1KLMA

Hiv-1 reverse transcriptase complexed with bhap u-90152
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
538
structure length
537
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Unique features in the structure of the complex between HIV-1 reverse transcriptase and the bis(heteroaryl)piperazine (BHAP) U-90152 explain resistance mutations for this nonnucleoside inhibitor.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 142
structure length 537
sequence length 538
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1klmA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1klmA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1klmA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1klmA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1klmA05
1R0AA 4ECXA 3TARA 3ZSVA 5KT7A 1X9MA 1HJRA 3M9NB 1CSJA 3DRSB 4MK8A 1ITGA 5KFSA 4FCYA 3LWMA 2IJFA 4LSLB 1QSLA 1TVRB 3CVKA 1TK5A 4ZP9A 3GQCA 5KG4A 1XR5A 2FJXA 3UIQA 3VQ4A 3FFIA 4ZMMA 1T05B 3IN5A 4MQ3A 4RW8A 4IFYA 1XR6A 2DFHA 4W5OA 4JV1A 4Q8EA 4I2QB 3RTVA 2XHBA 4ECVA 5HLFA 2Y1JA 1TGOA 4H4OA 3H5YA 4ELVA 2HWHA 1BI4A 3C6TA 3DI6B 3HPGA 4C8KA 3QEIA 1JLAB 1QUVA 4FK0A 3S9HA 4CEFA 4KI6A 3NE6A 1XR7A 1RDAA 5HBMA 3LP0A 2Z1HA 3I0SB 5HROB 4Q5VA 2RPIA 1QAJA 4KHQA 1S4FA 3AVCA 4FJNA 2UVWA 4HUEA 3TAMB 4ID5A 1S1VA 3ZT1A 3ISNC 2E6MA 4FK4A 2AX0A 3OYNA 4U6PA 4OGEA 3TWHA 3SQ0A 1REVB 3O4NA 4FJ8A 5EWEA 2NUBA 2W9BA 2YNGB 4I7FA 3H4DA 1RT7A 2WCXA 5C25A 4CF9A 1X9WA 1WSJA 1S1TB 4TYBA 2XRIA 4IKFA 4H4MA 4TLRA 3CDEA 3F73A 4ICLA 3QIDA 4MIBA 1TAQA 1RT6B 3KJVB 4FK2A 4PQUA 1GX5A 1JLCB 5J2QB 1C0UB 4B9TA 4URQU 3VQSA 1R0AB 4IDKB 2W7PA 4DQRA 3L2QA 2OPRA 1N48A 2X78A 3OHAA 4CEQA 3LZIA 1NK6A 3DMJA 1NOZA 3C95A 4GMJB 2BRLA 2HNDA 5KGXA 3MAQA 2HHWA 2FBXA 4DSLA 3IS9A 3HPHA 4HUFA 1LAVA 3HJFA 4QPXA 4B3OA 4TXSA 4W5NA 3E01A 1NJXA 1WN7A 4QWDA 3GV5B 3ZT4A 2PYLA 3NDKA 4M3XA 4WZQA 4CIEA 5HLFB 1VSIA 1N6QA 4H4OB 1K1QA 1SH2A 4BDZA 5HRPA 2IBKA 5F8JA 3M8RA 3C6TB 4DF4A 1WNSA 1X9SA 2JEIA 1X1PA 3AO3A 3N6NA 3MEDA 4CECA 4NYNA 3OJSA 3TQ1A 1C0TA 5HBMB 2JEJA 2F8EX 5KT3A 1RTHA 1JLBA 3DOKA 3H98A 4IRCA 3OYLA 4ID5B 1S1VB 5F8HA 5KGWA 2XY7A 4N5SA 4ECRA 3KLHA 4XIUA 4E89A 1JL1A 3VQEA 3EPIA 1TK0A 2W9BB 1KCFA 2WTFA 4I7FB 3NBPB 3CFPA 1RT7B 4DSEA 5C25B 3THVA 2GIRA 4BDPA 3LALA 2FVCA 1J5OA 2KZMA 4N76A 1CZBA 2ILYA 4ICLB 3VQBA 3FSIA 1ZTWA 2J6SA 2J6TA 1GOCA 4PQUB 2AU0A 2PZSA 5KFFA 2EHGA 4DTUA 2D0CA 3BJYA 1HNIA 4DSKA 3KMQA 2ATQA 3MFIA 2J6UA 3JYTA 2OPRB 3SJJA 4RNNA 1WSHA 3B6PA 2UVUA 1Z25A 2OYQA 2IM1A 2EC0A 2HNDB 1SL0A 1RT2B 1Y97A 4O4RA 3QLHB 1KHWA 4Z4FA 1MMLA 5CYQB 2FLNA 1JL2A 3IRXB 3OL6A 3EPGA 4IH7A 1BQMA 1TKDA 1RYSA 1F21A 1QSSA 1RNHA 1YTAA 2FBTA 4FW1A 2R2UA 3DYAA 1D0EA 3DDKA 3E01B 3T1AA 4GVMA 4CEBA 3KMSA 3MECB 3NGZA 4E7JA 5F8IA 2D5RA 1IKVB 4MFBA 3FQLA 4BACA 1IKYA 1N6QB 4EBEA 4HTUA 3QZ7A 5KFPA 3TVKA 1ZTTA 5J2PA 3Q8SB 4JV2A 1D8YA 4F3TA 5DQGA 1YVFA 3H4BA 1Q9XA 4CERA 4DTXA 3Q8QB 3QGHA 3AVLA 1C0TB 5KG5A 4X2BA 4KKOB 4EP4A 2YV0X 3EY1A 1RDCA 1RTDA 4FM2A 4AHSA 1A5VA 3LPTA 3OS0A 3OL7A 3KK3A 2VG5B 2QKBA 2ALZA 1IKWA 5HRNA 2XY8A 2B6AA 3SYZA 1S1WA 1JLQA 5HP1A 1TL1B 3KLHB 1QSYA 4RNFA 4OKEA 4O0JA 4O0IA 3MR5A 3C6UA 3QO9A 5JS2A 1T3NA 3N6LA 2G8KA 4RUAA 3DLBA 3KLGA 1RTJA 1NK0A 4AHCA 5KFAA 2RF2A 1YTUA 4QW8A 4CJLA 2VA3A 2OZMA 1HNIB 3LZJA 4NLQA 4K4YA 4F4KA 4I9LA 4WXWA 1U47A 4N47A 4KTQA 5KFCA 5KFBA 1BISA 4YR3A 4CGFA 4CJFA 3KHHA 3NFAA 1DTTB 5T7BA 4CCHA 2B4JA 4FLTA 1UAXA 1J9AA 5KFEA 3LWLA 4E1MA 5KFRA 1WAJA 4CJ4A 3GYNA 4J2BA 4LQ9A 1VSLA 1BQMB 1QE1A 2DY4A 2YKMA 1S9GA 1HQEA 4DEZA 2RDJA 4M3TA 1LAWA 3LP2B 4JRPA 3RR8A 3DLEA 1S1XA 1WLJA 3ZSRA 3PJWA 1IKYB 1VRUB 2VA2A 3PW4A 3T5KA 5T14A 4K4VA 4DTNA 5J2PB 4KAIA 4RW9B 4NLUA 5F8MA 1BIZA 4HHTA 4F4ZA 3GIJA 2ZQBA 4ECSA 2ZE2A 2YHBA 3HM9A 4WZMA 2JGUA 2HHTA 3ZSOA 4M41A 5CYMA 3FDSA 1S0OA 1JX4A 5DLGA 5F8NA 1CZ9A 1LW0A 5KG0A 4CJKA 1RTDB 1RDRA 2BGGA 3SUNA 3KIOA 1RTIB 3P5JA 5FDLA 3CIZA 4EZ9A 2HVIA 2B6AB 4FLXA 1D9FA 2C2DA 1S1WB 3VQQA 1JLQB 4ED7A 3OYAA 1S6PB 3VQ7A 4ZPCA 3MEGA 5KT4A 3OLAA 3PX0A 2G8VA 3V9SA 3C6UB 3HVWA 1KVCA 3PUFA 3QIOA 3QO9B 4KB7A 4TQRA 1GOBA 2PYJA 1ZYQA 1NK8A 4DTSA 1BHLA 3K5MA 4CEOA 1HYSA 5KFIA 4FZZA 3OYKA 1NOYA 4TQSA 1A5WA 1WSEA 2RF2B 4GC6A 4CIGA 1BCOA 3OYIA 1FKOA 1CLQA 1LWFB 4QOZB 3IG1A 4MKAA 4IR9A 2IAJA 1QHTA 4J9NA 4DFJA 3SQ4A 4WYWA 2DPJA 2KFZA 1UA0A 3NF7A 4LH4A 2YNHA 4KSEB 3DRRA 4ELUA 4RU9A 1LWCA 3T5HA 4AILC 4ZP8A 3L2WA 4Q44A 3RBEA 4O3SA 3QEPA 2YKMB 2AX1A 3BR9A 2GUIA 1HQEB 3NGIA 2W9AA 3P1GA 3BGRA 1ZBIA 2GV9A 4CK3A 3U6FA 1S1XB 2ETJA 3D0PA 4XPEA 3KLFB 4DQPA 3KLEA 4DSIA 4CEEA 4EBCA 5J2MA 3CJ5A 3QEWA 1Q9YA 3H5SA 2Y1IA 3SPZA 5KFYA 1JLEA 3QGGA 4EP5A 1U4BA 4PY5A 3MF5A 1J54A 4GC7A 4M3WA 5FRMA 1IM4A 5EU7A 3OVNA 4J9PA 2ZE2B 4ZP7A 4CGGA 1SKRA 3U3GA 4CGJA 2XY5A 1LW0B 4Y1CA 4B9MA 1KLNA 4R8UB 3O4QA 2O5DA 5FDLB 1DLOA 5JUMA 4CJWA 3H2LA 4J9RA 3PY8A 4ZPDA 4DTOA 3PV8A 2Q3SA 3KKSA 4CJSA 3D45A 4E7IA 3OL8A 1TKZB 3AVGA 3CM6A 2WK4A 2UVRA 5J1EA 2E9RX 4DTPA 3V6KA 2HAIA 4KB0A 4K4ZA 3SUOA 3G6XA 3OSNA 2W8KA 1RILA 3HT3A 1FKOB 2C22A 4M3RA 4WFZA 3WNGA 4BDYA 3NAHA 3GIMA 1TL3A 1TAUA 2C2RA 4K4UA 3SV3A 4EO6A 4CF2A 3RB3A 1RBUA 2R7YA 1S6QA 3NL0A 3AVJA 5KFQA 2YNHB 4FBUA 4PWDB 1JLFA 4FJ7A 3HK2A 3DRRB 4B9LA 3KOAA 3PW5A 1LWCB 4FJHA 1C2PA 3OYJA 2YKNA 2QV6A 2D0AA 4ED1A 4CHOA 4O3OA 4CGHA 4FJGA 2B43A 5I3UA 1Q8IA 2JC0A 2VWJA 5KFUA 4LSNA 2XI2A 1S1UA 3KHGA 2BE2A 3V81B 4ZVFA 3OL9A 3RMDA 2I5JA 4E19A 2KZZA 2F96A 4HKQA 2G8HA 2BDPA 3MEEB 5J2MB 1W0HA 5DGBA 4NRTA 1JLEB 4RW4A 1RT3A 4RNHA 4BWMA 5DLFA 4Q0BB 3V6DB 1NHVA 2XO7A 3PR4A 3TAPA 4FW2A 3B6OA 4LH5A 2AGQA 5J2NB 2W7OA 4K4WA 4R5PA 2ZD1A 2IS3A 2IC3B 3DLKA 4F2SA 3DM2A 3I0RA 1RBRA 2R8HA 1NJWA 4F4XA 1ZBLA 1SL1A 3VQCA 2W8LA 2HNYA 4JS5A 3SI6A 2YNIA 5KFWA 4E1NA 3JSMA 2A1RA 1DLOB 4CFDA 3TAGA 1HPZA 3FRZA 3NH2A 4E0DA 3L8BA 5L1LA 1BIUA 4ED8A 4B9NA 4IFVA 3ZSWA 3TAQA 4IH6A 4ED0A 1L3VA 4DL3A 2XGPA 5I42A 3FFIB 3V9ZA 2P5OA 4IG3A 4FM0A 2FBVA 5J1EB 3QEVA 5F9LA 4RW8B 2KFNA 4IFYB 3AO4A 2V4QA 4F4WA 4DFMA 1KFDA 2OPPA 1K6YA 4ZP6A 1VRTA 1BI4B 4B8CA 4URGA 1WAFA 4C8LA 1XC9A 3CJ2A 4K8ZA 2FVSA 2W9CA 1VSEA 4HCBA 4F50A 4NCGA 1TL3B 3MTKA 1XI1A 4TN2A 3T5LA 2XC9A 3QNNA 5SZTA 3QIPA 3AO2A 1SUQA 5DQHA 3LP0B 5DMRA 4KAZA 3SI8A 4M94A 4NLGA 3PW2A 4DU4A 5KRTA 3I5AA 4O3QA 3MR2A 4O55A 2GIQA 5EWFA 2VWKA 1L3TA 1TV6A 2YKNB 1SV5A 3MFHA 5JS1A 4TYAA 1VSJA 4J9MA 3DLHA 3SUPA 5I3UB 4LSNB 1G15A 4TY8A 1S1UB 4M3UA 4R0EA 3ZSZA 1JXLA 3EZ5A 3HHKA 4DQIA 2I5JB 4K50A 3T3FA 4KFBA 1NKBA 3SCXA 2IMWP 3OYMA 1U09A 1RT3B 3VQ5A 3KK2A 2D3UA 4DL4A 4QAGA 1NK5A 4H4MB 3G6VA 4CJEA 4FLYA 4DL2A 4KHSA 4ZPAA 2G8WA 4R5PB 2ZD1B 4NLTA 3OYGA 3DLKB 1NK9A 3DM2B 3I0RB 2R2RA 4FLVA 4KTWA 2IDOA 2O4GA 4ZPBA 3M8QA 1W9HA 3H40A 4YMEA 3PX6A 1YT3A 2HNYB 3ZT0A 2YNIB 5L1KA 2RDIA 3DMJB 2WONA 1HPZB 5DQIA 4IFVB 4FJXA 4Y2AA 4KTZA 3IS9B 2QK9A 5I42B 4DTMA 1S9FA 3WNHA 3V1RA 2OH2A 3SUQA 4IG3B 3AA4A 1VSHA 2E9ZA 4B3OB 2XCAA 5KFOA 4O4GA 4CIFA 1QS4A 3V6HA 4J2EA 4WXOA 4ECUA 2JEGA 2OPPB 3RB4A 4YR2A 4MKBA 4F2RA 4HCCA 3L3UA 3RB0A 1LWEA 3O3FA 4DS5A 4DL7A 2W9CB 1MU2A 2VG7A 3QYYA 3MEDB 1N56A 4IQXA 4O3NA 2BRKA 5KT2A 3EYZA 2RKIA 2ITGA 3QIPB 2QKKA 1RT5A 1SUQB 1XHXA 1RTHB 1JLBB 3OSPA 3GIKA 3DOKB 4O5BA 3BQ2A 4PUOA 5KFXA 1FK9A 4KHRA 4KRFA 1NK4A 4FZXC 1RT4A 3ASMA 1QTMA 4WFYA 3HPOA 4EO8A 3AV9A 2XI3A 4ZHRA 3OJUA 3KK1A 3VN5A 2JC1A 3TANA 2IM3A 3G10A 2X6NA 4C8NA 4J9LA 3AA3A 4KFBB 4H54A 3V4IA 4FLZA 3V1QA 2YNFA 1RA6A 1TKXA 2FVPA 3QGIA 1J5OB 4I2PA 3SQ2A 3KK2B 1RDBA 1KFSA 3WNFA 3TI0A 1ASUA 3KHLA 1CXUA 3M8SA 1KHVA 3UQSA 3JYTB 3QZ8A 1C6VA 3PVXA 2Z1JA 4CF1A 4OGCA 5D3GA 4QCLA 4KHMA 2WONB 4RW6A 1N4LA 5KFVA 3UR0A 3AVNA 1RT1A 2F8SA 2IM2A 1KVAA 4E3SA 4DFKA 2BQ3A 1BL3A 4CJPA 3RRGA 1RCHA 4FLWA 4NLSA 3Q8PB 1QAIA 2IJNA 2C28A 2DFEA 4ZTFA 2UUTA 4IR1A 1NK7A 4O4GB 3DYAB 3AVHA 1TKTA 2CJQA 4LY7A 4E7LA 5CZ1A 3DOLA 1D5AA 3TABA 4MFBB 4DG1A 1IG9A 4CGDA 4RNOA 3ZCMA 1LWEB 4CJQA 4CFCA 3CFOA 4M3YA 2HNZA 3CDUA 3KD5E 4MK7A 3DLGA 1RAJA 2HHXA 1MU2B 2VG7B 4Q8FA 4CK1A 3MXIA 1I6JA 2F8TA 3SPYA 4FVMA 5FRNA 1RT5B 3CWJA 4B08A 1C1CA 5KT6A 1RBVA 1FK9B 2HVHA 2WHOA 4G1QA 4IRKA 3KNAA 3P83D 1VK0A 4YQWA 3KK3B 1IKWB 4ZVGA 1S0MA 1GOAA 4ZHRB 3ZT2A 4CEAA 3OS2A 1C1BA 5HP1B 4I9QA 4KE5A 3L3VA 3KK1B 2HB5A 4U7CA 2PY5A 4DS4A 2X74A 2BQUA 4FJMA 4CFAA 1TP7A 3SQ1A 4KREA 3V4IB 2YNFB 2ILZA 4CGIA 5EUHA 1NNDA 4LSLA 4DQQA 4I2PB 3BSOA 3KLGB 2HWIA 1RTJB 1B9DA 4BWJA 1T8EA 1JXBA 3GILA 1U45A 3NKYA 4ED2A 3HSTB 3OYEA 1D1UA 4AHTA 1W25A 4Z4GA 4N56A 1T05A 2OPSA 1RYRA 4IG0A 4CJ3A 3I5BA 3D5MA 3NF6A 3V6JA 5D3GB 5KFMA 4RW6B 2FVRA 2B5JA 3ITHA 3V9UA 4IKAA 1RT1B 1ZBUA 4OLAA 1CXQA 2E4LA 3GIIA 4JUZA 4KB1A 3LAMA 1QE1B 4K4TA 4ECYA 4ZTJA 1S9GB 1VSFA 1TKTB 3I0SA 5HROA 2Z1GA 3DLEB 3DOLB 3BSNA 2JLEA 4FLUA 5KFTA 3ZSQA 2JEFA 3TAMA 4JV0A 3M9MB 1EKEA 5FROA 1JLGA 4DMNA 4RZRA 4EZ6A 4DTJA 4MH8A 2HNZB 3V1OA 3NH0A 3EZUA 2KTQA 4KI4A 4FJLA 4J9KA 4NLPA 4DF8A 4DSFA 4KHYA 2RN2A 4F3OA 2X6SA 5CYMB 2YNGA 1C1CB 5KFZA 1NKEA 4XPCA 2CKWA 4Y34A 2HW3A 3UPFA 2FVQA 2E6LA 2ZKUA 4ECQA 4RG8A 1VSKA 2OA8A 1C1BB 4KV8A 4NYZA 4OKKA 4AHUA 1JLCA 5J2QA 1C0UA 2DTUA 3H08A 3MEGB 4CFBA 1EXQA 4HYKA 1FXXA 4IDKA 3NGYA 2C2EA 3PZPA 5KFKA 4Z4IA 3CQ8A 3I5CA 3RMAA 4J9SA 3F9KA 1HYSB 4B9SA 2AJQA 4NYFA 2FBYA 4CJUA 3OYHA 4E7HA 3QETA 3SFGA 4URSA 3BQ0A 4M3ZA 4CJTA 3RRHA 4J9QA 1IKXA 5L1IA 3IG1B 2IAJB 5K14A 3HVTA 4E7KA 3QEXA 2OPSB 4NLYA 3VA0A 4IG0B 4ZVHA 1C0MA 3GV8B 5DG9A 4FJIA 3NAEA 1N5YA 4CHZA 5KI6A 3G86A 2OZSA 3OY9A 1QQCA 2B5JB 2V4RA 4DWIA 3ITHB 3I8DA 4NLXA 2AQ4A 3VQPA 2D41A 2WOMA 1C1AA 3C94A 3QESA 3CJ4A 4O44A 1T03A 4IBNA 3NHGA 3PO4A 3BGRB 1UA1A 3K59A 4NRUA 4H8KA 2AGPA 1IO2A 1U49A 3VQAA 3LANA 4QWAA 3CO9A 1B9FA 3LP1A 2IGIA 3KLEB 1JLGB 1EP4A 4FYDA 5KG6A 3IGNA 1HNVA 1HRHA 5F9NA 2V0NA 2D0BA 4DL6A 4MK9A 4N41A 4YFUA 5C5JA 5EWGA 3BDPA 3RMBA 2UUWA 4BE1A 1K1SA 3VQ9A 4OLBA 3AVIA 3RB6A 3NBPA 1FKPA 3TAFA 4DFPA 3K5NA 4Z4EA 3KLVA 3CJ3A 4K4SA 3DLRA 4KV8B 3G6YA 3VQ6A 1WNEA 1ASVA 2IOCA 5CZ2A 3V9XA 3TAEA 2OPQA 4ED6A 3S3OA 1RBSA 3AO5A 1ZBFA 1UOCA 1TK8A 3BREA 3H59A 5SWMA 4AH9A 4C8OA 4Z4HA 4J2AA 1RT2A 3QLHA 2AWZA 4NLRA 5CYQA 1SL2A 4TY9A 3IRXA 4DTRA 2G8IA 2DPIA 1IKXB 4Y1DA 1J53A 3ALYA 4CEDA 1U48A 5K14B 3CM5A 3HVTB 4PA1A 1L5UA 4CJVA 3DRPA 4Z4CA 2WB4A 3MECA 1EX4A 1IKVA 4BE0A 4ECZA 1N5YB 3ISND 1S6QB 4OJRA 2R8KA 2UVVA 4CHQA 1JLFB 3L2RA 4Y2CA 4CESA 2I1RA 2WOMB 4G3IA 3ZSXA 3AA2A 1S48A 1KSPA 1ZBHA 1D9DA 5KFJA 4O44B 1T03B 1RBTA 1S5JA 1JXEA 3AVMA 2ASJA 4KKOA 5KG2A 2BE2B 3MXMA 4W5QA 3LP1B 4L8RB 4HUGA 2VG5A 2VG6A 1XHZA 4FS1A 2P51A 2Z1IA 5KFNA 4NLWA 4F8RA 1EP4B 3O3GA 4M42A 4C8MA 4NCAA 5KG1A 4RW4B 4OPJA 2IM0A 1HNVB 1TL1A 4B8AB 4BE2A 1O1WA 4HVJA 3HYFA 4NLDA 3VA3A 3NAIA 4B9UA 3UDLA 1DTQA 1FKPB 1KLMA 3HP9A 3KHRA 3VQ8A 1LV5A 4CJRA 3S3MA 5DG8A 3KD1E 3JSMB 1GX6A 4KHNA 1WSGA 3H5XA 3OLBA 4CHYA 2HMIA 5E41A 2YHAA 2E9TA 2QXFA 4Q43A 2BQRA 3BQ1A 4KHUA 2OPQB 4ID1A 4K4XA 4KBIA 3SV4A 5F8GA 3CFRA 2HHUA 3HKWA 1I3AA 1DTTA 4Z0UA 1Z26A 1ASWA 3PW7A 1XWLA 2GBZA 2G8UA 5F8LA 4NZ0A 2XY6A 4CHNA 1VRTB 3PX4A 3OYCA 3A2FA 1HQUA 3H5UA 3QINA 3HP6A 2ATLA 4TSXA 1SKSA 4NCGB 3LP2A 2P5GA 3TR8A 3HVRA 3DRPB 3LP3A 4CF8A 4KO0A 3NMAA 4W5RA 4J9OA 1VRUA 4CF0A 3AVBA 4M45A 1L3UA 4WYLA 4FJ5A 2A1SA 3CG7A 4KPYA 1T7PA 3IGVA 4WE1A 3SNNA 3M8PA 3ICLA 3OHBA 3M9OB 3AA5X 3KTQA 2KQ2A 4RW9A 3K5OA 3O3HA 1TV6B 4FJJA 1SV5B 1U04A 4DLEA 1HYZA 2QE5A 2R8GA 4LQ3A 5C24A 1NJZA 4YP3A 4TY8B 4JRQA 5EDWA 2EX3A 3AVAA 3T5JA 3MR3A 3QNOA 1RTIA 3K57A 4FZYA 2VG6B 1I39A 4O3PA 5KFDA 1S9EA 2D3ZA 4RUCA 1YVUA 3SZ2A 4EEYA 1Z4UA 4ECWA 4EYHB 1S6PA 3K5LA 1OS5A 4NLVA 4CJ5A 4IOBA 4O3RA 1RDDA 3U3YA 1DTQB 2R8JA 3M8QB 1KLMB 4DLGA 2FLPA 3BSAA 4ZVEA 3NGDA 1NHUA 4XO0A 5C42A 2GC8A 3RWUA 3K58A 3OYFA 3Q8RB 5KFGA 2HMIB 3NF8A 5JXSA 1LWFA 1HMVA 3L2VA 2IA6A 3ZT3A 3PHEA 4FBTA 4QW9A 4OVLA 1LW2A 3T19A 3HO1A 2W42A 1JIHA 4FJ9A 4WFXA 1SH0A 4ED3A 3NF9A 4IH5A 3NCIA 4RW7A 4DU3A 4M95A 2DFFA 4EBDA 1BQNA 2ASDA 4QWBA 1HQUB 1WSFA 3PO5A 4DL5A 4AHRA 4YR0A 4J2DA 1EETA 3AVFA 2FJVA 4GW6A 3LPUA 2RKIB 1NKCA 4KO0B 4Y3CA 5KFLA 3KLIA 3KLFA 3K2PA 3HXMA 2BANA 2O4IA 3SFUA 4PUOB 5KG3A 5KFHA 1JKHA 1S10A 4WE1B 3M8PB 4YNQA 3N6MA 4AHVA 5HRRA 4FJKA 1RT4B 1S0NA 3ZSYA 4UQGA 4CHPA 2WRMA 2XWYA 3ULDA 4CK2A 5C24B 2R8IA 1UWBA 3HVAA 4KHWA 3LDSA 5DG7A 4R8UA 1VSDA 5KRSA 2KW4A 3MXJA 4K8XA 3DRSA 1VSMA 2HHVA 4OL8A 1KTQA 1S9EB 1HARA 3PW0A 3BSCA 1TKXB 5L1JA 1HYVA 4CE9A 3NH1A 1TVRA 2XGQA 4OKJA 4OPKA 4EYIB 2HHQA 2XCPA 3MR6A 2D7SA 4QWCA 1TKZA 1BGXT 1KVBA 4NLOA 3OS1A 1L3SA 2FLLA 3VQDA 3RR7A 1S97A 1IH7A 4ECTA 4FXDA 5KT5A 2V9WA 1A5XA 3D28A 4IRDA 1SH3A 5DGAA 5HRSA 2P1JA 4I2QA 2LSNA 5C42B 5CY4A 1S49A 4MIAA 4FM1A 3OYBA 4NCBA 3DI6A 3OYDA 1HMVB 4RNMA 3RAXA 4ELTA 2R2SA 3GV7B 3WNEA 3L2UA 3G0ZA 3CYMA 1JLAA 3E51A 1LW2B 4Q45A 4F4YA 4W5TA 4DSJA 3CDWA 3S3NA 4B9VA 1NJYA 2R2TA 1RA7A 4PWDA 4RW7B 3LAKA 3KKRA 3RAQA 5KG7A 1BQNB 4DG1B 3PJXA 4JLHA 3RBDA 1TQLA 4QWEA 3DLGB 2BR0A 3FQKA 1BCMA 4FS2A 3AO1A 3IAYA 1EETB 2AGOA 1REVA 3V9WA 4LD0A 1ZETA 1T94A 3CJ0A 3V81A 5DK5A 3KLIB 2BANB 3AVKA 1JKHB 1WSIA 3MEEA 2HHSA 3HL8A 4G1QB 4CEZA 3RMCA 1S1TA 3PR5B 4DQSA 2G8FA 1KRPA 4Q0BA 3QERA 3V6DA 4DU1A 5J2NA 1RT6A 3KJVA 2IC3A 2FC0A 1B92A 4JS4A 5KTQA 1SKWA 2ASLA 5L9XA 2FJWA 1UWBB
chains in the Genus database with same CATH superfamily
2FC9A 4ECXA 3ZSVA 1X9MA 4XH1A 1K8AT 1CSJA 1LK7A 1NZ8A 1VQ8N 1UKUA 1ITGA 5KFSA 3J7YI 1OH6A 4FCYA 1OQ3A 2HHHF 3A8IA 2VJVA 1TK5A 2H9ZA 1HR0F 3HZGA 3GQCA 1YITN 5AQZA 4FF3A 2P8IA 3VQ4A 4FWLA 3FFIA 2CAJA 3AQOA 3HD1A 1QDUB 1U8SA 4ZMMA 2M8DB 1T05B 1QLNA 3HSDA 2VASA 4ZCKA 3PIOL 3M30B 1QUPA 3BEXA 1NM1A 4A47A 4Q8EA 1LWXA 4I2QB 3RTVA 1MWKA 3PXGa 2AZ1A 5HMWA 2Y1JA 4P10A 2HWHA 5HMXA 1BI4A 4K43A 2X51A 2CQ1A 1WDTA 1IJEB 4BQZA 5DM6Q 2GX8A 4C8KA 1QQNA 2Q31A 3VENA 1JLAB 2E29A 3S9HA 3T1HK 1YJTA 1XR7A 3HFKA 1ZZFA 5HBMA 2D9PA 1RDAA 4WF9L 3W60A 2FB0A 3I0SB 5K8NA 2RPIA 3B4MA 2UVWA 3EXCX 2GVDB 1S1VA 2ZH6A 4FK4A 1OSDA 1SJ1A 1JJCB 5HN0A 4P7TA 3P31A 3H46O 3OYNA 1CQNA 4UQTA 2VL1A 2VBXA 1IBMF 5EWEA 1YZ7A 3H4DA 2P9SA 5CABA 3TUPA 3QAUA 2E5IA 4FKYA 2XRIA 3JSBA 1U6BA 2LYVA 1TAQA 4FN5A 2AJ0A 1RT6B 3KJVB 4PQUA 2P9LB 5J2QB 1FRHA 1U0HB 1RTZA 2QWRA 3MMCA 1VQKS 4IDKB 2W7AA 3OHAA 2XLKA 2FHMA 3C95A 3HHNB 4IFEA 2VQFJ 2BM0A 5AQMA 3WIUA 5F3TA 2BUNA 3OT9A 3LH2S 2YKQA 2CUYA 2UUBK 3DGPA 3M6XA 5AZJB 1OYEA 4YORA 3CPWM 4BRCA 2OEKA 3HZEA 4QWDA 4CVNE 2BYCA 3DOMA 1YSJA 1ICEB 4WZQA 4M3XA 4CIEA 5HLFB 3D3BJ 1VDHA 2IBKA 3PTWA 3S01A 3M8RA 2ZH9A 4F02A 5I3PA 2JEIA 2KFYA 4WYBA 4NYNA 3TQ1A 3GLJA 1C0TA 2F8EX 1RHKB 4B3RK 1JLBA 1R8PA 2MLZA 2VPXB 4IRCA 2IA0A 3OYLA 2RE1A 3CGIA 3KUEA 1Y00A 5F8HA 5KGWA 3OTOJ 1EWQA 3KLHA 2UUCJ 4OPAA 3J8AA 4JI3K 3EPIA 1TK0A 3GWCA 4I7FB 3NBPB 4JHDA 3CFPA 1RT7B 3D2FB 5C25B 3RSEB 2GIRA 5G4DA 4K5SA 3AY9A 3VAIA 3LALA 4CBXA 3NMUA 4ICLB 3VQBA 4PHTX 2EHGA 3OA9A 3M32A 1HNIA 1VBKA 1F3FA 2ATQA 2NYHA 4BBYA 2HQFA 3B6PA 2VV5A 5B0EA 2QLXA 1HBOB 2HNDB 2P9IA 4IJAA 1HHQA 3TVYA 4AL5A 1KHWA 4OYBA 1PIEA 5CYQB 2DD8S 2BJ7A 1WJ9A 3OL6A 2G9OA 1SIWB 3C8YA 5H9FK 1HIYA 4JI1J 1RB0A 1RYSA 2W6LA 2FBTA 2R2UA 1D0EA 1TUUA 4E7JA 5F8IA 1IKVB 3OD2A 1TTHB 2E1MC 3NNCA 2JX2A 1HW8A 3GR1A 4CZLA 4EBEA 2F5GA 2E1RA 5KFPA 1H72C 1CBKA 1AZSB 4HACA 4DBQA 1D8YA 2CPIA 4JV2A 1FI4A 5DQGA 1YVFA 3H4BA 3CC4N 4F3TA 2NRHA 4DX5A 3W2WB 4WFAL 1U2RA 4KHPK 2Q6CA 2X1AA 4DR1J 1WELA 1MWMA 3AXKA 3RBZA 2HFZA 2P2CB 3MPDA 4YDXA 1J5EJ 2RUGA 2VG5B 1MWZA 4DCHA 2XY8A 1S1WA 3WDOA 5EHHA 4LF8J 1TL1B 4IOCQ 3W9JA 4O0JA 4O0IA 3WEEB 3EX7B 4ZLPA 3EE3A 2MYFA 3C6UA 3J7AN 3F5TA 3QO9A 3EE9A 5FD1A 5JS2A 2J0WA 2KXNB 2K7KA 5HQMA 2GAGC 1HKCA 1BOTO 2RF2A 1VQOS 4U67L 4HDGA 3BP8A 4QW8A 3EO3A 4P73A 3B8HA 2FZGB 4B1ZA 2BJ9A 5BRDA 4NLQA 4K4YA 4DMZA 1U47A 4WXWA 3A8EA 4I9LA 2C2NA 2QFJA 2ASOA 4KTQA 4AM7A 4CGFA 4CJFA 2XMWA 1HL6A 2HURA 5G0RA 2B4JA 3A3OB 4GKJK 3GFXA 1H7WA 2LA6A 3FEXB 5HVFA 3TPQA 5MLCQ 1UFWA 1YJNS 4NLBA 1VSLA 2B51A 3JS6A 1S9GA 1HQEA 3J7ZT 2ERRA 3LP2B 4LFBK 1XNRJ 3SCIE 1HWLA 1X5TA 3DLEA 5E2QA 1IBLK 3ZETB 5HK4A 5RUBA 1Q7LB 3PJWA 3MOZA 5J2PB 1GH8A 3N5FA 4KAIA 3C46A 1KD1O 4BVOA 4HTIA 4RW9B 3MM9B 5F8MA 1BIZA 1GLBG 4HHTA 2R42A 4ECSA 1VS3A 3HM9A 1FWKA 1E6YB 2V50A 2JGUA 2DHXA 2HHTA 4M41A 5CYMA 1JX4A 2XNQA 4ISEA 3VERA 5BYRA 5DLGA 1CZ9A 1LW0A 2VH7A 4YDDB 3S1TA 3SUNA 1ZPWX 2M3DA 1I3OB 2ZH8A 1FX4A 5FDLA 2RIJA 2B6AB 4FLXA 2C2DA 1JLQB 3RYLA 3JAMO 3W63A 1SQKA 5B0GA 2CJXB 3OYAA 2J0QD 3MEGA 5KT4A 2G8VA 5D78A 4EWTA 3HVWA 3PUFA 2V8PA 3UFCX 2PYJA 5D0EA 1BHLA 2IRXA 2M2BA 3QAEA 3K5MA 4DXLA 5KFIA 3R5DA 3MWTA 4FZZA 1UW9A 1A5WA 3DU5A 3HOTA 1IM6A 3O80A 4AQYK 3D67A 3CJKA 2L9NA 4JI8K 4OX9K 1R8CA 1NSAA 3SK3A 3ENWA 1GXUA 4DFJA 2ZGZA 4PKHA 3SQ4A 1T02A 1EARA 4P74A 3NF7A 4QIGA 3ONQA 3OFEA 4QR0A 1RXOB 1Y64A 3F44A 4ELUA 4X84A 3T5HA 3H3OB 4ZP8A 1R6YA 1CVJA 1NZAA 3EDQB 2AX1A 4F36A 3ENQA 3P1GA 3CCSS 1S1XB 2ETJA 1WBBA 2XMTA 3KLFB 3THXA 5GAGU 2YWHA 4B1VA 3CJ5A 5LJ5Y 3VEZA 3QEWA 3H5SA 3SPZA 1JLEA 3QGGA 2D9OA 4PY5A 4LF7F 4M3WA 5FRMA 2ZE2B 4ZP7A 2HAFA 3UCZP 4CGGA 1SKRA 4BGBA 3OUYB 2XY5A 2P6TA 3OV7A 1KLNA 1H1VA 4JI6K 4IOAQ 2GQCA 2YPYA 1YZ6A 3O4QA 2O5DA 1IQZA 3SBGA 3NS7B 2H3GX 3C16B 4I64A 3US5A 2Q3SA 3X3UA 3TUZC 1YQHA 3IUCA 3HULA 4FWMA 3CM6A 2UVRA 3PRDA 4USWA 4F0MA 2E5LK 1ZAXA 4DTPA 5IQ6A 3MCPA 1VISA 1FRIA 3BY5A 4KB0A 2IBOA 4LFAJ 3CNQP 2JWLA 1ZOTA 3MUVP 3R2CJ 5JVGL 3JTOA 3C6HA 2C2RA 2QX0A 4K4UA 4YOXA 3VGLA 4EO6A 4CF2A 3LO3A 1LOTB 4NASA 3AVJA 4FBUA 3O6QA 4JI2F 2MHEA 5LSRA 1QJHA 1JLFA 4B3SJ 2ALYB 2NYIA 1YBTA 3CE8A 1UVLA 2YPZA 3EUNA 1R8AA 4O3OA 4FJGA 2B43A 2F7VA 1Q8LA 3ET6B 5B7WA 2XI2A 2BE2A 4OHXA 2CQGA 2HIYA 3OL9A 3RMDA 1TL5A 2OO4A 4F7VA 2G8HA 2ROEA 2HFNA 4LSZB 4NRTA 1CQMA 3LL3A 3MM7B 4NI2B 2F9TA 2ZJPQ 3FZ2A 3PR4A 4FW2A 3FSXA 4K4WA 4R5PA 2IS3A 1WEYA 4F2SA 5FLXU 2IDLA 2CQDA 1ROFA 3W65A 3WT0A 3G2XA 1DLOB 3W62A 2XSJA 3FRZA 4DV0F 4ED8A 3TAQA 4IH6A 4ED0A 1L3VA 3M1FA 1ZZNA 5I42A 3V9ZA 3I33A 5C2DA 4LRDA 4UY8T 1KWMA 1IG8A 2VB6A 3DGVA 2XZTB 4CTAB 4RW8B 1UFKA 1S7IA 2J0SD 4DFMA 2W4DA 1JK9B 3ZO7A 1KFDA 1VRTA 3VGKA 2YHWA 4DV4J 4EMDA 4DZDA 4K8ZA 5FPNA 4OJ3A 3WQUA 4QU7A 1CJKB 4NCGA 2I0XA 4LF6F 5K8OA 3M2RA 2LQ8A 3IP0A 5DQHA 2ZWHA 2ZOMA 3LP0B 4KAZA 2RQKA 3H1VX 3P39A 4CLSA 1SQEA 5LMUJ 3MR2A 4FPIA 2IVNA 3TWZA 2DT9A 3NGUA 2NLXA 3MFHA 1R0BG 1UMJA 2HZAA 4TYAA 1U1KA 5DJBA 3M6UA 5E5NA 5H1SQ 5I3UB 4LSNB 2PEHA 2YHXA 4TY8A 4LF5J 1PJ5A 3ZSZA 3IBFB 5E26A 3CCJN 2DIVA 2F4FA 3KJNB 5HL7L 4Y0FA 2I5JB 5GADP 2RU9A 1ZM2A 2BX6A 2KHCA 3L4QA 2IMWP 2HHHK 1U09A 4K2JA 1HR0K 4CZJA 4H4MB 4CJEA 3NRBA 2G8WA 2IIHA 4NLTA 3DM2B 3HJVA 2IDOA 1DY3A 2QT7A 4ZPBA 3M8QA 3CPEA 1YJUA 2JNJA 4O8KA 5D4NA 2RHKA 2RT3A 1BO5O 4ZLLA 1T3VA 3ZZPA 1EJ7L 2WONA 1HPZB 2K2PA 2VONA 3OXLA 5DQIA 3O9SA 1QVGM 4KTZA 4NPOA 2DRBA 4QYZJ 4JKGA 3TSUA 4LMZA 3F2KA 4DTMA 2GGPB 4QYRA 2BA9A 1IVZA 4LR8A 1VSHA 2HQDA 2XCAA 4CIFA 2VHGA 3D54A 2HFSA 3V6HA 2CDQA 2SXLA 2OPPB 4LFCF 5AQVA 4F2RA 3RB0A 3O3FA 4DS5A 2NXNA 2YWWA 3R3TA 4A8XA 3VEVA 1TL7B 3FCWA 3VVUA 4O3NA 2BRKA 1VQ8S 4ZPWR 1IBMK 1SUQB 4RX6A 1RTHB 4JKBA 1VMBA 5LMNF 2RDDA 1YITS 3GSDA 3IKMA 4FZXC 1JNRB 4IYQA 3ASMA 3HPOA 1Q81O 4A8WA 4ZVPB 5EGYA 3KK1A 3IR5B 3U7JA 4H4KC 3ILOA 1FHTA 3KJQB 2IM3A 1N32J 1GXTA 4J9LA 3GCXP 3ENBA 2FY1A 3V4IA 2V4JB 1RA6A 5B0AA 1F60B 1WC1A 3FBCA 2F1FA 4DR5J 2RMLA 3NLCA 3MX2A 4ILRA 3TI0A 4AT1B 4B3TF 4OV1A 3G71N 4TVAB 1PYSB 2DO4A 3BBFA 2HBJA 5J1PA 4QCLA 1NBWA 3MR7A 5CCLA 3UR0A 1N34F 1WHVA 2G0CA 4M5JA 3F56A 2CGLA 2O8BA 4DR4F 2VCPA 4CJPA 2O8FB 3FBEA 3Q8PB 3VCDA 1CLFA 2IY5B 2ABYA 1BU6O 2V8VA 3PACA 2AEMA 2FHOB 4JI7F 3QRQA 4MFBB 3JTPA 1IG9A 3MPVA 4MO4A 3CFOA 3G9CA 2HNZA 3CDUA 5AQGA 3DLGA 1RAJA 4FNHA 1SKUB 1J2VA 2O8CB 3CCES 3T1YJ 2F8TA 4FVMA 4TLQA 5FRNA 1RT5B 3CWJA 3CC7N 1YIJS 3QNWB 2WHOA 4A8KA 3P83D 2WSFC 1VK0A 3IC1A 4JV5J 2VDHA 3ZFVA 2ZHOA 4ZVGA 2DISA 4ZHRB 1AFJA 4FL9A 5HP1B 4I9QA 3L3VA 2DCLA 4FOEA 2HQIA 5DM7Q 5C10A 2VICA 4DUZF 1IN0A 5JICA 4J9VA 4CO2A 2HK2A 4RU2A 4FJMA 3VAKA 1R59O 4A59A 3GYGA 1A9NB 2VODA 1Y0HA 2P9EA 5EUHA 1NNDA 3H45C 4KR0B 3BSOA 1WSRA 2MEWA 1RTJB 3R1HA 4A2BA 1T8EA 1KS2A 1F2GA 2CJAA 1T05A 2V7ZA 1YHQN 3OQ2A 2OPSA 4IG0A 2BJ8A 1VC6A 3M30A 3I31A 5I9EB 3NF6A 2BOAA 2E2PA 5D3GB 3BO3A 3MD3A 3T7ZA 1S3XA 2AV5A 1RHMB 2VC0A 3GBTA 2B5JA 2YBVA 3FK4A 3ITHA 1O51A 3T1HJ 1IWAA 1IJJA 3CCQN 4QU6A 3BYRA 4OLAA 4JUZA 4KB1A 2JSXA 3LAMA 3VF0B 2UXCF 1QE1B 3K7RA 4ECYA 5M2PA 2G1DA 1T3OA 3KG1A 3I0SA 4QZVB 1OWXA 2KRBA 2JLFA 1PGZA 2CVEA 2GAHC 1TFWA 2M88A 3CCLN 4LT6A 2KTQA 4DR3F 1XQSC 4DF8A 1JMTA 1G4CA 3R9LA 2KRRA 4OZ2A 5KFZA 1YX2A 3ENHA 4WP8A 1SC1B 4FKXA 3G87A 3VV2B 2C3OA 2DHAA 2RHSB 4Y0WA 2ZKUA 4ECQA 4RG8A 5GAEP 1PJ6A 2ZBQA 4KV8A 4AHUA 4C97A 2P9LA 5J2QA 2PO4A 5CQGA 1U0HA 2Q6BA 1PBUA 2VBWA 1FXXA 4IDKA 2QA4N 4FXWA 1HA1A 1JJ2M 2YWGA 3BBBA 3CC4S 1WKJA 2UUBJ 2ROPA 2F8HA 3BQ0A 4M3ZA 3CMES 3HMJG 4V19S 3OFHA 1SJ4P 1CULB 4J9QA 5FPEA 1IKXA 3IG1B 2IAJB 3AHPA 3QEXA 5AZJA 4FJIA 2AMCB 1VK3A 3NAEA 1NGJA 1SIZA 1OY6A 1WF2A 4CHZA 3ZTRA 1VQPN 3D1OA 1HBNB 3EGVA 3OY9A 1QQCA 2V4RA 4DWIA 4FWOA 2V5HG 1WWHA 4NLXA 2WOMA 4L73A 2DB1A 3UD3P 3QFUA 1RAHB 5IV3A 3C94A 3CJ4A 1T03A 2G2ZA 3K59A 4NRUA 3K5PA 2AD9A 1HI1A 1T9VA 2CNKB 3VQAA 3LANA 5F2RA 1D4XA 2MKHA 3AAQA 1JLGB 2BKPA 4JI3J 1BC6A 4FZVA 1UFLA 5HSPA 3GG1A 3P4IA 2NRXA 4DL6A 4MK9A 1K1SA 4OLBA 1CC8A 4HH1A 3RB6A 3NBPA 3MDQA 3RSEA 3O1BA 1N52B 3VAFA 4Z4EA 4PKIA 1NO8A 4K4SA 2WW8A 1MN9A 3FEYB 2IOCA 4P7VA 1KN6A 2UU9F 3TAEA 2OPQA 2HFVA 4HL9A 1TK8A 2B4UA 2FJEB 5H9FJ 2EK1A 2HFUA 2AKWB 4EI2A 4IEEA 3R5AA 2AWZA 1TUGB 3NGSA 5CYQA 3ZLJA 4KH4A 1DRZA 1D8ZA 2HYIB 3BS9A 2FSKA 3ALYA 3CM5A 1I94F 3HVTB 4PA1A 3VVTA 4J91A 1SI9A 3DRPA 3UKRA 1IKVA 2HLTA 1Q78A 3ISND 1HKAA 2EKNA 2QO3A 2DR8A 2R8KA 3AB4B 4CHQA 3L2RA 1AZSA 5HJXA 2I1RA 5AR0A 1RBOB 1Z2ZA 2GTDA 4LF7K 2V52B 4IO9L 3W2WA 4XEIA 1V6HA 3AVMA 3P45B 4YHHF 3D68A 2ASJA 2XMUA 3LQVA 5KG2A 4A8SA 2NRZA 6FDRA 2EI5A 1HI0P 3UDEA 4PL7A 3LP1B 1N5TA 4HUGA 2VG5A 1XHZA 5HATA 2OIHA 3FGUA 2D1KA 1HWIA 4OPJA 2IM0A 2ZM6F 1TL1A 2NUHA 1EWRA 4OPHA 1KP6A 3VA3A 2FUG9 4B9UA 1QZ6A 5B0FA 4TU7A 4BQLA 2DXDA 1SC6A 3VMFB 4CJRA 3S3MA 3O8MA 1GX6A 4KHNA 2O01C 3PLAA 5ETNA 2F9WA 2HHPA 4U8YA 2E9TA 3MPUB 3TZXA 2QXFA 2YHAA 4WQ4C 3T9ZA 4GKJJ 1NDCA 2XZWA 4FDFA 4K4XA 2QRRA 2U1AA 2WBMA 4L3NA 2ZC4A 3R5GA 3CFRA 4ZK7M 1K0TA 2RRBA 4Z0UA 3PW7A 3L95X 1F9EB 3HI9A 1RWKB 1HBMA 2GBZA 2NRRA 5BR9A 2QIFA 5AFUH 1IBLJ 4Z2XA 4XK8C 2APOA 3UVJA 2ATLA 3LP2A 2YX4A 3LP3A 2AJ1A 4OO1J 5F41A 4KO0A 1X4GA 4J9OA 1RADB 1L3UA 4FJ5A 4KPYA 2A1SA 1NH8A 3IGVA 2ZJQL 3NGKA 4RW9A 3MAAB 3K5OA 1TV6B 2F40A 4CZKA 3U4LA 1U04A 1B3TA 3WIVA 4NL5A 1YJVA 1E6YA 1ZPVA 5AQTA 3ZZYA 5AXLA 4LQ3A 1KC8T 5C24A 3GOIA 4YP3A 5EDWA 3IBWA 2BZ2A 3OW2R 2EX3A 1U6ZA 3OVBA 3MR3A 2MJUA 2DNMA 2FHJA 4DU7A 1LCUA 1VR6A 3Q7CA 4DQ8A 5IQQA 2O8EB 4DV0K 1FDNA 3NGRA 4EYHB 1LNQA 4A48A 3K5LA 1MMNA 2ZBIA 1RWXB 3J7YU 2W01A 1DTQB 4AQYJ 4BC4A 3DNCA 3P49B 2OFHX 4JI8J 4ZVEA 3NGDA 3AJ2A 1NHUA 4XO0A 2EFNA 4ILJA 2ROGA 3JS9A 5C42A 2E1ZA 3K58A 4WFNL 5KFGA 1X3MA 4C1NK 3NF8A 3L2VA 3PFEA 3ZT3A 2PMHA 3G96A 4LF6K 3VEOA 3LDPA 4OVLA 3T19A 2W42A 1JIHA 2IVFB 4WFXA 1SH0A 1K73T 3R8EA 2DNKA 4DU3A 4DV5K 1GQEA 2W25A 2CIMA 3MDFA 4DV3F 2MQ8A 1AUSL 1HWKA 4NXMF 5GINA 3M6WA 2ZH1A 4YR0A 4DV6K 1EETA 3AVFA 3HSJA 3CCRS 1P8ZA 4BRNA 3MCOA 3A8YA 2RKIB 2A0FB 4DZ6A 4Y3CA 5KFLA 3MURP 3KLFA 3CCVS 4PUOB 5B0CA 1JKHA 1S10A 2MKJA 2UXBJ 5ITHA 1CJVB 4AHVA 3PNIA 1RT4B 2GCFA 1S0NA 1EIYB 3P5TL 2JL9A 3JB9k 4CO5A 4JI6J 2P9KB 2DH7A 3I32A 3U1LA 3OVAA 3HVAA 5GADU 1VSDA 4ZIVA 4OL8A 1KTQA 1S9EB 3BSCA 1TKXB 5L1JA 3G4SS 4OKJA 3C16A 1ZM4A 2XCPA 2DR7A 2D7SA 4QWCA 2FJBB 2E5LJ 1Q82O 1YAGA 1FW6A 2HBQB 1Q81T 3OS1A 4ZCMA 1O6XA 4QIEA 1S97A 3D28A 2ZJRL 2EFGA 5DGAA 4KBOA 4KRWA 3MPYA 3R9PA 2LSNA 4DUTA 4LF4K 2HSTA 4B1XB 4X4TA 4FM1A 1UJ6A 3GZ7A 2WVFA 1RCXB 3OYBA 3DI6A 1ZAVA 1N0VC 3G0ZA 3EXYA 3H25A 1BLUA 1YRXA 5J1NA 5LMNK 4A2AA 4RW7B 3LAKA 3MMJA 3RAQA 1QAXA 3OR1A 2NZTA 1PCAA 3SEOA 1XJWB 1VFJA 1V3ZA 4QWEA 2FIUA 3O5BA 2NZ4A 3IAYA 2AGOA 4LD0A 4AUKA 1B64A 2DR5A 1XNQF 2LDIA 5DK5A 3KLIB 1AUDA 3W1YC 4BR7A 4M5KA 2FD2A 3HL8A 1RHQB 4C11A 3PR5B 3CMQA 2D0OA 3CCMN 4J8FA 4WP3A 1IUJA 2EG2A 2RS2A 2FC0A 2MKCA 1SKWA 5KTQA 2GWJA 5L9XA 2CQ4A 2FJWA 4B3TK 3LUYA 4R0JA 5KT7A 3DDNA 1HJRA 3CJQA 3MM6A 3M9NB 4ZVRB 4NXNF 3CW2C 5D0RA 2XLJA 1GT8A 2J8AA 3LWMA 3C15A 3QICA 1W2BM 4LSLB 3M2VB 4ZP9A 2N82B 1N34K 4DR4K 1XR5A 2FJXA 2H48B 1KBRA 4JI5F 4CTAA 4MQ3A 4RW8A 4YN3B 4M63A 4JI7K 4FP9A 1U1PA 4DU8A 1V3SA 3EZWA 3SIPB 2XHBA 2RRNA 4H4OA 3H5YA 1QD1A 1Y10A 2J9DA 2HWTA 1QUVA 2EVZA 4DR2F 4CEFA 2R7SA 2DNGA 1QVFR 1MROB 5F0XA 3LP0A 2D1CA 2QEXN 1XC3A 4Q5VA 2HRYA 4KHQA 1S4FA 4FJNA 1Q8BA 2K3IA 2O67A 4MLHA 1YRUA 2LEBA 3L7PA 4ID5A 5AQNA 3ULEB 3ZT1A 3ZZUA 1B7YB 1TFYA 1REVB 2QXLA 4DUZK 3O4NA 2BBEA 2LQ9A 5ADXA 3I82A 2HHHJ 3JQKA 5HVHA 3PFOA 1KQKA 1HR0J 2W9BA 3IWXA 4ILGB 2WCXA 1SJFA 4TYBA 1RBLA 4H4MA 2GELA 4WPAA 3F73A 3L3CA 4FK2A 5EXWA 1JLCB 4K42A 1C0UB 4URQU 5FLXO 2OKQA 3CD6N 2XYPB 1GFWB 4DQRA 3L2QA 1NK6A 4GMJB 3TQEA 4DSLA 1QQMA 5HI7A 4C2MA 3QDKA 4D3HA 3CC7S 4K0KF 3HPHA 2UXCK 2CQCA 4HUFA 5GMEA 4W5NA 3E01A 3G25A 1YWXA 2HBYB 2WAQD 1VSIA 4DR3K 5HRPA 3RAMA 1IBMJ 2OP5A 3T41A 3QBXA 3QRPA 2WBRA 1TL7A 4CECA 3OJSA 5HBMB 2JEJA 5KT3A 1RTHA 4QBUA 3ZTPA 2OEMA 3BGUA 2LEAA 2C3MA 2MZRA 2E20A 2UYTA 3GSIA 2QGFB 1VQLN 1S1VB 3Q83A 3W7BA 2ZH2A 3LGMA 3CF5Q 1YHQS 1HWUA 4XIUA 1SQGA 4E89A 1JL1A 4J37A 1F2HA 3H3NO 4C48A 1C0FA 4MO5A 1KCFA 1I1GA 4DSEA 1TL4A 3THVA 1UPPA 2IPOB 2Z57B 4WKRA 2KZMA 1UL3A 5DO2A 2QLBB 2BJ1A 4N76A 5AQXA 2XEXA 5JVHL 2PBDA 1ZAWA 4Y00A 4PQUB 5IWAF 1RHJB 2D0CA 3BJYA 2JH3A 3KMQA 1RZMA 3MFIA 2J6UA 3MMCB 4RNNA 1WSHA 2AP6A 1X8DA 1S12A 3MPWA 1FFWB 3JAMY 3MAHA 3PYGA 5T7LB 4EK2A 5AQSA 1U8WA 4CT8A 1JL2A 1BQMA 1TKDA 2EBGA 1PYTA 1QSSA 1RNHA 2YKAA 3T1AA 5IS2A 3MECB 4M5NA 2IYIA 5HQ8A 1QTNB 4MFBA 2P9PA 1IKYA 4HTUA 3QZ7A 2YWKA 2FHKA 3VAJA 1Q9XA 4CERA 4DTXA 2HBZB 2OELA 3Q8QB 3QGHA 5JLHA 5L46A 1C0TB 5KG5A 1YK9A 5DDPC 1RAEB 2E7WA 1RTDA 3LPTA 2VGNA 2UUAF 1JCFA 4BRMA 3QFWA 2ALZA 2Z2YB 5EOYA 2GJ2A 5HP1A 3GONA 3KLHB 5IM0B 2UU9K 4ZJOA 2B9XA 3TTCA 4JI0F 3C2PA 3C66A 5F0WA 1VQPS 1NGGA 3CD5A 4JHDB 1T3NA 1PC4A 3H2UB 1Q95G 1TYQB 3CI5A 1PSDA 4RUAA 4ZKAA 1RTJA 4M5IA 5KFAA 2AIRB 2R7RA 3E9OA 2OZMA 2QMWA 2F3JA 3PEHA 4WBFA 1I94K 1HNIB 3LZJA 3QT8A 3GFZA 2R7XA 1GLEG 5DS7A 3BH6B 4H0PA 3ZZTA 4JI4F 1BISA 4FWRA 2HBRB 4YR3A 4CCHA 3NFAA 1FX2A 5B08A 4K2XA 3BPSP 3CPWR 4G9ZA 3MWBA 1J9AA 1XN9A 2VBYA 5KFEA 2YTCA 3CQYA 1WAJA 2A41A 4J2BA 4LQ9A 1LFWA 3SJHA 1QE1A 5E3QA 4YHHK 4M3TA 4JRPA 3Q8UA 3QSYB 1WD6A 5FIIA 4IWVA 2KKHA 1BUPA 2J76E 1VQKN 4DHVA 4DPUA 4L6V3 3T5KA 2H4WB 5T14A 3DLLQ 4HACB 5K5MA 2ZM6K 2D4WA 3GIJA 2CGJA 2YHBA 2FZKB 3TRGA 1RU2A 2V67A 4ERDA 4BS2A 5KG0A 1SC3B 8ATCB 3SCJE 2BGGA 3CCWA 2V68A 2YI1A 1LQ9A 3J7Z5 3CIZA 4HTLA 1S1WB 3KZBA 4ED7A 1HNXF 1RAGB 3VQ7A 4ZPCA 1Q8KA 2COLA 1S79A 1P8GA 5A0YA 3C6UB 1KVCA 3QO9B 2E2OA 2W40A 3PDNA 5ETSA 2G2YA 3OTEA 4FNIA 4TQSA 1ATNA 3LM9A 2RF2B 4GC6A 3OYIA 3SBMA 6AT1B 1CLQA 1CULA 4FYWB 1K47A 2C2KB 1NGCA 2DNQA 3IG1A 4LREA 4IR9A 2IAJA 1VBXA 3X1LB 1UA0A 5HJYA 3MWPA 3I56N 1HBUA 4LH4A 5G0RB 3VF4A 3M1VB 1DJ0A 3R27A 5AE2A 1FCAA 3ILJA 2AHOB 4RU9A 3SSRA 4FYVB 1NXIA 3L2WA 1OH7A 4O3SA 2YX6A 3F9MA 4CYUB 1HQEB 1G1XA 1IWGA 1HNZF 2W9AA 3ZYYX 2VPWB 1ZBIA 2FHJD 3FEZA 2GV9A 1WC6A 3HSGA 2M4MA 1H2VZ 4EBCA 4P2XA 4K8RA 5J2MA 2DHSA 2QL7B 2Y1IA 1AA1B 1WI6A 3BO2A 4ZVTB 1U1RA 5EU7A 2HOEA 2MZ1A 3SSQA 3U3GA 1LW0B 4Y1CA 3CC2S 2PI4A 1FXLA 3VETA 3JQJA 5FDLB 4KGVB 2FJDB 5JUMA 4CJWA 5AXKA 1PBAA 3MMBB 4OZLA 4DI6A 4E7IA 1VRQC 1ITPA 2R9LA 3AVGA 1KEKA 3CJ9A 2WK4A 5J1EA 2HRUA 1RK8A 5IT4A 4DPYA 1RWWB 1WKLA 4L72B 4M5DB 2E9RX 3HHLC 2HAIA 1FE4A 2IRUA 4JD2A 3CJKB 2W8KA 5JJBA 3HT3A 2W2QP 4NXMK 2KXFA 2QL5B 3D6MB 3VZHA 4P75A 3WNGA 4BDYA 4UOGA 2VQFF 1TAUA 3K9JA 3H20A 3ZEUB 3M2UA 2V94A 2R7YA 1Q82T 4LF7J 3NL0A 4ZS6A 5LT5A 5C2CA 3NWGA 3GG4A 4B9LA 4QR1A 3KOAA 4YY3J 3PW5A 4FJHA 2YKNA 3DHWC 2PMZD 4JKEA 4CGHA 3CUNA 4WCEQ 2BE7D 3UW1A 2EXUA 5D0HA 5KFUA 3MCSA 3KWMA 3R5CA 1S1UA 2CNLB 3V81B 1WOSA 4ZVFA 2KZZA 3J7A1 2BDPA 3MEEB 4H0TB 3PEJA 5HQLA 3NG8A 1JLEB 4CLTA 1RT3A 4BRLA 1NPRA 5KPZA 5DLFA 3QQCD 4LBHA 4AFFA 4LH5A 3FBBA 3AQPA 3GB0A 2W7OA 4CW7B 4ID8A 2Z4PA 3I0RA 1RBRA 3QT6A 2MQNA 3VTIA 5DDOC 2R8HA 3W5ZA 1NJWA 3HHLD 3WC2A 3VQCA 2W8LA 3SI6A 2OI2A 3SAHA 3IWLA 3R3LA 5BR8K 2YCHA 1VBZA 4E0DA 2DY9A 5C2GA 2KG0A 4B9NA 3ZSWA 2GUPA 1SPBP 2G0JA 4JI2J 5AQOA 1VQ6S 4P72A 4IG3A 3CJRA 3P96A 4K41A 5E3RA 3ENAA 2ZWPA 1S57A 4RBUA 2J4RA 1M5HA 2BTFA 4RL1A 3HFVA 3U02A 2XB2D 5D4PA 1XC9A 3CJ2A 2FVSA 3V2UC 2W9CA 4HCBA 2RQCA 1XI1A 1XNQK 5SZTA 4OJHA 3DLJA 3IXQA 1F5BA 4B1YB 3AJDA 5KRTA 2X7IA 3HSZA 4CO3A 3MAAA 5EWFA 3SQGB 1TV6A 1DQAA 1WDDA 1S7HA 3TA1A 1VSJA 5LL6d 3SUPA 1D09B 2UXDF 1GLLO 1T6DA 4DV0J 3CCZA 3HHKA 4DQIA 4NXNK 3U9ZA 3T3FA 4KFBA 1VOMA 3CTRA 2O8EA 4NMLA 3OYMA 3VQ5A 2D3UA 4DL4A 1XUPO 4YOUA 2KYXA 1LK5A 4KHSA 4ZPAA 2WC9A 4R5PB 3OYGA 2R2RA 2WVCA 2W4CA 1Y5IB 4GV6A 3H40A 4Q2LA 3K2YA 5BPNA 3W8GA 4YMEA 3CCSN 1FXDA 3ZT0A 3W2VA 2LCWA 2RDIA 3DMJB 4LF6J 3VAGA 1S76D 1GK8A 2G4BA 2V2KA 5TKWA 5I42B 4DR2K 5KAKA 1KQFB 1R0CB 2JHEA 2BJEA 3H42A 4B3OB 4O4GA 3PRVA 3GL1A 2FGOA 4ISGA 2HQGA 4WXOA 3VPZA 4I67A 4YR2A 3F41A 4A5AA 3A5OC 4OX9F 3MHYA 2HQ3A 3PYDA 2VG7A 3QYYA 3MEDB 2VQEF 5EX0A 5KT2A 3EYZA 2RKIA 3G8SA 1HWJA 2DKOB 4CRJA 4O5BA 3FR0A 4PUOA 5GAGP 4DCJB 1FK9A 3OFGA 4MKVA 1WC5A 2QFIA 5GVQA 1NK4A 2KO1A 3KDOA 1RT4A 5ETRA 1KQSM 1QTMA 3KG0A 4WFYA 2GFFA 3AV9A 3IFRA 4WWSA 1DGKN 1BA0A 1DURA 2Z30B 4PWWA 2HK3A 2HBMA 2EEYA 3AA3A 1FO1A 2Q66A 4H54A 1TKXA 2FVPA 4BROA 4I2PA 3A5NC 1NJIT 4ILHA 2E5GA 1WOPA 3O9RA 4K0KK 1RDBA 1KFSA 3WNFA 5K9FA 3ZNUA 4OZ5A 3FZBA 4PG5A 3KHLA 4LFCJ 4ZITA 5IC4B 3OVSA 4RWTA 4RBTA 4OI2A 1KHVA 3UQSA 3JYTB 3NCPA 5ADZA 1C6VA 3PVXA 2Z1JA 2Q43A 4OGCA 2XMMA 3POTB 2WONB 3V4MA 1UAWA 4RW6A 5KFVA 3AVNA 2OSQA 1RT1A 4DR6F 4JKGB 2V6AA 3O9TA 5KPTA 4DFKA 2A6MA 5LMNJ 4FLWA 4NLSA 2H65B 2UUTA 1NK7A 4FPRA 3K0JA 1TKTA 4LY7A 2KLAA 4E7LA 2QJ3A 1D5AA 1S5ZA 3TABA 5A8WA 4CGDA 4RNOA 3ZCMA 3WZ0A 3EZOA 2JWNA 3LM2A 2D3OR 4Q8FA 4WJBA 3BKUA 1YJWN 2DNRA 3SPYA 3TA0A 3VR1A 4X66F 2KVQE 5KT6A 3SLCA 4JP8A 1JJHA 4GKKF 4YQWA 4DX6A 4USIA 3RBXA 2RNEA 4B3TJ 1S0MA 2ZNYA 5BN8A 3ZT2A 3OS2A 5IWAK 4LVOP 3KK1B 2MMYA 4CLUA 2B4PA 2E5JA 4U7CA 4DV1F 3GE9A 4GVBA 1N34J 1TP7A 3SQ1A 4N7TA 3V4IB 4U9RA 4DR4J 2AEFA 4DQQA 4LSLA 3KLGB 4U95A 2HWIA 2R7QA 1UVIA 2QLJB 1E4FT 1B0TA 4BWJA 2CJBA 2AYEA 3MXHP 1JXBA 3GILA 1U45A 3NKYA 4ED2A 3HSTB 1C4AA 3NMRA 1OQ6A 1JWWA 1RYRA 1QVGR 5H9EK 4PKGA 1PAEX 3D5MA 1ZC6A 1VQSA 2Z8QA 5KFMA 1NEEA 2ADCA 1EZZB 2YXLA 2K3KA 1JXVA 4IKAA 2Q0UA 2IMOA 3WUHA 2ZOGA 1I51B 4V19J 4WFBQ 4DB3A 1CXQA 3BV8A 2A5XA 2DR9A 2NRVA 3D1HA 1MROA 2GJFA 3VAHA 1YGYA 4FLUA 2A2CA 5KFTA 3ZSQA 2UUAK 1AFIA 4JV0A 3M9MB 5FROA 3ULEA 4DUZJ 3VQTA 2CQ0A 1YI2S 3FZMA 4DTJA 2HNZB 3EZUA 4FJLA 2CQPA 1WORA 2UV8G 4JI0K 4G65A 4F3OA 2FJAB 4FF1A 3Q89A 4G1IA 2ZHBA 3GP9A 4ZVOB 1NH7A 1X5SA 2HW3A 3AXMA 2CA9A 2Z2MA 5ETKA 2B56A 1XMOJ 2MZJA 2WSEC 2OA8A 4QR2A 5KPRA 1JLCA 1VBYA 4OLOA 1C0UA 2DTUA 4JKFA 1RAIB 4A8QA 2VGMA 2AJ4A 4JI4K 3Q86A 5KFKA 3CQ8A 3UO0A 3I5CA 4DJBA 2ASYA 5M1OA 4J9SA 3F9KA 4AXIA 1HYSB 1RWPB 2X1GA 4B9SA 2UXCJ 4OHVA 3GFHA 3H8YA 4URSA 1AXQA 1UWAA 3UN2A 1KTVA 3GJTB 2XBPA 5JVHQ 3CULA 2OPSB 3VA0A 4IG0B 2ZC3A 4C1NI 2YQ0A 4DR3J 5B09A 4I1TA 4LRFA 3PIPL 4EFHA 2OZSA 2B5JB 3ITHB 3I8DA 2AQ4A 4USKA 1C1AA 3G8TA 4QS7A 4DN9A 3E66A 3FZHA 2ZFHA 4O44A 3FZKA 4PABA 3BGRB 3NHGA 4IZ9A 4H8KA 1W7WA 1NUEA 2OTLS 3TTDA 2V9KA 5B8HA 1B9FA 5AQFA 2IGIA 1VQYA 3KLEB 3MCAB 4I69A 5KG6A 2KJWA 4CI6A 1HNXK 2V0NA 3RZAA 4N41A 4YFUA 2XYGB 2PFUA 3VQ9A 2AW0A 4DFPA 3SMSA 2XHCA 1U1OA 4A4JA 2DGSA 1YXQA 1GAOA 3HLUA 4LF5F 4CZMA 4KV8B 3G6YA 1BE4A 1WNEA 1ASVA 3V9XA 2FF6A 2WSCC 1VQ4S 2W4PA 2W24A 3S3OA 3CCEN 3O1WA 4LIRA 3AO5A 4BR9A 4C23A 2YY3A 4AH9A 4X65J 4AYBD 1YIJN 5E7OB 3OFFA 5T7LA 2YWFA 4JK9A 2YQ3A 3IAS9 4NLRA 2MQLA 1IKXB 3CJ1A 1J53A 1HNZK 1NGEA 1L5UA 2M9KA 4CJVA 2QTWA 4Z4CA 3MECA 2W6KA 3OXFA 1S6QB 4OJRA 2UVVA 1FJGF 3CQXA 3DN9A 1RISA 2CZ9A 4UT4A 4USMA 4KC5A 1VYAA 2WOMB 3M8YA 1G3OA 2DNNA 2GA7A 3ZSXA 2CPEA 1KSPA 3AA2A 1T03B 1S5JA 2Q97A 4H5RA 2NLWA 1WTBA 3MXMA 4OI6A 5CHIA 3IO1A 2VG6A 2Z1IA 4NLWA 4F8RA 1Z6RA 4M42A 5DRKA 3LDQA 5IM0A 4B8AB 4BE2A 2VPZB 4QOTA 2PIIA 4H4KA 2DNPA 4MMOA 1E6VA 3O2IA 3I56S 4RPFA 1U1QA 2K1RB 4YB7A 4UOHA 3UDLA 1TYQA 2VPYB 1JCGA 3VQ8A 3MUTP 1I94J 1RHUB 4Y2MA 3F0NA 3TUIC 3FC9A 3EE8A 1JJ2R 2B4VA 4OFZA 1NDPA 5DM6L 2HMIA 1RQ0A 3O5TB 3BQ1A 2OPQB 3RVCA 2VQFK 3VWSA 4IQMA 1CG2A 2WVBA 2V63A 1I3AA 5D77A 2MKKA 4YHHJ 5F8LA 5FPDA 2R7UA 4PG8A 3OYCA 1HQUA 3QINA 3HP6A 2F9JA 1YDLA 2IDEA 3DRPB 3UKRB 1NHKL 1CJUA 4CM2A 4DDFA 2ZM6J 4ETZA 3MK6A 4CBWA 1T7PA 3M8PA 4OYIA 1IBKF 3AA5X 3THPA 3VALA 2AT1B 2PA8D 4TKTA 1OJ4A 4FJJA 1RUSA 3D2EB 1HLUA 1X4BA 3G6ES 3CMEN 1SZ2A 4H0OA 1OIAA 4O5FA 3AVAA 1U7LA 3D3CJ 2VIHA 3ZTQA 2D3ZA 3NOCA 2AYBA 2XMAA 4ZN1A 4RUCA 2L9WA 4CO0A 3SZ2A 2OTJS 4L75A 2GMJA 4ECWA 2C3PA 5C15A 2DGTA 1OS5A 3HI0A 2F4VF 1WG4A 4FF2A 3H2VE 3U3YA 3UR3C 2BW7A 4DLGA 4Z7CA 2RU3A 1N0UA 2X1BA 3WQPA 3Q22A 1GLJO 3QJLA 3OYFA 5F0UA 4NB4A 3CCUS 1MDUB 3K17A 3M6GA 3PHEA 2LMIA 3S8SA 1LW2A 2CH5A 5MAOA 1HFEL 2GV1A 4FJ9A 2ZGYA 2QZ8A 5AXNA 3M1VA 4IH5A 1XMQF 4OYWA 1FDBA 2JWKA 1HBMB 2ASDA 4RJVA 3I96A 2E7XA 1NAQA 4XH4A 1YVNA 4W98A 2BM1A 4DL5A 3UVJB 3DC2A 4CYUA 4J2DA 3EGZA 2UXDK 1XEZA 5A76A 2MTLA 2A42A 4GW6A 3LPUA 4KO0B 2QTDA 5T41A 2CVIA 2XTJP 4JKHA 5KFHA 3IM9A 3N6MA 2DTJA 4PQAA 2ZDPA 3EVMA 2CADA 4UQGA 1XMBA 4CHPA 4IOXA 5L8RC 5C7PA 4Y2KA 1WOQA 5D4OA 5C24B 2R8IA 1UWBA 2E8AA 3DRSA 2HHVA 2Y8YA 1HARA 3BO4A 2CZVC 4XAKA 1TVRA 3D6TB 2E66A 1D9AA 3MMBA 1NB7A 2QSWA 3MR6A 5EY4A 1MLAA 3QATA 1BGXT 1FWLA 1KVBA 3MGJA 3QT7A 4U7UD 3ZX0A 2FLLA 1NGAA 3VQDA 3EGWB 4KGKA 5KT5A 3EN9A 4DV3J 3TYTA 4IRDA 2XS5A 1AW0A 4M5DA 1BA1A 2WZ1A 5HRSA 2P1JA 3CJCA 2IRYA 2QLWA 2FDNA 5C42B 3HZ6A 5JMNA 4EAHD 1VQ7S 5FLXY 4NCBA 2FGCA 2R2SA 3WNEA 2DXEA 2VQEK 3L2UA 3CYMA 1Q7YO 2W1BA 3ZEUA 4OYMA 2ZZMA 5IT9U 2IYGA 5M1FA 3CT9A 1YBAA 3KKRA 2WVEA 5KG7A 4DG1B 4PZVA 4JLHA 3RBDA 1TQLA 2YWEA 2ZBRA 4MDBA 4IOCL 1WACA 5LJWA 4FS2A 2M70A 1EETB 1ZETA 4M5MA 3V81A 3KJFB 3OHRA 4CD3A 1JKHB 1WSIA 5M1KA 3MEEA 2BEFA 3RMCA 1S1TA 4DQSA 2G8FA 2ASPA 1X4CA 2E1YA 1BWVA 3ETMA 2GO9A 1VK8A 2K06A 2V7YA 1R0AA 2VFTA 2J0XA 2H5IB 3IWNC 1H6KX 1RWUA 1U2FA 2CNNB 1EHWA 2IJFA 1QSLA 2RB7A 4DR6K 4JYAF 1DQ9A 5KG4A 3HCXA 4PYAA 1S22A 1SCJB 4H0XB 4U7UK 1XR6A 1TZ0A 2DFHA 4W5OA 1RACB 3HHLB 4JV1A 2JDJA 4ECVA 2NZCA 2HGMA 5CH7B 1KAYA 1TGOA 1Y3JA 5CD4H 3P3DA 1XNQJ 2BH1A 3C6TA 3DI6B 1RAOA 4F9OA 1JNZB 4CH1A 1YF5L 4I6MA 4CLPA 1ESVA 3DJCA 3NY0A 4FK0A 4KI6A 4X66K 3E9LA 3NE6A 2OGUA 2Z1HA 3TW0A 3IR6B 4GRSA 3J80U 2GJIA 4P6QA 4UTGA 2JJ4D 4BRGA 3AT1B 4GKKK 5GAHI 4HUEA 3TAMB 4BRFA 2HBKA 3OR1B 3FFKB 3SQGA 3HBTA 1UVNA 2GO8A 2AX0A 4NXNJ 4U6PA 2F9DA 4PKDB 3TWHA 2H51B 3SQ0A 2Y1LB 5HMZA 4MDAA 1GNKA 4DV1K 1CS4B 2KU7A 3NVKA 2C3YA 2HS3A 3LTOA 2YNGB 3THYB 2QA2A 4CF9A 1WSJA 4C11B 2G2OA 4JI5J 4IKFA 4TU9A 2FQQB 4Y2IA 3CDEA 2VD3A 4MIBA 2DGUA 1P9YA 2Y9HA 1DKGD 1SJQA 3VQSA 4WKYA 2VKZG 3J7YP 4M1KA 5LSLA 3B54A 2AF6A 2W7PA 1W97L 1VLOA 3MM6B 2OPRA 3CCRN 1EKRA 1YG0A 1VQ5S 3C15B 3DMJA 3CCVN 1YJWS 3MAQA 4DR2J 2HHWA 4AM6A 1Z05A 1WHXA 3AD7C 2FBXA 2E88A 2H5EA 2N7YA 4BCAA 4WQ4A 1Q16B 2HVDA 4C0OC 1ZH5A 4N77A 4YOTA 3P4UB 3HJFA 1LAVA 3JQMA 2HGNA 4B3OA 2O8DA 4ISFA 2H5JB 2PYLA 1TUYA 1ZBSA 2GHPA 4C3LA 2GX9A 1W26A 1N6QA 4H4OB 2PE8A 4BDZA 1M5OC 1NNEA 4DF4A 1WNSA 1GLFO 3G4SN 2ZUGA 3ZTOA 1X1PA 3AO3A 4ZJQA 3MEDA 3K8VA 2V34A 4MJKA 1Q5VA 3MM5B 4A8YA 4Z37A 4I6YA 3NNHA 4OV6A 5EX5A 1YLXA 4I56A 2V2ZA 3H98A 2OSRA 4CWBA 4IOAL 2V51B 2R4FA 2BVZA 4ID5B 4DV5F 4DPOA 1RBAA 1Z1ZA 2HZVA 5CCMA 1UPMB 4C4WA 3HTVA 4DV6F 5A8RB 2NXJA 5ETLA 4LF2A 1M0SA 3VEYA 1NMDA 3KWIA 2WW4A 2W9BB 2WTFA 2NNWA 4K0KJ 2FVCA 1VHFA 3L7UA 4WP9A 3WXIA 4ED4A 1YTYA 3O3LA 3EVWA 5AQUA 2V2VA 3FSIA 3R1LA 3C14A 2J6TA 2ZWOA 2PZSA 2WVDA 3W5YA 3B6BA 1W2BR 5AE1A 1P27B 3W5XA 3CMAS 3JYTA 2JRSA 3SJJA 4P2SA 1T44A 2QA1A 3POTA 2AYMA 2EC0A 3A5MC 3R6GB 3R6MA 1Y97A 3QLHB 3J81U 1MMLA 2VBZA 2W2MP 3HDSA 2FLNA 2V8GA 3KYLA 5AE3A 2QLFB 2MKSA 1F21A 3ZXWA 3E01B 2CH6A 3MUMP 4GVMA 4CEBA 3KMSA 3N4PA 3NGZA 2KM8B 2XM3A 3DXKA 4BACA 2ZOFA 4LF4F 3TVKA 4RWWA 3IR7B 2E7VA 2KB2A 4S0MA 5L38A 2M5YA 2CQBA 3BF1A 3FKBA 4I6AA 4ZPVR 4AF1A 3TO8A 4KKOB 2WB1D 1FEHA 2YV0X 1K8KA 2F7TA 3EY1A 3OBWA 4FM2A 5AJ3F 1A5VA 3THTA 3ZTSA 1KDNA 2QKBA 2HPUA 2RHQB 2RJZA 5LJ3Y 3D7EO 4OYZA 4LF5K 2Y3YA 4WK3A 3PHTA 4BLGA 3H1QA 1QSYA 4RNFA 4Y6IA 2DCUB 3UDVA 2JOQA 2UXBF 2HSEB 3N5BA 3MR5A 2J9EA 1TMMA 2P9NA 4CZCA 2LKZA 3D0IE 4M8LA 4YOWA 4WQ5C 3W66A 2Y1RI 2G8KA 2OMOA 1IJFB 2A40A 3KLGA 4KIAA 1IR0A 4AHCA 3IMXA 4J9UE 4OI4A 1YTUA 1DT9A 4A8FA 5H9EJ 1SAZA 2EC2A 4ZDNA 3N01A 1NMEB 4N47A 1I5OB 3BDEA 4NEZA 4OZ1A 4QYZK 1FJGK 5T7BA 4D3GA 4FLTA 1T11A 2O1PA 3GTYX 1UAXA 3N0VA 3M8WA 3LWLA 4A5BA 4E1MA 5KFRA 1O8BA 4CJ4A 3GYNA 2J7WA 3AD8C 1GTHA 2XMJA 1BQMB 2UUAJ 2DY4A 2YKMA 1MWQA 4DEZA 3LDNA 4JEPA 1WUAA 2MLXA 5AZIA 3PIOQ 1Y7PA 2P9PB 3ZSRA 1IKYB 4RUHA 1Q86O 4JI0J 4K4VA 2MKIA 1N54B 4JAXA 1N36J 4USTA 4F4ZA 4U7BA 1EQYA 5ETPA 2LU2A 2E1PA 4WF9Q 5F8NA 2WBNA 3EJMA 4CJKA 1RTDB 3KUHA 3OR2A 3P5JA 3DXBA 2Z58B 1RE1B 4EZ9A 4FWQA 2BMBA 1D9FA 3L7OA 3A13A 3VQQA 3FCVA 4JI4J 4BR5A 3ZNJ1 4QIWD 4ITSA 1S6PB 3OLAA 4FYXB 3UE2A 1GOBA 1NK8A 4DTSA 3OPKA 1HYSA 2MZQA 1BXNA 1UVJA 3OYKA 1NOYA 1WSEA 1BCOA 1FKOA 5CR4A 4CZEA 1LWFB 4QOZB 1YUWA 4J9NA 4PXDA 5HVGA 3FMBA 2DPJA 2BKOA 3BF3A 4PG7A 4HEA9 4R79A 1WKKA 1Q0NA 1R7IA 4BR2A 5CZXA 1QQOA 2YNHA 3H0PA 4KSEB 4HVZA 3HHDA 4F3MA 1IBKK 3MX5A 3DRRA 1C0GA 2CQHA 1T9XA 2H54B 2I9SA 1LWCA 2HS0A 2GIFA 1EO1A 4AILC 4Q44A 2D0PA 3QEPA 2HKEA 3BR9A 3NGIA 3BGRA 4UZCA 2QM1A 4FWKA 4CK3A 4NZ6A 1N8RO 1HNXJ 3KLEA 4DSIA 4CEEA 1F5AA 3TP2A 3FRYA 1T0TV 4FF4A 1Q9YA 5KFYA 2XG8A 2HF3A 4TU8A 1J54A 2KVIA 2FTRA 3FE1A 2N7CA 1IM4A 4NYPA 2F4VK 3BGOP 3VEXA 3UKUB 2CZ4A 4B9MA 3B82A 4R8UB 3ILIA 3K8WA 4CJ7A 1ZM9A 3H2LA 4LC9B 4J9RA 2DBBA 1M90O 3FNNA 1FRKA 4CZGA 4CH7A 4X64F 5IZHA 4DTOA 3PV8A 1KD1T 3KKSA 4CJSA 3OL8A 5A0YB 4HHJA 1UEKA 1R89A 2KT3A 4O23A 3Q2TC 4MIWA 4HT7A 1XMQK 4LIWA 1W7AA 5A2QU 4K4ZA 1HNZJ 4GO5X 3SUOA 3AA8A 1H0HB 2J5AA 3DXSX 2C22A 4X4RA 1O13A 3QFPA 3HF5A 1KOHA 2DITA 3M7VA 1X31C 3GIMA 4KJIA 1TL3A 2CG4A 3CD7A 3HFZB 3SV3A 3RB3A 1RBUA 1YJRA 3DKDA 1EQ0A 1S6QA 1HBUB 2DR6A 3SXLA 4TNOA 4B02A 4BRIA 2Z56B 4FJ7A 1OH8A 2VOPA 4H5TA 1B7FA 4GV3A 4B3RJ 1C2PA 3TOQA 2QV6A 3FJ2A 4ETXA 2D0AA 4ANCA 2Q36A 4DOZA 2B8QA 2NR0A 5DM7L 1Q8IA 2JC0A 2VWJA 2Z0GA 3MZIA 1RP5A 1QZ5A 1HNWF 3KHGA 3UNGC 3QMQA 3ZX2A 1NLVA 4NX9A 1SBRA 1PC5A 4E19A 1WI8A 3BGFA 1Q7YT 1V4TA 2F96A 5EN1A 5J2MB 2ZNZA 1W0HA 5DGBA 5GADI 2HS4A 1WF0A 4RNHA 4Q0BB 3V6DB 2GMHA 2P9UA 3B6OA 2ZD1A 2PSZA 3TU5A 3Q7BA 3DLKA 3VESA 4WFAQ 1Q1KA 2K1RA 2G0IA 1VJWA 3WXMB 7AT1B 4RTFD 4F4XA 1SL1A 2HNYA 2YNIA 2ZVSA 4KH0B 5KFWA 4E1NA 4CFDA 3TAGA 3LF0A 4B1UB 5L1LA 1M1GA 1BIUA 4IFVA 5ETVA 2N4CA 5DZ6A 4LRAA 1NWKA 4K5RA 2CPYA 3FUYA 4W90B 4DL3A 2XGPA 3WC0A 1WB9A 1F6TA 1K0VA 2E5HA 3BB5A 4FM0A 3VF2A 5J1EB 3ULHA 4IFYB 2YX1A 2GZOA 4JD2B 4PYDA 4ZP6A 4URGA 4U67Q 1WAFA 5AQPA 4C8LA 3HRGA 3IMQJ 4F50A 3NOGA 4WIIA 2QWLA 4CO4A 3MTKA 2XC9A 3QNNA 3OXGA 2XWXA 2N4DA 3QIPA 3M2UB 1APSA 1S0VA 5DMRA 5GAHP 1HUXA 4OX6A 4M94A 4NLGA 1S77D 2UZAA 3I5AA 4OYAA 2GIQA 1L3TA 4KHPJ 2YKNB 2E1CA 3L4IA 1B0PA 5JS1A 3D2EA 4J9MA 3A8JA 4YOVA 2E2NA 3MMVA 1EAYC 3E1YA 1T9WA 1G15A 1OY8A 1S1UB 4M3UA 4ER8A 4R0EA 2CPZA 1JXLA 5CAAA 1YKWA 2G1HA 1MG7A 4K50A 4V1Ak 1KVIA 2YQ1A 1MMDA 1PKUA 2NXCA 3AOBA 1RT3B 4KGZB 1UZDA 3GMGA 1N33F 4X4NA 3KK2A 1NK5A 1RDWX 3R5JB 4QAGA 4JYAK 1FTCA 2F63A 2J9CA 1E3MA 1NK9A 3BKFA 3I0RB 3QPIA 5M1PA 4IO1A 4YDUC 3QB0A 1G7CB 1RGIA 1BD6A 1ZM3A 3A4TA 3R6LB 4BVPA 3EWGA 1U1MA 5CA5A 5HO4A 3IS9B 2QK9A 1S9FA 3WNHA 3V1RA 3SUQA 4IG3B 4I6WA 3AA4A 4YS2A 1NM2A 1FRMA 5KFOA 2XNRA 2FC8A 2Q0RA 1QS4A 3CC2N 1Q53A 4J2EA 4CO1A 2DXFA 4ECUA 2UXDJ 3GDQA 3RB4A 4LFBJ 5THWA 4HCCA 3L3UA 1LWEA 4DL7A 2W9CB 1MU2A 2D3O1 4F04B 1N56A 4JBCA 1VCTA 1VAZA 1FESA 2ITGA 1EB0A 2QKKA 4BY9C 2YJEA 3GIKA 3DOKB 3N9UC 2QYCA 3BQ2A 3GIRA 4KRFA 3HHEA 4JOUA 5L9NA 3SQOP 4F4AA 2HMPA 1KR4A 3VN5A 1VQMN 2JC1A 1N88A 1VQ9N 4ANEA 2X6NA 4C8YA 3W3SA 4KFBB 1WEZA 3K0SA 2YNFA 3QGIA 1J5OB 5FJ4A 2QN6B 3ID6A 1S72S 4B9QA 2LQBA 4AD6A 3LDLA 2ZHAA 3RG6A 1N5QA 5EVZA 5E84A 3UN3A 1CXUA 3M8SA 2BABA 4BRPA 1OPIA 1URRA 4OX9J 1FNOA 4CF1A 4CLZA 1RU1A 3W2VB 2CNOB 2VQEJ 4KHMA 3PKYA 2V2QA 2PMWA 1N4LA 4CIOA 2F8SA 2IM2A 2LA4A 4E3SA 3T69A 1UJ5A 2BQ3A 2DRAA 1BL3A 1WC3A 4P9SA 3RRGA 1RCHA 2DGQA 1KQGB 1VHIA 2IJNA 5JLFA 3B78A 2DFEA 1Y4ZB 4O4GB 3DYAB 3AVHA 5CZ1A 3DOLA 3Q24A 3MN9A 4DG1A 3I55N 5BN9A 1FXRA 4CFCA 4M3YA 4MK7A 3G82B 2VG7B 1Y9OA 4CK1A 3C19A 5JVGQ 2NXUA 1I6JA 2VOOA 4DV2F 3LW5C 2MQPA 3EKUA 4FPAA 1WBDA 4B08A 3DDIA 1C1CA 4DCOB 1VQ6N 1URNA 1O5JA 1FK9B 4DV7F 2I7PA 4IRKA 3KNAA 2LEPA 3KK3B 2YJFA 4B17A 1IKWB 1YJ9S 1FA0A 1GOAA 2L9DA 1C1BA 2GEMA 1TELA 3L6QA 1TR0A 4Z7YA 5GAEI 1R6VA 2FY8A 1Y3KA 4A57A 5IFMA 2PY5A 4DS4A 2BQUA 4CFAA 4DR6J 3PM9A 4KREA 1X4HA 4ZVUB 2DEJA 2ILZA 2DRDA 4I2PB 1CEZA 3PSFA 2PDAA 2AJFE 3OYEA 1W25A 1C4CA 2MY7A 2GVZB 4CJ3A 3I5BA 2VWBA 2ZVIA 3HHLA 5HMYA 2EG1A 3KKFA 3V6JA 3JTNA 1HD1A 1U1LA 4F26A 4RW6B 5BR8F 3V9UA 4X66J 2CWXA 1RT1B