1KLMA

Hiv-1 reverse transcriptase complexed with bhap u-90152
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
538
structure length
537
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unique features in the structure of the complex between HIV-1 reverse transcriptase and the bis(heteroaryl)piperazine (BHAP) U-90152 explain resistance mutations for this nonnucleoside inhibitor.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 142
structure length 537
sequence length 538
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1klmA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1klmA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1klmA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1klmA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1klmA05
1EETB 3LAMA 5L9XA 3H5XA 2W7OA 3MFIA 3WNEA 3KJVB 2OPPA 3D28A 4QCLA 4CHOA 4E7JA 4NLXA 2HAIA 2XHBA 3TAEA 1ZTWA 4NRUA 4DSLA 1ZBLA 3BDPA 3SFUA 2O4GA 2IGIA 4ZTJA 1F21A 4NLRA 1Z25A 1RCHA 1KCFA 3CFRA 1IKVB 4I7FB 4G3IA 1RTIA 3FSIA 4ED0A 4CK1A 3I0RA 3EPGA 4CEOA 3JSMA 3V81A 4MK9A 4FLWA 4CF1A 4ZP7A 4BDYA 3H2LA 2AGOA 4CFBA 3HJFA 4RW8B 1EKEA 4RNHA 1LWEA 2VG5A 4B9UA 1JLBA 1T05B 2FVCA 3IS9B 3TI0A 2XCPA 2YNFB 4NLDA 4KREA 2YNFA 1NOZA 5KFQA 3C6UB 4CJTA 3F73A 3PW2A 1RT2B 4FJ7A 3V6KA 4WYWA 4W5TA 2LSNA 2OZMA 4F4XA 5KFPA 1BGXT 4URSA 3QESA 3MR6A 3DLGB 1QUVA 2PYLA 4MFBB 4LH4A 3UDLA 3CDEA 3HM9A 2I5JB 4KAIA 1C0TA 3PW5A 1WNSA 2J6UA 4BWMA 2E9TA 1TL3A 4IDKB 4DS5A 2BANA 2IMWP 2FJWA 1RT7B 1KLMB 5F8GA 4YP3A 4B9VA 3AA2A 3KLGA 1RT4B 5FDLA 4DTSA 3E51A 2GC8A 4YNQA 4FLVA 4PUOA 4ZPDA 2YNGB 3N6MA 5KFWA 2RKIB 4I2QA 3TWHA 3GIMA 1K1QA 3NHGA 4ZHRA 1W0HA 3AO5A 5KG7A 1X9WA 4ECZA 1S10A 4E0DA 3HVTA 3QO9B 4O44B 1BQNA 1S0OA 5JXSA 1VSJA 3C6TA 2YHBA 4KHSA 4WE1B 3M8QB 4ECQA 4FW2A 2BANB 5DQGA 3NH0A 1TVRA 4CJ3A 4HTUA 3OYAA 5KFXA 4KFBB 3OYEA 5KFHA 2IA6A 4AHTA 1MU2B 1N48A 3I0SB 4CJSA 3MFHA 4ED1A 3PW7A 2O4IA 1LAWA 5J2QB 4DS4A 3NMAA 3SCXA 4PQUB 4CF0A 3DLRA 4GMJB 2VWJA 4M3TA 1ITGA 2HHWA 4AHUA 4M3RA 4XPEA 1JL2A 3P5JA 5FROA 4NLYA 4N47A 4G1QB 4DFPA 5JS1A 3OYGA 1REVB 5HBMA 4RNNA 3QEWA 1JXLA 3T5JA 3EYZA 1LW2B 4CJQA 2O5DA 4O0JA 3Q8SB 1IKXB 1SL2A 2G8HA 1JLQA 5KFGA 4ECXA 3RTVA 3HPOA 4F2SA 1B9FA 2HHVA 1WSIA 1RT3A 3MXJA 4GC7A 2BQ3A 2ITGA 2BDPA 4N41A 4O0IA 5F8NA 3BR9A 2RN2A 3NCIA 2OH2A 3S3OA 1RDDA 4JV0A 1W9HA 1UWBB 4HCBA 5KG5A 3B6PA 3QIOA 1NKCA 4MQ3A 1Z4UA 2FVRA 4JRPA 4KTZA 3DRSB 1RT1B 1TQLA 1FK9B 5I3UA 4QWBA 3M9OB 2IC3A 1U04A 3DOLB 3H4DA 1VSKA 4DL4A 4RW4B 2VA3A 2AQ4A 4FJ8A 5KFLA 3Q8PB 2C2EA 5T14A 1XWLA 5C24A 2GIQA 4AHVA 4FM1A 1RILA 5KFYA 5C5JA 2OPSB 1VSEA 1TL1A 4H4MB 4ZP6A 2OYQA 4Z0UA 4JS4A 3HVRA 4DQQA 2XI2A 3G6XA 3ZT2A 3NE6A 1N6QA 1RDAA 3PX0A 1HMVB 2JC0A 3QGIA 1WSGA 4J9LA 2WRMA 2G8FA 3I8DA 1N5YB 4EZ6A 1NKEA 2YNIB 5KFZA 3KHHA 1HNVB 3PJXA 3RMCA 1DLOB 3VQQA 1QAJA 4K50A 1EX4A 3O4QA 3V6DA 2XO7A 1QSYA 4WXOA 4F3TA 3ZT4A 4I2PA 1N4LA 1EXQA 3CYMA 4LSNB 5HROA 5F8IA 4UQGA 1SKSA 1LWCA 2KTQA 1VSIA 4KPYA 3HPHA 3TAGA 3VQSA 3D45A 1S9GB 4CIFA 4RUCA 4RW6A 5HP1B 3RAXA 1Q8IA 3M8SA 5JS2A 4KO0B 4FCYA 5KFAA 2IM3A 1TK5A 2G8VA 3K5MA 4EBEA 2P5GA 2HHSA 1JXBA 1L3SA 5K14A 2OPPB 1VK0A 1S9GA 3VQ4A 3HO1A 2QK9A 2YKMB 4H8KA 2GBZA 3ZT3A 2AX1A 1GX5A 4YFUA 1C1AA 4FLZA 3ZT0A 3D0PA 4FM0A 3KLHB 4QPXA 4K4WA 3QLHB 4L8RB 1TV6A 4FK0A 1RA6A 4DL7A 4CERA 3ASMA 5F8JA 5EUHA 3RB0A 5DLGA 4C8OA 4F8RA 3FFIB 3MTKA 1BCMA 1RT6B 4ED6A 4M3XA 1J5OA 1QTMA 1HJRA 4IG3B 5KFKA 2Q3SA 4E1NA 3ZSWA 3V9WA 4DTOA 3QNNA 1A5XA 3V1QA 3IRXB 2AWZA 3IN5A 2C2RA 4CJFA 4WZQA 1ASUA 3V6JA 4NLPA 1X9MA 2KW4A 4IG3A 4ECYA 1KHVA 4KI6A 3KMQA 2IOCA 1FKPB 3KK3B 1JXEA 1W25A 3QZ7A 1X9SA 4MH8A 4DLGA 4W5NA 4QW8A 1NK6A 4E1MA 1S1VB 1SUQB 3JYTB 4ED2A 2IBKA 2YV0X 2XRIA 1IKXA 3O3GA 1XI1A 4URQU 4KHYA 4TXSA 3T1AA 5KFFA 3L2QA 4Q0BA 4U6PA 2HNYB 3OHAA 4CEAA 3QIDA 3BJYA 1S0NA 1XR5A 1CXUA 1X1PA 5L1JA 1DTQB 3V1OA 4E7LA 2EC0A 1IKWA 2F8SA 3OSPA 3PV8A 3NGZA 3M8PB 4ECUA 1J53A 3O3HA 1IO2A 5HLFB 4IQXA 4WFYA 4DSIA 4GC6A 3SV3A 3C94A 1S1XA 2IM2A 4O3SA 4O3QA 1CXQA 3DLGA 4WFXA 3TAMA 4FYDA 1NOYA 1QS4A 4IBNA 5I3UB 4FLYA 4MIBA 4ELVA 4FJMA 4FK2A 4KO0A 2IJNA 4TY8B 2G8IA 1VRUA 3OL6A 4DTPA 1RDCA 1SV5B 4ICLB 1L3TA 3OLBA 4CEQA 2JC1A 4EO6A 4ED3A 3NL0A 4DLEA 2HHTA 2HNZB 3CIZA 1QSLA 2D41A 2VG5B 1N5YA 4KBIA 2ASDA 4Y1DA 4CF9A 4DTRA 3O4NA 3AVHA 4FXDA 1RDBA 2ILYA 3DLEA 1I6JA 3TAQA 4O55A 3SPYA 1LW2A 4NCAA 3OLAA 2B6AA 2IM1A 3RWUA 3AVBA 3SJJA 4AH9A 3UQSA 2IC3B 3KLEA 1RTHB 4M42A 3KK3A 2QXFA 3KJVA 1FK9A 2OPRB 1G15A 4R0EA 3OL7A 4NLGA 1QHTA 4CFDA 1SKWA 1QQCA 3T3FA 5CZ1A 3KD5E 3OYFA 5KFUA 4OKJA 4IDKA 1S49A 2R2RA 3GV7B 3PX6A 2B6AB 1S5JA 3KHLA 3KLFA 1C0TB 2VG6A 2HNZA 2XY7A 3KLIB 1UWBA 3L3UA 4NLOA 1S9FA 1B9DA 1Y97A 2E6LA 4Q8EA 3LP2B 3NBPB 2A1RA 1LWFB 2F8EX 3RB4A 1GOCA 3NKYA 1U47A 4CJ5A 2VG7B 3CDUA 3AVGA 4ZP8A 1NJZA 4E19A 2OPQB 5KT6A 3PR4A 2ZQBA 4CE9A 2ATQA 1S1WA 5K14B 3OYJA 4NLQA 4NLTA 2HWHA 2UUWA 4FS2A 4ZVGA 3ISND 1HMVA 3QEIA 3PW0A 1C0UB 5F8MA 4IFYA 1REVA 5HBMB 4PQUA 3DLKA 1RDRA 2V4RA 2WB4A 3RB3A 3G6YA 3MAQA 1KVBA 3K2PA 1TKTA 1RBSA 2ASJA 4EBDA 3NF8A 1KLMA 1S6PA 5DK5A 3P1GA 1EP4B 4B3OA 2X74A 4B3OB 3AVFA 2R2UA 4I7FA 3BSOA 4DWIA 1LWCB 1BQMA 1JL1A 2XY6A 3I5BA 2JEIA 1JLCB 5KFIA 4KE5A 3QEVA 3FRZA 3OJUA 4FBUA 4TN2A 4B8CA 1D5AA 4OPKA 1GOBA 3U3GA 5EU7A 4NRTA 2P5OA 4DG1A 2Y1JA 4CK2A 2YNHB 1RAJA 4KHQA 2EHGA 2XGQA 1RNHA 4IFVA 1I3AA 3UPFA 3C95A 1D0EA 2KZZA 3K59A 2B5JA 4KV8B 4R8UB 4DG1B 3AA3A 3V6HA 5KFRA 3F9KA 3OYKA 1HYSA 4M45A 4Y3CA 1LW0B 5CY4A 1TKZA 4FBTA 3LPUA 5I42A 3SFGA 2EX3A 4AHCA 1HPZB 4K4SA 3MR3A 4CJ4A 1LV5A 4CF2A 2YNGA 5DG7A 1C1CA 4Z4FA 1T94A 3ZSVA 3LANA 2R8IA 4B8AB 4BE2A 4DTNA 2ATLA 4F4YA 4IH5A 3TVKA 4R5PB 3OYNA 3SYZA 3WNFA 3ITHA 2IAJB 4ID5A 1NK0A 3EZ5A 4M3UA 2V9WA 4K4ZA 4CK3A 1L3UA 4CGJA 1EP4A 2YKMA 3KLVA 2R8KA 1JLEB 4W5OA 2JEFA 3SQ0A 2D3ZA 5J2PA 2ZE2A 4CIGA 2BE2B 2XY8A 2UVUA 3HP9A 4RW6B 1NHVA 5KG2A 4R5PA 4GVMA 5EWEA 4HCCA 1J5OB 4ZVFA 5KRTA 4Q8FA 3NGDA 1QE1B 4DU4A 4EP4A 1FKPA 1T03A 1CLQA 1T03B 4O44A 4CFCA 3M8PA 4ECWA 1LWEB 1JLQB 1ZBIA 1HYSB 3DRRA 4ICLA 3NAEA 5C25A 2XC9A 2R8GA 1U48A 4FJHA 4ID1A 1JLFA 4ZVEA 2UUTA 3KIOA 4OLAA 4BDPA 1VSMA 2WOMB 3QERA 3AVMA 3TAFA 2WOMA 3HSTB 2UVRA 2JEJA 3DI6B 4DTUA 4ZTFA 3VQ5A 3NH1A 1S1UA 3PJWA 3KK1A 4FVMA 1XR7A 3OYDA 3NGIA 5DG9A 1IKWB 3SQ1A 4CJRA 1SL0A 1RTDA 3G86A 5J2QA 5KFVA 3MEDA 5HRRA 2DPIA 1TAQA 5C24B 3L3VA 1HNIA 3DM2B 1KTQA 1KFSA 1SH0A 3VQ9A 3CO9A 3RMAA 3KK2B 3QIPB 2JLEA 4M95A 2P1JA 4DFJA 3KHRA 1TKDA 4KB7A 4FJKA 2C2DA 1U45A 3LP1A 2W8LA 3EZUA 5KFCA 3HKWA 4ZVHA 1BI4A 4R8UA 2W9BB 4Q45A 3ZCMA 4RW9B 4QOZB 5KGWA 4CGGA 5JUMA 3VA3A 4FW1A 3ZSYA 3AO1A 5HRPA 2YNIA 2BRKA 4IFVB 2FLNA 3LP2A 2X6NA 2HVHA 5KT4A 2W8KA 1IH7A 1KSPA 2G8UA 2FVPA 3PY8A 1UA0A 5J1EB 4KTWA 3LZIA 4M3WA 3CVKA 4IG0B 2CJQA 4K4YA 3SUQA 4CHYA 3KKRA 4CJPA 3DDKA 1UOCA 2Z1GA 1MMLA 1S1VA 1U4BA 4DQPA 2QV6A 5F8LA 3RR7A 3KLEB 1NHUA 4BE0A 4CFAA 2IAJA 2KQ2A 5DGAA 3CJ2A 3RBEA 3V4IB 2VA2A 2W7PA 2D0BA 3OYCA 1A5WA 3GILA 4AHSA 1NNDA 3G6VA 1EETA 4FJIA 4XIUA 3SQ4A 3HXMA 4EZ9A 3IRXA 2YKNA 1YT3A 3CJ3A 4ZPCA 4OVLA 3AA4A 3H98A 3PVXA 3TANA 5KFBA 1VRTB 4KFBA 3BQ1A 3T5KA 4DEZA 4IRDA 4Z4HA 4Z4GA 2BQUA 2HW3A 4KB0A 3CJ0A 4LD0A 1TGOA 4QW9A 3KLFB 3IGNA 4KHWA 4ED7A 1RTIB 2YNHA 1WAFA 3PHEA 1RBVA 2AGPA 3KLHA 5SWMA 2QKKA 3OL9A 4FJXA 1U09A 1L3VA 3AO2A 1JLAB 3I5CA 3OYIA 4G1QA 1A5VA 3V4IA 3MR5A 2R7YA 3MEGB 4CF8A 3OSNA 3CG7A 3OYMA 4Q44A 1BQMB 2R2SA 3WNHA 4DU1A 3MF5A 1RYSA 4YQWA 4KTQA 1S6PB 1C1BA 1T8EA 1IG9A 5HP1A 3VQAA 3ZSXA 3RRGA 4HKQA 4ZMMA 3L2UA 2E9RX 1RT7A 2I5JA 3DLKB 1SKRA 4JV2A 3DRRB 4WE1A 3KD1E 3QYYA 1VSFA 2WK4A 2ZD1A 1HPZA 4KSEB 3V1RA 4MFBA 3MXIA 3HVTB 1C0UA 4FLTA 2PY5A 3LP0B 1HQUB 1SV5A 1U49A 3V6DB 4YR2A 2IM0A 4MKAA 1JIHA 2BR0A 1YVFA 5CYQA 3LP1B 2OPRA 4J2DA 5KG0A 4CGHA 4Y2AA 2HHQA 1BI4B 3C6TB 1BIUA 2ZE2B 1FKOA 1RT3B 1YTAA 3S3NA 5F9LA 3K5LA 3L2WA 3THVA 4X2BA 2ASLA 5KFTA 4KHMA 1IKYA 3QZ8A 4RW8A 2OPSA 4YR3A 5J2NA 4ZP9A 3BQ2A 5J2NB 4K4UA 3LAKA 1KHWA 3MEEA 3H5YA 4RNOA 3E01B 5CYMA 1O1WA 4EYIB 3GQCA 3BQ0A 3K58A 4WFZA 4N56A 4CEDA 3QGGA 3V9UA 1VSHA 5KI6A 3ICLA 1LAVA 4Z4EA 1LW0A 4EO8A 1KVAA 2GUIA 1S1WB 4DL2A 3M9MB 4MK8A 3DOLA 4KRFA 4CHZA 3SI6A 3OYHA 5KFOA 3I0SA 2YHAA 4O3PA 4K4VA 1CZ9A 1RBUA 1S1TB 5E41A 2FVSA 3QEPA 4B9TA 4ZPBA 3IS9A 1L5UA 4KHUA 3RBDA 4J2BA 3KHGA 1QE1A 4EEYA 1BISA 1IKYB 4OKKA 5KFEA 4DL3A 3RMBA 1YVUA 1D8YA 3L2VA 4TY8A 1JLCA 4CJVA 3V81B 1BCOA 4E7IA 3PZPA 3CDWA 4Y1CA 4O4GB 4J2AA 3VQ8A 4F50A 4Q5VA 3EY1A 1RYRA 1SUQA 3OVNA 4KHRA 3DRPA 5DQIA 2X78A 4OLBA 5EDWA 2XCAA 4CJKA 2GIRA 1UA1A 2AU0A 3VA0A 3TAPA 3H08A 1RTHA 3VQBA 5EWGA 4E7HA 4NLWA 2RF2A 4PY5A 3KLGB 1ZBFA 5D3GA 4NLUA 5KFSA 3U6FA 3MR2A 4FJ5A 2F96A 3B6OA 4NLSA 3ULDA 5KG6A 2E6MA 2VG7A 4ECSA 4O4GA 4PA1A 1RT6A 5KFMA 1CSJA 3ITHB 4NYZA 3NFAA 4J9KA 4KI4A 2RPIA 1GOAA 1XHXA 4RW4A 4RW7B 5L1IA 1T7PA 5J2MA 3L8BA 5EWFA 4LSLB 4LY7A 1IM4A 4TQRA 3HYFA 4OKEA 1I39A 1S6QB 3QO9A 3NAIA 4HUGA 3O3FA 1SH3A 5F8HA 3QEXA 4RNFA 4K4TA 3ZSZA 3AO3A 3AVIA 4CIEA 2QKBA 4FJGA 4I2QB 4FJLA 4DTXA 4C8NA 1K6YA 4B9SA 3K5NA 2HMIB 4DQIA 3NF9A 3HL8A 1SH2A 2PZSA 2DTUA 2ALZA 3D5MA 3HK2A 4J9SA 1JX4A 3DYAA 3VQPA 1S4FA 2IJFA 2IDOA 1JLGB 2XY5A 1NK4A 2DFFA 2RDIA 2YKNB 2RF2B 4JV1A 4KHNA 3AV9A 4B9NA 3SNNA 1ZBHA 4KKOA 4W5QA 2HB5A 1B92A 1NK7A 3BSAA 3DOKB 3DI6A 3M8RA 2PYJA 3OL8A 1C0MA 3PO5A 2B43A 4MK7A 1ASWA 3LDSA 4KB1A 2C22A 1ZETA 2FBYA 2FJXA 2I1RA 4URGA 4Q43A 1HQEA 3GV8B 3RRHA 1NJWA 3U3YA 3BSNA 1HARA 3VQCA 5C42B 3G10A 1WAJA 4TSXA 1C6VA 1UAXA 4E7KA 3QIPA 3DLHA 4OL8A 3G0ZA 5I42B 2ILZA 4QWDA 1HNIB 4Y34A 4J9MA 3WNGA 4CEEA 1RTDB 2XI3A 1RBTA 4DSFA 1QSSA 3CWJA 4DSJA 3NH2A 2RKIA 1DLOA 2HNYA 2FBTA 3ISNC 3VN5A 3H5UA 1KFDA 1C2PA 3NF7A 4HUFA 4LSLA 3HT3A 4E89A 3M9NB 1TK8A 3AO4A 4DF8A 4ECRA 4M94A 1WNEA 3PO4A 4OJRA 1BIZA 4IRCA 2AJQA 3S9HA 4H4MA 4FZZA 2NUBA 5KGXA 2R2TA 1BL3A 3RAQA 3GV5B 4CJEA 4N5SA 4WXWA 5KT2A 4ECVA 4Y2CA 1MU2A 5DLFA 3DM2A 4RU9A 3AVJA 4I9LA 3H59A 3OYLA 2GV9A 3GIJA 2W9AA 3DLEB 2RDJA 2DY4A 4NCGB 3V9ZA 2JEGA 2Y1IA 3DMJA 2HMIA 3CM6A 3DRSA 4NCBA 1S1UB 3ZT1A 4C8LA 1S9EA 5DG8A 3HP6A 2R8JA 3QLHA 1Q9XA 4J9RA 3RMDA 3FQLA 1Z26A 3AA5X 1JLFB 2DFHA 4BE1A 1J54A 1S48A 3MECB 2HVIA 1JLEA 3CM5A 4DF4A 3UIQA 3T5HA 1YTUA 3VQ6A 4IKAA 4K8ZA 4K8XA 4CJWA 3SUNA 1J9AA 3BSCA 4H4OB 2DPJA 1DTQA 3QGHA 1RT4A 5FDLB 3UR0A 4NYFA 1D9FA 4IKFA 3N6NA 3OS2A 4KKOB 1NKBA 3MEDB 3OYBA 4LQ9A 4JUZA 1QAIA 2WONA 3AVAA 2BQRA 4FS1A 1C1BB 1XC9A 1JLAA 2D3UA 4B08A 4OGEA 2WCXA 3FQKA 3PUFA 5KTQA 3VQ7A 3SUPA 4CJLA 1RT5A 3CJ5A 1HYVA 3NDKA 3AVNA 3AVCA 1TKXA 3E01A 5CYMB 3QNOA 5KT7A 5KT3A 4DQRA 4DL5A 4O3RA 4CHPA 1HNVA 5KG4A 4RUAA 4ELTA 2W9BA 3FFIA 3KMSA 2D5RA 2W9CA 3RB6A 1JLBB 4CHQA 4HUEA 5FRNA 4WZMA 3DYAB 2X6SA 1S6QA 1TVRB 3Q8QB 4KAZA 1C1CB 4B9MA 4OPJA 4F3OA 4HYKA 2V0NA 5C42A 2VG6B 3KK2A 4TY9A 1BQNB 4NYNA 4IH6A 3JSMB 3L2RA 2KFNA 2HHUA 4MKBA 1HYZA 3ALYA 1TV6B 1DTTA 4AHRA 3DLBA 3AVKA 1NJXA 4J9OA 3K57A 4IOBA 5T7BA 2G8KA 3Q8RB 5J2PB 2IS3A 2D0CA 5HLFA 3OS1A 2ZD1B 4ZPAA 5J2MB 1RT5B 4BACA 3OY9A 5KG3A 4JS5A 1WSHA 1GX6A 3HHKA 1R0AA 5DGBA 3PX4A 4YR0A 2FVQA 4XPCA 5KG1A 2UVVA 4CEZA 3LALA 5KFDA 5HROB 3VQEA 2FBVA 3MEEB 2BRLA 2HHXA 4XO0A 4IR9A 1JLGA 4F4KA 4FJ9A 4WYLA 2BGGA 4B9LA 5C25B 2HNDA 3RR8A 4C8MA 3JYTA 1RTJB 4HVJA 4IR1A 2DFEA 4O4RA 4LSNA 3KLIA 1FXXA 3S3MA 2G8WA 3MEGA 1FKOB 1RT2A 4H4OA 1WSJA 4FLXA 4TQSA 2XWYA 4O3NA 1VSLA 1DTTB 4N76A 2B5JB 4KV8A 4EYHB 4DSEA 4DFMA 4CJUA 3CFPA 1S9EB 1S1TA 4FZXC 4FK4A 3NGYA 4DSKA 3H4BA 3BGRB 1HQUA 3KOAA 4H54A 3LP0A 1Q9YA 1TKXB 3TAMB 3P83D 3SQ2A 2R8HA 3NBPA 4FM2A 3TR8A 4AILC 3HVAA 4J9PA 3K5OA 4CHNA 2WONB 3LWMA 2D7SA 2V4QA 3NF6A 1TK0A 4Z4IA 3TABA 4JLHA 3OS0A 3I5AA 5D3GB 3VQDA 2W42A 4FLUA 4RNMA 2XGPA 4K4XA 4PWDB 4ELUA 4F4WA 2D0AA 1RT1A 5KRSA 1S97A 4GW6A 3OHBA 4E3SA 4QAGA 1WSFA 4JRQA 3ZSRA 2B4JA 5DMRA 3C6UA 4I9QA 4U7CA 1XR6A 3BGRA 4W5RA 3QINA 1S1XB 5CYQB 5L1LA 4FZYA 4I2PB 1S0MA 4F4ZA 3V9SA 5L1KA 4DTJA 3EPIA 3BREA 1WSEA 1ZYQA 1NK8A 4DMNA 2VWKA 4O3OA 3CQ8A 1KLNA 3H40A 2Z1JA 4CGIA 3GYNA 3CJ4A 4IH7A 5FRMA 2ZKUA 3OJSA 3NAHA 5KT5A 3ZSQA 4CGDA 4F2RA 3LPTA 3LWLA 3N6LA 1VRUB 1JKHB 2BE2A 5F9NA 3ZSOA 1TKTB 1NK9A 4LQ3A 3PW4A 4ED8A 3SPZA 3LZJA 5SZTA 3DMJB 2UVWA 1TP7A 4EBCA 3IG1B 5DQHA 1RBRA 1KVCA 2FBXA 4IRKA 1HRHA 4BDZA 5HRNA 3KKSA 5CZ2A 4J2EA 2OPQA 4DU3A 4DTMA 2HWIA 4OGCA 4CECA 4FJJA 3HVWA 4TYAA 4DFKA 1LWFA 4ECTA 1OS5A 3IGVA 1T05A 3GIKA 1TKZB 4TLRA 2OA8A 1WLJA 3A2FA 2E9ZA 4NZ0A 4ZHRB 4M3YA 4J9QA 3PR5B 4DQSA 3IAYA 4QWAA 2WHOA 2FC0A 4MIAA 4CESA 1VSDA 4O5BA 3I0RB 4RW9A 3T5LA 1BHLA 4TYBA 4CEBA 3QETA 1D9DA 4PUOB 3HPGA 2KZMA 3IG1A 4HHTA 4CCHA 4EP5A 2FLLA 5KFJA 2C28A 4DL6A 4QWEA 3SI8A 3H5SA 3DOKA 2Z1HA 4NLVA 4NCGA 4PWDA 1XHZA 4FJNA 3SV4A 5KFNA 4RZRA 2P51A 1JKHA 1K1SA 1TAUA 2HNDB 2Z1IA 1NJYA 2FJVA 4LH5A 2OZSA 2QE5A 1T3NA 2ETJA 3FDSA 1HQEB 4Q0BB 1D1UA 2A1SA 4CEFA 3GIIA 4M41A 1R0AB 1NK5A 1TL3B 3KK1B 5J1EA 3MECA 4J9NA 3V9XA 3DRPB 3SUOA 2J6SA 4YMEA 4IFYB 4IG0A 3AVLA 3TARA 2WTFA 5HRSA 4ID5B 2FLPA 2F8TA 1N56A 3LP3A 4C8KA 3SZ2A 3CFOA 2E4LA 2CKWA 1KRPA 4QWCA 1ZTTA 3KNAA 3M8QA 2AGQA 1CZBA 4BWJA 1N6QB 4RW7A 4Z4CA 4M3ZA 1ZBUA 3T19A 1WN7A 2AX0A 4CGFA 1RTJA 1TL1B 1VRTA 3MXMA 2W9CB 1ASVA 2JGUA 1RA7A 4RG8A 3KTQA 2KFZA 1SL1A 3TQ1A 1IKVA 2J6TA
chains in the Genus database with same CATH superfamily
2D69A 3FBBA 1RKJA 2E2PA 1GMWD 4FWSA 1NSAA 4DV2K 1Z2LA 3WNEA 3KJVB 1N36F 2RNEA 4I4BA 1V6HA 4NLXA 2OMOA 3BO4A 1ZTWA 3W64A 2GJ2A 2ZWOA 3BDPA 3SFUA 2KRRA 1XNQF 2IGIA 5AZIA 2ZHBA 2WVEA 1S99A 2HEKA 2GFFA 3IM8A 4NLRA 1Z25A 5F0XA 5KPTA 4E2FB 4G3IA 3MMCA 2XG8A 4ED0A 4CK1A 1U6FA 4DCJB 4ZJQA 4K5SA 3NNAA 3TWZA 4HTIA 2YQ0A 1NZ8A 3H2LA 4KGVB 3BGUA 1EKEA 4M7YA 4LFAK 3MR7A 1B0PA 2RDDA 3ZTSA 2FVCA 2E1RA 3PCOB 1FKAF 1SQFA 4G65A 4KREA 2YNFA 3BH7B 3T9NA 5KFQA 3PW2A 1RT2B 4MYUA 3E8OA 4IO1A 2RQCA 3V6KA 5K8NA 4DR5K 1JNRB 4DMZA 4KPCA 5KFPA 1MROA 4UF4A 2MKIA 4MFBB 3QPIA 4HHHA 1IQTA 3CDEA 2I5JB 4KAIA 2ZM6J 2GGPB 1C0TA 2E29A 5EY4A 2CNLB 1TELA 2ZJRL 5HMZA 2BANA 2IMWP 1XEZA 4B9VA 4CD3A 2GJFA 3CD5A 4FLVA 1WORA 4N8NA 3AAWB 3FBFA 4PUOA 4K8RA 2A42A 3QWPA 4BC2A 3GG0A 2NUUG 1HJOA 4I2QA 3TWHA 1V5IB 1ELOA 2EW9A 4ECZA 2HVZA 2FZKB 4PPZA 1S0OA 2XSJB 4JOUA 1UP1A 1VQSA 4Q7AA 3C6TA 1WHVA 3IM9A 2MJNA 2CQDA 4CW7B 4KHSA 2Q97A 4DX7A 1TVRA 4IJNA 3D0HE 5KFXA 4KFBB 4HHJA 4AHTA 2XEXA 2WVCA 4M7XA 5J2QB 1LAWA 1H2TZ 4PQUB 1CS4B 3DLRA 4GMJB 4DV7K 1H72C 1ITGA 3RJMB 2HHWA 2FJDB 2V5HG 3ETOA 4CZEA 1JL2A 1RHMB 4DFPA 3GJSB 5HBMA 3D7SB 1NAQA 3HRGA 3QEWA 2R4FA 2V4JB 1M5VC 3J80U 2IVOA 4CJQA 4O0JA 1YKWA 3Q8SB 4DR2K 1IKXB 1SL2A 1JXVA 1RHRB 4ECXA 3SLCA 1P1LA 1Q95G 3L3CA 2HBJA 2G2ZA 4USJC 2B9YA 2BQ3A 1NM2A 4J37A 4GVBB 4UOCA 3SEOA 3NCIA 3B4DA 4HCBA 5KG5A 2IHR1 3QIOA 2IVPA 4KTZA 2NRHA 3QFUA 3NOCA 3DRSB 1RT1B 3KUEA 2GO9A 4QWBA 4IOAQ 1YZ7A 3AFGA 3DOLB 4OYMA 2U2FA 2WBRA 3H4DA 1NJIT 4K0KK 3ZO7A 2RUGA 5CYJA 2HQFA 2C2EA 1CBKA 3N9UC 3MMAA 1HUXA 5KFYA 1FT8A 2OPSB 3OFGA 1G3OA 1TL1A 4H4MB 3HT0A 2VQFF 2XYHB 2RAQA 2B4VA 2XI2A 3G6XA 1YIJS 4OLPA 1N6QA 1VQ8N 3RYLA 2ZJQQ 5AJ3J 4DX8H 2HPUA 4EZ6A 1NUEA 2ROPA 3Q2SC 2VKRA 3CC2N 2DXFA 1B7YB 4Z7CA 3AH6A 1OO0B 2BV3A 1QAJA 3CPEA 4ISEA 4OHYA 1KD1T 4P7TA 1MWYA 4PAAA 3GZ7A 3ZT4A 3M1VA 3PIOL 4LSNB 4NXNJ 5HROA 1UFLA 2MHNA 2JVRA 1SKSA 5AFUH 4QS7A 3TAGA 1YSJA 1M5PC 4IEEA 3MM8B 4CIFA 3M8SA 4RW6A 4FCYA 4CH1A 3U4LA 3ZNJ1 2P9NA 1F0XA 4BG9A 4OZ3A 4YS2A 1JXBA 1MROB 2XMWA 2YH1A 1L3SA 5BYRA 2B7BB 2OPPB 3WQUA 1S9GA 3HO1A 2QK9A 2YKMB 5C7PA 1FDAA 3WXJA 1NGJA 3ZT3A 2MEWA 4FM0A 4HACB 4K4WA 2MLYA 4L8RB 1RA6A 3MPYA 4CLUA 4CERA 4QYRA 4CO1A 3SBTA 3ASMA 4HT7A 1FDNA 1HNXK 4RKUC 1SAZA 5DLGA 3W1YC 2O8FB 5MLCV 4D3GA 2DY9A 4DUTA 3UDVA 1BWVA 1Q81O 3ZSWA 2MKHA 3V1QA 5AQVA 1PC5A 5GMDA 3IRXB 3IN5A 5JICA 4WZQA 4WWSA 2RH3A 5F0UA 1FX4A 2XB2D 1X9MA 1HWUA 2KW4A 3MPUB 4BC5A 2EXUA 1FKPB 2NQPA 1JXEA 3M30A 1W25A 3S01A 3MPDA 1NK6A 3JYTB 4LC9B 2SXLA 2YV0X 1XI1A 4URQU 4F67A 4KHYA 4TXSA 3T1AA 5KFFA 2Q0RA 1GFWB 3OHAA 4CEAA 2RU3A 3UO0A 1NMEB 4PG4A 3BYPA 3OQ2A 1XQSC 4KIAA 4E7LA 5IV3A 3GDQA 2F8SA 3OSPA 3D66A 2HHHF 2J0XA 3NGZA 4ECUA 2F4VF 3JAMU 1KS2A 1IO2A 1X5OA 4GC6A 2IM2A 5M1QA 1CXQA 2E1AA 3G2XA 1NOYA 4FPRA 5I3UB 4ELVA 4GKKJ 1OSCA 2CADA 1KN6A 2G8IA 3C0BA 2DNHA 1F2HA 3OLBA 1S12A 2LXIA 2VBWA 1WC3A 2R7QA 3KDOA 4EO6A 3NL0A 4I67A 5AQGA 1T9YA 1EQMA 1GLJO 4CF9A 4DTRA 3SJHA 4BRKA 3O4NA 4WYBA 5FPEA 3BBBA 3FZ2A 3RAMA 1WG5A 5BR8K 2KYXA 2C2MB 2A1BA 1LW2A 2D4WA 3B6BA 2RSQA 1NGIA 1FE0A 2PEBA 3GFYA 5AQHA 1M1HA 3SJJA 2IC3B 3QWUA 2Y1LB 3KJVA 1G15A 4R0EA 1QHTA 2EWHA 2D0OA 3KD5E 3OYFA 5KFUA 1VQLS 1VQ4N 1SKUB 1NGAA 3GV7B 2YJFA 1SC1B 4A8WA 3OXFA 2HNZA 2XY7A 3KLIB 2WTUA 1IM6A 4OZ0A 3VAGA 3Q23A 1S9FA 1B9DA 3FEZA 1KDNA 4Q8EA 6FDRA 1RLCL 2C3OA 4CH7A 4NLCA 4QIFA 2W2PP 4FO0A 3AVGA 1H1VA 1YJNN 3UN3A 1NJZA 2J76E 1VC6A 5KT6A 2N4DA 4PG8A 4CE9A 1S1WA 3CMEN 2BA9A 1DAXA 2MKKA 3UDEA 3O08A 1RLDA 3OYJA 2HWHA 4LRCA 4EIAA 3FKBA 1BE4A 1C0UB 2QI2A 5F8MA 1EO1A 3DLKA 1RDRA 2E1MC 4DUYK 4FNIA 1I5OB 1RZMA 3K2PA 1RBSA 3ENVA 1KLMA 3K8VA 3P1GA 1EP4B 3C14B 1SC3B 5JLFA 2X74A 4B3OB 1FX2A 2R2UA 4I7FA 3DCAA 4QOTA 1GNKA 3FNNA 5JVHQ 3FRZA 2N7YA 3CCUS 4X65K 3C15B 4RUBA 1RCXB 2CIMA 1WTBA 2Q1LA 2V52B 3HM8A 2CQ3A 1K73O 4CK2A 2AZ3A 1V5VA 2CNNB 3IUCA 2IIRA 3QBWA 5A8RB 2QZ8A 3UPFA 4KBOA 4OX9K 1D0EA 2AEJA 2B5JA 4KV8B 1FWLA 3ILLA 1PJ6A 4DG1B 1HYSA 5AQTA 3MDFA 2XBPA 5GAHP 2OD6A 3LPUA 5I42A 1YJWN 2Q6CA 4K4SA 3MEKA 4M5MA 1HR0F 4CJ4A 3CCQS 4Z4FA 1T94A 3MCAB 2UUBJ 2R8IA 3ZSVA 2RE1A 2ATLA 5HMYA 2PI4A 3ZLJA 3X1LB 4R5PB 1J5EF 3SCKE 3ITHA 2IAJB 1NK0A 3EZ5A 2Z58B 2V9WA 5H9FK 4A8XA 1HL6A 4DV7F 1Q1KA 2R8KA 4AM7A 1PIEA 2B9XA 2UVUA 1OMSA 4X4PA 5BN9A 3W60A 4RW6B 1NHVA 3T69A 4ZIVA 3GOIA 4HCCA 4ZVFA 3NGDA 1NH7A 2A41A 4GVBA 4LF7F 2M70A 1IJEB 3I6PA 3DRRA 3G87A 4ICLA 3NAEA 1SIZA 2XC9A 4DZDA 1U48A 1JLFA 1E4GT 2DK2A 1U8WA 4BDPA 2WOMB 4TNOA 1HI8A 1VQPN 1NM1A 3HSTB 1RWXB 2JEJA 4DTUA 3Q83A 3BF4A 3EE3A 3OYDA 3VGSA 3NGIA 1VQLN 1KC8T 1IKWB 2Q3PA 1P90A 1RTDA 3THXA 4PYDA 5KFVA 5K8OA 3L3VA 3CO9A 4QIGA 4LJMA 3BUZB 7AT1B 1VBXA 4A5BA 4M95A 2MKJA 4ZPTR 5KFCA 3ENWA 4PL7A 3HZ6A 2JX2A 1D4XA 3MK6A 3EGWB 3B8AX 4RW9B 3R27A 1IBKK 1F3FA 1RACB 2BRKA 3LQVA 1VQ4S 3LP2A 2ZNZA 3EX7B 5A76A 2FVPA 4NX9A 3LM9A 4M3WA 4ZCKA 2F8MA 4UTGA 4JI7K 1GXTA 4IG0B 1DQ9A 3MX2A 1LFPA 2J0WA 4CJPA 1VC0A 1UOCA 5M2UA 4FOIA 1MMLA 5D78A 3GBTA 4JK8A 4CZGA 5D4PA 3AD9C 3CCSN 3RR7A 4ER8A 1SJFA 3UKUA 1GTEA 2YKAA 2KQ2A 1J6ZA 2K3IA 5DGAA 4WQ4A 2WFBA 3RBEA 3VEVA 3CERA 5ETNA 3W3DA 4Y2MA 1I94F 4AHSA 1KKHA 3NY0A 3G6VA 1EETA 3ZZOA 4XIUA 3SQ4A 1ROFA 3DXKA 5LOQA 4OVLA 2YKNA 2KH9A 4ZPCA 2VC1A 3TANA 4BR9A 5I9EB 1PC4A 4F9OA 3T5KA 4Z4GA 4W4MA 1HFEL 4ZK7M 2IVMA 4ITSA 2AP1A 4C1NI 7FDRA 1BQXA 4GKKF 3QRPA 1SJ1A 2YNHA 1WAFA 5SWMA 4FJXA 2XHWA 1L3VA 4LRFA 4B3MK 1N5QA 1R8BA 4G1QA 1A5VA 3V4IA 3MR5A 1K0TA 5HSPA 2V2QA 3H8YA 1BQMB 2R2SA 2QL9B 3MF5A 3FZLA 3Q7CA 1M0SA 4DPWA 4XEIA 4YQWA 1RGVA 3IR5B 1T8EA 3EDRB 5HL7Q 1WD6A 4TVAB 3ZSXA 4M5LA 3L2UA 3OR1A 2FHKA 4TLQA 5AZJA 4P72A 4B1ZA 1VBKA 3HDSA 1S0VA 3FLCO 3DRRB 1MN9A 2DR5A 4WE1A 1QZ5A 3QYYA 1HPZA 1HBNB 3MCPA 3KWGA 3OBIA 4MFBA 3MXIA 1C0UA 2VFUA 2UU9K 3HZEA 3V6DB 3MGJA 5L8RC 4IOAL 1YVFA 1OH5A 3D1OA 2OPRA 1HKGA 4P74A 3QQCD 3TTCA 5CHIA 1BIUA 2NXUA 3JS9A 1YTAA 1UAWA 3K5LA 2AIRB 2XZDB 2ASLA 5ETQA 3TO8A 4BR2A 4CZCA 2ZUGA 4ZP9A 3D2EB 4A59A 1H74A 3MZIA 3S1TA 4CT9A 2P9SA 4K0KF 1WSVA 1HBUB 2KKHA 3AARA 1J27A 5IC6B 1K47A 1WKJA 3O80A 1R8HA 1I3OB 2HVEA 1IN0A 4Y65A 3K58A 1DKGD 1NSKL 3SDEB 3V9UA 1VSHA 3LW5C 3ICLA 3J8AA 2DBBA 4Z4EA 1AFIA 2UV8G 2UXCJ 1KAYA 4BR7A 3EXYA 4MK8A 1JWWA 2HS3A 1X60A 2P9EA 3I0SA 1YHQS 4HWIA 4OLOA 1XMQJ 4DV5J 4DCPB 2YHAA 4O3PA 3P4UB 1CZ9A 1RBUA 4B9TA 3BZQA 3RBDA 3KHGA 3W8GA 4EEYA 4OI4A 1Q18A 2D1CA 1CJUA 3VTIA 4DL3A 1UW4A 4DBQA 3P8BB 3VWSA 5D0RA 4TY8A 1ZPWX 1RISA 4E7IA 2W2MP 4NL5A 4MO5A 3RBZA 4UY8T 1RYRA 1YITN 4CP5A 4H5RA 4KHRA 2X78A 3CMAN 3AB4B 4Y28C 4Y2IA 3JB9k 3H08A 2VGMA 4P71A 3JTPA 4ES3A 2RF2A 2N4CA 3VAFA 5FLXO 5KFSA 2Z2YB 2E1PA 2HBMA 4GY2B 1VAZA 2I2YA 4PA1A 4QS9A 5LSLA 1CSJA 1N0UA 3PYEA 5IV4A 3DHWC 4NYZA 2DD8S 3CW2C 3ILJA 1Q4RA 1BUPA 4WFBQ 1JJ2R 1UW9A 5L1IA 2KKZA 2HGLA 1IM4A 2VPYB 1N5SA 4QU7A 4TQRA 4WIIA 5HO4A 3QO9A 2WSCC 3UCZP 3G25A 1FW6A 1R8PA 3PYDA 4CLPA 5F8HA 4YHHF 4MYTA 4K4TA 3PIPQ 3ZSZA 3AO3A 3JS6A 4FJGA 3P5TL 3O3LA 4FJLA 3GP9A 4OJHA 2H48B 1NHKL 2ASMA 2CZ4A 3K5NA 1ILYA 4YOVA 5DDRC 3HL8A 2L9WA 2DTUA 5JMVA 5AQJA 1QAXA 5GINA 1VHFA 2V8DA 1DEJA 5BRFA 5DM6L 4IQMA 2IJFA 5IOLA 2DNKA 2IDOA 2PO4A 1NK4A 2YKNB 4JV1A 2ZZNA 1HD0A 5EN1A 5DRKA 2PYJA 3CCVN 3VVUA 5LT5A 3LDSA 4EWTA 3RVCA 3Q24A 3G96A 5C0YA 3TZXA 2C22A 4WP3A 2FJXA 2YXLA 1E3MA 1B99A 3RRHA 2Z2ZA 2XMAA 1HARA 3VQCA 5C42B 4MLEA 1WAJA 1QD1A 1RAAB 4TSXA 1N34J 3DLHA 2I7PA 2QEXN 1NU0A 3MMJA 2YKOA 3OTBA 1HNIB 1CJTA 2QG9B 4LF9F 2EK6A 1EJ7L 4OI3A 3TSQA 4USIA 2YWEA 2F4FA 3CWJA 3NH2A 3MM9B 2RKIA 1C2PA 2AYGA 2R7UA 3O2IA 3AO4A 3FMWA 1AB8A 4X62J 5LMUF 1FJCA 4M94A 3PO4A 4DPOA 1PBUA 1FA0A 3UCGA 3S9HA 4FZZA 5KGXA 4JI0K 4MDBA 3GV5B 2DH7A 4F26A 2EVZA 5D0HA 2XMKA 4BC3A 1MU2A 2JWNA 4PWUA 5H9EJ 2MHEA 1SS6A 2E5HA 5CE3A 3H59A 2NREA 3QDKA 3OTOK 2DY4A 3CM6A 1S1UB 3ZT1A 3J7YI 4RBUA 1F60B 1S9EA 2RB7A 2A3JA 3HP6A 4J9RA 8RUCA 3D4JA 1NMNA 2BJ8A 4DV5K 3AA5X 3HF5A 2B4OA 4JN4A 3O9RA 1S48A 3MECB 2MZ1A 5GADU 1TYQB 1YTUA 4TKTA 2H51B 2E5LF 1QVFR 1J9AA 3BSCA 2DPJA 1H38A 5ETOA 4NYFA 3A13A 3NP5A 4XH5A 4X84A 3OS2A 3GG4A 3TUIC 3MAAA 5BXIA 5F3TA 3OYBA 3R9PA 3ULEB 4LQ9A 4NZ6A 3ZFVA 5IWAF 3SQGA 4L76A 1C1BB 1JLAA 1YTYA 4C1NK 3M2RA 2B56A 1OY8A 3AVCA 5CYMB 4JI4F 5KT3A 4JI1K 4DL5A 4DR5F 4KYZA 1U1RA 3UI3A 4O8UA 4ELTA 3V5RA 2W9BA 3FFIA 2D5RA 2GVZA 3RB6A 4CHQA 1NCLA 4LR9A 1Q16B 3TX0A 4KAZA 2CXEA 3VETA 4OPJA 3U9ZA 4BRPA 2M7SA 2V0NA 2OMLA 4TY9A 4NA3A 4LFBF 4IH6A 1RWVB 3L2RA 1EHWA 4A4JA 3IAS9 2KFNA 4MKBA 3ALYA 1HYZA 4AHRA 4NPOA 4C2MA 3HHNB 3KZBA 2G2YA 2NRTA 3AVKA 5A8WB 4LF6F 2Q31A 4S0MA 4DV2F 2A6AA 5GAEU 1XMBA 5E3AA 3IBCB 4EI2A 1LOTB 2Y1RI 2IS3A 2D0CA 2H54B 1Z2ZA 4LIRA 1FVQA 1WSHA 3HHKA 3OR2B 1R0AA 3PX4A 2FXUA 1P8GA 4YR0A 4A2AA 2FVQA 5HI7A 2WBNA 5KFDA 4CD1A 4O8KA 3VQEA 4PXBA 2W2NP 2BRLA 4LBPA 4XO0A 3R3TA 4IR9A 3MWTA 2Z2LA 4FJ9A 1O8BA 4UZCA 3IXQA 2HNDA 2DFEA 3OXLA 1FXXA 1FERA 3MEGA 1MWZA 2BACA 4UY85 1NBEB 4H4OA 2HBRB 4TQSA 1YJ7A 1WC5A 2IDEA 2UU9F 1QQMA 4QIVA 2ACYA 1VSLA 1DTTB 4DSEA 3W2WB 2XMJA 3H4BA 3J81Y 3LP0A 4CZKA 3GLJA 3P83D 5T41A 3SQ2A 3PIPL 4NE9C 3MCSA 4IOCQ 3TR8A 2MXYA 2V34A 5EOYA 2MYFA 5CA5A 3H46O 1FFGB 4I69A 4CHNA 3C16B 4ZCLA 1BWFO 5BR8F 4BRQA 5SUHA 3E9LA 3NF6A 1YX2A 3CCQN 5C2CA 2VZ9A 2LQ8A 3A8KA 4I64A 2V7ZA 4B3RF 2B4UA 4FLUA 3Q89A 3NEKA 5C10A 1NO8A 1WELA 4P75A 2D9OA 3I9ZA 2NZCA 1Q7YT 3Q22A 5LSRA 3J80O 1RBOB 2D0AA 3DLLL 4LF5K 4JRQA 3C6UA 3K2YA 2NS1B 7FD1A 1FJ7A 2PN6A 1XR6A 1WDTA 3PEHA 3M32B 4GRSA 5L1LA 3CCUN 4FZYA 5ITHA 1DJ0A 4FZVA 4F4ZA 4DTJA 2DGQA 3BREA 3L4IA 1NK8A 4H03B 3DRXA 2VWKA 3H40A 2JSXA 3CJSA 5DZ7A 2VU5A 2CH6A 3PRVA 4RWWA 4CYUA 4F0HA 4DR6K 2NRWA 1R59O 1V3SA 3B82A 3VGKA 3LPTA 3TJ9A 1RE1B 3LWLA 1X0FA 4OZLA 1TKTB 1NK9A 4JKHA 3SPZA 3G82A 3DMJB 1RK8A 2H5EA 3OTCA 4EBCA 1RU2A 1U24A 1FESA 5DQHA 2WSFC 1YIJN 2UXBF 2FBXA 1HRHA 3HSJA 2HHHK 5KOWA 4DU3A 4CECA 1X5PA 4PCQA 4XAKA 4ANDA 3M1VB 4OX9J 1F5AA 1OS5A 1XN9A 3IGVA 1F1BB 3GIKA 1UFKA 3J7Z5 1TKZB 4TLRA 1M5KC 4CNYA 2OA8A 1U0SA 1BLUA 2QWOA 1SI9A 5BR9A 2LXFA 1RGIA 2VPZB 5FJ4A 1YRTA 2E5LJ 2W6LA 3CEDA 2FC0A 2X1GA 5HL7L 4KHPK 2HFZA 4O5BA 5D8HB 3I0RB 3KJNB 2UUBF 1ESVA 1D9DA 3HPGA 2BKOA 4CCHA 2VONA 2FLLA 5KFJA 2C28A 3H5SA 1HBOA 4NLVA 5DO2A 2K2PA 3SV4A 3D54A 4RZRA 2P51A 4WQ5C 1UVNA 1NJYA 5LY3A 3CNQP 1HQEB 1OPZA 1ZM2A 4MIWA 1ZAWA 4LR7A 2VGNA 4CO4A 4CIOA 3M3ZA 3UCUP 5M1OA 2CPDA 3V9XA 5FD1A 3C2PA 4UOHA 4PG7A 4YMEA 4OYXA 4B3SF 4ID5B 4OJ1A 4C8KA 3DU5A 2YWFA 3SZ2A 2HFNA 2E4LA 1HD1A 1XNQK 3K9JA 1KRPA 4QWCA 1SZ2A 1ZTTA 4CWBA 4JI8K 2UYTA 2AGQA 2BM0A 5HJYA 1WJ9A 1X4DA 3MPWA 1U1KA 3WQPA 4H0PA 3ATUA 2AX0A 4K2JA 3KTQA 1ASVA 5LMNK 2J6TA 3C7NB 2DCUB 2C1EB 3LAMA 1Q8KA 3MFIA 3G6ES 5I3QA 2POKA 4MKYA 2P9LB 2OPPA 2M0GB 4QCLA 4E7JA 5HATA 2XHBA 2HKEA 1WACA 3FBCA 4DSLA 2VQFJ 3MM8A 1FNOA 2A10A 2BBEA 1CQNA 1H0HB 3CFRA 2F7TA 4RUHA 2AYMA 2HBYB 4YEAA 2ZNYA 2OCEA 3NVMA 3KXDA 4FLWA 3ZEUB 2W7AA 3FZHA 4JI6J 1XMOK 2Y8WA 5AR0A 4RNHA 1LWEA 2HYIB 2G1DA 4B9UA 3R97A 4LF8F 4NLDA 1NOZA 2YKPA 1X4FA 1HR0K 3C6UB 3F73A 1FDBA 4YY3K 1R0CB 1T6CA 2QN6B 1SBRA 1S72S 3D6HB 2NCKL 4WYWA 4W5TA 2WC9A 2FTRA 4M5GA 1WEXA 3MR6A 1Y00A 2PYLA 1VQMN 3PW5A 1WNSA 2J6UA 4BWMA 3U1NA 2GHWA 2E9TA 1OSDA 4IDKB 4DS5A 3LUYA 1XNQJ 2ZJRQ 4FVUA 1RT4B 2GC8A 3O1BA 1AUDA 3CDBA 2K3KA 4FDFA 3OHRA 3T1HF 4IFEA 4ZPDA 2V9KA 3LDOA 2H3GX 3NCPA 4G1IA 2I7NA 1RQ0A 3CD6S 2RKIB 5C2FA 3ZETA 4DR3J 3GIMA 2CJBA 1K1QA 1BA0A 4ZHRA 5AE2A 4CJ7A 1S6UA 1S10A 4P7VA 4DKWA 2YHBA 3RW7A 3TEHB 2ZH6A 4WE1B 4ECQA 4CZMA 4CJ3A 3H2VE 1NGGA 3PG9A 4KHPJ 2IA6A 1MU2B 2HIQA 3QBCA 3I0SB 4CJSA 4ED1A 3TP2A 2Q2RA 3H3NO 2VWJA 1UCNA 4WFAQ 5B0CA 1Y5LB 4XPEA 1KWMA 4OX9F 4UOFA 4NLYA 4G1QB 2PEHA 3GONA 3W2VB 4W90B 4DR3K 3BEGB 4DJBA 4DV0J 1JXLA 1MDUB 3GJQB 4BGBA 3EYZA 1YBTA 4FN5A 1LW2B 3J7YP 3TUJC 3D1QA 3ENQA 3DJCA 2ZH1A 1VQOS 2G8HA 4OI1A 1JLQA 3HPOA 1WSIA 1RT3A 3MXJA 4GC7A 5HMXA 2ITGA 4LBHA 2XQCA 1YUWA 2OH2A 4N8OA 1NDCA 3BS9A 1W9HA 3B4MA 2HOEA 1UWBB 4LF4K 3B6PA 3SCIE 1IBLF 3LPYA 1AXQA 1Z4UA 4JRPA 3MMVA 2DNLA 3J81O 1U04A 3H3OB 1VSKA 2GHVC 2YHYA 4RW4B 2VA3A 6AT1B 5CXTA 5KFLA 3Q8PB 2DH9A 5T14A 3RZAA 4G1PA 4C7QA 2PE8A 1FRJA 3A8IA 4D3HA 2CGJA 3PYFA 4FM1A 1RILA 3QJPA 5C5JA 3CIMA 1R0BG 2LDIA 3MAAB 4JI3J 3O44A 4OMFG 4HTLA 2OYQA 1QVGR 3HVRA 3CULA 4JI6K 3MOZA 3HI9A 3M6GA 4GKKK 5LL6d 1HW9A 1SB6A 2RQ4A 1WSGA 4IOXA 4J9LA 3I8DA 4DR2J 1N5YB 1YBUA 2HLUA 2FZCB 1NKEA 3A3NB 3ATVA 5KPRA 3ZZ0A 1S77D 3RMCA 4A8SA 2FSNA 1DLOB 2HS4A 1UFWA 4U8YA 3VQQA 1EX4A 2DNOA 2YKQA 4JKCA 2CDQA 3I32A 4I2PA 1EXQA 3IMQJ 3GIRA 3AJ1A 2LEPA 5LMNJ 1VK8A 2WW8A 3D45A 2VL1A 2YPZA 1Q8IA 5DETA 3Q8VA 2FJEB 2G8VA 3K5MA 2P5GA 2HHSA 1ATRA 2V68A 2BE7D 5HOOA 4X66J 4WK1A 3PM9A 2GBZA 2HG4A 3R5GA 2AX1A 4QIWD 4YOUA 4YFUA 4PKIA 1OH8A 1HNZF 3ZT0A 4BRGA 2N7CA 1B3TA 2P5VA 3KLHB 3QLHB 2FC9A 2XMTA 4CYUB 4DL7A 3CCEN 2ROGA 3EXCX 3RB0A 1AFJA 4C8OA 1X4CA 1YI2S 1BCMA 1YXQA 4M3XA 2QJ3A 1QTMA 4IG3B 5KFKA 2Q3SA 4YB6A 4E1NA 1Y64A 3V9WA 3QNNA 1SCJB 4OZ2A 2BUNA 2DGUA 1ASUA 1WHXA 4NLPA 3WC2A 2PA8D 1D8ZA 3BGFA 1KHVA 3HHLA 4KI6A 3KMQA 2U1AA 1IBCB 1WUAA 3FE1A 4MH8A 2DPNA 4ED2A 3AQOA 1VQ5N 3MWBA 1VQNN 2CG8A 3L2QA 1Q5YA 2HNYB 3W9HA 1RWMB 1W7AA 1S0NA 1X1PA 3M8ZA 1IKWA 4JI8F 2M88A 2YQ3A 4IQXA 1TUVA 4OI0A 2YHXA 3SV3A 2AW0A 2OTJN 1EQ0A 1QS4A 1ZZNA 4KO0A 4OPAA 1VK3A 1PG5B 2XLIA 4OYAA 2PMZD 1IBMK 2ZBIA 2VJUA 1VRUA 3OL6A 3FEXB 3RU0A 4DTPA 2EKYA 1SV5B 4ICLB 2VYPA 4CEQA 3AJDA 4RWXA 4ED3A 1T0TV 4UZBA 4J91A 2HQCA 2V67A 3BYRA 1WHWA 2D41A 4OJ3A 2VG5B 4Y1DA 1KBRA 1HBUA 3KNGA 1RWUA 1Z1ZA 4OYZA 3ZTQA 3AVHA 3PRBA 1FRIA 3QSYB 2JNJA 2DGWA 5AE3A 3OLAA 1N36J 4ILJA 2QM1A 3UE2A 1P27B 2GMJA 3P49B 3UQSA 3UKUB 4M42A 3R6MA 2QXFA 3AGRA 4FWKA 1H6KX 1FK9A 1UL3A 2OPRB 3UKRB 3ZX0A 3NMUA 4JI0F 3FRYA 4MJKA 4CFDA 4NB4A 2M3DA 1F9FA 2RRBA 3T3FA 1Q81T 4OKJA 2PFUA 1M1KO 4IDKA 2DYAA 2LA6A 2R2RA 2VF3A 3KUHA 5KAKA 2B6AB 1QQNA 2EFGA 3KHLA 2FLOA 2CAJA 1UJ5A 2ZJQL 4C0OC 3QFWA 3CXCM 4NLOA 3GCXP 3W9IA 3TYTA 3J7AN 2E6LA 1D09B 4NEZA 3LP2B 8AT1B 3NBPB 1FNMA 3HHLC 3A12A 3NKYA 1TUYA 3JXUA 3CDUA 4ZP8A 1JMTA 3GSDA 2AEMA 3A3PB 5CR4A 2PI5A 3JTNA 4ZVGA 3PW0A 2A2CA 4O0NA 4IFYA 4JI2J 1REVA 1LQ9A 3DDIA 3G6YA 5A2QO 4ZJOA 3MAQA 1KVBA 3POTB 4FP9A 3M2UA 2V6AA 1S6PA 5DK5A 4BRMA 3VAIA 4B3OA 2Q36A 3AVFA 4DV2J 2XY6A 3I5BA 1JLCB 4JI5F 4KE5A 3POTA 1WWHA 2GVDA 3OJUA 2AKWB 4FBUA 3NWRA 4DV4J 4B8CA 4OPKA 1GOBA 3LPEA 5HVFA 4WCEL 3AQPA 2ZF5O 4NRTA 2XMVA 2Y1JA 2BZ2A 2EHGA 4DV3K 2XGQA 3VZHA 1P1TA 3C95A 3K89A 3M8YA 2KZZA 3K59A 1RHQB 1KVKA 3AA3A 3V6HA 4BR0A 1DRZA 3CSKA 2VFTA 2IRXA 1LW0B 2VFRA 2HZVA 1HPZB 1YJVA 2BJ9A 3MR3A 4DU8A 3D0IE 4CF2A 3R5DA 2QRRA 2YNGA 3VAMA 5ETSA 1C1CA 3ZEUA 4B8AB 3LANA 4BE2A 3NNCA 1HX1A 4BGAA 2VQEJ 2NUHA 4DR1J 4NXMK 2KT5A 3W5XA 1Q7LB 1FI4A 3EMTA 2CPEA 4M3UA 1L3UA 2ZVIA 4CGJA 1HWLA 2Q43A 1TL5A 3H25A 3EKUA 3SQ0A 3AD8C 2D3ZA 2FGCA 5EX0A 3QAEA 4DI6A 4PKHA 2BE2B 5AQRA 4CIGA 4FKYA 4KH0B 1O5JA 5MLCQ 3KWIA 1TUUA 3F56A 4CLLA 1R3NA 3DC2A 3CJRA 5D4OA 4R79A 2QWNA 1UJ6A 1FWPA 5ADXA 5ETMA 4Q8FA 4DU4A 4EP4A 1CLQA 2BEFA 3M8PA 3ULHA 4ECWA 1LWEB 4KY3A 3NMRA 1ZBIA 4X4NA 5C25A 3PTWA 4QIEA 1WEYA 4ZVEA 1VFJA 2B7CB 2Q79A 2ZOFA 1CJKB 2UUTA 1UVMA 3KIOA 2MY8A 2O8BA 4OLAA 3QERA 4BQZA 2WOMA 1BY9A 4NASA 2F40A 2BUPA 2UVRA 3UB5A 2VQFK 4ZTFA 2WBMA 1NLVA 3PJWA 1JJ4A 4ED5A 1X0PA 4FVMA 1XR7A 1F6TA 3W63A 5DG9A 1SL0A 2Q66A 5J2QA 1KP6A 5M2RA 3LDLA 4ILMA 5C24B 3O5BA 2JOQA 1HNIA 3DM2B 1KTQA 1Y5NB 4P52A 1SH0A 5ETLA 2HQGA 2CRLA 3VGUA 3GCWP 3RMAA 3KK2B 3NXZA 4BC7A 3J81U 2C2OB 3MMBA 3VEZA 3KHRA 4KB7A 1LOUA 2C2DA 3RBXA 1U45A 3A3OB 2W8LA 3EZUA 4WKYA 4PABA 1IR1A 1T3OA 3MCNA 4HEA9 1BI4A 3J80Y 1T9TA 4LF7K 4CTAB 4QOZB 4J9UE 4MT1A 4WQ5A 3VEYA 4B3RK 3ZSYA 4OI6A 1DFDA 3AO1A 5HRPA 5EX3A 4NMXA 1T44A 2X6NA 1IH7A 2UXDF 2DKOB 1KEKA 3QJLA 4KTWA 4WTOB 4USVA 1VBZA 4K4YA 4EFHA 3SUQA 3KDNA 4DR4J 1FHTA 2HFVA 2QYGA 1EWRA 2RE2A 3CPWR 1NPPA 1WEZA 4NMLA 4JNEA 1RADB 2P9PA 1FRKA 4BRFA 1HBOB 2WZ1A 3B54A 1RWOB 2C2ZB 4OIXA 4BE0A 1ULRA 1FXDA 1RAFB 4JI2K 3CJ2A 1J5EJ 2VA2A 4FXWA 2L9DA 2D0BA 3GILA 1A5WA 3CTRA 2E1YA 2E5LK 4BVOA 3AA4A 1ZM9A 2EBGA 2OLWA 4DU7A 1MWQA 4CT8A 2P9IA 2UUCK 1KOHA 4I0WA 4IRDA 3GFZA 4JHDB 3W61A 3KFWX 4OHXA 2P9UB 2O8CB 2VUGA 1LWXA 4BRNA 1F3VA 2AGPA 3WIVA 4J8FA 3OL9A 1YLXA 2QKKA 1U09A 4MDAA 1A6LA 1F9EB 3A5NC 2YX4A 2QXLA 3CF5L 2DGOA 1AZSA 3MEGB 3SCLE 1I94K 4HT5A 4JI5J 4CF8A 2WB1D 5ETTA 1HHSA 1IWAA 4X64K 1TR0A 4PXDA 3WNHA 3SSSA 2PSZA 4LSZB 1RYSA 1K8KB 4ZN1A 4KTQA 3CJTA 5HP1A 4ILLA 3QATA 3RRGA 4HKQA 4ZMMA 1XBWA 2E9RX 1RT7A 1OVQA 1SKRA 2GV1A 3M2VB 4JV2A 2BOAA 3T1YK 4X65F 3KD1E 3TQEA 5AXKA 4ZA1A 2CJXB 2W25A 2ZC4A 3L95X 3V1RA 3SCJE 4FLTA 3A8EA 2F65A 2J7WA 4AD6A 3LP0B 4FWMA 2LLZA 4WFNL 4X4QA 2EEYA 2IM0A 4A57A 1JIHA 2B3TB 3LP1B 1Q7YO 2ZWHA 1FO1A 4DV5F 2P9UA 3NGKA 2MLXA 4CGHA 4Y2AA 2HHQA 2ZE2B 1RT3B 3E9OA 5F9LA 2GWKA 2KJVA 5KFTA 4H4KA 4RO0A 4RW8A 1UPMB 4YR3A 4ZS6A 3I56N 1KHWA 4CRJA 3H5YA 1EB0A 1B70B 2DHHA 3BY5A 3E01B 4LF1A 1O1WA 5K8MA 1UVKA 3JSYA 1X3NA 2PFDA 2ZKTA 3ZNUA 4WFZA 2WVBA 4ZVRB 4N56A 4CEDA 4P2MA 4IJAA 1LAVA 5IM0B 4EO8A 2KXNB 5LMNF 4MO4A 2GUIA 1S1WB 1YWXA 3M9MB 4DV1J 4ZN3A 4KRFA 3FCWA 2ZGZA 2OJ3A 4K4VA 1S1TB 3K9KA 2FVSA 2VCPA 3KK7A 3PSIA 1BHNA 4ZPBA 1L5UA 4KHUA 3BF1A 4J2BA 4PG6A 4QYZJ 2G0JA 2ZH2A 1QE1A 3EGZA 1IKYB 5KFEA 1ZBSA 4YHHK 2Z2MA 2CYYA 1D8YA 4A8QA 1YVUA 3L2VA 4IYQA 3NLCA 4FWRA 3V81B 1BCOA 2RRNA 3LTOA 3PZPA 4Y1CA 3Q2TC 2FQQB 4J2AA 3EY1A 5AJ3F 1RDUA 4YY3F 5E26A 1OPIA 5HN0A 1BU6O 2CQHA 2AU0A 1IV0A 4JI4J 3VA0A 4H5TA 1ZZFA 2UXBJ 3CDAA 5EWGA 2CUYA 2G1HA 2E1ZA 4NLWA 4U7UD 2JHEA 5H1SQ 3MR2A 4PHTX 2F96A 3IBFB 1FRHA 3ULDA 5KG6A 2VG7A 4OX8A 2VH7A 3CCZA 4ISFA 5KFMA 4M5IA 4UT4A 2ALYB 4OFZA 1WC4A 4J9KA 3J81j 1AROP 1N8RO 3T6JA 3LL3A 4RW4A 3EZOA 4AT1B 3THYA 4YN3B 3QB0A 1H98A 3L8BA 5EWFA 3M6UA 4LY7A 2K1RA 1GLDG 2AJ0A 3HYFA 5LXRA 1OKJA 3O3FA 1SH3A 3QEXA 2VBZA 4C3LA 4RNFA 3MX5A 1VQ6N 3G4SN 2OKQA 1XNRF 1K44A 2CH5A 2RJZA 1CJTB 4TU9A 3DGVA 4C8NA 1K6YA 2MZTA 2HHHJ 1VQ9N 2VFVA 4DQIA 1U1QA 1VQNS 1SH2A 2E2QA 2ALZA 4CZJA 5T7LB 3DDNA 3ONQA 4V19J 4WCEQ 3TZYA 3VQPA 1IG8A 1JLGB 5H1SV 2DFFA 2RDIA 5EX5A 2N3OA 2E44A 2W40A 1X5TA 3ZZTA 4B9NA 3AV9A 1SQGA 5B08A 3SNNA 1ZBHA 4KKOA 1P9YA 5DZ6A 2QWLA 3VOVA 3O8MA 3DOKB 4XH4A 4L75A 3OTDA 1H2UX 2B43A 4FNHA 3RUBL 4Z94A 4KB1A 3X3UA 4KRWA 1ZETA 1MSWD 3W8PA 3IFEA 4BC4A 3M4XA 3EM1A 1HQEA 1ZPVA 2DB1A 4ZVSB 2NSCA 2AYEA 3PKMA 2JVOA 4U7UK 3TEGA 2X1FA 2AYBA 1UAXA 1NG9A 2W2OP 2O8FA 3CJ7A 3G0ZA 5I42B 2A3ZA 2ILZA 4QWDA 2YVSA 4Y34A 4BRDA 2YWKA 1IBMJ 3FC9A 1MG7A 4C97A 4A8KA 3AA8A 1RTDB 3CC4N 4NYPA 3OUYB 4DSJA 2BW7A 3CUNA 2FB0A 3VN5A 3H5UA 3NF7A 4JKBA 3A5OC 3HT3A 3I8BA 2KU7A 4EU0A 3ZZUA 2ZH4A 1WNEA 2PFFB 4OJRA 3DWLA 1UZDA 2MGZB 1X7VA 3UKRA 2P2CB 3WXIA 1RP5A 4YOXA 2R2TA 1BL3A 3RAQA 2W2QP 2XWXA 5F41A 4QS8A 5DLFA 4RU9A 1P6TA 1N88A 5CQGA 2GW8A 3OYLA 2FJAB 2YX7A 1CZAN 4KT0C 3DLEB 1V4SA 2XNRA 3NGUA 1VBYA 4Z37A 4F3MA 3BGLA 4ZLLA 4NCBA 1NEEA 2BOPA 5DG8A 3F44A 4LF8J 3HSCA 2QA4S 4JI7F 2HWTA 1Q9XA 1UJ4A 1RHKB 4RCHA 3R2DJ 2GHPA 1Z26A 1U1PA 2GNKA 2JLFA 4PRFA 2DFHA 1J54A 2KT2A 4FWPA 1GXLA 4JI6F 2HVIA 4IKAA 1NXIA 4K8ZA 2RHKA 5D15A 2WVDA 3O9QA 3PACA 4JI3F 5FDLB 4OV6A 4IKFA 2PBDA 4KKOB 1NKBA 3MEDB 1SJ4P 1JJHA 2BQRA 2V2ZA 2CQ4A 2KM8B 1SJRA 1XC9A 4JD2B 1ZH5A 5GIOA 4CO5A 1K8AT 3FQKA 2DHXA 2ZBQA 5KTQA 3HI0A 3R6LB 3VQ7A 3SUPA 3EVOA 3DXBA 3AVNA 3B8HA 2XHCA 3E01A 1I1GA 1HKAA 1HNVA 1HI0P 4FPIA 4WFNQ 4RUAA 2VOPA 1RHUB 3C65A 2DXDA 1ATNA 5CD4H 5ADXH 2P9IB 5FRNA 1CJUB 4DPUA 4JBCA 2YWWA 1S72N 3G9CA 4F3OA 5AQNA 2QLWA 5C42A 1DHMA 1BQNB 1VQ8S 1SC4B 2NR0A 1YBAA 2GQ2A 3H90A 4OZNA 1DTTA 2RD5C 4DR7F 5D4LA 4EFAC 3DGPA 4HI2A 4WTYA 2CZVC 1FD2A 3Q8RB 3VCDA 1DY3A 4Y00A 4L73A 4UY8O 1RT5B 2O3DA 3VGMA 1E6YA 2LCWA 4JB8B 4XPCA 4DOZA 4KHPF 5KG1A 2R3VA 2CGLA 2FUG9 2V63A 4R0JA 1BC6A 2CJYB 2CPZA 3P6YC 1IJFB 2HMPA 4WYLA 2I6WA 3ZTPA 2VKZG 1GLBG 1PSDA 1RTJB 4HVJA 4IR1A 5A6PA 4O4RA 3L6QA 4FPBA 2OIHA 3S3MA 2G8WA 3EUNA 2HF3A 1JCFA 1WSJA 3M8WA 4FLXA 4GNIA 2XWYA 3M32A 4JP8A 1HNWK 4YDUA 4O3NA 3P45B 3FZMA 2B5JB 4KV8A 3W2WA 4EYHB 4DFMA 4DR4F 4CJUA 2MQLA 1S1TA 4MAKA 2UXCK 4FK4A 3LDQA 3NGYA 1U2FA 1HQUA 2DR8A 3QBXA 2KYZA 1G2EA 2FIUA 1NSQA 3DXMA 4M5NA 3LOUA 2ZZMA 2V51B 2XS2A 2CQGA 4J9PA 2NXJA 1DBDA 2Z8QA 3N4PA 3MI7X 3CJKA 5IFMA 2AT1B 5AQQA 3I9V9 5BYSA 3A0IX 2C3MA 2BJDA 2YHWA 4K2XA 1TK0A 3BZCA 2BJ3A 1HI1A 2NRZA 4Z4IA 3TABA 2R7XA 3OS0A 2NZ4A 5D3GB 2V8HA 4OYIA 2EBEA 5D77A 2NNWA 2L9NA 5KRSA 1GAOA 3F41A 3SQGB 1M1KT 4GW6A 3MHYA 2ZHAA 3ZSRA 3AY9A 2EG1A 3R2CJ 1QVFM 1G1XA 1UVJA 3QINA 3PNIA 5LJVA 4I2PB 4KGZB 5L1KA 3DRYA 4AUKA 3EPIA 3BPSP 3CJAA 3G71S 1RUSA 4FVCA 1HNWJ 4DMNA 5CH7B 4NA2A 3CQ8A 1BMQB 4C9DA 4F0MA 1HBMB 5E3QA 1URNA 1PJ7A 1ZXOA 4CGIA 3GYNA 5IT4A 2OANA 4IH7A 3OJSA 4C3MA 5KT5A 5H9FJ 4CGDA 1XK8A 3CPWM 2P6SA 1WOQA 3GWCA 4XDDA 2BE2A 5F9NA 4P2XA 1FWKA 3HHLB 4ED8A 4DQ8A 3AJ2A 5SZTA 2UUBK 2QWMA 4X64J 1HPMA 5HRNA 4J2EA 2OPQA 4OO1J 2E8AA 3D9BA 4OGCA 3CGIA 2EI5A 4QPTA 5KQ8A 4TYAA 2FYXA 1LWFA 1QM9A 2PD1A 3ZXWA 5AQWA 1T05A 3MN7A 5BPNA 1OY6A 1RWKB 2ASYA 3BDEA 4OJGA 2UUAJ 4ZHRB 4M3YA 1LK7A 3GYXB 1OH7A 5E33A 3FK4A 2WHOA 5M1PA 3CMES 4MIAA 1VSDA 3MM9A 3T5LA 4RW9A 2K7KA 2GTDA 4JI1J 4AQYK 4H4KC 1BHLA 2HGNA 3OA9A 4GKJJ 2V94A 4OYOA 2LXUA 4GO5X 4B3SK 3QETA 4A62A 1FJGJ 3OFFA 2KZMA 1GMUA 4V1Ak 2ZDPA 4ZPWR 4AE5A 1R31A 1N34K 1J5EK 4DL6A 1W2BM 4LF5J 1XHZA 4NCGA 4PWDA 3HFZB 3PHTA 3DKDA 4DV6F 2HNDB 5KQDA 1QLNA 2GAGC 3LA0A 2VWBA 2NXCA 1H3DA 4NI2B 3FDSA 2MKYA 3HMJG 1YRXA 4X64F 4M41A 1R0AB 2YI1A 4FF3A 1NK5A 1TL3B 3KK1B 4USWA 4FF1A 1KR4A 2E20A 4J9NA 3PLAA 1WC6A 3AVLA 4JI4K 1CLFA 5HRSA 2YBVA 3CE8A 1GXUA 1N56A 3LP3A 4ZKAA 3CFOA 2IRUA 2ZITA 5LXYA 3UN5A 1CZBA 4LT6A 2OFGX 4A8MP 4ZVQB 4RW7A 4M3ZA 2B4PA 5FIIA 5B7WA 1N32K 4LRAA 4CGFA 1RSCA 3D6FB 1FD8A 2JGUA 1RA7A 2VV5A 3SSQA 1IKVA 5ADZA 1EETB 1RAIB 3ZETB 3TUZC 4KH4A 3H5XA 2DGXA 1RCOB 3O5TB 5C2DA 4F36A 4L3QA 1VJWA 4CHOA 2ASOA 4ETXA 2O8BB 1OY9A 1Y0HA 1ZBLA 1FRLA 4B1YB 2IDLA 4ZTJA 1HHTP 1F21A 3TTDA 3CCVS 1SC6A 1IKVB 3G8SA 1BWEA 1RTIA 3FSIA 4PG5A 3EPGA 2W6KA 4CEOA 3J7YU 3JSMA 2N82B 3FR0A 2DO4A 4MK9A 4CF1A 1C4AA 2VQEF 2AGOA 3HJFA 1WG4A 3CCMN 1BD6A 1JLBA 1ZAXA 4P6QA 2Y9HA 4LF4F 1GMWA 1HKCA 3H1VX 3TI0A 2XCPA 1KONA 5E2QA 3OFEA 5EVZA 3O9SA 3M1FA 3BKUA 1X3MA 1NDLA 4FJ7A 2R9LA 3OPKA 2OZMA 4F4XA 4QR1A 2RUSA 4B9QA 4A5AA 3QESA 2CPFA 2QA1A 3DLGB 1QUVA 2KJWA 4LH4A 2RHSB 3HM9A 5KOXA 3H42A 1TFYA 1UVLA 2E2OA 1M5SA 2W01A 5KPZA 1P9QC 2V2KA 1TL3A 4B3MJ 4H5WA 2D0PA 2EFVA 2FJWA 1RT7B 1KLMB 5F8GA 4YP3A 3AA2A 3KLGA 3ID6A 3E51A 2O8EA 4L3NA 1T3VA 3QAUA 4YNQA 1R6VA 3QT5A 2M2BA 2FHJA 2YNGB 1WBBA 1PYSB 3N6MA 2HS0A 4K7QA 1WTFA 4LF9J 3WX8A 5AQOA 5E84A 3M2RB 3NHGA 5KG7A 1UTAA 3FMBA 4PYAA 1VQKS 4E0DA 3SMPA 2JWLA 4O44B 1BQNA 4M1KA 1VSJA 1FJGF 2VBYA 2NYHA 3T1HJ 4QQBA 4BC9A 4FW2A 5DQGA 1YJ9N 2DIVA 3AXKA 1YZ6A 3NH0A 1S3XA 5K8PA 1YQHA 2VD3A 5KFHA 1N48A 3C66A 2JL9A 3MFHA 1VISA 2O4IA 4DS4A 1S4EA 3SCXA 3KKFA 5GAHI 4CF0A 2DNZA 3TOQA 4HLBA 4ZVOB 4AHUA 2MQQA 2OUGA 2V69A 4N47A 3WIUA 1REVB 1FXRA 5M2PA 2XSFA 5D0GA 1WC1A 4I6MA 3TX8A 3T5JA 4L3KA 3SQOP 4WK3A 1M90T 2BE9B 3MN6A 3N4WA 3ZZPA 4YUDA 1FRMA 5KFGA 3QSIA 2VICA 2AA4A 2KB2A 5IXUA 4F2SA 2HHVA 3UVJB 4QYZK 3JTOA 2BDPA 2B51A 2KL8A 3VV2B 4CO2A 5DM6Q 2RN2A 3S3OA 4WF9L 1RDDA 4JV0A 4Y2KA 1IXKA 2QL5B 3AODA 1NKCA 4ATNA 3HKZD 2DNQA 3H45C 2FVRA 1YJNS 1X5SA 1TQLA 3BN7A 1FK9B 5I3UA 4AFFA 3M9OB 3AOCA 3CCJN 2IC3A 1JJCB 1Y9OA 1RWWB 2Q6BA 2PIIA 3OD2A 4DL4A 2AQ4A 3SBGA 1VQPS 2CQCA 2EPIA 2PGCA 2GIQA 4DR6J 3FUYA 1ZAVA 3MMBB 5U47A 1ITPA 5GAGP 5AQXA 1VSEA 1CQMA 3QICA 4ZP6A 3FGVA 1XC3A 1VYAA 2R7RA 2D1KA 4YOEA 3PSFA 4R25A 1RDAA 1PBAA 2JC0A 1QHAA 2WRMA 3GSIA 2IVNA 2YNIB 3CF5Q 5KFZA 1HNVB 4O23A 3CCLN 1CJKA 2CPJA 3IP0A 3WXKA 3VGVA 5F1XA 3EICA 4USMA 1PKUA 3EO3A 2LA4A 4JV5J 3MCOA 4HL9A 1QSYA 1VLOA 4WXOA 2JFKA 4F3TA 1LFWA 2KFYA 2DCLA 3SMSA 3CYMA 1GEHA 1BA1A 4IUFA 2BYCA 1LWCA 4OZ1A 2YY3A 2KTQA 1ZC6A 1VSIA 3KJQB 5A8KB 1VQYA 1O6XA 4KPYA 1RJJA 4M8LA 3HPHA 3ISZA 1E6YB 2KT3A 5LJ5Y 1S9GB 1WKKA 1F2GA 1Q82O 4L6V3 4CLSA 5HP1B 3RAXA 1AZSB 4C48A 5JS2A 5KFAA 2DVIA 2G13A 1U1NA 1HWJA 2V8GA 4EBEA 5K14A 1L3KA 3M05A 1VK0A 3VQ4A 3E2EA 5IT0A 2AEFA 5HQLA 3ADAC 4H8KA 2UXDK 2O8CA 2HSEB 1VS3A 4RL1A 2UP1A 4FLZA 3D0PA 3S8SA 4YDUC 3KVGA 4FK0A 2C2NA 2LFVA 4CO3A 3WXLA 4UOGA 1YF5L 1B0TA 5EUHA 3C8YA 3VGTA 4JKGB 1RKIA 5E7OB 4DXLA 2JH3A 4I6AA 4ED6A 4C8ZA 4IEIA 1J5OA 3JQKA 1TFWA 1HJRA 2F9TA 4EAHD 2KVIA 4DTOA 1CPZA 4FSVA 3BO2A 2NRVA 2OI2A 4PQAA 1HNZJ 3EZWA 3ZC4A 3V6JA 1GH8A 3D3CJ 4DV4K 4BRLA 4ECYA 3KK3B 3QZ7A 2LQBA 4W5NA 3VAJA 3CETA 1P8ZA 5AE1A 3BV8A 5I4MA 2XRIA 1IKXA 3O3GA 1KXPA 1VQ7S 2GVDB 4Q0BA 2HZCA 3HZGA 4P9SA 3W62A 3BJYA 1XR5A 1CXUA 1E4FT 2J8AA 3V1OA 2QX0A 1YK9A 1TTHB 2IYGA 4JYAK 2DXEA 1J53A 3VHQA 2AF6A 4WFYA 4DSIA 5D4NA 3D6TB 3C94A 1S1XA 4O3SA 2HBQB 4O3QA 3DLGA 3TAMA 1VHIA 3R5BA 5GMKa 4FYDA 3CCMS 4FLYA 3TZWA 3ILOA 3ZYYX 3HFKA 2QLXA 1AA1B 2QLFB 2XLJA 3OVSA 2GZOA 4KH6A 2EKNA 1NDKA 2FGOA 4DLEA 4U95A 3UDCA 2HHTA 3GL1A 3O6WA 2GX8A 4LMZA 1QSLA 1VQ9S 1N5YA 4KBIA 2ASDA 2RVJA 4B1XB 4FXDA 1M1GA 1RDBA 3IBWA 4NXMF 3DLEA 3Q86A 3TA2A 3VERA 5B0EA 2VASA 1X4HA 2Y0BB 3RSEA 2CDRB 5BN8A 4HI1A 4M5JA 3I4HX 1LCUA 4FKXA 5DM7L 4AH9A 3MOJB 5GAEI 1GLFO 3DHXA 4DV0F 3C15A 3KLEA 1RTHB 3KK3A 3HX9A 4YY3J 1U26A 4XTTA 3ID8A 3Q0AA 4NLGA 2NYIA 1QQCA 4LF5F 5CZ1A 3I33A 1N34F 4LIWA 4BS2A 1NGFA 4C8YA 3K0SA 3I31A 1R8CA 2JZ5A 1S5JA 3AHPA 3KLFA 2VG6A 2DHAA 3NG8A 1UWBA 3OTOJ 3L3UA 4AXIA 4JKGA 5JLHA 1VI7A 3WT0A 1W2IA 1Y97A 1GQEA 2E7VA 1LWFB 3OBWA 1GOCA 4CJ5A 2YWHA 2VG7B 2QYCA 1OWXA 3NNHA 3PR4A 4FYYB 2VODA 5K14B 1TU0B 2OAUA 2F1FA 4NLQA 2UUWA 4FS2A 3ISND 1HMVA 1IR2A 2VOOA 3W2VA 3A4TA 4PQUA 1CS4A 4FYWB 2V4RA 3EE8A 2WB4A 3RB3A 1RTZA 3I55N 2M8DB 2F3JA 1N8RT 3PFOA 3HHLD 4NXMJ 3LO3A 3PYGA 3EEQA 3DN9A 1LWCB 3P39A 1JL1A 3L7OA 5GADP 5KFIA 5GADI 3U1MA 3QEVA 1X4BA 1KOOA 5LJ3Y 5EU7A 4DG1A 1UKUA 1RAJA 4KHQA 1I3AA 2HSTA 5LMUK 1PAUB 4OZJA 3CC2S 3O9UA 3HHDA 2JFDA 1XERA 4UUXA 4R8UB 1MWMA 3ENHA 5G0RA 3F9KA 1H73A 4Y3CA 2HBZB 3ZZZA 3SFGA 3K8WA 4DV3J 1BOTO 4YHHJ 1N5TA 3G8TA 4DTNA 5FLXU 4IH5A 1XMOF 4BHQA 3OYNA 2ACMA 5CD4A 4ID8A 4JKEA 2ATCB 4ID5A 1SJQA 4V19X 4CK3A 1FXLA 1QTNB 2MPUA 3P96A 3BKTA 2IA0A 3U27A 2KM8C 4W5OA 4DX5A 2JEFA 2ZM6K 2HBLA 2MSSA 4AXJA 1YGYA 5HVHA 1LXNA 1K9MO 2XY8A 3KWMA 1R43A 3HP9A 2CQ1A 4WU2A 3L4QA 3CQXA 2OELA 4R5PA 4JKAA 1B0VA 4GVEA 1U2VB 4CBWA 5KRTA 4I56A 1QE1B 4PR6A 4QR0A 1T03A 1XNRJ 2YX6A 1KQGB 4Z7YA 1HYSB 3AY0A 2MDAA 2ZOGA 4LF9K 5E3PA 1RWPB 2KXHA 2R8GA 3DNCA 3GYGA 4FJHA 4ID1A 4JK9A 4DL0C 5IM0A 5E3CA 3SDEA 3CMAS 3AVMA 4H0XB 3DI6B 2DGTA 1CEZA 3NH1A 5AZIB 2CQPA 2M9KA 4CVNE 4ZLNA 3R5JB 4PKGA 4G9ZA 3MM5B 4OZ5A 3FZKA 4WQ4C 5JVGL 3G86A 3CXCR 5HRRA 5AQLA 4BRAA 3T9ZA 1TAQA 2E1CA 3MPVA 1KFSA 3M6XA 4ZCIA 5E3RA 4C98A 2QTDA 3QIPB 2P1JA 4NEYA 1SXLA 4FJKA 3UWTA 2ADCA 1U6ZA 1T9UA 3LP1A 3HKWA 4ZVHA 1YHQN 2COLA 4R8UA 2CFXA 3THTA 4Q45A 2OHDA 3AA9A 2VJVA 5KGWA 5JUMA 4DPYA 3D2FA 2YNIA 4IFVB 5KT4A 2W8KA 3WC0A 1KSPA 1XNRK 1CC8A 1G6BA 4LRBA 3PY8A 5J1EB 4Y0WA 3LZIA 3CVKA 3UD3P 3WEEA 4JEPA 5BPLA 3CI5A 4BCAA 4P2FA 1MA9B 4CHYA 2MTLA 3GB0A 2KDOA 3DDKA 1HW8A 2UUCF 2Z1GA 1VR6A 2MQPA 3MMCB 5M1FA 1RFQA 1D3WA 1HWIA 5ETPA 4M5DA 4IOCL 3N01A 1V9OA 3D6MB 3S41A 3VENA 5A8WA 5BYQA 2VBXA 2M5YA 2D3OR 2W7PA 2IMOA 1EKSA 1XMOJ 3OYCA 3QJJA 2P9SB 3D68A 2KG1A 1VQKN 3I55S 1Y5IB 1YT3A 3JAMO 5KFBA 1VRTB 4OV1A 5B0FA 3CCWA 3P38A 3ILIA 4P10A 2GWJA 1M90O 2ZUAA 4KB0A 1TGOA 3ZTRA 1KQSM 4QW9A 1U1LA 4J5OA 4C0BA 2MQNA 4AL6A 4B3TJ 4ED7A 1TL7B 1RTIB 2H5IB 3PHEA 4BLGA 2A18A 3KLHA 2VPXB 1VHXA 3AO2A 4XH1A 1FEEA 3G82B 2VPWB 3I5CA 3OYIA 5DDOC 1HBNA 5HJXA 2R7YA 2DHSA 3OSNA 3CG7A 1EQYA 3OYMA 4Q44A 4FPAA 3H2UB 3BPDA 5F3ZA 5CABA 1S6PB 3SXLA 1C1BA 2C3YA 9ATCB 2CNKB 1S22A 2JDJA 3MN9A 3M6WA 2PA3A 3A5LC 1VSFA 1IBMF 2ZD1A 4ZDNA 2BW2A 4KSEB 5B0GA 3HVTB 4IZ9A 4CZHA 4ZVUB 1U49A 1KVIA 1H7WA 5CYQA 3THPA 4WFAL 4J2DA 4MMOA 1BI4B 4DV1F 1FKOA 1SQEA 1PYOB 3S3NA 2K7JA 3L2WA 3BGOP 4X2BA 2H5JB