFA 2AQ4A 2HNYB 3NF6A 1DLOB 3A2FA 5F8HA 2XWYA 4R5PB 1RTDB 2F8SA 1S1TB 4JS5A 1QSYA 2D3UA 1S4FA 1KLMA 3EPIA 3L2WA 4TXSA 3KLHA 3RBDA 4K4SA 1BI4A 3SYZA 1L3UA 3KJVA 4B9SA 1Z4UA 4ED2A 2WCXA 3NKYA 3AVFA 4CFCA 5KTQA 4IKFA 2BQ3A 4M3TA 4DEZA 1TQLA 2RKIB 4O3SA 3GIMA 4IFYB 1IKVB 1IKYA 3PJXA 4E0DA 3AA5X 4K4ZA 1W25A 4FW2A 4M3XA 2RF2B 4X2BA 3LP2A 3TANA 4DL4A 1SKWA 2KFNA 3HT3A 1SUQB 2VA3A 3RB3A 4N56A 1KHVA 4CHZA 4IH5A 4OPJA 5F8MA 1IKWA 3V1QA 5DMRA 4URSA 3SFGA 4MIAA 3QEVA 1TKXB 1KTQA 2YKMA 1BGXT 3HVTA 4HUFA 1CXUA 1S6QB 3RWUA 3CJ3A 1WSJA 3QEIA 3OLBA 4DQRA 4ECWA 3OHAA 3L3UA 4ID5B 5KFIA 1S9FA 1VRUB 1RA6A 3KD1E 1KVCA 3AO3A 2ZD1A 2W42A 2WOMA 1XI1A 3JSMA 1N5YB 1TV6A 3DYAB 3MECA 4MFBB 4DF4A 4MKBA 3ZSOA 4NCGB 4B8AB 5KG6A 3AO2A 4E7LA 3HHKA 3EPGA 5L1LA 4K4VA 2HAIA 3G10A 1SV5B 1JLAA 1K1SA 4CEDA 4FJGA 2XGQA 3VQ8A 1NHVA 3KK2B 2AGPA 1LW0B 4FM2A 2Z1GA 4Z4HA 3C6UA 5FRNA 3DOLA 3PHEA 3KLHB 5K14A 4U6PA 1XR5A 1WSEA 1KLMB 1S6PA 1XC9A 4AHTA 3GIIA 5KT6A 4M41A 1KHWA 4DU4A 2QXFA 4O55A 1RT7B 3V6DA 3LZJA 3OJSA 4JS4A 1HQEB 2ALZA 4NZ0A 1B9FA 5E41A 2HNYA 4KHUA 2QV6A 3SZ2A 3KLEA 3FFIB 3CYMA 1WAFA 3LP2B 2OA8A 4QWDA 1RBTA 3IG1A 2OYQA 3SUOA 4MKAA 2YNGB 2B4JA 4M3UA 4PUOA 3C6TB 4RNFA 3MEDA 3FQKA 5DK5A 3V81A 4H4MA 5CY4A 4CJEA 3P5JA 3VQDA 2BANB 3GYNA 3F73A 3KLEB 3LWLA 3ZSZA 4NLDA 2WTFA 3LP3A 2RPIA 4JV2A 2ASLA 3WNFA 4OLAA 1RAJA 4CECA 4Q45A 1ITGA 3AO4A 4CJ4A 2OPQB 2FVQA 1O1WA 1C0MA 3ISNC 2WOMB 4ED8A 4ELUA 4HHTA 4DTPA 2G8UA 3BSNA 3KLVA 1REVA 4QCLA 2XCPA 2O5DA 4FJXA 2YNIA 1RT3B 3NFAA 4NLGA 3HVTB 5CZ2A 4CGFA 4N41A 4FLYA 5EWGA 4H8KA 1NOYA 4ELVA 3CDWA 3SV4A 3LPTA 1RTIB 2RF2A 3KLFB 4I2QB 3LAMA 4R8UA 4F8RA 4DTMA 4E89A 4CIGA 3MR2A 3FRZA 3QESA 3AVHA 2BGGA 3DRPA 1QUVA 4E1NA 1GX6A 1DTQA 2BR0A 5KFLA 3RRHA 3HM9A 3NE6A 4O3PA 4M3YA 2GBZA 1Q8IA 3OYCA 2IOCA 4TYAA 2Z1JA 3KK2A 4CFAA 3KKSA 3KHGA 4KE5A 4XPCA 3K5LA 4CJPA 3KTQA 1B9DA 3EY1A 4FM0A 2IM3A 1NK9A 2D0CA 3CWJA 3CVKA 5F8IA 4JUZA 2WK4A 4CESA 1SL0A 4CJFA 1NKEA 1TV6B 3DYAA 4MFBA 5HRRA 3ZT3A 1EP4B 4PUOB 2ILYA 1ASUA 5KFSA 5HRNA 3QIDA 3DRRA 4TQSA 4BACA 4OKKA 3SI6A 4AHSA 4RUCA 3B6OA 3V9ZA 3IAYA 3VQCA 2OPQA 3WNGA 2E9TA 1JXBA 3OL7A 1K6YA 2O4IA 4NLSA 1KVBA 4IG3A 1YVFA 5KG3A 4Q0BB 4WYLA 3DLKA 3BQ2A 3PR5B 2B43A 4DTXA 2IM2A 3ISND 3S3OA 3DM2A 4ZVFA 4AHRA 2OPPB 2XO7A 4WXWA 3VN5A 5EWFA 2KFZA 1ZTWA 1J54A 4YNQA 4WE1B 2PZSA 1LAVA 4KAIA 4IG3B 2Z1HA 4KFBA 3CJ4A 3IGNA 4OPKA 4ZP7A 3RB6A 4TYBA 4E19A 4IDKB 1S9GA 4Z4CA 3N6LA 3H40A 1TL1B 3NAIA 4NLVA 4CCHA 1NHUA 2ATQA 1T7PA 3IRXA 4Q8EA 4ZP6A 4DS4A 3BREA 3QZ7A 1JLGA 4CHPA 5KG1A 2BANA 3PW5A 4DFJA 2IA6A 3C6TA 3H08A 3AO1A 4ZVGA 3CDUA 4RNNA 5J2PB 5F8LA 1S1WB 5KFYA 5J2MB 4YP3A 5KFJA 4JRQA 4DTOA 5KFTA 2X6SA 3QIOA 1TP7A 4CEOA 4DLEA 5CYQA 3U3GA 2B5JA 2YKMB 4KI6A 1NK8A 3CJ2A 1LW2B 4R0EA 1KRPA 4J9NA 1LWEA 2OZMA 4HCCA 2QKBA 2FJVA 4ZVEA 5D3GA 2KTQA 1D5AA 5CYMB 3KMQA 4KHSA 3OL9A 1RCHA 4F3TA 3H5YA 3TI0A 2JC0A 5KFAA 2ASDA 3BGRB 4O5BA 3SQ2A 4FCYA 3OL6A 4NLRA 3E01A 3U3YA 3AVAA 4CEFA 4F4ZA 2VG5A 1EKEA 5F8JA 1HYSA 3SQ0A 4C8NA 4DS5A 2ZQBA 1U47A 1RTJA 2BE2B 1IH7A 1U49A 2D0BA 3OYEA 2R2SA 2E9RX 4NYZA 1EP4A 5DG7A 4Z4GA 1BHLA 4G1QB 4WYWA 2HB5A 5KRSA 1LWCB 4O44B 3PX6A 1ZBIA 1S97A 1WN7A 3PZPA 4BE0A 1WNEA 4RW7B 1HMVB 4KAZA 2R2UA 2IAJB 4KV8B 4DL2A 2WB4A 5KFUA 2QK9A 3NAHA 4AH9A 5L9XA 3LPUA 2XY8A 4DTRA 1A5WA 1DTTA 1Z25A 5KGWA 4XPEA 4Y34A 4Y1DA 3L3VA 3ITHA 3GV5B 5L1IA 4Y1CA 1RDDA 4B9MA 4KBIA 3IS9B 5J2NA 4J9KA 3QLHB 1JLGB 3EZUA 1NJWA 4LD0A 4IG0A 1C2PA 4ECUA 3D0PA 3ICLA 5EDWA 4MQ3A 2J6TA 1RT6A 4I2PA 3RB0A 1Y97A 3QGGA 5SWMA 4NRUA 3DLKB 5C24B 2EHGA 4KKOA 5D3GB 4J9OA 1EX4A 3MEGB 2V0NA 4HTUA 3DLBA 1TKDA 1ASWA 4EEYA 1S0MA 2GIRA 1KVAA 4DWIA 1IM4A 2YNIB 1JLEA 2HVIA 3V6KA 1N6QB 4KHMA 5J2MA 4HUEA 4CJQA 4MK7A 3MF5A 5HROB 4IKAA 3PY8A 4J9LA 3UDLA 3V9XA 4R5PA 3PV8A 4KB1A 4J2EA 3ZSQA 4RW9B 1TAUA 3GV8B 4QWAA 2C2EA 2AWZA 5KFBA 4B9TA 1TKTA 2R8JA 4K4YA 2YHAA 2IDOA 2YNHA 3DLGB 4TSXA 1ASVA 1JLCA 4FLVA 5SZTA 4KB7A 1D8YA 1C0TA 1L3SA 3BDPA 4ECVA 2B6AB 4O4GA 4JLHA 1TGOA 1JLBB 5KT7A 3LANA 1RDCA 3S3MA 4FJNA 1YTUA 3PJWA 4F4WA 3G6VA 5C42B 4URGA 5KFQA 1FKPA 1YT3A 2HHTA 3MXMA 1CLQA 1HQEA 4FK2A 3OYJA 5KFRA 2HWHA 3NMAA 2R8HA 3QNOA 4ZHRA 4HYKA 3CFPA 4ZP9A 1HPZB 1LWCA 1NK6A 4AHVA 1BQNB 1EXQA 2W9AA 3LP1A 3IS9A 5J2NB 4CHYA 1NK0A 4C8KA 1HARA 4K8ZA 4IRKA 3C95A 1BQMA 2HNZB 4ZVHA 5T14A 5K14B 1BL3A 4FM1A 5CYQB 1UA0A 1TKTB 2XI2A 3OL8A 1RBRA 4YR0A 1QAIA 4ZHRB 1RDRA 4TY9A 4EP4A 4KKOB 2ETJA 3LDSA 1U4BA 1A5VA 3MEEA 3WNHA 3DMJA 3LAKA 4YQWA 1CZBA 2VG5B 2W7PA 4GC7A 5DQIA 3Q8SB 4QWBA 4LSLA 3TAGA 2FBTA 1FK9B 2GIQA 1BIZA 3BQ1A 3QGIA 3MXIA 3KMSA 4IH7A 4JV1A 4ZP8A 1NKBA 2HW3A 3L2UA 3O4NA 2VA2A 4B9UA 2BRKA 2FVPA 1Q9YA 4CJTA 4CJKA 3KOAA 1S1UB 3TABA 2GV9A 2YNGA 4J9MA 4LSNB 2YHBA 3TWHA 3DRPB 4PQUA 4W5OA 5JXSA 4CGDA 1SH2A 3DDKA 1TKZB 1HYSB 3OYHA 2VWJA 3VA0A 4TN2A 2W8KA 4BDYA 1TL3A 2FVCA 1HNVB 4RW8B 3TAQA 4IH6A 4DQPA 3S9HA 3DLEB 4F4KA 3VQEA 3K59A 3KHLA 4LH4A 1UAXA 3VQ9A 3O3HA 4KSEB 5I3UB 1KSPA 4ICLA 4URQU 1HYVA 4O0IA 3DLRA 2YV0X 5HLFB 2V4RA 1HQUB 2I5JA 5EWEA 3QIPB 4RW6B 4RZRA 1REVB 3B6PA 2BQUA 2W9BB 3N6NA 5KRTA 3RRGA 1RT4B 3ZSYA 1U45A 2ZE2A 1RT5A 2FJWA 1L5UA 1RT7A 3V6DB 3OYBA 2D41A 1S48A 5JUMA 1ZYQA 4F4YA 4KHNA 1RTIA 2AX0A 3SI8A 3FSIA 1XR6A 4ED0A 1LWFA 4CJWA 3G86A 4K8XA 3NHGA 2DY4A 3SNNA 3NCIA 2ZKUA 1XHXA 5I42A 2WONA 1JLFB 2LSNA 5KG5A 4XO0A 3ZT2A 3QO9A 3VQ4A 3V81B 3AA2A 3AVIA 4DSIA 4IDKA 3PR4A 4M95A 4OL8A 3NF8A 4AILC 3UPFA 1LWFB 2C28A 2X78A 4NCAA 3OVNA 3OJUA 3DRSB 1S1UA 2WONB 4B3OA 2OPRA 3VQBA 3EZ5A 1GOBA 4NRTA 3KD5E 2IS3A 2HHSA 4PA1A 3MFIA 3V4IB 1QE1A 4Y2AA 3L8BA 4B9LA 4OKEA 4KI4A 1IG9A 4ID5A 1UWBB 1VSJA 5HRPA 3CM6A 4DLGA 3T5HA 3ZT4A 4IOBA 3NAEA 4FBUA 4CHOA 3KHRA 3DOLB 4O3RA 1R0AB 4CJSA 3VA3A 1WSGA 1EETB 1W9HA 5DG8A 2J6SA 3K5MA 2BE2A 4FJHA 3ASMA 3H4DA 3KLIB 3I8DA 5HRSA 3KNAA 4FLTA 5KGXA 2CJQA 3OYLA 5HLFA 4DL5A 5I42B 5L1KA 4DG1B 3CJ0A 1LV5A 1S0OA 4IR1A 1HQUA 4O3OA 5I3UA 2CKWA 3K5NA 2UUWA 3PW0A 3PW2A 3H4BA 1N48A 3KK3B 4WZQA 3RR8A 1HNVA 1D9FA 4IQXA 3TAEA 3PX4A 3T5JA 2F96A 1RT2B 1RDBA 5KFDA 1N56A 2RKIA 1CSJA 1VSLA 4K4WA 5J1EA 4FXDA 3HO1A 3QGHA 3OYNA 4NLUA 4K50A 4RW4B 4IFVA 1DTTB 1QQCA 3PO5A 5DG9A 4DU3A 4H4MB 2XY7A 4K4XA 4DQSA 4W5NA 2D7SA 1S1WA 1U48A 4I9QA 2XI3A 2Z1IA 3VQ7A 4I7FB 3NH2A 4QW9A 2IMWP 4KPYA 2AX1A 1VSKA 3NGIA 5KG4A 2ILZA 4E3SA 1S6QA 4RUAA 4DMNA 1ZBUA 1HRHA 4E7HA 4J2AA 4KHWA
chains in the Genus database with same CATH superfamily
3A4TA 3VEWA 2BV3A 3GYXB 1RWVB 1EKSA 2CGJA 3BBBA 3FCHA 1PSDA 3CMAS 5A8KA 3SCXA 3BGOP 1WHVA 2KLAA 2P5OA 4G65A 5E84A 2ERRA 5FD1A 5EHHA 4FWMA 4LUBA 1NGGA 2C3PA 4GKJF 2F7TA 4J9QA 4CK1A 2KG0A 4PKHA 2W4DA 1I6JA 3W5XA 2M8DB 4RX6A 4DR5J 1YJ7A 4HEA9 4FPRA 2R8KA 1MNEA 2D9PA 4DJBA 3CJKB 1E4GT 4LF8K 4LIWA 5BR8J 4LF1A 1HNZJ 4FP9A 4OYBA 1XR7A 2B4UA 3TU5A 3NGUA 1N5TA 3GP9A 1VQ8N 4HR2A 2A10A 3UR0A 1GMUA 4NLXA 3QO9B 2HRTA 1VQNN 3Q89A 4CO3A 2H65B 2YHXA 5AE3A 3IAM9 4HACB 1RHKB 2CWKA 2HYIB 1GMVA 2M70A 4NZ6A 2ZD1B 3ILOA 3TX8A 1SKUB 3VQPA 1KOOA 3H3NO 3W2WA 4B8CA 4CGGA 4DR7F 3I0SB 5KPRA 4LBPA 1BMQB 2MKSA 2WHOA 1QM9A 1OQ3A 4DV2K 2DGUA 4OPHA 4YR3A 2NSBA 5C2FA 4F3OA 3P1GA 3MPDA 4Z4FA 2P9SA 1L3KA 1JIHA 4OQJA 1VK8A 5E3RA 1VC0A 1S22A 5B08A 2PDAA 1UETA 3OFGA 3D3CJ 3PNIA 3QRQA 3C6HA 1U8WA 1NGCA 3TAPA 3SAHA 4JKAA 5IWAJ 3ZTSA 3KLGB 1JWWA 1SL2A 4PWDB 1GXUA 2OIHA 1OYDA 3U4LA 2Q1LA 5KOXA 4RU9A 2VG7B 3MEGA 1EO1A 1JLCB 1VBYA 3BF1A 3NP5A 5M1NA 5AQSA 1E6VA 1WEYA 5KFGA 3C19A 3G87A 5T7LB 3CF5Q 3O2IA 1HWKA 2VQEK 1TVRB 1U6BA 1YJNS 1B64A 2E66A 1U09A 3FMWA 3K17A 1ZBHA 2ZH9A 4QPXA 3P4IA 2EFPA 1I94K 1KVJA 3WUHA 3D6TB 1EKRA 3G6YA 4X4NA 3QRPA 3L7OA 1TL1A 4LR9A 3WC0A 3OVBA 2P9KB 3THVA 3R5AA 5FLXO 4ZDNA 3ZCMA 2NUBA 4X4RA 3C14A 4B3RK 1WC0A 4L3KA 3FE1A 1VQLN 2PY5A 2YXLA 4OYIA 5IS2A 3OBYA 3Q8RB 3KFWX 5KFWA 3MM9A 3WIUA 4LBHA 2BZ2A 3OR1A 2OPRB 1DGKN 3MM7B 1L3TA 2ATLA 4F0HA 2XHWA 3ZSWA 1G6BA 2JLFA 2B5JB 3AD9C 1N34J 3WT0A 1LK7A 2IJFA 1CVJA 2R7TA 1R0AA 4OLBA 1HNXJ 3CJ5A 2QMUB 1PJ7A 4IOAL 3EVMA 3PX0A 2J5AA 5AQOA 4DR5K 4FSVA 1RTDA 3PW7A 2V50A 2M5YA 3M6XA 3AJDA 5AJ3F 1U02A 2G1DA 2GVZA 2WBMA 2GW8A 1MU2B 4L3QA 1IQTA 1VBKA 2QA4N 4CF8A 4EP5A 5M2PA 2UVUA 2AEMA 1UOCA 3FFIA 2KVIA 4B3TJ 3UCUP 1N34K 3KJFB 2K7JA 3R8EA 1B7YB 3Q86A 3AQOA 4BGAA 2IC3A 1NGBA 2PIIA 3MZIA 2DRAA 1FE4A 2XZDB 3D7SB 4ZPTR 3OYFA 3M8RA 1J5OB 2BJ7A 2OD4A 3VQ5A 2OANA 4DN0A 4K5SA 4C1NI 4OI4A 4EFAC 4EZ6A 5IZHA 2DGOA 2R2TA 2OTLN 5KAKA 2DXEA 1HMVA 4DR3F 5C5JA 3UB5A 3RMAA 2DPIA 1RBVA 5GADI 5F8GA 2JL9A 1I94J 3GG4A 4N8OA 1FXRA 4LFAJ 1NK4A 5AFUA 1CJUB 2QL7B 1N6QA 1KFDA 2LQ8A 3BN7A 3AV9A 3DOKA 1X9JA 3TTFA 1VQ4S 2MSTA 1RT1B 5C25B 5KFKA 4PABA 2MYFA 3HHEA 3OUYB 3GIKA 3RR7A 4LF5J 2DNYA 4NXNF 1S6UA 2MZ1A 4ZPDA 2H3GX 3HTVA 1X5TA 4WFNQ 3CCSS 4DQQA 1WDDA 3QT7A 3H8YA 4E1JA 2BJ9A 1XMOF 1JLQB 4WKRA 1JJHA 4DL6A 1DY3A 4OJ1A 2E5GA 2FLNA 1Y10A 2ASJA 1FNXH 4A8QA 3V1RA 3GG1A 4Y6IA 1RT4A 1KAZA 1Q8BA 4RW9A 5GAEI 2FC0A 2OTJN 2DXDA 4OZ1A 3AVKA 4LVOP 2CJ9A 3OYMA 2YNFB 5M2UA 3VESA 1VIOA 3EXCX 4LRBA 1S57A 4YDDB 2AHOB 6FDRA 2UVVA 3CCVN 3UKUB 1S0NA 3TVYA 2E1CA 3GLJA 5F0UA 4M3ZA 4NLTA 4JKHA 3RSEB 4AE5A 4ED7A 4DV4J 1UAWA 5HAOA 4ITSA 4B9QA 1IKVA 4IFYA 1DFDA 1JLQA 2RHQB 5KFFA 1Y4ZB 2AF6A 3E01B 2J9DA 5D0RA 2V9WA 5JLHA 3TRGA 3MR3A 2V8DA 4DV0F 4OI3A 4JI1F 4GVMA 3T19A 5BR8K 4CJUA 1S6PB 2NRTA 3HOSA 4PKDB 2Q1NA 3VAHA 2GHWA 3SCLE 3JAMO 3N01A 3VR1A 3ZX3A 2CZVC 3JAMU 1WNSA 5KFOA 1IQZA 4WQ5A 2DTUA 3TA0A 2AKWB 4M5DB 5AQXA 3FZ2A 4CZKA 3DRRB 4EFHA 3BB5A 4KFBB 2I7PA 4KO0A 2H4YB 2YKNB 2QA4S 3M8SA 1ZBSA 3OYKA 3PO4A 2UXBF 3W8GA 3E2EA 3PIPL 2F8TA 3ZZOA 2UXBJ 2PI4A 1N36J 3KLGA 4FS1A 3QEPA 4CF9A 1F2GA 1CXQA 2WVBA 1C0UB 3HJVA 2J0QD 1F0XA 4YMEA 3CE8A 3AVNA 2NPIA 3UCZP 2ZOFA 1GXTA 1UKUA 4A8XA 1VSMA 3I82A 1OWXA 1CS4A 3AVMA 1KR4A 4L74A 3M30A 4NLWA 2QWPA 5DQGA 1FFSB 3OVSA 1TMJA 4IG0B 2BABA 4OI0A 3AA3A 4WFNL 1X3MA 3C7NA 3HSTB 2DPJA 2DHHA 2MY7A 2HVZA 3KLIA 3AVBA 4C8MA 1D3WA 3PJ9A 3NS7B 2Y1JA 1OVQA 3UN3A 4USIA 3MDQA 3A0IX 2APOA 2GJFA 3D54A 4CNYA 3LUYA 4DV3J 4DV6K 3OYGA 3CIMA 3M8PB 3CD6N 4RBVA 1X4AA 3MCOA 2ZITA 1N5YA 2R7QA 1UW4A 4L8RB 4DX7A 4HKQA 4ALZA 2MLYA 2D9OA 2V52B 4CIOA 3KUHA 3D3BJ 3BPDA 3J81O 3UO0A 3UDVA 4CBUA 4CLSA 1CJVB 2DB1A 5AZIB 2VBXA 4DV6J 2XLKA 4IJNA 2R7YA 4DV3K 4LF7J 3ZX2A 5ETOA 4NPOA 1GLEG 4PCQA 1FX2A 3OQ2A 4IR9A 3OR2A 4C4WA 1HBOB 1RK8A 5AJ3J 3NH1A 4M3WA 1RDAA 2DR9A 1G1XA 2QTDA 5CHIA 2MMYA 1ELOA 3HCXA 4ED6A 3FBFA 1B0PA 1MWYA 3MMAA 3F9MA 2ZWHA 4RU2A 2L3MA 1IBKF 1CJTA 3BY5A 1HNXF 4RUBA 2ZVSA 4ZCMA 3W8PA 4GKJJ 3SUPA 3NS5A 4YB6A 5B0GA 4ZIWA 4I6MB 2HMIA 5H9EJ 3WBZA 5AQUA 5T7LA 4C8LA 3MD1A 5FRMA 2MQQA 4ENOA 2CQIA 2F3JA 1VQ5N 1T3NA 4Q43A 1F3VA 1K9MO 1SL1A 2XHBA 5IT9U 3OSPA 2AMCB 4UOHA 4BC7A 2W25A 2HS4A 3T5LA 4ANCA 3SMSA 3FDSA 2VKZG 4IFVB 2UUBJ 3KIOA 3VGUA 3GFYA 1RAGB 5KT5A 4X66J 4M5JA 2KJVA 3CCJN 5GVQA 1NZ8A 4FJ8A 1FJ7A 1PYOB 3GV7B 4EUVA 2QE5A 4JI8K 3L2RA 1TK0A 1MROA 3HSJA 3M2UB 2RS2A 5GAHP 2LCWA 4TQRA 4NX9A 4LR8A 3T3FA 4ZIVA 2ITGA 2QIFA 1R89A 1VQNS 3TZWA 2IBKA 3K7RA 3LM9A 3U9ZA 2UUCJ 3BH6B 2GQQA 2QL9B 5I3QA 3US5A 2NXJA 3TZZA 1G15A 3SV3A 2MHEA 3PIOL 1FRHA 3BO4A 3LGNA 1JJ2M 1H7XA 1T9TA 3VQSA 3EDQB 1VIXA 3Q8UA 3RBEA 4CLLA 1HA1A 1M5SA 3GIJA 4L3NA 3HVRA 1CJKA 3MECB 3FNNA 2R7RA 2Q97A 2MHNA 1OSCA 3CERA 3IN5A 4JKBA 3CFRA 2FJDB 2JEGA 4JI3K 2IRXA 3VGLA 4ECSA 4A59A 2HQGA 1YX2A 3DU6A 2R8GA 4DV1F 1WG5A 2J6UA 3EMTA 1YJ9S 5D4PA 5AQYA 3UE5A 1LNQA 2G2ZA 5F3ZA 5FPMA 1WSFA 1DJ0A 2AU0A 4ZTJA 1JCGA 4CI0B 2J0XA 3TA1A 3PVXA 5L8RC 3O3FA 3M9OB 4YOTA 5FDLB 2WBRA 4EMDA 5F9LA 1VLOA 2UXDF 2XWXA 1QZ6A 1FNMA 2KFYA 4IEEA 1DURA 3IWNC 2DFHA 4OZ0A 1T05B 2IYGA 3GU0A 4Q44A 2HHUA 3QATA 1YTAA 4OYAA 4Z0UA 3CFOA 4ILGB 2LEAA 5DM6Q 2I7NA 3U8XA 4DTNA 3MTKA 1N36F 2HMIB 1PJ5A 3DGVA 4K25A 1EQYA 4W4MA 1O13A 1ILYA 2XGPA 4JK8A 1RB0A 4KHQA 1UVMA 3U6FA 4LFCJ 1RA7A 2WFBA 3G9CA 3MMBA 3NVKA 2CNKB 4OGCA 4AM7A 1TUYA 1RT3A 4ED1A 4FLZA 1TKZA 4FZYA 3OV7A 3MR5A 3R7NB 2CJYB 2HHWA 3AO5A 4KRFA 1N32K 1DLOB 3W2VA 2OI2A 2ZBCA 2AZ1A 2F8SA 4P7TA 1S1TB 3CD7A 2D3UA 1FJEB 4JKCA 3T7ZA 1Z2ZA 5AZJB 1I3OB 3D2FA 2GUPA 4ED2A 2HFOA 4M5KA 4CFCA 2J0WA 1SQGA 4HI2A 3D7EO 3PSIA 4M3TA 1Q82O 1IKYA 4E0DA 4LFBF 3WX8A 4DDFA 2IMOA 4XDCA 4LSZB 3NXZA 2RF2B 3LP2A 1SKWA 2H48B 2MZJA 2KFNA 1P1LA 4A8YA 2VA3A 2Q6CA 4N56A 5CE3A 2MXYA 1RGIA 1KHVA 4OPJA 3V1QA 5IV4A 4URSA 3SMZA 4ZVPB 2YKMA 5CABA 4HUFA 1NDPA 3IR7B 2K8GA 3OLBA 2FPHX 2OMOA 2MSSA 5KFIA 1VRUB 1RA6A 2UU9F 2AP6A 3CPWR 3AD8C 1XI1A 1TV6A 4DF4A 1V9OA 4NCGB 2WBNA 1DRZA 3ENOA 1NGJA 4FJGA 2XGQA 1RWUA 4KGKA 5B0CA 1H98A 3ILJA 1DT9A 2NRWA 4BC4A 4AQYF 1QQOA 3Q2TC 4Z4HA 4UOGA 2V7ZA 3IP0A 3CIPA 2J9CA 2YWWA 3DOLA 2M2BA 4M5HA 3KJQB 1VQ7S 2F63A 3IR6B 1KLMB 3HSGA 1S6PA 1Y5NB 4AHTA 4KHPF 3GIIA 1HHQA 2QXFA 5D0EA 3G71N 4X4TA 1HQEB 4LRFA 3U02A 5DM7Q 4GVLA 2GTDA 3O9SA 2AZ3A 4KH5A 5C15A 2F65A 2HNYA 3MOZA 2VL1A 1OO0B 3M7VA 3M32B 1KTVA 2OA8A 1WUUA 3IG1A 1T44A 3NVMA 3E9LA 5JVHL 3MEDA 1T11A 3PCOB 4H4MA 2DNHA 3SSSA 4BC3A 3OXLA 3F73A 2VQFF 3EWGA 5FLXY 1E6YA 2PMHA 1B0TA 5HL7L 4YB5A 1GTEA 1X7VA 4TNOA 3VETA 2HRUA 3ILLA 4CECA 4M1KA 1ITGA 1YF5L 4CJ4A 2OPQB 2KT3A 3FZFA 4BR2A 1HUXA 1BA1A 1VMBA 4DTPA 1XERA 1XK8A 4OZNA 1REVA 4QCLA 3VHQA 3KG0A 2XCPA 3CJRA 3EO3A 4DV2J 4DR2J 3K89A 2M4MA 3CCRN 3FEZA 3J80Y 1YRUA 4CGFA 5D6GA 4HLBA 3PM9A 3CDWA 4AXJA 3LPTA 4A2AA 4B1VA 2RF2A 2FJEB 2A0FB 5GMKa 1OMSA 3WQTA 2R9LA 4H5TA 3QT6A 3IA0A 5H9FJ 4DV5K 4DV5J 4ZS6A 3RRHA 3ETMA 3ZZRA 3P39A 3NE6A 4P10A 2LEBA 4QIFA 3K9JA 4CLWA 1Q78A 3K5LA 3BO3A 5AQFA 4OYOA 3EY1A 3CCQN 4KIAA 3CT9A 2D0CA 5E3CA 1RWMB 4WTOB 3FUYA 4JV5F 4CESA 3SIPB 3DYAA 9ATCB 1EP4B 4O8UA 1SJ4P 2R7SA 3JXUA 2V69A 3CC2N 4TQSA 4YDUC 2VBYA 2DR6A 6FD1A 4OKKA 5BN8A 1XN9A 3SI6A 4AHSA 1K8AT 4ZCIA 3SDEA 2VC0A 1SI9A 2QO3A 3VQCA 1IM6A 1JXBA 3OL7A 1V4TA 2O4IA 1KVBA 5HQMA 2XMAA 2RS8A 1U1LA 2GJ2A 3GR0A 4IOAQ 2RE2A 3S3OA 2ACYA 5BPMA 2IVMA 2AJ0A 4PXEA 4YNQA 4WE1B 1SC4B 1LAVA 5HN0A 2Y8WA 2LDYA 5DDRC 2QMWA 3BS9A 3KVGA 1KC8T 4ZITA 4NB4A 2B7CB 3TTDA 4QZVB 2LQ9A 5BRDA 2CQ3A 2ZNZA 3PDNA 5AT1B 2IPOB 3H40A 3T1YK 3I6PA 1IXKA 4QR1A 1R8HA 2ROEA 3DHWC 3R5JB 4CCHA 1NHUA 1NGDA 1Q8LA 1LK5A 2VPWB 4ZP6A 2MZTA 2VV5A 1K73T 4CHPA 3HHLC 3VALA 2D0OA 1YRXA 3CETA 4DFJA 2RHSB 2ASOA 4U67Q 1QLNA 1N32J 4FWKA 1APSA 2HBLA 3AO1A 2E5LK 2XEXA 5F8LA 5KFYA 1QY7A 1AZSA 2F4FA 4N7TA 2QT7A 4Z2XA 4BQLA 3CCSN 4DLEA 3U3GA 2QWOA 2B5JA 2NRHA 4R0EA 3HD2A 2GWJA 3T1YJ 4MJKA 1KRPA 1LWEA 3PACA 4CTAA 4ZVEA 4F0MA 2K2PA 5CYMB 4KHSA 1HBMB 2ZUAA 3H5YA 3TI0A 3W63A 1X8DA 3BGRB 3CNQP 3OL6A 3HHLD 2YPZA 3HT0A 4F4ZA 4DMZA 1KXPA 4ZLLA 3QDKA 4L75A 4B3RF 3EICA 1RTJA 2BE2B 3AJ1A 4KGXB 5A8RA 3R7BB 2DITA 4IJAA 3MMVA 2D0BA 3OYEA 2R2SA 3H6EA 2E9RX 4NYZA 4NZ7A 5MAOA 1TYQB 2P9UB 5KRSA 1FCAA 4O44B 4I64A 1WN7A 3MI7X 3IFRA 1HMVB 2BXJA 5E33A 2DVIA 4WP3A 2IAJB 2P9PA 2ZJRQ 2OFHX 3QWUA 5KFUA 3BYRA 4AH9A 2F5GA 4TVAB 1QTNB 1KKHA 4C7QA 2AV5A 5KGWA 4XPEA 4Y34A 4JI2F 1YJTA 3C66A 1HLUA 4C1NK 4KBIA 4C11A 3QLHB 1GXLA 4F04B 1URNA 4LD0A 4JI1J 1HR0J 1HD1A 3D0PA 3D2WA 4MQ3A 2MLZA 3MN6A 2P9EA 3DLKB 5C24B 2EHGA 3FVYA 2VONA 4BCAA 3FEYB 2JFDA 4FOEA 3MEGB 3DLBA 1CJTB 4HTUA 1KBRA 1Q81O 1NB2A 1ASWA 1RQ0A 3DNCA 1SC6A 1AA1B 4DWIA 2GIRA 1KVAA 1GLDG 2FXUA 1SJFA 3GR1A 2HVIA 1N6QB 1HX1A 4DR1K 3THTA 1N54B 2GO9A 4KHMA 5GAEU 2P9IB 2J4RA 3MF5A 5HROB 4J9LA 3UDLA 3V9XA 3JS6A 4CLFA 2V68A 4RW9B 4X66K 1TAUA 3GV8B 4QWAA 1UMJA 3D9BA 4X4VA 1SXLA 4DR2F 2B4VA 3OFFA 2YNHA 2IDOA 5HVHA 3B8HA 2V8PA 1D8YA 3GFXA 5EX5A 4MDBA 4X62K 2HBQB 1DARA 4P9SA 5IXUA 1TGOA 5KT7A 3J7ZT 4BROA 3TQEA 3RBXA 3S3MA 3PJWA 4F4WA 4URGA 4AL5A 4V19J 3JS9A 2HHTA 3MXMA 2DNPA 3WEEB 2HWHA 3NMAA 4QU6A 4KJIA 2EWHA 2P9IA 1EWRA 4AHVA 2KVQE 2PC6A 4CHYA 5J2NB 3UVJB 2R4FA 3UD4P 1LXNA 5K14B 1ZPWX 4BRDA 2AJFE 2XI2A 1RBRA 4YR0A 1QQMA 4YHHK 3H46O 3MEEA 3R97A 3LA0A 5DQIA 3A5MC 2WW8A 3Q8SB 3TAGA 1FK9B 1RAAB 3I9V9 4IH7A 4JV1A 4ZP8A 4NO7A 1Y7PA 2U2FA 4B9UA 4ES3A 2FVPA 3W61A 3Q8YA 4CJKA 3C3LA 1ZM9A 4QR0A 4J9MA 4LSNB 2DO0A 1WBBA 3VOVA 3V4MA 4TN2A 2YTCA 4FKXA 2WTUA 3TAQA 5LJ5Y 3BZCA 3N4WA 4LFAF 3DLEB 2DNKA 4CRJA 2WAQD 3K59A 2F9JA 3MM7A 4LH4A 3VQ9A 5I3UB 1KSPA 1OH8A 5C2GA 4FWQA 4Q2LA 3L95X 4YY3J 5ADXH 4EHTA 4MYUA 4MKYA 1J5EJ 4OIXA 2IVPA 4KT0C 1REVB 1YITS 4FXVA 2RE1A 5C10A 5GINA 3MOJB 5K8PA 1VHFA 2EPIA 4H0VB 1L5UA 4NA2A 3OFEA 2N82B 3QBWA 3OYBA 4UQTA 2XSJB 4XK8C 1XR6A 1UVJA 3AAWB 2YWEA 2XS5A 5AQPA 1LWFA 4DBQA 1NSQA 4K8XA 4DUZK 2ZH1A 4OZJA 3I32A 2KH9A 2ZKUA 2KT5A 2WONA 2AYEA 2X3DA 4DPWA 1ZA1B 2LSNA 2DRDA 2BKOA 5E26A 3JTOA 4IOCQ 4DSIA 3PR4A 3C7NB 1DAXA 1KEKA 2C28A 3S01A 2WONB 4OHVA 2OPRA 2UXBK 1CPZA 3VQBA 4DCHA 4FXWA 1P27B 3V4IB 3O5TB 1MDUB 4KI4A 1X4EA 3HULA 2KM8B 1U2VA 2NRVA 3W9IA 1IJFB 3NAEA 4CHOA 4CJSA 3DOLB 4O3RA 2P9NA 1VI7A 5DG8A 3AOCA 2BE2A 5A8RB 4FJHA 4LF8F 3I8DA 1ZAVA 3VF2A 3KNAA 5LSLA 1GK8A 3C16B 4ZPWR 5I42B 5L1KA 1HQUA 4O3OA 2CKWA 5C7PA 2CQ2A 2DNRA 2HOEA 3DU5A 4H0YB 4U9RA 3HKZD 1YIJS 2A6OA 5RUBA 1HNVA 4I67A 4G1IA 4G1PA 3VF0B 3TAEA 2KM8C 4CZLA 3T5JA 2FLOA 4Z7YA 1X5SA 1S76D 1VSLA 5J1EA 1DQ9A 4GV6A 1YJ9N 1HWLA 4IFVA 1DTTB 4B3MJ 1QQCA 4DU3A 4H4MB 2KKZA 3LW5C 1URRA 2BJDA 3NH2A 1FI4A 3H25A 5KG4A 1W2BR 3BDEA 3DKDA 4NI2B 1OJ4A 4Q8FA 2KZZA 3R27A 3MCSA 4W98A 1WACA 4ZLPA 3Q23A 3VQQA 3GFZA 3AY0A 4GMKA 5F8NA 3TR8A 1HWJA 5KPZA 3W5YA 1LFWA 3TARA 3UNGC 5EX3A 2FC8A 4M5DA 2R7VA 4BWJA 1GLCG 3E66A 3ENHA 2QYCA 3ENQA 1VQ5S 3MFHA 4KH4A 4CK3A 4N76A 1FRJA 5BRHA 3TSUA 2E1ZA 4J9PA 3FZLA 2JEFA 2JEIA 2QW9A 2C2ZB 1WLJA 2BW7A 4H4KA 4CI6A 1VQ9N 2VOOA 5ETMA 2RRAA 4I2PB 2JHEA 2JWKA 1BISA 2ZVIA 3MEDB 1SQEA 3GCWP 4RWXA 2FJXA 1IJJA 4RNMA 5EOYA 1T0TV 1EX8A 1WEZA 2B6AA 5E2QA 4HDGA 3VGTA 4OV1A 4KHYA 3MMCB 5AQJA 2E2OA 3NF9A 2ZUGA 3CJKA 5A0YA 1PCAA 3VMFB 2CJKA 2JNJA 4FYWB 3MR7A 3P31A 2O8BA 3QQCD 2PBDA 3UD5A 3CJ9A 4FPAA 2HFSA 3V9SA 2K3KA 3SBGA 5AQGA 3BGRA 4CZEA 2PMWA 4LFCF 3H45C 2KRRA 3FCVA 2M9KA 3TAMB 3ALYA 2AYMA 1R8AA 4PG6A 5M1QA 3MMAB 1GX5A 3M8QB 2QFIA 3I9ZA 2IDLA 2RQKA 4HVJA 3J7AN 4DV4K 4JI2J 1RILA 1RJJA 2OP5A 1XIQA 2DGVA 1SC1B 5BXIA 4FS2A 1WSVA 1FKPB 4JI8F 3TEGA 4FDFA 2R2RA 4PG4A 1CS4B 3BV8A 3I55N 2MJUA 1NUEA 1OIAA 2RJZA 1DTQB 3ZZYA 2FBXA 4DI6A 1ZBLA 3P96A 2NZ4A 4ISFA 1Y11A 1C0UA 1NLKL 4IXCA 2FHMA 3OTOJ 4OX9K 2WVEA 4WQ5C 2VFSA 1P8GA 1L3VA 3GILA 3G6XA 4NLQA 2DRBA 3TVKA 2ITMA 2FZGB 3VGVA 2UV8G 4DV1J 4FZXC 2XMKA 2KXFA 3R9LA 1K73O 1Q7YT 3UQSA 2MQMA 2IAJA 1WKJA 3E51A 2XSJA 4LF5K 3NGTA 2PAVA 2HFVA 1YK9A 4DR4K 4NYOA 3CUNA 4OPAA 5EN1A 5B0EA 1T05A 3BO2A 3CD5A 2OMLA 1S72S 2I6WA 2I38A 4B08A 3D1OA 2CQHA 3MUTP 4DSLA 3EE9A 2EEYA 5K20B 4HH0A 1HI0P 1RBOB 2SXLA 4P72A 1VBXA 3N5BA 2D1KA 4OV6A 2PSZA 2XCAA 3ZSVA 3TAMA 4CJ3A 4ICLB 1G2EA 3RMBA 1UVLA 3WEEA 4NI2A 3OT9A 5KI6A 4DSKA 5F2RA 4W92B 3OTOF 3I0RB 3R3TA 4EU0A 3IGVA 2RQ4A 4ZN3A 1M90O 1V3SA 2ZDOA 4EBDA 1WD6A 2HF3A 3BJYA 4DUZJ 4DFKA 5D0GA 5DGAA 2BRLA 4BRKA 1R31A 4U8YA 4FF2A 4M7YA 1PBAA 4O5FA 1BOTO 4Y0WA 3DLEA 2MQOA 4NXNK 3DDNA 2ZH4A 3DXMB 2MQNA 2E5HA 4CF2A 4HHUA 2V8HA 2BUNA 4J9UE 3KG1A 2P9GA 4LY7A 5AQHA 4BQZA 2FLLA 1J5EK 1TELA 1XWLA 2HNDB 2YKPA 4OLPA 2C22A 1KN6A 2AT1B 2WZ1A 4YY3K 2CJBA 5HP1A 3DLLL 4NEYA 3NCRA 1AW0A 1P8ZA 1WDTA 4X65K 3Q0AA 4CEAA 1VSDA 5JMVA 3OYDA 1UVIA 3MN7A 1TL5A 1T9XA 3FBEA 1XQIA 2YJFA 3CPWM 2GHPA 3QLHA 2VASA 1NGIA 1EETA 2F1FA 4O3QA 4ISEA 2GFFA 1S99A 4FJLA 3MR6A 1W2BM 3EGVA 4Y2KA 1XNRK 1VJQA 4TU8A 3KXDA 1IR2A 1JL1A 4YS2A 4LIRA 1RHMB 2Z4PA 3VZHA 2AGQA 2Z8QA 1IWAA 1XMBA 4DCPB 1RTHA 1C1CB 3BKTA 1HBUA 3QEXA 3A8KA 4X4PA 2G13A 3M8YA 1RP5A 4TY8B 2HLTA 3SBTA 2W01A 3MMBB 2NQPA 3MXJA 3AOAA 1TAQA 1IBCB 3LZIA 4MDAA 3HOTA 3U1NA 4M7XA 5AE2A 5AR0A 4PQAA 2QWRA 1QVFR 3I0RA 4B02A 3KLFA 3PRDA 3ENBA 2D69A 1JB0C 3GE9A 1ICEB 4M5GA 3BR8A 4OJHA 3H5SA 4FO0A 2GQ2A 3JYTB 1UZHA 3CCMN 1ACMB 1SVDA 4WFZA 2HIYA 4JYAF 4PWWA 3C14B 2OEKA 3OLAA 2ZWOA 4BDZA 4J9RA 1ZETA 3R1XA 1FJGK 1HNIB 1IUJA 1UEKA 3P49B 2DNNA 1VSEA 1YJWS 5FDLA 4F4XA 1Q16B 1S1XB 1BIUA 2NXCA 2HF4A 3O3LA 4K2JA 1MU2A 5L46A 3EYZA 1EQMA 4WJBA 1MWKA 4NYNA 4CNZA 3U9DA 3HFKA 5AZJA 1RT2A 3T1HF 4A2BA 4LF4J 3SPZA 4PY5A 1D8ZA 2ZGZA 3M1VB 3MEEB 2KO1A 5HP1B 4DR1J 2BE7D 4PQUB 2HZCA 2M0GB 2BACA 4MO5A 1GOCA 3TUPA 1UZDA 2MY8A 2YH0A 3VEYA 4NXMK 1RBUA 4BRMA 1IKYB 3X1LB 2CDRB 4CJLA 5K9FA 5HATA 3W3SA 5J1NA 4UTGA 4UOCA 3LP0A 4DUTA 5IWAF 2H1YA 2P51A 2PE8A 1S5JA 3HP6A 2BDPA 1I1GA 1EARA 4P2FA 3ZT0A 4HCBA 1JLBA 1RAEB 2VFTA 3GZ7A 4FK0A 1M5PC 5KT4A 1VC6A 4CLTA 3AHPA 3DLHA 1N8RO 3QMLA 4S0MA 5IT9Y 1HPMA 1EJ7L 5KQ8A 1WHYA 3IWLA 1FVSA 2YCHA 4YORA 1VJWA 3CCZA 4J7CA 4B9VA 1M5OC 1S77D 2CH5A 4U96A 1NJYA 3W0LA 4QWCA 3WXKA 2OEMA 1RT1A 5D4OA 1M1GA 4O4GB 4H4OB 2PN6A 4F3MA 2LLZA 3D6HB 4OYZA 3IO1A 4CO5A 3VV2B 3LDNA 5JS2A 2VHGA 2CGKA 2HQDA 4WE1A 4ZLJA 1VQPS 3V6HA 3DRXA 4H4OA 1FDBA 2BQRA 4P75A 2IJNA 3CQXA 4QOZB 3V6JA 5KFVA 5KFNA 4E7KA 1WAJA 2XS2A 2KZMA 3HP9A 3C46A 1EHWA 4NLYA 4DL0C 3UIQA 2LMIA 3IFEA 1SIWB 3A5LC 4GC6A 1FTCA 3I5AA 1Z05A 4NL5A 3TSQA 1D1UA 3A12A 5CZXA 3HKWA 2PA8D 2QZ8A 4DPXA 1SH0A 4DFPA 4FBTA 1WOQA 4CF1A 3HL8A 1IR0A 4DTJA 1AYEA 2ZH3A 3RSEA 4ID1A 2HVHA 3TPQA 3M8ZA 2P9PB 5LJ3Y 3KK3A 3H98A 3IKMA 1VQOS 3FSXA 4MKVA 3T6JA 2CVEA 3BSOA 4FJJA 3D2EA 4CLYA 2F7VA 4BGBA 3IC1A 3ITHB 3LP0B 3SQ1A 3ZFVA 3OW2M 5AXNA 4PXBA 5FPDA 4QAGA 4CJVA 1W97L 1AZSB 1S4EA 4DL7A 3AVCA 3KHHA 2E4LA 3W1YC 3G4SS 3IG1B 4P73A 2XZTB 5J2QA 1H38A 3GSIA 1NHKL 1Z26A 1BQNA 3HSDA 1D0EA 4OJGA 2G8HA 3M2UA 5J1EB 2F9DA 4KB0A 5HBMB 1GFWB 1T8EA 4R8UB 4FVMA 1AUDA 1MA9B 2YKNA 1N0VC 3QT8A 4JI4J 1O8BA 1Q79A 1RSCA 4CZJA 4DR6K 1RT5B 3KZBA 3K8WA 3AAPA 4JKDA 4QYZK 3QYYA 2L9WA 2V34A 4GNIA 2K06A 4OI1A 4CGJA 2HBRB 4B17A 2GO8A 2P5GA 2F4VF 2LU1A 3DOKB 3BUZB 2G8WA 5E3AA 1YBUA 4A8WA 3N79A 3CJCA 1PBUA 5BYQA 4ILRA 3M9MB 2G0CA 3OPKA 2ZJPQ 1VYAA 4LF6F 1E6YB 4OZ2A 1U0HB 1U04A 1UPPA 2KB2A 4USMA 2E20A 1W26A 3PYGA 3M8WA 2BA9A 1YJWN 5H9FK 3IMQJ 1QDUB 2OEJA 1FNOA 2FJAB 3WNEA 5HL7Q 3GE1A 4CFBA 4KYZA 1RHJB 3TA2A 1XNRJ 2HK3A 4NMLA 3A8YA 3HZGA 2BKPA 5ETPA 4FJMA 5AQNA 2QA2A 1TL4A 2UXCF 1N34F 3W9HA 4RNHA 4DQIA 2RUSA 1S49A 4BR9A 4DV7J 2BE9B 3C8YA 2O01C 1N0UA 1FA0A 5GIPA 3DXKA 4HHJA 4AXIA 1SH3A 3NWRA 2A2CA 3TAFA 1Q9XA 1CZAN 3MAHA 4PPDA 4FLWA 4FJIA 2XQCA 2CPZA 4Z94A 4B1XB 2D1CA 2ZM6F 2AD9A 4DR3K 2MZQA 1WEXA 4J2DA 5LMNF 2RVJA 1IBLF 3D28A 4CJ5A 3DLGA 6AT1B 4DU8A 4DL3A 3SPYA 4DR1F 2V4QA 3C6AA 3H5UA 3DHXA 1T9WA 5KQDA 4WP9A 1W0HA 2Q2RA 4QR2A 3GQCA 1TZ0A 2YNFA 4MO4A 3D5MA 1TKXA 2FLPA 4JI6J 4K5RA 4I0WA 2J8AA 1N33K 1UFWA 2QSFA 4FJ9A 3HDSA 4KTQA 2HSEB 3FZBA 4H54A 4BWMA 3T1AA 4I1TA 3R5DA 4DUYJ 2N4DA 5DDQC 3E1YA 1R8PA 4Y2IA 4Y0FA 3QJPA 1QS4A 1RWXB 3SDEB 4FZZA 3VAJA 2NRZA 1SV5A 4C6AA 5T41A 1BI4B 4DPTA 3RMCA 2KG1A 2Y1IA 2OCEA 4KQZA 1OH6A 1OPZA 3OR2B 3GL1A 3NBPA 2QG9B 4CLUA 3OYAA 2IM1A 2FSKA 4ER8A 2RDJA 2XNQA 2EBGA 4FK4A 2N3LA 2IVFB 3W60A 3PYDA 4IQMA 4ERDA 1RHRB 2HNYB 1CULA 3PYFA 3NF6A 3BBCA 3A2FA 3LPEA 4OYPA 5LY3A 1BUXA 1QSYA 3LH2S 4F36A 3EPIA 2CQ0A 2I9SA 1C4AA 5MLCQ 2BW2A 3U27A 4CZCA 3Q24A 2DJWA 1N88A 4IKFA 5CHCB 2QJ3A 4YOYA 2KKHA 1XNQJ 4DEZA 2RKIB 3VVTA 4O3SA 4ZN1A 4IFYB 1IKVB 1WI6A 4K59A 1W25A 3JAMY 2DGWA 2W2MP 3W5ZA 4F4AA 4F02A 1NCLA 3RB3A 1IBMJ 1C4CA 1YWXA 1CBKA 5HMWA 4MIAA 1WC1A 4C0BA 2VGNA 4TKTA 2R7OA 1NEEA 1TKXB 2UUCK 2CG4A 2KYZA 2E1YA 3PIPQ 1CXUA 2B9YA 3RWUA 3CJ3A 3Q8VA 4HVZA 3O6QA 4ECWA 3L3UA 2HEKA 3T9NA 4ID5B 4MT1A 4GKKF 1S9FA 3IM9A 2DH7A 3DRYA 3QWPA 2WOMA 3JSMA 1N5YB 3DYAB 2NCKL 4WP8A 4DUZF 3ZSOA 4KBOA 3E3XA 5KG6A 4E7LA 2R7UA 1RKIA 1X4BA 4PZVA 1U1MA 4UY85 3F41A 3H2VE 4ED4A 4DV0J 2LP4A 2O8BB 3VQ8A 2QYGA 3CJAA 3SQGB 1Q18A 1Q86O 2M52A 4A8FA 4JB8B 4R0JA 1QZ5A 3N28A 3KLHB 5K14A 4DV5F 2HFNA 1XC9A 5LJWA 3M30B 2DGSA 3SLCA 3TEHB 3V6DA 3LZJA 1GH8A 4JS4A 2E8AA 4NZ0A 4B1WB 2POKA 5I3PA 4LF6J 4KHUA 2W6KA 3CJ1A 3FFIB 1NBWA 3A8JA 4U67L 2OYQA 3SUOA 2JSXA 4Q7AA 1Y64A 3C6TB 4ILMA 5CY4A 4CJEA 3NCQA 2J7UA 3GYNA 3KLEB 4HI1A 2WTFA 1BD6A 2ASLA 4FWOA 3GMGA 4ZVTB 5BPNA 2NRXA 3EN9A 1WSRA 2FVQA 1O1WA 3S8SA 1V5VA 2WOMB 2MEWA 2CJXB 2G4BA 4QYRA 3CC7N 2G8UA 3J7YU 3KLVA 4JI4K 4CZMA 4KY3A 2O5DA 1RWPB 1NM1A 1FDDA 1Q81T 2QM1A 3M32A 3C65A 1RWWB 2ZHBA 2UUAJ 4FLYA 4H8KA 1FDNA 1NOYA 3RG6A 1I94F 1UJ4A 1OY6A 2HHPA 3KLFB 4R8UA 2P9UA 2YQ1A 1U6ZA 4DTMA 2ZGYA 4CIGA 3MURP 3G4SN 3DRPA 3MAAB 2BR0A 3GYGA 4JN4A 4B3SF 2W1BA 3HRGA 4C3MA 5BRFA 2Z1JA 4TYAA 1DQ8A 4CFAA 2HBYB 4WIIA 2ZZMA 4XPCA 4FVUA 4CJPA 1B9DA 1KAXA 1PC4A 3D68A 4M5MA 3P6YC 4UW2A 4F25A 1NK9A 3CVKA 5F8IA 3PFEA 1SL0A 4CJFA 1NKEA 1PIEA 4UF4A 1TV6B 4DU7A 4KC5A 2Q36A 3ZT3A 2CNLB 1U8SA 3SK3A 4J91A 1ASUA 1OPIA 2RNEA 4WIQA 3QIDA 1TYQA 3DRRA 4JI5K 1HHSA 1RDUA 5B09A 5M1PA 3N4PA 1PAEX 3UI3A 4RUCA 3B6OA 3V9ZA 2ZF5O 3QJJA 3QNWB 2E9TA 4NLSA 4IG3A 1HKCA 1KWMA 4WYLA 3DLKA 3PR5B 3R6GB 5AJ3K 1VK3A 4ZA1A 2E44A 3PRVA 2XO7A 3C2PA 4WXWA 5GIOA 3J81U 5GAGI 2PZSA 1SJRA 4KAIA 4V19S 2Z1HA 1Q1KA 2NXNA 1XC3A 3D0IE 3CJ4A 3IGNA 3RB6A 4TYBA 2ZH2A 4IDKB 2MQPA 3THYB 2YKQA 1HKAA 1PYSB 3N6LA 2Z2ZA 4DV7K 3DXMA 3TTCA 1R8BA 3IRXA 4Q8EA 1MWZA 4JI7K 2V9KA 3L3CA 3BREA 3PRBA 3L4IA 5KG1A 3PW5A 1HNZF 4JKGA 1QHAA 3LGHA 2IA6A 3J81Y 3H08A 3IDHA 1UWAA 4ZVGA 2W4CA 3CDUA 4RNNA 1WG4A 1V6HA 1B7FA 1S1WB 1LKZA 3TOQA 2JH3A 5KFJA 5FPNA 2GGPB 3ZZZA 3QIOA 3IBWA 2YKMB 1NNEA 2A1BA 1LW2B 1ROFA 3MGJA 2OZMA 2DHGA 1OVYA 1CLFA 3M5RA 1D5AA 1RCHA 4DR4F 4FNHA 1XTZA 1HBOA 1VISA 4DPOA 1WB9A 3DC2A 4FCYA 3A1YG 1YKWA 3E01A 2A6AA 3AVAA 3U3YA 4CEFA 2GJIA 4M63A 2G2OA 1HYSA 3A8EA 2JLGA 1X60A 3BEGB 3GJRB 1ZH5A 2VKRA 2JWNA 4KH0B 4DR2K 4F9OA 4M5NA 1UVNA 1U49A 4JHDA 1FEHA 2LEPA 2WVFA 5CCLA 2HPUA 2GVZB 1T6DA 2HHHK 1R3NA 2HB5A 3VEZA 1S97A 1WNEA 4LBIA 4CZGA 2LXUA 4AL7A 3CCWA 5DZ6A 3BM7A 2R2UA 1B99A 2GX9A 3CCES 4DL2A 5F3TA 2EXUA 4CDIA 1R6YA 1X4GA 3NAHA 3POTB 5L9XA 4D3HA 4DTRA 1QVGM 4BRGA 4H5NA 2IHR1 5ADZA 1Z25A 1H3DA 1QQNA 2X1FA 2GHVC 2W2PP 2DHAA 5AFUH 3GV5B 5L1IA 2BJEA 1HW9A 4WQ4C 2B9EA 1JLGB 1RHQB 4IG0A 3M2RA 2HZAA 3CCEN 2V7YA 5EDWA 4YHHF 1NGEA 4I2PA 3RB0A 1WORA 4DX5A 1Y97A 4IEIA 4X4OA 5A76A 1FE0A 1VGYA 2GX8A 2KJWA 4HDHA 1P6TA 4J9OA 3O4WA 1TKDA 4YY3F 1S0MA 3VF4A 4TU7A 1IM4A 2C2NA 1XEZA 1NH8A 3A3NB 1KAYA 1JLEA 1R6VA 3V6KA 4CH0S 4JI1K 2E88A 4HUEA 2ZH8A 4UZBA 3PY8A 2R3VA 1IBMF 4R5PA 4AT1B 5EY4A 3AAQA 2W24A 3BYPA 3FFKB 1GTHA 1TFYA 1HR0F 1W7AA 5E3PA 5KFBA 4PG5A 2R8JA 3EUNA 4K4YA 4JI7J 3QPIA 4TSXA 1FRLA 1JLCA 4LF8J 3TJ8A 5SZTA 4KB7A 1C0TA 5K8MA 4DX6A 2AYGA 4WTYA 2B6AB 3CMAN 2V2ZA 4AQYK 3VTIA 3TW0A 4GRSA 1YTUA 5C42B 4CO2A 2VCPA 2HRYA 2OFGX 4FK2A 2MQ8A 4U7BA 4L73A 2E5IA 2CPEA 1RU2A 4I6AA 4LF9K 2GMLA 3LP1A 3IS9A 1H72C 2M3DA 1NK0A 4C8KA 3VERA 2VODA 3NGKA 2QA4G 4WBFA 5T14A 1BQMA 2HNZB 2H5EA 1BO5O 1WTBA 4IO8A 1HKGA 3DXBA 5CYQB 1TKTB 2W2QP 3OL8A 1H73A 1QAIA 4KGVB 3EKUA 1YZ6A 2KL8A 3LDSA 3DMJA 3LAKA 5M1OA 2CIMA 2FDNA 4JI5J 2DNOA 3EGNA 4C3LA 3HBTA 3UE2A 4P74A 2EFNA 1BIZA 3QGIA 1ZOTA 1NDLA 3KMSA 1H0HB 1F9HA 1ZXOA 5CAAA 2VA2A 2XYPB 3TX0A 3KOAA 1VQSA 3SSRA 1KQSR 2GV9A 2XMWA 2L08A 2IA0A 4DV6F 4CGDA 3DDKA 1ZM4A 5GAGP 3VA0A 1TL3A 1VCTA 2IYIA 4IH6A 1TUGB 1YZ7A 2LQBA 4ILJA 3GB0A 1UAXA 3O3HA 3ET6B 4BLGA 1BA0A 1LXJA 2CUYA 3DLRA 2CPHA 1FW6A 3OW2R 1HQUB 2I5JA 5EWEA 3KKFA 1PILA 4RZRA 5ETTA 4DR4J 3B6PA 2BQUA 2W9BB 3N6NA 4E2FB 1Q82T 1U45A 2ZE2A 1Q7LB 5IWAK 2FJWA 1RT7A 1M90T 2CH6A 2D41A 1O0PA 3J7Z5 3LM2A 3HX9A 1T3OA 2AX0A 3SI8A 4CZIA 3PEHA 5I9EB 3G86A 4ES2A 1NWKA 3NHGA 3SNNA 2C1EB 3NCIA 2X1AA 2EKYA 1CJVA 1IBKK 1B4SA 2ZOGA 2PFUA 5KG5A 1HNXK 3QO9A 3IMXA 3AA2A 2AIRB 1FVQA 3FC9A 2ZZNA 3NF8A 3UPFA 3MK6A 4NCAA 2B3TB 2X78A 1NJIT 3J7A1 3PYEA 4A47A 3NEKA 4R79A 1GOBA 4NRTA 4Q2MA 1GMWA 2E29A 3KD5E 2HHSA 3MFIA 4D3GA 1VQ9S 4B9LA 5AQQA 5FLXU 3E9OA 1IG9A 3CM6A 4JKEA 2BEFA 4BC2A 2LU2A 3L4BC 4U7UD 4BR0A 4FBUA 1R0AB 3VA3A 1WSGA 5A0YB 3KUGA 1H2TZ 3K5MA 4C8YA 2BUPA 3KLIB 1BUPA 5HRSA 3CSKA 2P9LB 1LEOA 3HFVA 5KGXA 1U6FA 2CJQA 2FZKB 5HLFA 4DL5A 2XULA 2GNKA 5HQLA 1SJ3P 4EHUA 2IRYA 4IR1A 5D15A 3VAFA 4M8LA 3D2FB 3V5RA 2WSFC 2P9NB 3VCDA 2HFUA 3H4BA 3MCNA 4WZQA 4IQXA 3B6BA 1TL7B 2EFVA 3I4HX 4FXDA 3RGIA 1JJ4A 1RTZA 1NGHA 5DG9A 2UUBK 4W5NA 4I9QA 2E5LF 2CPJA 2IMWP 4KPYA 3CCLN 3I96A 2Y1RI 4U7UK 3NS6A 4ETXA 4E3SA 2ACMA 2LECA 1SPBP 4DMNA 1NM2A 1HRHA 4E7HA 4KHWA 2HHHJ 2VGMA 3GPAA 3CCJS 3ENAA 3OR1B 4JK9A 1MSWD 4CJ7A 3DOMB 2G8FA 1E4FT 4Q5VA 3NOCA 2D3OR 4JI3F 5D0HA 3CCLS 4J90A 4AM6A 3GSDA 1NPRA 1KDNA 3CHWA 1PGZA 2YHYA 1U0SA 4ATNA 3AOBA 5IC6B 4H5RA 3THPA 1SKRA 1YBAA 4WFAL 3VAIA 1ZPVA 4WZMA 5GAHU 3TQ1A 5C24A 4TLRA 1XMOJ 4MH8A 2WVCA 4ECQA 3JSYA 3AA4A 2OAUA 3A5OC 1SC3B 1LQ9A 5IM0B 1DLOA 4H03B 4WU3A 3R1LA 4FKYA 2ASMA 4H5WA 3TUIC 2FUG9 2EX3A 5KG0A 2VFRA 1P90A 2OZSA 4PKGA 1LOUA 1CJKB 2IIHA 5A8KB 4OHXA 4OYWA 1R8CA 3HPGA 3DI6A 3CJ8A 4DF8A 5K8NA 4ZTFA 3EGZA 4JRPA 4LSLB 3J8AA 2YVSA 5HK4A 3BSCA 3GJSB 3EXYA 3D2EB 4JKGB 1VQKS 2Z2YB 4PPZA 2L9DA 1NJZA 3T5KA 3CDAA 4I6WA 4WYBA 3OHRA 5L9NA 1NJXA 5U47A 4BC5A 3MD3A 2DBBA 5KFPA 4IOXA 3BGFA 4XIUA 3LOUA 3OHBA 2DD8S 4OX9J 3OTOK 1C0FA 2O3DA 1NJIO 4QS9A 2OPPA 4K41A 1BU6O 1JJCB 3UR3C 4QIVA 4IDHA 2XTJP 3NBPB 5AXMA 3BH7B 2VPZB 4RW8A 1SIZA 2R7WA 4CLKA 3UN5A 3EJMA 1T95A 4G6VB 5IT0A 1GLAG 3VQAA 2FGOA 2GCFA 3RTVA 1WI8A 2QLJB 4DSJA 4X66F 1C1BA 3MUMP 2QC3A 4LFBK 3JTNA 4DHVA 3KDOA 2CQDA 4LC9B 2Z2LA 1RI7A 3OA9A 1P1TA 2P8IA 4NLOA 4X62F 5DGBA 5LMNK 2FTRA 2VZ9A 4ID8A 2VH7A 1ZBTA 2LA6A 1ESVA 2YI1A 2IY5B 1VRQC 1S1TA 2CPIA 2Q31A 2MTLA 4MK8A 2E5JA 4GO5X 1RFQA 3H7HB 4Q0BA 3LO3A 1ATRA 2FHOB 3DI6B 4U8VA 4YB1P 4HUGA 3D0GE 1D9DA 2UU9K 3H2UB 4B3SJ 4NLPA 3K5OA 1JXEA 4DTSA 1SAZA 1RCOB 4ZKAA 5THWA 1UCNA 3AA8A 4F50A 2DFEA 2OO4A 2A41A 1IKWB 2IDEA 5HVFA 4WPAA 4LF4F 1XNRF 3OS1A 1VSHA 1VHIA 5E0OA 4OZ3A 5C2CA 1JXLA 1LWEB 1M1KO 5KG2A 2YKOA 3SCIE 1S3XA 4P6QA 1OY9A 2V4JB 2XC9A 3C94A 3CCUS 4C97A 4V1Ak 4C3KA 1F1BB 4BRIA 4LF7F 3PKMA 3O5BA 1EAYC 2OJ3A 3WXJA 4U7CA 3S3NA 3U1LA 2WC9A 2Z30B 3UN2A 1WKKA 1XJWB 2XS7A 2DPNA 2HS3A 4CFDA 4J2BA 5ITHA 2DIVA 4OX6A 1NK7A 3A8IA 3UDEA 3CCUN 1NRKA 3GG0A 4O44A 5L1JA 2C2RA 4RWWA 4K8RA 3MWBA 1DHMA 3MMCA 2C2KB 3G82A 4M63C 2O66A 3G25A 3OS0A 4CHNA 4CYUA 2HHXA 4M5LA 4MIWA 3N0VA 4CGIA 5CZVA 3IXQA 5KFHA 2D0AA 4DR6J 4ECTA 4OHZA 4FLUA 2RDIA 1JKHA 3RAMA 3VAKA 3O9QA 3LDLA 2P2CB 1HBMA 3M4XA 2QEXN 2B51A 2O8FA 5KFCA 1GMWD 2R8IA 2EW9A 1VR6A 4UOFA 2LXFA 4M45A 2CJAA 1K1QA 3WXLA 2JJ4D 2XLJA 4JV0A 1LW0A 3MUVP 3UCGA 4NXMF 2ZH6A 3CQ8A 3W64A 3SQGA 3NWGA 1X5PA 3ZLJA 4EO6A 4WQ4A 3DRSA 4BY9C 1CG2A 4Y65A 2L9NA 2K1RB 3JQMA 1N5QA 4FZVA 4W5TA 1G7CB 2KW4A 4G1QA 5HROA 4ED3A 5DO2A 3OTBA 4GKKJ 4GMJB 4CVNE 1IKXA 2ZC4A 2RD5C 3CEDA 3P3DA 1K8KB 3NDKA 4Y00A 3ILIA 3O1BA 3ATVA 3ET6A 4JV5K 3CB4A 4E1MA 4Z37A 3KG4A 2PFDA 4H5VA 2QL5B 1S10A 3W66A 3MM6B 5T7BA 2F8EX 3AVLA 4ZPVR 1MWMA 5DDPC 1YJRA 4O0JA 3LPYA 2Q3PA 3RB4A 1YDLA 1QHTA 3CXCR 4GVBB 2ZBQA 2D0PA 1C6VA 4K4UA 2DO4A 1R43A 1WC3A 1U25A 3LGMA 2IC3B 3ZSXA 3RMDA 3DFEA 4K4TA 1AXQA 2FVSA 4A8MP 3BSAA 1K8AO 3U1MA 2A18A 1XMQK 3CDEA 1JK9B 3MCPA 2CRLA 2W7OA 2IVNA 4DSEA 3IBCB 2H3EB 1Q8KA 3T41A 2AJ2A 1BWFO 1JNRB 4PHTX 1IO2A 4CIEA 2L41A 3H1QA 4J9SA 3E9PA 4CEQA 3A3OB 1SZ2A 2EG1A 4AHUA 2JGUA 2FY8A 3ZETB 1OH5A 4F2SA 4K7QA 3I31A 5F1XA 3G71S 2KT2A 3QEWA 3OUYA 4JI4F 2HBZB 1ITPA 4DKWA 2W6LA 1VDHA 2CG8A 4CE9A 3MHYA 2LXIA 5IM0A 1HPZA 4E7IA 4CK2A 1Q53A 1IG8A 4N5SA 4CZHA 4KV8A 4IBNA 1GNKA 2DCLA 1AFIA 5CQGA 5J2PA 4JI6K 3D6RA 3AGRA 1GLFO 3OS2A 2LVWA 2XY6A 1E3MA 1NZAA 2JVRA 3OTEA 2VBWA 2CNNB 1JLEB 4NYFA 4IZ9A 2EK6A 1RAIB 3WXIA 4NASA 1NSKL 5KFXA 3LWMA 1RKJA 5HQ8A 4I7FA 4IO9L 2E7VA 1UL3A 2NUHA 2KQ2A 4BDPA 2Q66A 2P6TA 1X9MA 1TK8A 5CYJA 5GAHI 5LMUF 4KH6A 3CMQA 5ETQA 3B54A 2RAQA 3L9ZA 2WUSA 1R0BG 2PYLA 3H59A 4I9LA 2W7AA 1HHTP 3CDBA 2G8IA 5AQZA 4ZJLA 2ROGA 1KP6A 1VC5A 2NLXA 4AQYJ 4K43A 3T9ZA 2OSQA 5CZ1A 3QNNA 1HKBA 4PL7A 2P9LA 1FJCA 3GJQB 4TY8A 3MPWA 1AT1B 3BGLA 4YOXA 4FN5A 1NSAA 5M1KA 3GCXP 4WXOA 5A2QY 4BVPA 3GDQA 4XTTA 2XBPA 4EBEA 3L09A 2CZ4A 4KTWA 1ZBFA 4I56A 1S79A 1X9WA 4ZMMA 1S7HA 3KK1A 3Q8QB 1TTHB 1N5VA 3JYTA 1RCXB 5ETVA 2H4WB 2YX4A 2EG2A 3W65A 2W9CB 4OLOA 1B3TA 1HBNB 2FY1A 5A8WA 2VOPA 4NOHA 4OKJA 3MX5A 4CD3A 1YUWA 2A1SA 1JLFA 4BRNA 1VQMS 4Z7CA 1T03A 2GQCA 3PIOQ 3DGPB 2AA4A 1A5XA 1HNZK 3B78A 3IBFB 3SUNA 4FF4A 3QJLA 3O1WA 4DHYA 1RACB 1XUPO 3MM9B 1VSFA 4Z4IA 3G6ES 2ZM6K 1FWPA 1UPMB 2UUTA 4JD2B 1IBLK 2IFXA 3EKSA 3TO8A 3HXMA 1OYEA 3M2VA 4DCOB 1OKJA 1CEZA 3PG9A 3UW1A 4UQGA 5CD4A 2XMVA 4RKUC 1R59O 3R8YA 1YG0A 1S5ZA 4FYDA 1TVRA 1YBTA 4ECRA 4LH5A 2NPFA 4BE1A 2NREA 4QJVA 1FKOB 4NXNJ 2CQCA 2L48A 3IWXA 1M0SA 4NE9C 1WTFA 3ID6A 4I6YA 1RNHA 1F6TA 4F2RA 1FERA 4LJMA 2ZJRL 4FYXB 4WWSA 3T1HJ 4RNOA 1LW2A 4E7JA 3O3GA 3BQ0A 4U95A 2ZJPL 1IJEB 3KK1B 3H3OB 3L2VA 1N4LA 3P45B 2CAJA 4AF1A 4B9NA 4ZK7M 1Q86T 2J7WA 3OY9A 2Z57B 4CM0A 1PC5A 1NK5A 2R7XA 5B0AA 3TWZA 3WQPA 2G1HA 2Y1LB 4TU9A 4N47A 3VENA 1DEJA 4K42A 4BRAA 2J76E 1JXVA 3PLAA 3THXA 1VRUA 2CNOB 3P8BB 3ADAC 1LWXA 2A42A 4PXDA 1B70B 1QAJA 3NGYA 3HPHA 3MAQA 2N7CA 3TZXA 4DR7J 2N3OA 1MROB 3V2UC 4FOIA 4MMOA 1Q95G 4O4RA 3CQYA 4NWBA 4LF9J 3NNCA 3OFHA 1S9EB 3SUQA 3H2LA 3I33A 3M6UA 4FF3A 4GV9A 3RU0A 1RAFB 4OZLA 1A0OB 1G3OA 4B3TF 4W5QA 5EU7A 1S1VA 3QICA 4JKFA 4NLCA 5FJ4A 2GIFA 5KFMA 1BCMA 2P9CA 2GVDA 4FNIA 3ZT1A 3G2XA 2JC1A 3HVAA 4RTFD 2JLEA 2C3YA 4E98A 2BM0A 2W9CA 2RSQA 4ZPCA 1NMNA 4PWDA 3H0PA 4DOZA 4HTLA 2F8HA 3MX2A 4F3QA 1YTYA 2FZCB 4CW7B 3M2VB 8ATCB 3RW7A 5KG7A 7FDRA 2LKZA 4RCHA 1LFPA 4BBYA 4I6MA 5HO4A 3HHDA 3VAMA 1SKSA 4KREA 3G82B 1F21A 4EZ9A 1HNWK 2NYIA 1J5OA 1RTJB 3FMBA 1PAUB 5F41A 1FJGF 2PO4A 1VQON 2XO6A 2FBVA 2B9WA 2KDOA 5GMEA 2V5HG 1KQSM 5KT2A 4CEEA 1UW9A 1WOOA 1MMLA 1NO8A 2IGIA 1BG3A 3J7YI 1FEEA 2N7YA 2HZVA 4V19X 3AQPA 5TKWA 3K2YA 1GQEA 3Q2SC 4AHCA 3QERA 3NF7A 1D4XA 2O67A 3FSYA 3T1HK 2AGOA 2VJUA 5K5MA 2GC8A 1S6OA 3K8VA 1I5OB 1NNDA 3EX7B 1S9GB 2CVIA 4RL1A 4ECZA 2BX6A 5ETNA 3KJVB 2UXDJ 5BN9A 4KRWA 2LDIA 5F8HA 1Y9OA 2XWYA 4OMFG 1N8RT 2UUAK 1RTDB 5D4LA 1S4FA 3VEXA 4P52A 3M1VA 1G99A 4TXSA 3KLHA 1L3UA 4B9SA 1Z4UA 2RUGA 3NKYA 9RUBA 3AVFA 3H20A 5GMDA 4LRDA 1M5KC 2BQ3A 2V94A 3HFZB 2YH1A 4JNEA 2MZSA 3PJXA 1Q5VA 2GA7A 1U1PA 4CQ1A 4K4ZA 1FKAF 3U7JA 3OXFA 3TANA 4J5OA 4FWNA 3O9TA 3HT3A 3FBBA 2V8VA 1UEUA 4CHZA 4IH5A 3B4MA 5F8MA 5IV3A 5DMRA 3SFGA 4USTA 3E8OA 4CWBA 1KTQA 3ATUA 2YQ3A 3KDNA 4NA1A 1S6QB 5ELZA 1WSJA 2HBJA 3ZXWA 1FFWB 3LTOA 2HBMA 1VQKN 2UYTA 3EE8A 3MTJA 1KVCA 1FESA 3AO3A 2ZD1A 2E1MC 3MECA 3P5BP 3EL2A 4QU7A 1Q5YA 4B8AB 4QIEA 3HHKA 3I4PA 1WC5A 1Q0NA 4USWA 4JEPA 4K4VA 3G10A 1ZC6A 4WFAQ 1JLAA 5L39A 4CEDA 2AEJA 3THYA 4W90B 3JXOA 2CPDA 2RIJA 2NRRA 4UZCA