1KLMA

Hiv-1 reverse transcriptase complexed with bhap u-90152
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
538
structure length
537
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Unique features in the structure of the complex between HIV-1 reverse transcriptase and the bis(heteroaryl)piperazine (BHAP) U-90152 explain resistance mutations for this nonnucleoside inhibitor.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 142
structure length 537
sequence length 538
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1klmA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1klmA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1klmA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1klmA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1klmA05
1J54A 5F8JA 3C6UA 4ECUA 4K4XA 3C6UB 2EX3A 3SZ2A 3V4IA 4H54A 2BE2A 1JL2A 2BE2B 5KFVA 2R2UA 2KTQA 4B9SA 3ITHA 3LALA 4I9LA 1JXLA 1RA6A 3ITHB 2DPJA 2JEFA 1WLJA 3QETA 1U04A 3ZSWA 3KLIA 4NLQA 3KLIB 5CYQA 2IAJA 3Q8SB 4CEQA 3AA4A 5CYQB 2BQRA 1JX4A 2VG7A 4F3OA 2AX0A 3NH2A 5KFQA 2VG7B 1RT6A 4KFBA 1CXQA 1RT6B 4KFBB 4NZ0A 3VQQA 4J2DA 3OLBA 2JLEA 1Z25A 1RT7A 1GX5A 5DLGA 4TY9A 2RF2A 3N6NA 2RF2B 3AVFA 4FJKA 4I9QA 1CZ9A 3OYKA 3OYIA 3TAEA 4H4MA 4HYKA 4EBDA 4WFZA 4O3NA 1RBRA 3NCIA 2KQ2A 4OLAA 1EP4A 4ECXA 3LWLA 1EP4B 4J9QA 2XY6A 4RG8A 3ZCMA 2HHUA 4KO0B 4NCGA 2WB4A 1HYVA 4NCGB 3OYLA 5HRRA 1S9GB 4IRCA 2OZMA 5K14A 2BANA 1BGXT 2BANB 1MU2A 2GV9A 3M9OB 3AA5X 5J2MA 1MU2B 4O3RA 4DTPA 2HVHA 5J2MB 2E9TA 2G8FA 1RT4A 1RT4B 2JEGA 3KIOA 3KLGB 2YHBA 3D0PA 2ITGA 4IBNA 3VN5A 4ED3A 4CFCA 2ASDA 4URQU 3ASMA 1RDBA 4J9LA 1SL2A 2KZZA 1N56A 4LSNB 4FJXA 1ZTTA 4ZTFA 4FS1A 4Q44A 4O3SA 2FBXA 3S3OA 4HVJA 3RWUA 1WSJA 2VWJA 1JXBA 4Z4EA 4U7CA 3AO1A 2ALZA 4KHQA 2X78A 1FKPA 2FJVA 4ELUA 1FKPB 2AQ4A 1LAWA 4N47A 2E4LA 3OYAA 3ZSVA 4CGFA 3G0ZA 3CIZA 4FLUA 3K58A 4IRKA 2V9WA 4ECYA 3SQ1A 4NLOA 3G6YA 2AJQA 4DQRA 1S1WA 4DL3A 3NGYA 4NCAA 4KV8A 4IQXA 3LAMA 1DTTA 1S1WB 3K57A 5KRTA 3BQ2A 1DTTB 1BL3A 3KD5E 5JXSA 4OLBA 1BIZA 3BSCA 3QZ8A 2UUWA 2C2EA 4ICLA 3KHHA 4KSEB 3VQAA 3HXMA 1L3VA 4E7HA 4IKFA 4KHUA 3NAIA 4JLHA 4B9VA 4F2SA 1KHVA 2YNHA 3DOKA 3MR6A 2I5JA 3QERA 1SH3A 3DOKB 2I5JB 4CEEA 4Q43A 3VQ7A 2W8LA 1ZYQA 1JLGA 4WE1A 2E6MA 3QGIA 4WE1B 3QEIA 4KAIA 4MH8A 3N6MA 1EXQA 4G1QA 3G6XA 3KOAA 3OHBA 5KFDA 4CJSA 2PZSA 4HCCA 4DQQA 4WZMA 1VK0A 4CEZA 2WCXA 4ECQA 3M8RA 3PO4A 5KFXA 5DLFA 4OKKA 2IM1A 3LZIA 1QS4A 1XR6A 1JLFA 1WSGA 3QNOA 1JLFB 5KFPA 4MFBB 1YTAA 2EHGA 4F4XA 4EP4A 3AA2A 2R8JA 3AVNA 3O3HA 1NK4A 5KFGA 3HK2A 5EUHA 1LWEA 3RMAA 1LAVA 4Z4HA 1LWEB 3CM6A 2W9CA 2P5OA 1RTHA 2FBYA 1TVRA 3MR3A 2W9CB 1RTHB 4M3YA 1S0NA 1TVRB 1KFSA 2C2RA 1UWBA 1UWBB 4YR0A 3L8BA 5JS2A 1JLCA 1VSJA 3SV3A 1U47A 3K5OA 4IRDA 1T94A 4IH5A 4ED8A 1ZBLA 4Q8FA 2J6TA 3TAGA 3D28A 4OL8A 3CDWA 3CG7A 3TWHA 3QINA 4I7FA 5KFZA 4EO8A 3DMJA 4I7FB 1S10A 4CEFA 3DMJB 3FQLA 5HBMB 1XHZA 1IKXA 2QE5A 4LQ3A 4O44A 1N4LA 4O44B 2W9AA 4C8MA 3V9ZA 1Q8IA 4ELVA 4KI6A 3OLAA 2I1RA 1D5AA 4GC7A 4GMJB 4W5RA 1TL3A 5KFHA 1TL3B 3BGRA 4PQUA 3AO2A 4DSEA 3BGRB 4PQUB 4B9MA 3NKYA 4DTUA 4B9NA 4K4VA 4DFKA 1ASWA 2ATLA 1L5UA 4CERA 2ETJA 1RCHA 2E6LA 1W9HA 4ECZA 4I2PB 4Z4FA 2RDIA 1RTIA 3PR4A 4ECWA 1RTIB 3M8QA 4LD0A 3M8QB 4DLEA 3SQ0A 2FBTA 1RAJA 1Z26A 4CJUA 3V6JA 5KGXA 3NBPA 5T14A 1JL1A 3NBPB 5KG7A 3LP2A 3MTKA 1N5YA 4CEAA 3LP2B 4UQGA 5I3UA 5JUMA 4HKQA 2G8UA 5I3UB 3AVCA 1A5VA 1RBVA 1NK6A 4J9KA 4RU9A 2VWKA 3VQDA 2R8HA 3T5KA 3HP9A 1RDAA 4QWBA 4KHRA 2IM0A 2VA3A 3ZT0A 3SQ2A 1EETA 4NLVA 3IGVA 3HVRA 2Z1IA 3VQPA 1NKCA 1J5OA 3GV8B 2FVRA 3Q8QB 2Z1HA 4DTSA 4J9RA 1DTQA 1S0MA 2FVSA 1DTQB 5F8LA 1L3TA 1BQMA 4DS5A 1BQMB 4AHTA 3SUOA 5J2PA 2FVPA 3CJ4A 5J2PB 3O3GA 2ZKUA 2ILZA 3PVXA 3O4NA 2G8KA 2UVVA 3KLHA 1VSLA 3KLHB 4FJLA 1C0TA 3VQ6A 3G10A 4LQ9A 4RW7A 3GILA 3LP0A 4KHWA 2CJQA 4JS4A 4CGDA 1U4BA 3ALYA 1ZTWA 3HVAA 2J6SA 1Q9XA 4CF1A 4N5SA 5SZTA 4FJMA 1U48A 3TAMA 1QSLA 3ZSOA 4Z4IA 2HVIA 1RYRA 4DSJA 4RNMA 4J9MA 1WN7A 4YMEA 3OHAA 3PW4A 3RB4A 2YNGB 4F2RA 4K4ZA 5SWMA 3AVBA 4B8CA 2YKMB 3OYMA 1TL1A 4CK2A 1TL1B 4NLGA 4DSLA 1ASVA 1RILA 4TSXA 3NGDA 2JEIA 1BI4A 4CJPA 3FRZA 1BI4B 3RTVA 5DQGA 4TLRA 1QAJA 3PHEA 1VSIA 3LZJA 1YTUA 4HUEA 1NNDA 2FLLA 3PW5A 1C6VA 4Y3CA 5KT4A 2ZD1A 4ZMMA 4K8XA 2XCPA 3DYAB 1FKOB 4K4UA 4OPJA 2OH2A 4O0JA 4M41A 3WNEA 4M94A 5KFCA 4RNFA 4KB7A 3AVHA 2JC0A 1XHXA 4DMNA 4N41A 4J9PA 1VRUA 3AVGA 4KKOA 5EDWA 5L1KA 3ICLA 4KKOB 3HL8A 4TY8B 1RT5A 1B92A 3PW0A 3MEGA 5HROB 3MEGB 1J53A 2FLNA 4CJWA 3KKSA 3PO5A 1KLMB 4BE1A 2HW3A 5CYMA 1T03B 4DF8A 5CYMB 4NRTA 2IA6A 4NYNA 3ZT4A 4FJ9A 2UVUA 4FJ7A 4FVMA 3ZT3A 3KK1A 3KK1B 2GC8A 5DG8A 2HNDA 1W0HA 3LP3A 2R2SA 4E3SA 2ZE2A 1TKXA 1TKXB 2Z1JA 1X9MA 2XWYA 2D0CA 3I5CA 4FS2A 2W9BA 5FRNA 5C42A 4OVLA 3AVAA 5C42B 3T5LA 2BQ3A 4QW9A 2HHXA 4F50A 4F4WA 1LWCA 4TN2A 1K6YA 1GOCA 1HMVA 1D9FA 3WNFA 4J9OA 2W7OA 3CYMA 1NK7A 3EPGA 3G86A 2R8GA 4O3QA 3EYZA 3P83D 2KZMA 4KTZA 3AVIA 2XY7A 3QEPA 5KFAA 3QIOA 5EWFA 4MKBA 3V4IB 3KK3A 2IS3A 3KK3B 2IJFA 4DSFA 4PUOA 3KHRA 4PUOB 2C22A 5FRMA 3MAQA 1D8YA 3H08A 4DL4A 4H8KA 2IAJB 4O4RA 1S4FA 3T3FA 3VQCA 4M3RA 1RTDA 2ATQA 4HCBA 3F9KA 2B43A 4FM1A 1RT7B 3CWJA 3NGZA 4CF0A 3TAFA 4ED7A 1C1AA 1RA7A 3QO9A 4J2BA 3NF7A 1IKWA 1S97A 2RPIA 4BWJA 4C8OA 1JLEA 4H4MB 1JLEB 1U49A 2FBVA 4Z4GA 2OPPA 4CGJA 1YVFA 3QEWA 3OYDA 3V9XA 4FZZA 1D1UA 1QSSA 4PY5A 1HYZA 1O1WA 3V9UA 1I6JA 3H98A 5K14B 1WSHA 4OPKA 1BCMA 3DLRA 2Z1GA 2D3UA 3H5XA 1N48A 3OYGA 1KVAA 1RDRA 4FK0A 1SH0A 3LDSA 1XC9A 2W7PA 3IRXA 2BQUA 3IRXB 4FJ5A 4Y2AA 2Y1JA 1RTJA 4EYIB 3HM9A 3MR5A 4ZHRA 1TKZA 1WNSA 3OS0A 2YHAA 4ZHRB 5DG7A 3AO5A 4FM0A 5HLFA 3OYHA 3DLBA 2ASLA 1XWLA 5HLFB 1JLAA 4ZPCA 5DQIA 4WFXA 1JLAB 2XO7A 4AHVA 3THVA 1KVBA 5EU7A 4CIFA 2YKNA 2YKNB 1ITGA 2WONA 3CJ0A 1Q9YA 4DL2A 2PY5A 1HYSA 1LWFA 3A2FA 1HYSB 1SV5A 1LWFB 1TQLA 1SV5B 4PWDA 1S48A 3LP1A 4NLXA 1S5JA 1G15A 4PWDB 2VA2A 1X9SA 1SL1A 1VSFA 4CFBA 1HQUA 4GW6A 3UR0A 4EBCA 1HQUB 5CZ1A 1NJZA 3HPOA 3I8DA 3NF9A 3PX6A 4KV8B 3SUQA 3MEDA 1NK8A 4ZVFA 1RT1A 3MEDB 3CM5A 2XGQA 1KHWA 2AGOA 4ICLB 5KFBA 1UAXA 2G8VA 4MK8A 4CEDA 5F8HA 4TYBA 2AU0A 2R8KA 2YNHB 4E89A 1T05A 2E9RX 3H5UA 4ECVA 1HJRA 3SNNA 4O55A 3OJSA 3SYZA 5C24A 4FLXA 3TARA 4AHUA 1TKTA 1JLGB 3RAQA 3BQ1A 1VRTA 1VRTB 4G1QB 4M3WA 4EO6A 4Z4CA 4KBIA 4EEYA 1D0EA 1KSPA 4YQWA 3DOLA 4HHTA 3DOLB 1L3SA 2HNYA 2RDJA 4O4GA 2HNYB 4O4GB 2P5GA 3OJUA 4FXDA 1C0UA 1C0UB 4LSLA 4LSLB 1TGOA 4FYDA 2QV6A 1D9DA 4PA1A 4CEBA 3L2RA 2W8KA 2V4RA 4RZRA 1RT2A 4C8NA 4DL5A 2ASJA 2X6NA 3QGGA 3WNGA 4E1NA 3BDPA 3FQKA 2DFFA 1JLCB 4G3IA 4CECA 3N6LA 1KLNA 3V1RA 3CDEA 3CQ8A 1U45A 2F8TA 3DLHA 5F8GA 2IM3A 4Y34A 3QEXA 3MXJA 5KFFA 3SV4A 1IG9A 3L3UA 3SPZA 4QAGA 2HB5A 4KTWA 4F4YA 4E7KA 4DU3A 4WYLA 4K50A 3SI6A 4EZ9A 4NLPA 3HP6A 1WAJA 4E7JA 1RBTA 2P1JA 3ISNC 1IKXB 4EYHB 4NLYA 4DTOA 4F4ZA 4DL7A 2JC1A 5KFRA 3U3GA 3V1OA 3SCXA 4CJ4A 4E7IA 3V6HA 1X1PA 1JKHA 5CY4A 4ID5A 4CIEA 1JKHB 4E19A 4ID5B 2HNZA 5C25A 3OL7A 4TQRA 4ECSA 2QK9A 2XI3A 3FDSA 5C25B 1NK9A 4M3ZA 2UVWA 3RB6A 2GUIA 4XPEA 4CF9A 1MMLA 1RYSA 4CK3A 3VQEA 3B6OA 3DRSA 4KTQA 3DRSB 3KLFA 4OGCA 3KLFB 4KHMA 3RAXA 5DK5A 4ED0A 3H5SA 3V6KA 2G8WA 2R2RA 1ZBFA 1N5YB 1S1UA 1XR7A 1S1UB 2AGPA 4CHYA 4DSIA 2EC0A 1BIUA 5J1EA 3G6VA 4DFJA 4DFMA 1GX6A 4DU4A 5J1EB 3S3MA 1NHUA 4OJRA 2BDPA 1RT3A 3LANA 2CKWA 3OYCA 3HYFA 1EETB 4IKAA 2O5DA 2WOMA 3SFGA 4FK2A 1J5OB 3T19A 3TVKA 1I39A 3OYBA 1GOAA 3GIJA 3HO1A 3GIKA 4FJGA 4K4WA 3T5HA 1KVCA 2QXFA 4O3PA 2J6UA 4M3TA 3QNNA 5KFUA 2IDOA 3LAKA 3EPIA 2D7SA 2IGIA 3MF5A 1C0TB 4NLSA 3QIPA 4IH6A 3QIPB 4RW7B 3LP0B 4IDKA 4Y2CA 4M3UA 4W5NA 3RRHA 3CO9A 4HUGA 3OYEA 5DG9A 4FBTA 1C1CA 3GV7B 1DLOA 1S1VA 1C1CB 1S1VB 1IH7A 4NLWA 4IFYA 5F8NA 3TAMB 2WTFA 3NH0A 3S9HA 2OPRA 1TP7A 3BSNA 4DQIA 4GC6A 3LPUA 3BREA 3H4DA 5KI6A 3AV9A 1QAIA 3KMQA 1I3AA 4CF2A 3SJJA 5KG2A 4Y1CA 5KT6A 3E01A 1QSYA 3E01B 4MIAA 1ZETA 5FROA 3SUPA 3KLVA 5KFEA 5F9LA 2E9ZA 3SFUA 4OGEA 2OYQA 3MFIA 1K1QA 1NK5A 5KT7A 1HNVA 2KW4A 1HNVB 4DWIA 3V9SA 1RDCA 5L1LA 4U6PA 2GIQA 3QLHA 3QLHB 2BGGA 5FDLA 3OSNA 1T7PA 1RBSA 3DLKA 2BR0A 4ZTJA 3DLKB 2ZD1B 3UQSA 3NF8A 4CJ3A 3BR9A 4ZP8A 4FJNA 3NH1A 3V6DA 5HP1A 3GIMA 2V4QA 3TAPA 3MXMA 5HP1B 4OKJA 4I2QA 4URSA 3I5BA 4I2QB 3MFHA 4DTRA 3RMCA 2XI2A 2IOCA 1NOYA 3KHGA 3AVJA 1VRUB 2GBZA 3PY8A 1T8EA 4IFVA 3RMDA 3S3NA 3E51A 1T3NA 5KFSA 3ZSRA 3U3YA 1REVA 1RT5B 3AVKA 3VQ4A 1REVB 1JIHA 4XO0A 3T1AA 3NHGA 3HKWA 2FLPA 1C2PA 4CE9A 3PUFA 3QGHA 3UDLA 5HRSA 1HRHA 2X6SA 3VQBA 1F21A 4QW8A 3JSMA 2A1SA 3CFOA 2IM2A 3DI6A 3K5MA 3RR8A 3ULDA 3Q8PB 4URGA 3DI6B 4BACA 2HHTA 3NF6A 1TAUA 2HNDB 2R8IA 3OL6A 2XCAA 3O3FA 2ZE2B 3KLEA 2HMIA 4AHSA 3KLEB 2HMIB 5KGWA 1FXXA 3K5NA 4EBEA 1EX4A 3OYFA 2AGQA 4Q0BA 2W9BB 2XY5A 2ILYA 4CHQA 2DTUA 4CK1A 1VSEA 2IMWP 4J9NA 1LWCB 2FJXA 1HMVB 3TI0A 1BHLA 2P51A 5F8IA 4KRFA 5KFNA 1SKSA 4WFYA 3QZ7A 3DLGA 3DLGB 4R5PA 4R5PB 4ZP9A 4ZPDA 3KJVA 5EWGA 3KJVB 4FJ8A 5J2NA 1N6QA 3GQCA 1N6QB 1K1SA 1TAQA 4Q45A 3ZT2A 4HTUA 2KFZA 4LH5A 4IR9A 3TQ1A 4HUFA 4KB1A 4QWCA 3RMBA 2HAIA 2IC3A 5L1IA 4NLTA 2D0BA 1RTDB 2IC3B 5F9NA 4KAZA 4KHNA 3NDKA 3TAQA 4R0EA 3BJYA 5KFJA 3QO9B 5D3GA 1IKWB 4CF8A 5D3GB 2WHOA 5KT5A 5KG4A 4K4YA 2OPPB 4DTJA 2AX1A 5KG6A 4CGIA 1UA0A 3K5LA 4FCYA 3K59A 4CHNA 3H5YA 3H40A 5T7BA 4ED6A 3SQ4A 3WNHA 4WZQA 1S0OA 2O4GA 4CESA 4FZYA 3MEEA 2RN2A 3MEEB 1S6QA 5L1JA 4DG1A 1S6QB 4DG1B 4R8UA 3C95A 4OKEA 4M95A 3NAEA 4R8UB 4N56A 4NYFA 3NL0A 3VA3A 4KO0A 3EZ5A 4N76A 4YR2A 1NHVA 3DRPA 1S9GA 4M42A 3D5MA 3DRPB 1LW0A 4AH9A 3AVLA 3L3VA 1LW0B 4ED1A 2YNIA 4O3OA 1RNHA 1J9AA 2YNIB 3TR8A 1S9FA 3IGNA 1RTJB 4IH7A 1TKZB 3KLGA 4K8ZA 1X9WA 1C0MA 3VA0A 1IO2A 2HHVA 2UVRA 1WSIA 3LWMA 3RBDA 3PW2A 2A1RA 4NYZA 3T5JA 1XI1A 4X2BA 2WONB 4ZPAA 3SUNA 3DDKA 4LSNA 2FC0A 2F8EX 4KI4A 3Q8RB 1WAFA 3LP1B 4GVMA 3M9MB 3HPHA 3TABA 1VSDA 5KFYA 1LW2A 3O4QA 5DGBA 1LW2B 3SI8A 4RNOA 1VSKA 1S9EA 4TYAA 4NLUA 4IG3A 1S9EB 4QWEA 1KRPA 4IG3B 1R0AA 4ZP6A 4M45A 1R0AB 3ZSYA 1RT1B 3K2PA 4DTXA 3KD1E 3I5AA 1HPZA 1W25A 4L8RB 3PV8A 1HPZB 4J9SA 3HPGA 3M9NB 4QPXA 2GIRA 3RB0A 3BQ0A 2DPIA 3HJFA 4CJKA 1T05B 2B5JA 3HSTB 2B5JB 4YP3A 3MXIA 5C24B 4CGHA 3OYNA 4JUZA 1WSFA 2R2TA 3IAYA 2HHQA 1TKTB 5KG3A 1WSEA 4EP5A 1ZBUA 4B8AB 4W5QA 3AO4A 3PW7A 3CFPA 2FVCA 3TANA 4CJEA 2PYLA 4CFAA 4DU1A 2XY8A 2WK4A 4RW8A 1QUVA 2F96A 4RW8B 1LV5A 4CJRA 1NKBA 3OL8A 3P5JA 3V9WA 4FK4A 5J2QA 1QHTA 4JRPA 5J2QB 4WXOA 4E0DA 3BSAA 4B08A 4RNNA 3GYNA 4WXWA 5CZ2A 4IR1A 4CGGA 1TK5A 3D45A 4ECRA 2OPQA 5KG1A 4LY7A 3RR7A 1NJYA 2V0NA 2OPQB 3V81A 5KFMA 2KFNA 3V81B 4F3TA 1HARA 1IKVA 3H2LA 2XGPA 1BQNA 1L3UA 1IKVB 1RT2B 4MFBA 1BQNB 4MK9A 2XC9A 5L9XA 2HHSA 3KMSA 1FK9A 3FFIA 4RUCA 3OL9A 3HVTA 1BCOA 1IKYA 1FK9B 3FFIB 4RNHA 3HVTB 5KTQA 3UPFA 4E1MA 1IKYB 3RRGA 4BDZA 4FLVA 1SKRA 2HWIA 4KREA 2ZQBA 4Z0UA 2XHBA 3KHLA 4IOBA 1CLQA 4FW2A 4J2EA 4FJIA 5DGAA 3VQ8A 3PJWA 3CDUA 2LSNA 5HRNA 5KFIA 1Z4UA 1XR5A 2BRKA 2YV0X 4MIBA 4KHYA 3EZUA 4DTMA 3ZT1A 2OZSA 4F8RA 5KT3A 2Y1IA 3PX0A 3BSOA 1YVUA 4FLYA 2OA8A 1KCFA 3M8SA 4B3OA 1OS5A 3B6PA 4Y1DA 4CJFA 4CFDA 4B3OB 4JS5A 4JV2A 5HBMA 3CJ3A 4CJ5A 1EKEA 4JV0A 1SH2A 1KFDA 3AA3A 3HVWA 4RW4A 1NJWA 4RW4B 2HNZB 2VG5A 4DFPA 4ZVHA 4YNQA 4CJLA 2VG5B 3IN5A 3VQ5A 3NMAA 4NRUA 4NLRA 3GIIA 2C2DA 2DY4A 2G8HA 4FZXC 3P1GA 1JXEA 4ID1A 4MK7A 5DQHA 3ZSXA 5DMRA 4ZP7A 5KFWA 3KNAA 4I2PA 1B9FA 4JRQA 2FVQA 4F4KA 4RW9A 2D3ZA 3UIQA 1NJXA 4FJJA 4RW9B 1S1TA 1YT3A 3M8PA 4C8KA 1S1TB 4BE2A 3M8PB 4DLGA 1HQEA 4QWAA 3CVKA 4NLDA 1HQEB 3PZPA 4YFUA 3DM2A 1RT3B 3NFAA 3DM2B 5F8MA 4ECTA 1BISA 4RUAA 4IG0A 4CHOA 3JYTA 4CEOA 4ELTA 4IG0B 3JYTB 3OVNA 3CFRA 4CHZA 2WOMB 1VSMA 3DLEA 4KPYA 4FLWA 5KRSA 5JS1A 3DLEB 5KFTA 4Q8EA 1S1XA 2RKIA 4FLZA 1S1XB 2RKIB 3MR2A 3PX4A 1RBUA 1QTMA 2HHWA 3PJXA 2IJNA 3L2UA 3ZSQA 3ZSZA 1SL0A 3CJ2A 5EWEA 4Q5VA 3RBEA 2IBKA 2YNFA 2YNFB 2JGUA 3MECA 4YR3A 3GV5B 1SKWA 3MECB 5KFLA 4IDKB 4AILC 3OS1A 5E41A 2BRLA 4TXSA 1DLOB 3EY1A 4DQPA 4WYWA 1CZBA 4O0IA 5KFOA 1GOBA 4IFYB 1NK0A 3RB3A 4CJQA 3HHKA 2OPRB 1CSJA 4BWMA 3OSPA 1NOZA 4EZ6A 1QE1A 2D41A 2R7YA 3QESA 1QE1B 5C5JA 2Q3SA 1TK8A 1JLQA 1JLQB 4ZPBA 4CCHA 4M3XA 4DSKA 1JLBA 3U6FA 2G8IA 3KTQA 1JLBB 1RDDA 4CJTA 3DRRA 3DRRB 3AO3A 1A5XA 3SPYA 3QYYA 3L2VA 2YNGA 3OY9A 2DFEA 4MKAA 2NUBA 4FLTA 1B9DA 2D5RA 2XRIA 5KT2A 2YKMA 3C94A 4AHRA 3IS9A 3V1QA 1Y97A 4K4SA 3IS9B 1VSHA 4W5TA 1CXUA 4DL6A 4ED2A 2FJWA 1S49A 1TKDA 4DQSA 5FDLB 3KK2A 3H59A 4CJVA 2O4IA 3KK2B 4ZVEA 2C28A 4XPCA 3VQ9A 4H4OA 2X74A 2B6AA 3OS2A 4DF4A 4H4OB 2B6AB 4QCLA 4MQ3A 4BE0A 5KG0A 4DTNA 4C8LA 3V6DB 3NAHA 1ASUA 5KFKA 1UOCA 4FBUA 4K4TA 3QEVA 4KHSA 1ZBHA 3DYAA 4ZVGA 2VG6A 1FKOA 2VG6B 2QKKA 4RW6A 1ZBIA 4IFVB 4FJHA 4RW6B 1HNIA 3ISND 4KB0A 3H4BA 1HNIB 4LH4A 2UUTA 3I0SA 3I0SB 5I42A 5I42B 3L2QA 3CJ5A 3F73A 3OYJA 2PYJA 2WRMA 1S6PA 2F8SA 1S6PB 3IG1A 1QQCA 4J2AA 1NKEA 3IG1B 4KE5A 4XIUA 1TK0A 4TY8A 3JSMB 2W42A 5HROA 4B9UA 1TV6A 1TV6B 3PR5B 2JEJA 4BDYA 1KLMA 1SUQA 1T03A 1SUQB 1WNEA 3QIDA 4B9TA 2AWZA 3NE6A 4CHPA 4CIGA 4DEZA 5KG5A 2D0AA 3I0RA 4BDPA 3C6TA 3I0RB 3C6TB 2OPSA 4Q0BB 1A5WA 3LPTA 3KKRA 2OPSB 3NGIA 4FW1A 1UA1A 4W5OA 3VQSA 2HWHA 4FM2A 4NCBA 4QOZB 3HT3A 4QWDA 2B4JA 3FSIA 4B9LA 3L2WA 4JV1A 2QKBA 3AVMA 5HRPA 1C1BA 1C1BB 2DFHA 4AHCA 1KTQA 4DS4A 4E7LA 4TQSA 1U09A 5J2NB 4O5BA 1IM4A
chains in the Genus database with same CATH superfamily
2QGFB 3VF4A 1N34F 3PSIA 3KWMA 3C6UB 4H54A 1RWVB 2PO4A 3D1QA 2BE2A 2J5AA 1Q79A 1YAGA 1RA6A 3ITHB 2DPJA 2KT3A 2K06A 3QETA 1U04A 2NQPA 3ZSWA 3KLIB 2F4VJ 2O8EB 4NO7A 1JJHA 5CYQB 2RRBA 3T1HF 2DPNA 4KFBA 4P52A 4WTOB 3O5BA 3OLBA 1Z25A 1NMNA 3SSSA 3VEXA 3N6NA 2Q0UA 2RF2B 1N32K 1CZ9A 1N36J 4MT1A 2JLGA 1YJTA 2NLWA 3IR7B 1RBRA 1G2EA 1S4EA 4OLAA 3JAMY 1F9FA 1EP4A 2FZKB 5D0HA 1HIYA 2OELA 2CRLA 1BLUA 5HRRA 3KG0A 2OZMA 1NGDA 4DR6K 1PYTA 1RHQB 1F3VA 1BGXT 2W2PP 1MU2B 4DTPA 5J2MB 2O8DA 3HMJG 2G8FA 3HHLB 1RT4B 4QOTA 1VQYA 4UOGA 5K8PA 2ITGA 1UP1A 1BWVA 4CFCA 4C3LA 4LF6K 1Z2ZA 1G1XA 3ASMA 3MX2A 1N56A 1V5IB 3MMJA 4C0BA 4ZTFA 2DO0A 3PRDA 4FS1A 4O3SA 1VQ5N 3O9RA 4GVLA 1C4CA 1TR0A 1FKPB 1VS3A 2AQ4A 5EX0A 2E4LA 3OYAA 3ZSVA 4ZOSA 2P9LB 4CGFA 2AV5A 3CIZA 4LF9F 2ZGYA 2UXDF 2J4RA 2WVEA 1IJEB 1AW0A 4WQ5C 1WHVA 3G6YA 2D3O1 4CM0A 4DL0C 2O1PA 4KV8A 4IQXA 1S1WB 3KD5E 5JXSA 4ER8A 2C2EA 3VQAA 3HXMA 1KQFB 1QVFR 4KHUA 1B0VA 4B9VA 1CG2A 4LFCF 1FRHA 3MWTA 3RW7A 3KZBA 2I5JA 2ZBPA 1HWUA 3DOKB 3AAWB 2IVFB 1XMOK 1IXKA 2XZWA 4Q43A 2W8LA 2VBZA 4WE1A 3QGIA 3AOCA 1EXQA 4MH8A 3N6MA 2VGNA 2ZEJA 4CO4A 2DNPA 2E5HA 5FLXO 4BC4A 4DQQA 2WCXA 2AKWB 4NPOA 1I3OB 1Z6RA 1U1QA 4NXNF 5F1XA 3QNOA 1HJOA 1ZPWX 4DV6J 2KVIA 1YTAA 2EHGA 4A8WA 2L48A 1K0VA 2V6AA 3PNIA 3AA2A 4JI0F 3HK2A 3FZHA 1LWEB 3CM6A 2HZVA 2W9CA 2P5OA 2D9OA 1TVRA 2YBVA 1RTHB 3ZZUA 2C2RA 3AT1B 1K47A 1LFPA 4DQ8A 3EE9A 5JS2A 2G0JA 2DK2A 2DRDA 1XNQK 2C2ZB 4DX7A 4WFBL 4YOWA 2AMCB 2R4FA 3PTWA 4ED8A 2J6TA 5LJWA 4DUZJ 2E1AA 3QT5A 3HSGA 2ZJPL 4I7FA 3BBCA 2H48B 1CJVB 3TP2A 1XEZA 1YJ9N 2QE5A 4LQ3A 2VBXA 4CLZA 1KN6A 4C8MA 1HUXA 1Q5YA 1GAOA 2VPXB 4LIRA 1DURA 2I1RA 3T69A 3PXGa 4KGMA 5KFHA 3CC7S 3BGRA 2JDJA 4DSEA 4QIEA 4DTUA 4B9NA 1VC0A 1R8CA 1M1HA 2BM1A 1L5UA 1HBOB 3M3ZA 2NXUA 4I2PB 2DITA 3PR4A 5HK4A 4CZKA 1KC8O 2ZH9A 1LQ9A 3TX8A 3MN9A 2FBTA 1PBUA 5AZIB 1NGJA 2IVNA 3O8WA 1RAJA 4OI6A 2HURA 3NBPA 5KGXA 4JI7F 2W7AA 1TUVA 1W26A 3W9HA 1OMSA 4CEAA 2QXLA 1ZC6A 2G8UA 3J80O 2V50A 2P9PB 4QZVB 1IBLJ 1A5VA 1RBVA 4J9KA 4DV4J 3VAMA 1O0PA 2R8HA 4V19J 1OKJA 4KHRA 2VA3A 1HQ2A 3BY5A 3CCMS 2M8DB 1WBDA 2RQCA 1FWKA 4LF7J 2CZ9A 4Z2XA 3HVRA 2Z1IA 4DR5J 3MGJA 4D3GA 1HBMA 2Y9HA 4KGKA 3Q8QB 2Z1HA 2LXIA 1DTQB 2XO6A 5F8LA 1H2VZ 1L3TA 1BQMA 2CJAA 4KHPK 3SUOA 3R6LB 1XMQJ 3CJ4A 4YY3J 2ZKUA 3DXKA 3QFPA 4B3MF 2OEKA 1N34K 2G8KA 2ZFHA 4QIFA 4DPOA 1T9WA 3B78A 4LQ9A 1YXQA 3W8PA 3I33A 4ZS6A 1U4BA 2GHPA 3ALYA 3D3BJ 1Q9XA 4CF1A 2CPHA 3ENQA 1U48A 5DDPC 3H42A 1QSLA 1NPPA 2LYVA 3T1HK 3IP0A 2FGCA 4DSJA 2I8EA 3BBBA 1T9VA 1UW9A 4P6QA 3J8AA 2E7XA 1P90A 1GFWB 3C65A 3QSIA 4B8CA 2VQFF 1YJ7A 2APOA 1WKLA 4NLGA 3H20A 4QIGA 2CIMA 5I3QA 4CJPA 4E2FB 3O1LA 4YHHJ 5D77A 1S7HA 2H9ZA 1WEYA 2UUAF 4K8RA 4H5VA 3HFZB 2B7CB 1NNDA 3MM5A 2FLLA 1CLFA 5HMXA 2HZAA 1H73A 4Y3CA 3FFKB 4ZMMA 3AA8A 4K8XA 3EM1A 4WKRA 3DYAB 2DD8S 2VGMA 2DEIA 3DU6A 3S01A 3VAJA 2QMXA 2VQEK 2ASPA 4AL7A 2XEXA 5AXNA 3CF5L 4J9PA 1WEZA 2BYCA 1KQKA 3WQTA 2R7SA 3FMBA 1GTHA 3SDEA 4ZPVR 2BEFA 3DWLA 1B92A 2XTJP 3POTA 4KPCA 3CI5A 4A62A 4LF9K 5FJ4A 3BS9A 2QWLA 3NS6A 1GXLA 3EZWA 3PO5A 3KKSA 4FF2A 1NSAA 4B3TJ 2HRUA 1Y64A 4NYNA 4FJ9A 2HVZA 4CZCA 2EEYA 1NJIO 1BWEA 1FNXH 2HNDA 1WDDA 1D3WA 4X4PA 2O8BB 4ZJOA 5JMVA 1LK7A 2BM0A 1XNRJ 4LFCK 1X9MA 4JN4A 3CETA 4M63C 3A4TA 5GMKa 4FS2A 3AVAA 2R7QA 3WNFA 3DRYA 4ZIVA 1EAYC 2DRAA 4O3QA 2HS3A 3EYZA 3H3NO 3BZQA 3FEXB 3HSDA 3P83D 3U9ZA 5GADP 2XY7A 3QEPA 3AJ1A 2H1YA 4MKBA 4OI0A 3KK3A 2MZ1A 2IS3A 1SC3B 2AIRB 2QI2A 4NXNK 4LREA 3FGUA 4CO5A 1CS4B 4DR2F 1BU6O 2DXFA 1HBUB 1RKIA 5BJRA 1Y10A 4O4RA 2XMKA 2P9IA 3KJNB 3VQCA 5FPDA 3CJKA 4LFAF 2U1AA 4J5OA 4HCBA 4FM1A 2ZWHA 5GAEP 1IKWA 1S97A 2RPIA 2ZOFA 3BF1A 1KR4A 2FBVA 4U8VA 1B99A 2OPPA 3QEWA 4YORA 1DY3A 4OJGA 1O1WA 4UY8O 4EUVA 3AOBA 1JQGA 3M6UA 4DV5J 1YJUA 1TTHB 2UU9F 1WSHA 3IBCB 3DLRA 2D3UA 2F9TA 1KVAA 4C1NK 1RQ0A 2MHNA 4Z37A 1OH7A 4WCEL 3IRXB 4OPAA 3KWGA 3EMTA 1E6YB 3ZXWA 1ZOTA 4IYQA 4BR9A 2Y8WA 5E3QA 3X1LB 3CJ8A 1CC7A 3CQYA 3OS0A 2MJNA 4ZHRB 1ZH5A 2ASLA 1XWLA 2JJ4D 1X8DA 3SCJE 4WFXA 2EG2A 3THVA 2YKNA 1IVZA 3CJ0A 4GKJF 2FYXA 5HQLA 1RAGB 3IR5B 4B1WB 1SV5A 1LWFB 4X66J 2M7SA 2FGOA 1S48A 4PWDA 2GHVC 3O1BA 4EHUA 4DPYA 4JI7K 3UR0A 4Y2IA 2VV5A 2IVPA 2UXCF 4HHUA 1KDNA 3NF9A 1K73T 3PYGA 1YTYA 3PX6A 4Z94A 1H38A 3MEDA 4ZVFA 2QN6B 3PIPL 5KPZA 3J7YP 2AGOA 3D6MB 3EDQB 4FNHA 5G0RA 4TYBA 4CBWA 1NDPA 3CXCM 4E89A 1NUEA 1MN9A 4NWBA 3H5UA 2J9CA 4J37A 3HULA 2WUSA 5HAOA 3CJQA 4JKCA 3CPWR 3WC0A 3CCES 4HLBA 4AHUA 3H1VX 4BQLA 3SIPB 4W4MA 4B3MK 1CJTA 1V3RA 2LQJA 1VRTA 3L09A 4Z4CA 1VQMS 4EEYA 1D0EA 2WVFA 1KSPA 3D1HA 5ETRA 4CBUA 3MM9A 3CD0A 3S8SA 2HNYA 2PA8D 1C0UB 3T41A 5IWAF 2GVZB 1D9DA 4JKHA 3VQTA 1JNZB 1SI9A 4M5IA 2V4RA 1IJJA 1OO0B 1RT2A 3P96A 1KQGB 2AJ0A 2P6TA 4JI5F 2K8GA 1DQ8A 2HSEB 1RACB 2HEKA 2NRHA 3FQKA 2VQFK 1JLCB 1IG8A 4DI6A 4DUYF 3V1RA 3CDEA 2JZ5A 2IM3A 4Y34A 1S77D 3OHRA 1AFJA 4AF1A 1IG9A 2QA4S 2CPEA 3SPZA 2UUAK 1VK3A 4DU3A 2XQCA 1WAJA 1Q8LA 2PFDA 4EYHB 8AT1B 4DB3A 3PIOL 3BGUA 4MIWA 4ALZA 4CVNE 4FPIA 1N36F 4DV3F 1NGEA 3V6HA 4JEPA 1JKHA 4ID5A 2EI5A 4E19A 4DMZA 1R43A 3OL7A 4NZ6A 4TQRA 4AL5A 1AXQA 5C25B 2CA9A 2QEXN 4M3ZA 5JLFA 2Q97A 4CF9A 1MMLA 1RYSA 1R0CB 2L9WA 1QZ5A 4KTQA 3VZHA 3B82A 4OGCA 3KLFB 2Y0SD 2HPUA 1Y0HA 1KBRA 4F4AA 1I94J 2NLXA 2G8WA 4WBFA 2R2RA 4BR7A 1WHWA 4M5GA 1XTZA 1ZBFA 1N5YB 5HI7A 4HWIA 2XLIA 4CLKA 4TKTA 3N0VA 1XK8A 2EBGA 2BV3A 3CJ7A 2HGLA 4DU4A 5J1EB 4WU2A 4OJRA 1HLWA 3LANA 3R3TA 4ZJQA 2FIUA 4JYAK 2KU7A 1F9HA 4M5JA 2L41A 1RK8A 2FHJA 4IKAA 1KEKA 2V4JB 3O9SA 4BRNA 3OVSA 1I39A 3FRYA 3D2WA 3JQMA 3TWZA 2Z2YB 3H2UB 3GIJA 4O3PA 4USUA 2CH6A 4M3TA 1PILA 1NRKA 1HL6A 3LAKA 1P27B 3M2VA 4DOZA 1X31C 3MF5A 1IWAA 4NLSA 4A57A 2JRSA 3O6QA 3SQGB 3BKUA 3UDVA 1NZAA 4IOCQ 1PGZA 3CO9A 4DR2K 4ID8A 5DG9A 3GV7B 2O01C 1DLOA 1S1VA 1A9NB 5ETVA 2UXBJ 4DV1J 2XULA 5AQZA 3NH0A 3RUBL 3J81Y 2K1RB 4YOTA 1TMJA 3AY0A 1NSKL 4LFAK 5IOLA 5KI6A 2IDEA 1NNEA 1X4BA 2EFNA 1QAIA 3M8YA 4YS2A 4JI6F 4YOXA 2E29A 2MQ8A 1YWXA 3NG8A 1QQMA 4WK1A 3UN2A 2CYYA 1NU0A 1QSYA 4MIAA 4M7XA 5FROA 4S0MA 1X4EA 4A48A 2E5IA 1TL7B 4PG6A 1G3OA 2VBYA 5F9LA 4PEOA 4OGEA 1K1QA 3CC7N 2WVCA 2UU9K 4DV6F 2JWKA 1YLXA 2KW4A 2PFFB 1CJUA 4OYZA 4L74A 3CD6S 3GTYX 3ET6B 3QFUA 3B8AX 1PJ6A 4DPUA 3C66A 2ZGZA 3FZBA 3Q2SC 3H7HB 2BGGA 3DOMA 1N5VA 5FDLA 2MTLA 3JS9A 4X62F 3HSJA 2DR5A 2QW9A 2ZD1B 1OYEA 4C23A 4CJ3A 3BR9A 3EX7B 4ZP8A 2W2OP 4FJNA 4JAXA 3MXMA 3V6DA 3P49B 4F04B 2OMLA 4URSA 3MFHA 4DTRA 2ZJRL 3RMCA 1EIYB 4QR1A 2F63A 2KM8B 1VRUB 3PY8A 4GKJK 1T8EA 2A42A 4DR4F 2E5LF 4IFVA 4BRQA 4ANDA 5M2PA 3FE1A 1NSPA 2XYPB 2MKKA 4DR7F 1X0PA 2LDYA 3ISZA 3T1AA 3WHIA 2VIHA 1M1KT 3DNCA 2FLPA 3KG1A 1C2PA 6FDRA 3L7OA 3VAHA 1Q78A 3CFOA 3OR2A 3JTOA 2UUCJ 4FWKA 3Q8PB 1JK9B 4BACA 3W64A 2HHTA 1RLDA 2KFYA 3ILOA 2R8IA 3OL6A 2XCAA 1BY9A 1X5OA 4MAKA 3AGKA 1KQSM 3R1HA 4AHSA 3FEYB 3K0SA 3MEKA 2F5GA 4WQ4C 1FA0A 1WG4A 2Q6CA 1VAZA 3OYFA 3IMXA 2NRWA 4FPRA 2DTUA 1Y5IB 4J9NA 1LWCB 4OYMA 1RHJB 4C8ZA 4ZPWR 3CCUS 5B0AA 4DXLA 1YVNA 1P1LA 3UKUA 3GCXP 3CJAA 2BJDA 2FC8A 5IM0B 2XB2D 2YI1A 4KGVB 5BREA 4R5PA 2FF6A 4ZPDA 1IBMJ 3GE9A 2VOPA 5AQFA 1FEHA 1E6VA 2H51B 3FBFA 2CQDA 1KKHA 4CM2A 5IWAK 2CJ9A 3J80Y 4DR5F 4QIWD 1A6LA 4HTUA 3NGSA 4BR4A 4IR9A 3RMBA 3DAWA 2XS7A 5L1IA 5E84A 4KAZA 4KHNA 3D67A 4JI5K 3NDKA 2XG8A 2G1HA 2PEBA 5KFJA 2A10A 4CF8A 5ETQA 2KXFA 3IAM9 4DUYK 1LFWA 1MMNA 5KG6A 3THXB 3K5LA 2KYXA 4FCYA 4UT4A 1ATSA 3H40A 1UVMA 5T7BA 4ED6A 2KHCA 3QWUA 4FZYA 2F4VK 2DKOB 1S6QB 2R7WA 3UD5A 1VI7A 3NAEA 4R79A 2CNOB 4R8UB 4K59A 4N56A 2RD5C 4ITSA 1KVKA 2SXLA 5BYSA 2CPFA 3FBCA 4MMOA 2FJDB 3OXGA 3M7VA 1YUWA 4O3OA 1N36K 2QTDA 2YNIB 4DV3K 3VV2B 3IGNA 3HHLA 2IIRA 1TUYA 1H1VA 2PN6A 1C0MA 1IO2A 1VBZA 5AR0A 2ZH2A 3VGKA 3QRRA 1DQ9A 2A1RA 4NMXA 3ZFVA 2WONB 2O8FB 4DR3F 4BRLA 5LSOA 3TABA 4FOIA 1GXTA 3W2VB 1QAXA 3ZZYA 3D2EB 5DGBA 1LW2B 3SI8A 4PL7A 4TYAA 2M2BA 1SJQA 2H65B 4A5BA 2E1YA 2A6AA 2U2FA 3I5AA 2JSXA 3GCWP 1HPZB 3HPGA 3VHQA 5BXIA 3ZEUB 4D3HA 1HWJA 2EFPA 5EY4A 3US5A 4UF4A 1JJ2R 1X9JA 2B5JB 4YP3A 3MXIA 1OQ6A 3ENOA 1T0TV 2V67A 1BC6A 1WSFA 2R2TA 1TKTB 5KG3A 3CERA 3P38A 4ED5A 1ZBUA 2CUYA 4W5QA 2LQBA 3BN4A 2GX9A 2ZH5A 1CQNA 1W2BR 2PGCA 4J7CA 2XY8A 4JI2F 1NKBA 2RE2A 3P5JA 3WUHA 1URRA 5J2QB 3FCVA 4RNNA 3SAHA 1U1PA 2ZH6A 2OPQA 3UCZP 4JI6K 4IUFA 1IKVB 1JJ4A 3M32B 1FJEB 3FFIA 1BCOA 3C16B 1ZZFA 4RNHA 3HVTB 2BZ2A 1IKYB 2BACA 2E66A 3L7PA 2XHBA 4CI0B 1N5SA 1RHRB 3HSZA 3SSQA 2ZNZA 2OD4A 2GQ2A 3KHLA 5HVHA 2H5EA 2MGZB 2BX6A 4DV6K 1PG5B 2RRNA 5L38A 4FJIA 3OR1B 5K8MA 1CULB 5KFIA 1XR5A 1M1GA 4KHYA 3EZUA 4AYBD 3CB4A 3DN9A 3CIPA 4AM7A 5KT3A 1VLYA 3PX0A 4FLYA 1FT8A 1KCFA 4B3OA 3TA0A 5HMYA 4Y1DA 1CJVA 3C15B 1U2VB 4CJ5A 1NGIA 3OTOJ 4KIAA 1SH2A 3AA3A 1T6CA 4DUZK 2Q0RA 1ATRA 1EKRA 2ZH1A 4YNQA 3IN5A 1U1KA 3TUIC 3NMAA 3GIRA 2XWXA 2JH3A 3TX0A 2E5LK 4NYPA 4AQYJ 5BR8F 3PJ9A 4QYZK 5FPEA 2XSJA 2W24A 4DR7K 3HHNB 2UUBJ 3P1GA 4MK7A 5DQHA 3K17A 3ZSXA 4I2PA 3IRWP 4F4KA 3CCEN 2D3ZA 1NJXA 1U0SA 4K0KF 1S1TB 1X0FA 1RI7A 3AXMA 2NS1B 1I51B 2ZBRA 4DLGA 2WTUA 3MAAA 4ISEA 1HQEB 1D8ZA 1VQMN 2M5YA 4HACB 2BVZA 3V2UC 5CA5A 4N77A 3B54A 1U1LA 2P9PA 4RUAA 1KD1T 4IG0A 3JYTA 4CEOA 4X66F 3OVNA 2P2CB 3ETOA 4B3RF 4NE9C 2HG4A 1S1XB 3ZX2A 1FJGJ 3BDEA 3D68A 3TUZC 3L4QA 3CD7A 2YNFA 3DLJA 5BPMA 2FXUA 3F5TA 3D0IE 3C19A 5HANA 4AILC 3OS1A 2E1CA 3IMQJ 1VQKS 5E41A 2MQMA 5F3TA 4DQPA 2MKSA 1CZBA 4DR5K 1GOBA 1FX2A 3CMAS 2F65A 3OXFA 4FPBA 3HHKA 4ENOA 2OPRB 1CSJA 3T6BA 3OSPA 2QA4N 1U1MA 2R7YA 3QESA 4P74A 2BTFA 2Q3SA 3QB0A 4YY3K 2AP6A 3VF2A 4CCHA 3DGPB 4M3XA 2QX0A 3PRBA 1JLBA 5LMNJ 4CJTA 3QYYA 3L2VA 2DT9A 4JP8A 4MKAA 5AQKA 2C42A 2PFUA 1B9DA 4UOCA 2D5RA 2QC3A 4P7VA 5T7LA 2DHSA 1D09B 2CG8A 1YGYA 3IS9A 1MLAA 1Y97A 2MKHA 2HSTA 4YOYA 3L3CA 3PKYA 1VSHA 2F7TA 4PR6A 4DL6A 3EN9A 3QQCD 4HTLA 5EHHA 1S49A 1M90O 3LL3A 4CJVA 3NCRA 1JCEA 2XMMA 7FD1A 3VQ9A 2NRZA 2B6AA 1DBDA 4QCLA 4UQTA 5KG0A 4DTNA 1M1KO 3HZEA 4AT1B 1KTVA 1M5OC 5CXTA 1TMMA 1ZBHA 5M1NA 2F8MA 3DYAA 1XBWA 3KXDA 5C7PA 2MPUA 3LPYA 1IBKF 3ZTQA 4DR3K 1FXRA 1HNIA 2MLXA 2RDDA 2VPWB 3I0SB 5I42B 3GR1A 3L2QA 2OLWA 3CJ5A 4PL8A 2WRMA 2GTDA 3IG1A 2HLUA 5ETKA 1NKEA 4XIUA 3JSMB 2W42A 3A3PB 1R59O 2HQFA 4PPDA 5F0UA 5H1SQ 4B17A 4OLPA 1SUQB 1WNEA 3QIDA 4CHPA 1U24A 1T6DA 4UTGA 4X4SA 3I0RA 4BDPA 2OPSA 4Q0BB 2O8BA 3KKRA 1JJCB 4I67A 1I94F 3P3DA 2HWHA 1DKGD 5EOYA 3HT3A 5B7WA 3A3NB 2MJUA 4B9LA 4JV1A 1SAZA 3ENVA 4FYXB 3VEYA 2VYPA 1S57A 3TZYA 3EE3A 4DU8A 4ES1A 2WBRA 4JI2K 2Q36A 2HK3A 2E8AA 3UB5A 1HHQA 1U09A 1HR0J 2W01A 4A2AA 4O5BA 4WQ5A 1SC6A 3QBXA 1EQMA 1IM4A 1J54A 3SZ2A 4XH5A 2V9KA 3B6BA 1G7CB 1JL2A 2BE2B 2R2UA 4YN3B 2KTQA 3LALA 1SQGA 4I9LA 1JXLA 4ZVSB 2QSWA 5HVFA 4HVZA 3CD6N 5EX3A 1RXOB 4OHXA 1UTAA 4C2MA 3AA4A 1FXLA 2IVYA 4F3OA 2AX0A 5KFQA 5B08A 4PG4A 4KFBB 3VQQA 2X3DA 2JLEA 2V2QA 2ZH4A 5DLGA 4TY9A 1RZMA 2M52A 3M2UA 3DXSX 2ZHBA 3FK4A 3EGNA 4DV1F 4XH1A 3TAEA 4HYKA 2J0WA 4EBDA 3W9JA 3NCIA 5LL6d 4ECXA 3LWLA 1EP4B 4J9QA 2MHEA 3R97A 3ZCMA 4Y0FA 4X64J 1HYVA 4DV2F 2BANA 3M9OB 3AA5X 3DHXA 4XK8C 2O8DB 3UNYA 2O3DA 5IC6B 5JMNA 2CPJA 3KIOA 3UWTA 4QR2A 4IBNA 2Q3PA 3SK3A 1E6YA 2VFSA 1T9XA 2Q1LA 2LEAA 4J9LA 4IFEA 3CJ9A 4FJXA 1ZTTA 2COLA 3L6QA 8RUCA 2W4CA 2QM1A 1GXUA 5A2QY 3S3OA 1JXBA 1RBOB 1FTRA 4U7CA 2BW2A 4KHQA 2MZQA 4PWWA 2X78A 4K0KK 3CCUN 4N47A 5AQUA 1KP6A 3BKFA 4IRKA 1UVJA 4ECYA 1Q81T 3SQ1A 3VGVA 4GRSA 1U02A 4DQRA 4DL3A 2C1EB 3NGYA 3BQ2A 4X66K 1M5SA 2MQOA 5BRFA 2YJEA 2HWTA 4KSEB 1EZZB 1IJFB 4E7HA 3NAIA 1EHWA 5HATA 4XEIA 3FZKA 3D6FB 1FRLA 1SS6A 5IT0A 3C0BA 4DHVA 4QS7A 1XIQA 3MR6A 3QERA 2I5JB 1ZA1B 2LKZA 4CEEA 3VQ7A 3CQXA 4USTA 2LQ5A 4WE1B 2YWEA 4KAIA 4B9QA 2R7RA 3BKTA 3OHBA 4USVA 2LQ9A 4LBIA 2QWPA 1F1BB 4WZMA 4CEZA 3PO4A 4IQMA 5DLFA 2GS8A 4OKKA 5J1NA 1RBAA 3LZIA 3KUGA 1HW9A 1JLFA 4JV5J 3M5RA 1FEEA 4HEA9 4MFBB 4EMDA 4F4XA 1B0TA 1FD8A 3AVNA 1V9OA 3VZIA 3WX4A 2GVZA 3OW2R 4MDBA 2Z8QA 5EUHA 3RMAA 4MJKA 2W9CB 3Q24A 4M3YA 1TVRB 3JSYA 1UWBA 1SKUB 3W8GA 1SC1B 4M1KA 1JLCA 2HHHF 1JXVA 2G2OA 3SV3A 3TW0A 3O9UA 1OY9A 4IRDA 4LR7A 2CQ1A 1ZBLA 3PCOB 1N33F 4NEZA 3KFWX 4A8YA 4WF9Q 1VQ8S 4OL8A 3J7AN 4HTIA 4I7FB 3ADAC 3ZZTA 2VPZB 5HBMB 5FPNA 1XHZA 2H4YB 3EWGA 4O44A 3Q22A 2OKQA 4BBYA 4IOCL 4KI6A 1IBKK 3MHYA 1TL3A 3RJMB 2CZVC 2LU2A 3BGRB 4B9MA 3WX8A 2J9DA 4DV7J 5EVZA 4K4VA 1HI0P 4KH6A 3WXJA 4WFNL 2BMBA 3SCIE 2YVSA 2ZVIA 2MQLA 3AQPA 1RCHA 1W9HA 2HFVA 1RTIA 1Z26A 3TVYA 4GV9A 4ZLLA 3NBPB 2VL1A 5KG7A 3LP2A 4U7UK 2KJWA 1N5YA 3D7EO 1RABB 1RU2A 2YWGA 4UQGA 2QIFA 2HAFA 5JUMA 1FWPA 1HNWF 4RU9A 4DUTA 1I94K 1HNXJ 3AB2B 1U2CA 4QWBA 2IM0A 3SBGA 3ZT0A 2QLBB 3TRGA 2V7ZA 1VDHA 1J5EJ 5HOOA 3SQ2A 3K0JA 2B8QA 1RB0A 2HVEA 3IGVA 5FD1A 2DR9A 1YBTA 3CDAA 2XS5A 4DTSA 1HBMB 2R7XA 2H4WB 3E9OA 2LMIA 3KJQB 2E2QA 4DS5A 3WXLA 1BQMB 1EARA 4OZ5A 2FVPA 4JI1F 1Q95G 3DXKB 3GG0A 4EIAA 3O44A 2CQ3A 1BA0A 5GAHP 4FJLA 2IRYA 3G10A 3K8VA 2CJKA 1B0PA 4JS4A 1ZTWA 4NASA 4N5SA 2KHDA 5SZTA 1PAEX 4FJMA 4M5KA 3MCMA 2HQIA 3ZSOA 4Z4IA 4M63A 2HVIA 2YPYA 3W62A 4H03B 4YMEA 1H7WA 3OHAA 1Q82T 3M1VB 1U2RA 3A5OC 4PYDA 1GLDG 2QL5B 3IWXA 3CCSS 4DV1K 2XZTB 4NEYA 3OYMA 1VHIA 1TL7A 3Q8VA 1X3NA 4TSXA 5F3ZA 1BI4A 3LDNA 4DV2K 4OHWA 2XMTA 3HHLD 3WC2A 1QAJA 3M30B 1HW8A 3Q7CA 4B1UB 2DGTA 1ZAWA 3OVBA 4M5HA 5AZJA 4M5MA 1GEHA 3PW5A 2LU1A 3MM5B 3MK6A 4MLHA 3QT6A 3UD3P 1WHYA 2ZD1A 2XCPA 3K2YA 1FKOB 4K4UA 2EBEA 2KXHA 4M41A 2C2OB 3UE5A 4M94A 5KFCA 4RNFA 1YITS 1XHXA 4J8FA 1EB0A 5B0FA 4N41A 3P39A 1VRUA 4NB4A 2MSSA 1NM1A 2XYHB 3FGVA 4KKOA 3SDEB 2YCHA 3MEGA 3POTB 4P7TA 4I6AA 1OSCA 3NVKA 4G6VB 2HBKA 2A3ZA 4F0KA 1GMWD 5RUBA 3MN7A 1GK8A 3ZT3A 3KK1A 1KXPA 2GC8A 1AYEA 4WU3A 2NPFA 1VQKN 4E3SA 1TKXA 3I87A 2IRUA 3EZOA 3CMAN 2Z2ZA 2XWYA 2A6OA 1B3TA 3I5CA 5H9FK 4OVLA 3T5LA 2BQ3A 2HHXA 1LWCA 4TN2A 1GNKA 3GL1A 1GOCA 2C3PA 1FXDA 2MY7A 1D9FA 4RUBA 2W25A 2E5GA 5IM0A 1R3NA 3BUZB 2L9DA 1DQAA 5KFAA 1VQOS 1HKAA 2G1DA 3V4IB 3MUMP 3KK3B 2V51B 2DVIA 4DSFA 4PUOA 2E1PA 1TYQB 7FDRA 1N0VC 4H8KA 3MOJB 3E3XA 2KKZA 1S4FA 3HOSA 4M3RA 5DDOC 3VVUA 1RT7B 1O13A 5CZVA 1F2HA 3TAFA 4L76A 1RA7A 4J2BA 3NF7A 3IA0A 3QNWB 2HHHK 1YRUA 2FHMA 3JTNA 1JLEA 1WORA 4H4MB 1U6ZA 5DRKA 4Z4GA 1MROA 3PEHA 3V9XA 3R9LA 2XM3A 1GT8A 1N33K 3LUYA 4PY5A 1HYZA 4ES2A 1I6JA 1DEJA 5K14B 2QSFA 3H5XA 3OYGA 1N52B 4OX9J 4FK0A 3O4WA 2RS2A 4F26A 1MMDA 3GSIA 5JVHQ 3EE8A 4FJ5A 2C3YA 4CH7A 3A8KA 3N5FA 4EYIB 3K9KA 1UZDA 3MMAA 3MR5A 2M4MA 3AO5A 3VETA 2RUGA 3F0NA 1JLAA 3TUJC 4ZPCA 3GYXB 2XO7A 4AHVA 3R8YA 3OTCA 2Z2LA 4C9DA 2YKNB 2BUNA 4WKYA 1ITGA 2WONA 2EC2A 4DL2A 1HYSA 1OVQA 3A2FA 1TQLA 1SV5B 4PWDB 4GO5X 1VSFA 1WF1A 1HQUA 3D2EA 3WZ0A 2MZTA 3CSKA 4YB7A 2YWFA 5B0DA 1HNWK 1NK8A 3MEDB 3AH6A 3CM5A 1VQLS 2XGQA 2VDIA 5TKYA 4ICLB 4F02A 4ZVUB 4MK8A 4CI6A 1DGKN 1QDUB 2V2KA 3O80A 3PEJA 3FSXA 3WXMB 2HBLA 3P8BB 1YZ7A 3G8SA 1W7AA 2A3JA 4X4TA 1WACA 1HJRA 2GWKA 1MW7A 4F36A 4OZ2A 4FF3A 3BPDA 5LMUF 2XYGB 4LFBF 2GUPA 2ZVSA 1TKTA 4JI1K 1JLGB 3RAQA 3R5BA 1CJTB 2NREA 3I56N 1VRTB 4G1QB 4CZEA 4JKGB 3R27A 2B0GA 4KBIA 4CO0A 1VHFA 1KWMA 4O5FA 4YQWA 3DOLA 2DNGA 4EU0A 1L3SA 2V52B 3MCNA 1ZS6A 5F0XA 2HNYB 3AAPA 1BHNA 4PHTX 4FXDA 5ETLA 4KJIA 5E5NA 2GMHA 2GA7A 3OVAA 3SXLA 4FYDA 5AQPA 1U1NA 4FP9A 2J0SD 5A2QU 1Q1KA 1YHQS 5DM7L 4C8NA 1R89A 2ASJA 2X6NA 3AOAA 3M32A 4YB1P 3U9DA 3PLAA 1AT1B 3E8OA 2X3GA 3DRXA 4E1NA 3I6PA 4F3MA 2CQHA 2ZOMA 5HJXA 1U2FA 1KLNA 3U1MA 1R0BG 2BXJA 2JL9A 4L3NA 5LM7E 3QEXA 4LF8J 9RUBA 3SV4A 1IR0A 4MLEA 1UAWA 4LMZA 2HLTA 1N32F 3L3UA 1P8ZA 3MPDA 4E7KA 2W6LA 2ITMA 2AA4A 2P1JA 3ISNC 3CTRA 4NLYA 4DX8H 4QS8A 1TFYA 1T44A 2YWWA 2RSQA 6FD1A 3C15A 1U2VA 2V8VA 3SCXA 3V1OA 3J7AP 1Z2LA 1X1PA 3CCQS 2CADA 3I4PA 2BJ9A 1JKHB 3OFGA 4ID5B 2KO1A 1WHXA 2QK9A 2LA4A 5KOWA 2UVWA 1EO1A 2O66A 3NCQA 1NHKL 4F9OA 2YHWA 1U1OA 1NWKA 4LR9A 3OTOK 4WIQA 5AE3A 2QWOA 4KHMA 3P4UB 3RAXA 2G0CA 2ABYA 4FVUA 1O51A 4AQYK 5C2GA 4JI4F 2R7TA 4NYOA 1S1UA 4OI3A 4DSIA 1NGAA 2IDLA 1BIUA 2Z56B 1RISA 1DRZA 4PG7A 1FESA 4PPZA 2CAJA 1C0FA 2CKWA 1IQZA 4IJAA 2O5DA 4ILGB 1WC4A 5F2RA 3SFGA 1KC8T 3GFZA 3T1YJ 9ATCB 2ZM6J 2FSJA 4K4WA 3T5HA 1WC6A 1KVCA 2QXFA 2JWLA 4A8XA 2J6UA 2B9XA 1Q0NA 1RAEB 5CYJA 4YOUA 3M2VB 1REGX 1C0TB 1XMOF 4IH6A 3TQEA 3IXQA 3RZAA 4W5NA 4Y2CA 2MY8A 2KG0A 3MX5A 3OYEA 1RGIA 4EGLA 3GONA 1UEVA 4DR1J 1M5PC 1S1VB 1IH7A 4NLWA 5F8NA 3TAMB 1UMJA 1KAYA 4NA3A 2CGLA 1DHMA 2OPRA 5AQXA 3BSNA 3UDEA 1VQ8N 2CVIA 4LRCA 1VIXA 3KMQA 1MWZA 4ZVQB 1MN7A 3NLCA 1ATNA 3E01A 1TU0B 3Q7BA 2XSFA 5AQIA 4DV0J 2D69A 1VC5A 2E9ZA 3SFUA 5C10A 3AFGA 2OYQA 1URNA 1S6UA 3X3UA 2KLAA 1HNVA 4OV1A 3UI3A 1RDCA 5L1LA 5LMNK 3SQOP 4ZLPA 2XMVA 3QLHA 3IDHA 5DM6Q 3GE1A 2ROEA 5DZ7A 4JI8J 1RBSA 3NEKA 4QBUA 5C12A 4NX9A 1R8PA 3NGKA 3R5GA 3NF8A 3TR5A 1HI1A 1Y4ZB 2ZZNA 3NH1A 3TAPA 2CDRB 4HI1A 1APSA 4BRPA 1NGHA 2ZUAA 2I7NA 2DXDA 5IT9U 4EFAC 3HHEA 3GJSB 3KHGA 2F9DA 4PRFA 1VQNS 2CWKA 2CQCA 3RMDA 1YZ6A 1M5HA 4L72B 3U3YA 1REVA 1RT5B 4I69A 5CABA 1WELA 3HF5A 2IYIA 1NLKL 2DHXA 5M2RA 3D0GE 4ZN3A 4CE9A 3PUFA 1ZM2A 3JSMA 2A1SA 2IM2A 3DI6A 3RR8A 3LDLA 2B7BB 4K43A 4LJMA 2AEFA 3VAKA 3LOUA 1TAUA 4OYXA 3O3FA 4I0WA 2WSCC 3W5XA 3C14A 2HMIA 4QS9A 3GB0A 3PM9A 1R7IA 3K5NA 1EX4A 2AGQA 4Q0BA 3KUHA 5LMUK 2ILYA 2XMJA 1UJ5A 2E88A 4GVBA 2A41A 4LFBK 3H0PA 4GO7X 3TI0A 4AM6A 4BG9A 2CPYA 2BKPA 2X1FA 5E3AA 2HGMA 1UZHA 1RAHB 5K9FA 5KFNA 2B4VA 3THTA 1MA9B 5E3PA 1HPMA 3DLGA 1T95A 4R5PB 4ZP9A 2RQ4A 1RAIB 3CIMA 4KGZB 1NJIT 2P9GA 3CCSN 1E6VB 2DBBA 2C3UA 1K1SA 2ZOGA 1WG5A 3LA0A 1RWWB 3ZT2A 2KFZA 4BVOA 4HDGA 1YJVA 4LH5A 2HBZB 4HUFA 2IC3A 4NLTA 3EL2A 1RTDB 1SPBP 1HR0K 1ZBTA 1YJNN 4DR6J 4PKDB 3KYLA 3QO9B 5D3GA 2A1BA 5LSLA 2R7UA 4KY3A 5KT5A 5CCLA 1HWIA 2F3JA 2HHPA 1PYOB 4LRDA 4CHNA 3H5YA 4WZQA 3KDOA 1S0OA 3MEEA 4LF5F 2BJEA 2M8HA 4LF6J 1PSDA 3C95A 4M95A 2CQGA 1NCLA 4C48A 1BMQB 3BPSP 1RU1A 4M42A 3D5MA 4WPAA 3GOIA 2KXNB 4AH9A 1OY6A 3AVLA 2OTJN 4ED1A 2I6WA 1HLUA 1S9FA 5AQRA 3DXBA 1RTJB 1X5PA 3EVOA 2DGVA 1ZZNA 2DNHA 4K5SA 2B51A 5D6GA 2CQ4A 2HHVA 3MM6A 1RCOB 4X64K 4UOHA 2EG1A 1UFLA 2QL7B 1WSIA 3VEOA 4UY8T 5A8KB 1RWXB 2MZJA 4RWWA 1XI1A 4X2BA 3SUNA 2CQIA 2F8EX 4KI4A 5LL6Z 2HRTA 2ASOA 1VQ6S 2VQEF 1C0GA 3ID8A 5G4DA 2VC0A 2QFJA 2YWHA 2ROPA 2GZOA 4JI4K 1S22A 1VSKA 4IG3A 3GSDA 1R0AA 4ZP6A 3CJTA 2P9UA 3ZSYA 2YKOA 2XNQA 1RT1B 3DC2A 1UJ4A 3LGHA 2DRBA 1QVFM 4WF9L 5DJBA 1F6TA 3HJFA 2G2YA 4ZCMA 1T05B 3G6ES 3PFEA 4JKBA 4X84A 3O5TB 4JUZA 1OH6A 2RIJA 3ULEB 3MI7X 4B02A 2GFFA 3AO4A 1Y7PA 3PW7A 4DU1A 4J9VA 3W2WA 2LEBA 4YUDA 1QTNB 3MPUB 1LV5A 2FZGB 4CJRA 1HKCA 4FK4A 2QWRA 2AYBA 3EEQA 4ANEA 3O9TA 4E0DA 3BSAA 4B08A 4UY85 1NB7A 1TK5A 2N7CA 3BYPA 1XNQJ 1VLOA 1RBLA 2VC1A 2Z4PA 5LSRA 5GMDA 2OPQB 3V81A 5K5MA 2KFNA 1Y11A 4F3TA 3H2LA 2NRTA 3EJMA 1BQNA 1S3XA 4MFBA 1QHAA 2PSZA 5L9XA 2HHSA 4L75A 5IXUA 3KMSA 1FK9A 3OL9A 3RSEA 3FFIB 2KT5A 1SXLA 3UPFA 3MMBB 4E1MA 2HWIA 2ZQBA 3EUNA 1F9EB 1RE1B 1HBNA 2DNNA 4IOBA 1CLQA 4FW2A 1BD6A 2VD3A 4J2EA 3QFWA 4G9ZA 2LSNA 5HRNA 2L08A 3A8EA 3HSCA 4A47A 4DTMA 3ZT1A 2L9NA 3QFHA 4F8RA 2E7WA 3BSOA 4CT9A 3DKDA 1YRTA 1OS5A 2XS2A 1V4SA 1B4SA 4B3OB 4CFDA 4UZCA 2CGKA 1WC5A 2HZCA 5HBMA 4K2XA 1FRJA 4OI2A 3GJRB 4JV0A 4XH4A 2DH7A 1R8BA 3HVWA 2HNZB 5D4PA 2GAGC 3IM9A 4BRGA 4CJLA 2XHWA 4WYBA 4X4UA 1ZBSA 4NLRA 1VQLN 3GIIA 3TPQA 2NZCA 2C2DA 2XSJB 2AYGA 4OX9F 4FZXC 2PD1A 1R6VA 3ZETA 2PBDA 1U1RA 4ZP7A 3WEEA 3KNAA 5MLCQ 3LQVA 3G25A 3TOQA 3NRBA 2CJBA 2FVQA 4RW9A 1SIWB 3UIQA 5AXKA 3M8PA 4WFAQ 3ENAA 1NGBA 3CVKA 4NLDA 4KHPJ 3MAAB 2OIHA 3IC1A 1FRMA 4YFUA 2PEHA 2GO8A 3AARA 5F8MA 3BM7A 1BISA 3VR1A 1N34J 3UKRB 5JICA 4IG0B 3JYTB 3A8IA 4DCHA 1EX8A 1VSMA 3DLEA 1FNOA 4KPYA 4FLWA 5JS1A 3QBWA 3BGOP 2BJ3A 4JKAA 3MR2A 2EKNA 2ZJPQ 4CLFA 5A8WA 1QTMA 2HHWA 2IJNA 3T1HJ 3ZSZA 3JAMO 3DU5A 1Q7YO 2EWHA 2IBKA 1YHQN 2YNFB 2JGUA 3V4MA 1SKWA 4IDKB 1IR2A 3OTDA 3R1LA 2VWBA 5AQGA 4CJ7A 1P6TA 3EY1A 4WYWA 4O0IA 3F41A 3PHTA 4IO1A 4OX8A 3OT9A 4CLTA 1FHTA 2Z2MA 4CJQA 2NUUG 1VISA 4P2SA 4BWMA 4CTAA 4EZ6A 2V69A 5C5JA 3Q2TC 2E1RA 3DCAA 4BVPA 3ZO7A 1NEEA 1ULRA 2ADBA 5T41A 3U6FA 2G8IA 5D4LA 1JLBB 4UZBA 3TZZA 1U7LA 1RAOA 3M1VA 5JVGL 4FYWB 4EHTA 3OY9A 2IY5B 4FLTA 4LF5K 1IV0A 1CEZA 1R27B 3CCQN 4YB6A 3NOCA 5KT2A 2HK2A 5T7LB 2L3MA 3V1QA 4K4SA 3IS9B 2DGXA 2AD9A 4LF4F 1FDDA 1OYDA 4ED2A 4K2JA 2V7YA 3KK2A 1CC8A 4BRKA 1F5BA 4BC3A 3M30A 3AA9A 3G82A 2F7VA 4AXIA 4FPAA 3JQJA 2W2MP 3R6GB 3C7NA 2B6AB 4MQ3A 1IR1A 1ROFA 3ZZRA 4LF9J 2WBMA 5KFKA 1MDUB 2P9EA 2UXDJ 5AJ3J 2H5JB 2MEWA 4ZVGA 1Q8BA 2VG6A 1FKOA 1NPRA 5H9EK 1ZBIA 4OZ1A 4KB0A 3H4BA 1HNIB 2DR8A 4LH4A 3MWPA 1FDAA 3MMCA 3O08A 3LW5C 2UV8G 4LFCJ 2XMWA 3MD1A 5C0YA 1QQCA 1IQTA 4J2AA 3IG1B 1TK0A 2Q66A 3W63A 4OJHA 3CHWA 2DHHA 2CZ4A 3E2EA 1TV6A 3BH7B 3R1XA 1WF2A 5HN0A 3TJ9A 3PR5B 2YY3A 1VBKA 4IO8A 4BDYA 2VJVA 1P8GA 1VQSA 3D0HE 4RBUA 3JSBA 2LP4A 2W2NP 3H6EA 6AT1B 5KG5A 2D0AA 3I0RB 4F67A 3ZNUA 5D78A 4A5AA 1A5WA 2OPSB 8ATCB 4W5OA 5KQ8A 5AFUH 4CH1A 3I82A 5JVHL 3I55S 3JSRA 1P9QC 2B4JA 4JYAF 3EGWB 3FSIA 2BA9A 2OSRA 3S1TA 5DETA 1Z05A 4JI0J 3AVMA 3UCGA 1KVJA 1C1BA 2Q43A 1KTQA 5HQMA 4DS4A 4TQSA 4CO3A 2Q1NA 1DAXA 2ZH8A 2M88A 3S7RA 1GLEG 4W90B 4P9SA 5F8JA 4ECUA 3QGPA 3FMWA 2G0IA 3V4IA 4DJBA 1FFWB 5F0WA 4B9SA 4BG8A 2HS4A 2OFHX 1WLJA 3G71N 4B3SF 4U96A 1VR6A 1TYQA 2BQRA 5A6WA 2VASA 2VG7A 3LH2S 3NH2A 2NXEA 2ADCA 1F5AA 1RT6A 3EXCX 1CXQA 2MZSA 4J2DA 3U4LA 3C2PA 1RT7A 3OTEA 5ETPA 3M2UB 2ZWOA 5ELZA 4FJKA 2HF3A 5C15A 3F2KA 4H4MA 1NH8A 4O3NA 3CCLS 1T9TA 2AZ3A 2HHUA 3E1YA 4RG8A 4KO0B 4NCGA 4DCPB 4H0PA 1VQNN 1S9GB 4IRCA 3H3OB 5K14A 4MDAA 3M4XA 1WSVA 4P2FA 2BANB 3C6AA 5AXMA 1L3KA 2VBWA 2BE7D 2YHBA 3D0PA 3SAFA 2A2CA 4O8UA 4JI7J 3VN5A 3UDCA 1X60A 4JI3F 1JNRB 2OANA 1R31A 4URQU 1UVKA 3F56A 1SL2A 3UN3A 2KZZA 1K9MO 4OX9K 3LM2A 1VFJA 3A8YA 1FRIA 3W60A 3LM9A 3H2VE 4N8OA 4FO0A 2WB1D 3QT8A 5EN1A 4Q44A 4JI8F 2FBXA 5L9NA 4HVJA 2VWJA 2BJ8A 3QRPA 4Z4EA 3AO1A 4OIXA 2FJVA 3FZLA 4ELUA 2BE9B 2MMYA 1YF5L 3HBTA 3G0ZA 2W2QP 3D54A 3K58A 2I0XA 1OIAA 2P9KA 2V9WA 1S7IA 2VFVA 2C2MB 4B3MJ 3NXZA 4NCAA 3LAMA 1DTTA 1KS2A 1BL3A 2LVWA 2O8CA 3BSCA 2R7OA 3QZ8A 4X4OA 3CPWM 4ICLA 3KHHA 3A1YG 3R3LA 5AQOA 1RLCL 3CE8A 1L3VA 4F2SA 1VHXA 4LRFA 1KHVA 4M7YA 1WSRA 1IUJA 1VGYA 2DTJA 1S59A 3JAMU 1SJ3P 4C3KA 1ZYQA 3K9JA 1JLGA 2WAQD 5HL7Q 1NXIA 3BR8A 3QEIA 2OCEA 2YTCA 4G1QA 3KOAA 4H4KC 4JOUA 1UETA 4JKGA 5KFDA 2VQFJ 4CJSA 2PZSA 1SCJB 4RUHA 5E33A 1T9YA 5DS7A 5KFXA 2IM1A 4USKA 1QS4A 1WSGA 1NU4A 2NR0A 1C4AA 1JLFB 4LVOP 2UUAJ 2R8JA 1K8AT 1NK4A 2LECA 2GCFA 3WIUA 3WIVA 4A8SA 3H46O 4MTPA 1LAVA 3FEZA 4X65F 3MR3A 1S0NA 3Q83A 1U26A 1KFSA 5C2FA 4KC5A 1UWBB 4YR0A 4RCHA 5A76A 3VOVA 2N4CA 4LF4K 1S72S 1U47A 1SIZA 1GLCG 4IH5A 5AQSA 2YKPA 3D28A 2DJWA 1BQXA 2DNQA 1LOTB 2VU5A 3QINA 2F4VF 3DMJA 1CQMA 3UVJB 1SJ4P 3TSQA 3UR3C 1J27A 3FQLA 2NXCA 1VQ6N 1UFKA 3SBMA 4KYZA 4OQJA 1Q5VA 2FJBB 3A8JA 5KPRA 4O44B 2BH1A 4LF8K 2V8DA 4ELVA 3OLAA 4GC7A 4GMJB 2HQ3A 1TL3B 4PQUA 3AO2A 3HRGA 2A2DA 3CC4S 3NKYA 1VMBA 1RP5A 4DFKA 1ASWA 4IOXA 4RO0A 4G65A 2G13A 5AQHA 3TYTA 3ENBA 2P9SA 4CERA 2AJ1A 4ECZA 5DDRC 2RDIA 3G6EN 1TFWA 4ECWA 1RTIB 5GAGI 3M8QA 5DZ6A 1SJ1A 2DR7A 2EFGA 4CJUA 5T14A 1JL1A 3MTKA 4FKXA 3LP2B 4FSVA 5I3UA 4HKQA 3AVCA 2ZITA 3THWA 5DM6L 2V94A 2VWKA 2J7UA 2J7WA 3F44A 3UN5A 1N8RO 2AF6A 3K89A 4DR2J 2VH7A 2RB7A 4DPXA 1Y9OA 4NLVA 4WP9A 4E98A 2ZJQQ 2B9EA 2VODA 3I4HX 1YK9A 5AQMA 2FVRA 1S0MA 3QJLA 2FVSA 3D3CJ 3T6JA 5ETMA 3DGVA 3PIOQ 3VPZA 2DIUA 2GJFA 5J2PA 4DDFA 1FERA 3O4NA 2FUG9 3KLHA 1MWMA 1VSLA 3K8WA 4ISFA 1C0TA 3D6TB 3GILA 2E2NA 4KHWA 4HHJA 4ILLA 4B3SK 1FJ7A 2J6SA 2E2OA 2UU9J 2WSFC 1UL3A 3TAMA 3QSYB 2B9YA 1LEOA 1LWXA 4J9MA 1WN7A 4G1PA 3PW4A 3RB4A 2YNGB 4F2RA 3MPVA 4DR1K 2DIVA 1ZPVA 2IYGA 5BR9A 1TL1A 4CK2A 1VQ9S 1HKGA 2CNLB 1ASVA 2HRYA 2QFIA 2QL9B 1UFWA 3FRZA 1UCNA 1BI4B 2LA6A 3TEGA 4GKJJ 3GYGA 3PKMA 2J7KA 3LZJA 5A6PA 5FLXY 4OYAA 1HHTP 3HM8A 4HUEA 2FSKA 2OO4A 1QY7A 2DCLA 2V2ZA 5AZJB 2VFRA 2UXCJ 4JI3K 3SMPA 3BV8A 3NNHA 4OPJA 3EKSA 4O0JA 1RDUA 3Q8UA 3T9NA 1UWAA 4I1TA 3WNEA 1FRXA 4KB7A 3AVHA 2JC0A 2ZZMA 4DMNA 4JI8K 4TU7A 4DUZF 2G4BA 1M90T 1JB0C 2ZNYA 1AUDA 4JK9A 4KKOB 1M5VC 1RT5A 4FF1A 4DPTA 5HROB 2OP5A 3MM7B 3MEGB 4I6MB 4ANCA 3CCMN 2QLWA 2FLNA 3MM8B 1FRKA 3GG4A 4BE1A 2HW3A 3LDPA 5CYMA 1T03B 4CZGA 4DPWA 2IA6A 1JWWA 2UVUA 4FJ7A 3W66A 3KK1B 3BEGB 1Q18A 2R2SA 1TKXB 3P5BP 4ZDNA 2N3OA 5IWAJ 4DX5A 1GMVA 5C42A 4DHYA 3N4WA 2XMAA 4QW9A 4F4WA 3VTIA 1K6YA 2J9DE 3OTBA 1WEXA 2RVJA 1FW6A 2QYCA 4J9OA 2W7OA 3CYMA 4JI5J 2R8GA 2HBQB 1WOQA 4GMKA 2GAHC 2LDIA 4KTZA 1IBLF 2GWJA 2B56A 5BPLA 3QIOA 4DUYJ 1OSDA 5EWFA 4DV4F 1OQ3A 4WJBA 2ZJRQ 2IJFA 3KHRA 3I8BA 2F8HA 3HX9A 4PUOB 3CEDA 4PWUA 3H08A 2IAJB 2NYIA 3N28A 4LF7F 1Y5NB 3ETMA 2HS0A 4BHQA 3AY9A 3FC9A 2DNRA 4X65K 1RTDA 1X4HA 3F9KA 2B43A 4A4JA 2KJVA 4C0OC 3CWJA 3NGZA 4ED7A 1XMQF 4WK3A 1C1AA 3QO9A 4B1XB 4O23A 4YY3F 4BWJA 4C8OA 4DV3J 1JLEB 1U49A 2YWKA 3D66A 5LJVA 1MROB 4F25A 1TL5A 4L73A 1D1UA 4OI1A 3PRVA 3MCAB 3DDNA 1Q86O 4OPKA 1BCMA 2Z1GA 3WXIA 3ATUA 1N48A 3G9CA 4Y28C 2DY1A 4NOHA 1SH0A 1XC9A 2W7PA 4PZVA 2BQUA 2P5VA 2NZTA 4TU8A 3ZX3A 5K8OA 2AYMA 1WI6A 2MB0B 2OI2A 2DR6A 2Y1JA 1RTJA 2IMOA 1FTCA 2D74B 2YHAA 2FY8A 3MMAB 4CLWA 5DG7A 5HLFA 2CPZA 5ETNA 4OHVA 3KWIA 1JLAB 3MCPA 3EVMA 1BXNA 1EWQA 4V19X 4ERDA 1KVBA 5EU7A 5A8KA 4CIFA 4YHHF 1TL4A 3RBZA 5HO4A 1Q9YA 2PY5A 2QMUB 1HYSB 3OV7A 4JBCA 1SQKA 2IVMA 4NLXA 1S5JA 1SL1A 3I55N 4CFBA 4GW6A 1HQUB 4YB5A 5AJ3F 3HPOA 2CPDA 3I8DA 3S6EA 2RRAA 3H1QA 2QEXS 4CZJA 4CD3A 4UUWA 3SUQA 1U6BA 3BO2A 2GVDA 4KH5A 3J81O 1RT1A 1F2GA 1JJ2M 1KHWA 3MXHP 3QWPA 4AL6A 5KFBA 1UAXA 4JK7A 2H5IB 5F8HA 4NLCA 4C97A 3O2IA 4I68A 1YG0A 2R8KA 3I9ZA 4KQZA 2YNHB 4FKYA 2E9RX 1T05A 2RHSB 2KDOA 1CBKA 2M3DA 1W2BM 2DGWA 4O55A 3OJSA 2QLJB 2QA4G 3D7SB 3IUCA 4NI2A 4FLXA 3NOGA 1QZ6A 4JI6J 2HBMA 3NVMA 3ULEA 4ZK7M 2CH5A 1E3MA 5D4OA 1K8AO 4B3TF 1Q4RA 3R5DA 3CO0P 1NLVA 4M3WA 3OFEA 4B1VA 1SC4B 3N79A 3ONQA 1YDLA 4HHTA 1UPMB 4IO9Q 3DOLB 1GLLO 1XNRF 3CNQP 4HI2A 5GVQA 1LCUA 2A5XA 4O4GA 3H25A 3VAFA 3CCLN 3AD7C 2IHR1 1S12A 3OJUA 2P5GA 4LBHA 3HFVA 4LSLA 5CZXA 5B0BA 2KRRA 2FTRA 2DHAA 1TGOA 2QV6A 4WFAL 4PA1A 3L2RA 1NMEB 2BJ7A 2BUPA 1QUPA 4X62J 4CNYA 1YIJS 3WNGA 4P10A 3BDPA 3CGIA 2DFFA 3MMBA 2GJ2A 4IEEA 4G3IA 4BS2A 3IWLA 2RT3A 1HNZJ 1U45A 1K8KA 3DFEA 1NDCA 1S99A 2F8TA 3DLHA 1FFSB 4LRAA 5KFFA 2MXYA 4DR4J 2HB5A 2E5LJ 4KTWA 2JFKA 2M70A 3Q89A 4F4YA 4QYZJ 4WYLA 4CZMA 3JTPA 2QZ8A 4DR7J 4K50A 4ZCLA 4EZ9A 4NLPA 4ZN1A 4E7JA 2G9OA 3A3OB 2OAUA 3DLLQ 1RBTA 3DXMA 1IKXB 1H3DA 4DTOA 1F60B 3A13A 2RILA 4DL7A 4CIOA 2JC1A 5AQNA 1RGVA 5KFRA 4EI2A 2VOOA 4E7IA 2DHGA 2NYHA 4P73A 1Q7LB 4CIEA 3GP9A 1OVYA 3VESA 2HNZA 4ECSA 1AA1B 3FDSA 1NK9A 5E7OB 4DV5F 3RB6A 2GUIA 3HFKA 4CK3A 3VQEA 1H2UX 3DRSA 3B6OA 3K7RA 1RHKB 1MWQA 1GLAG 2YKAA 4RBVA 2CQBA 5DK5A 5CD4A 5AQTA 2HFNA 4LBPA 5DO2A 3WXKA 2ZBCA 3NGTA 3H5SA 3QAEA 4H5NA 2Z58B 3R6MA 2PT0A 2IPOB 2XNRA 4MKYA 3THYA 1XR7A 1S1UB 2AGPA 2ZUGA 2EC0A 3TTCA 2HF4A 4DFJA 4DFMA 3TEHB 3S3MA 3CCJS 4YDDB 5EXWA 5D0GA 2GO9A 3OYCA 3AJ2A 3UKRA 5BRDA 1EETB 4LIWA 2XMUA 1J5OB 3TVKA 4ZLNA 1HWKA 5I9EB 4N7TA 3VTHA 1VJWA 3HO1A 5AQYA 4FL9A 4GV3A 1AB8A 1N54B 1QVGM 4ILHA 5KFUA 2KL8A 5GAHI 1PO6A 1IBLK 3U27A 2E44A 3EPIA 3BB5A 2QWNA 1Y3KA 2D7SA 2IGIA 4DV4K 3QIPA 4RW7B 3LP0B 4IDKA 4M3UA 3M6VA 3RRHA 1ESVA 2FJAB 4FBTA 1C1CA 2V8GA 1S72N 4OMFG 4LF7K 2B4UA 1KVIA 4DKWA 1ELOA 2Y0BB 3MCOA 1TP7A 3BREA 4ZVOB 3GZ7A 1AZSA 4CYUA 1XMQK 2KH9A 2KYZA 2ZBQA 1UEUA 2FC9A 2HIQA 4OHYA 3E01B 2FY1A 1W97L 1NO8A 5GAGU 1FE0A 2LCWA 5IV4A 2J76E 1VK8A 3J81j 3KK7A 3MFIA 4CLYA 4MYUA 4KRWA 3CC4N 1HNVB 4DWIA 4JD2A 3V9SA 4PKGA 3MAHA 4DR3J 4BR5A 1CJKA 3H8YA 3QLHB 2AW0A 5B0GA 3FBBA 3O9QA 3OSNA 3CW2C 1T7PA 3DLKA 1GLFO 2BR0A 4ZTJA 3J7ZT 2I38A 1VCTA 3C6HA 3UQSA 4JHDA 2RQMA 2VKZG 1BG3A 5HP1A 2V4QA 4O8KA 4OKJA 4I2QA 1MSWD 1NOYA 3CCWA 4KH1B 4YHHK 1RHUB 2QWQA 3AVJA 2GBZA 4Y65A 2RE1A 3PFOA 3TO8A 2OJ3A 5H1SV 1T3NA 3ZSRA 1REVB 1JIHA 4BROA 1YI2S 1W2IA 4DCOB 2UXDK 3HKWA 5AJ3K 5IT4A 4ZPTR 3QGHA 5HRSA 1N5QA 5B8HA 1HRHA 2LLZA 3IBWA 1F21A 4QW8A 2K3KA 5LY3A 3J81U 3B4MA 1PJ5A 3K5MA