1KLPA

The solution structure of acyl carrier protein from mycobacterium tuberculosis
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
115
structure length
115
Chain Sequence
MPVTQEEIIAGIAEIIEEVTGIEPSEITPEKSFVDDLDIDSLSMVEIAVQTEDKYGVKIPDEDLAGLRTVGDVVAYIQKLEEENPEAAQALRAKIESENPDAVANVQARLEAESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of acyl carrier protein from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligand transport
molecule keywords MEROMYCOLATE EXTENSION ACYL CARRIER PROTEIN
total genus 16
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2001-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1klpA00
2MF4A 4IZ6A 2FVFA 1L0HA 2L22A 2VSQA 1KLPA 2FVEA 2KOSA 2N98A 2KG6A 2AVAA 2L9FA 4BPHA 4HKGA 2KGDA 2AFEA 2LKIA 2K2QA 5HVCA 2MVVA 2EHSA 2N5HA 1NQ4A 3EJBA 4R0MA 2KOPA 4BPGA 5HV8A 2KG8A 3GZLA 2MR7A 2JU2A 2N5IA 1T8KA 2FACA 2FQ2A 1HQBA 2N6YA 1L0IA 1X3OA 2N50A 1DNYA 5EJDA 2KG9A 2KORA 2MD9A 2CG5B 2K93A 4H2WC 1AF8A 2GDWA 2K92A 2L0QA 2XZ1C 3RG2A 2KGEA 5KP6B 2LMLA 2FQ1A 2LOLA 2XZ0D 2GDYA 2K0YA 2KWLA 5KP8B 2JGPA 2FVAA 2JQ4A 4DG9A 2PNGA 2M5RA 4CA3A 3EJEA 2LIUA 5CZDB 4H2YC 2CQ8A 2KOOA 2LIWA 2LL8A 2FAEA 4BPFA 2EHTA 2KR5A 1OR5A 2ROQA 2CGQA 1F80D 2AF8A 1HY8A 2LPKA 3GZMA 4PWVB 3LMOA 2X2BA 2LTEA 2MY5A 3CE7A 2MR8A 5KP7B 2JU1A 1VKUA 2KGCA 4PXHB 2L4BA 2KOQA 2KW2A 2AFDA 2KGAA 4NEOA 1ACPA 1DV5A 3EJDA 2K0XA 2N6ZA 2MVUA 4H2XC 2FHSC 2DNWA 2QNWA 4MRTC 2FQ0A 2K94A 2CNRA 3NY7B 2GDXA 2FADA
chains in the Genus database with same CATH superfamily
2EFJA 2NO8A 1K9MQ 1W2BO 2VSQA 2KOSA 5F2KA 2L9FA 4COPA 2KGDA 1CEIA 2GZFA 4BPGA 1VQLP 1UJZA 2KG8A 1M1KQ 2JU2A 4QNBA 2QEXP 1RNIA 2N50A 1Q86Q 2OTJP 4U0AA 2KG9A 2CG5B 1YITP 2GDWA 3CCMP 2XZ1C 4IPYA 1VQ4P 2VLQA 2LOLA 2XZ0D 2K0YA 3CCRP 1E0HA 4GR6A 5KP8B 2PEOA 2JGPA 2PEJA 1VQKP 3EJEA 2L6EA 1M6NA 3I55P 2KOOA 2LL8A 2E1MA 3H0DA 1E6JP 2EHTA 2PEQA 2CGQA 2JYLA 1EOQA 4PWVB 5HGLA 3DS2A 1RO2A 2MR8A 3DTJA 5KP7B 5JPAA 2JU1A 3DS5A 1IMPA 2KOQA 4M0IA 3EJDA 2N6ZA 4H2XC 1VQ6P 1FR2A 2K94A 2CNRA 3NY7B 3WBHA 1NQ4A 2FADA 4GR2A 1VQPP 1GXHA 3NTEA 2L22A 2FVEA 3CCUP 1K73Q 2DGYA 1EIAA 4HKGA 2LKIA 5HVCA 3G28A 2PY8A 5HGOA 2JAZA 3CXCO 5HGMA 5HV8A 1AYIA 1A43A 1YI2P 3DS1A 5EJDA 3G29A 3G1IA 2KORA 2MD9A 3HZQA 2JO0A 2K93A 1Q82Q 2K0DX 1AF8A 1BXIA 1M74A 2K92A 2JB0A 2K5XA 2M8LA 2Z46A 5KP6B 2QA4P 2ERHA 2GDYA 2KWLA 2JQ4A 4DG9A 2OARA 2PNGA 4CA3A 4UHPB 2LIUA 1KQSO 1D1DA 2CQ8A 3CC2P 2PEKA 4U0EA 2XXMA 1OR5A 4PH0A 1F80D 1IUQA 2AF8A 1HY8A 2LPKA 3LMOA 5EW5E 3VRLC 2P9XA 2LTEA 1VQOP 1QVGO 3CE7A 3Q20A 3U43A 2VLPA 2BHVA 3CCSP 1RO0A 1YHQP 1YIJP 1M90Q 1IMQA 4U0FA 2L4BA 1ACPA 2KW2A 2AFDA 3GJNA 1GPJA 1K8AQ 2K0XA 1M6EX 2Z45A 2CWOA 2GZEA 2PEMA 5I4TG 2VLNA 3G26A 3GKLC 5F2NA 1YJWP 3CD6P 1QRJA 2WPTA 1K30A 2MF4A 2M8PA 4IZ6A 1KLPA 1ZNVA 2PENA 1MZ8A 1KC8Q 3G0VA 4BPHA 2AFEA 2KODA 2N5HA 3EJBA 1KD1Q 3CMAP 3H4EA 3GZLA 1N8RQ 2MR7A 3G21A 1ZMBA 1L0IA 1X3OA 1DNYA 3H47A 3I56P 4QKOA 3DS3A 2GZJA 2L0QA 1S72P 2KGEA 2LMLA 2FQ1A 3RG6C 3HYBA 1VQMP 1NJIQ 1UNKA 3OW2O 5CZDB 2PEIA 4BPFA 4U0DA 2ROQA 3GZMA 1AUMA 3M1MA 2X2BA 2GYKA 7CEIA 1VKUA 1VQ9P 5BS1A 2KGAA 4NEOA 1VQ8P 2MVUA 2FHSC 2DNWA 3G1GA 3DS4A 1VQ5P 4MRTC 4U0BA 3G71P 4PH1A 4COCA 1YJNP 4XFXA 3DS0A 2FVFA 1L0HA 2JYGA 2GZGA 2N98A 2KG6A 2AVAA 5F2OA 3CC4P 2K2QA 3CCEP 2MVVA 2EHSA 4R0MA 1Q7YQ 3CCJP 2KOPA 1Z6MA 3G4SP 4XFYA 1VHNA 4XFZA 2N5IA 1T8KA 2FACA 2FQ2A 1HQBA 2N6YA 3B5IA 2GZIA 3CCLP 3P05A 3CCQP 3MGEA 4H2WC 3RG2A 2LF4A 5HGNA 4WYMA 2FVAA 1Q81Q 1VQNP 2EG5A 1EMVA 2M5RA 2XV6A 4U0CA 1YJ9P 3DPHA 5DCKA 2JBGA 4H2YC 2LIWA 3CC7P 2FAEA 3CCVP 2KR5A 1JJ2O 1QVFO 2EIAA 5BS2A 2XT1A 2MY5A 2BUOA 3G6EP 2VLOA 3CPWO 1VQ7P 3LRYA 2KGCA 4PXHB 1DV5A 2ONTA 4F37A 2OTLP 1GXGA 1BAJA 2M8NA 4XRQA 1A8OA 2QNWA 2Z44A 2FQ0A 3CMEP 3B4QA 3E2DA 4XROA 2GDXA
chains in the Genus database with same CATH topology
2MF4A 4IZ6A 2FVFA 1L0HA 2L22A 2VSQA 1KLPA 2FVEA 2KOSA 2N98A 2KG6A 2AVAA 2L9FA 4BPHA 4HKGA 2KGDA 2AFEA 2LKIA 2K2QA 5HVCA 2MVVA 2EHSA 2N5HA 1NQ4A 3EJBA 4R0MA 2KOPA 4BPGA 5HV8A 2KG8A 3GZLA 2MR7A 2JU2A 2N5IA 1T8KA 2FACA 2FQ2A 1HQBA 2N6YA 1L0IA 1X3OA 2N50A 1DNYA 5EJDA 2KG9A 2KORA 2MD9A 2CG5B 2K93A 4H2WC 1AF8A 2GDWA 2K92A 2L0QA 2XZ1C 3RG2A 2KGEA 5KP6B 2LMLA 2FQ1A 2LOLA 2XZ0D 2GDYA 2K0YA 2KWLA 5KP8B 2JGPA 2FVAA 2JQ4A 4DG9A 2PNGA 2M5RA 4CA3A 3EJEA 2LIUA 5CZDB 4H2YC 2CQ8A 2KOOA 2LIWA 2LL8A 2FAEA 4BPFA 2EHTA 2KR5A 1OR5A 2ROQA 2CGQA 1F80D 2AF8A 1HY8A 2LPKA 3GZMA 4PWVB 3LMOA 2X2BA 2LTEA 2MY5A 3CE7A 2MR8A 5KP7B 2JU1A 1VKUA 2KGCA 4PXHB 2L4BA 2KOQA 2KW2A 2AFDA 2KGAA 4NEOA 1ACPA 1DV5A 3EJDA 2K0XA 2N6ZA 2MVUA 4H2XC 2FHSC 2DNWA 2QNWA 4MRTC 2FQ0A 2K94A 2CNRA 3NY7B 2GDXA 2FADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MF4 A;  4IZ6 A;  2FVF A;  1L0H A;  2L22 A;  2VSQ A;  1KLP A;  2FVE A;  2KOS A;  2N98 A;  2KG6 A;  2AVA A;  2L9F A;  4BPH A;  4HKG A;  2KGD A;  2AFE A;  2LKI A;  2K2Q A;  5HVC A;  2MVV A;  2EHS A;  2N5H A;  1NQ4 A;  3EJB A;  4R0M A;  2KOP A;  4BPG A;  5HV8 A;  2KG8 A;  3GZL A;  2MR7 A;  2JU2 A;  2N5I A;  1T8K A;  2FAC A;  2FQ2 A;  1HQB A;  2N6Y A;  1L0I A;  1X3O A;  2N50 A;  1DNY A;  5EJD A;  2KG9 A;  2KOR A;  2MD9 A;  2CG5 B;  2K93 A;  4H2W C;  1AF8 A;  2GDW A;  2K92 A;  2L0Q A;  2XZ1 C;  3RG2 A;  2KGE A;  5KP6 B;  2LML A;  2FQ1 A;  2LOL A;  2XZ0 D;  2GDY A;  2K0Y A;  2KWL A;  5KP8 B;  2JGP A;  2FVA A;  2JQ4 A;  4DG9 A;  2PNG A;  2M5R A;  4CA3 A;  3EJE A;  2LIU A;  5CZD B;  4H2Y C;  2CQ8 A;  2KOO A;  2LIW A;  2LL8 A;  2FAE A;  4BPF A;  2EHT A;  2KR5 A;  1OR5 A;  2ROQ A;  2CGQ A;  1F80 D;  2AF8 A;  1HY8 A;  2LPK A;  3GZM A;  4PWV B;  3LMO A;  2X2B A;  2LTE A;  2MY5 A;  3CE7 A;  2MR8 A;  5KP7 B;  2JU1 A;  1VKU A;  2KGC A;  4PXH B;  2L4B A;  2KOQ A;  2KW2 A;  2AFD A;  2KGA A;  4NEO A;  1ACP A;  1DV5 A;  3EJD A;  2K0X A;  2N6Z A;  2MVU A;  4H2X C;  2FHS C;  2DNW A;  2QNW A;  4MRT C;  2FQ0 A;  2K94 A;  2CNR A;  3NY7 B;  2GDX A;  2FAD A; 
#chains in the Genus database with same CATH topology
 2EFJ A;  2NO8 A;  1K9M Q;  1W2B O;  2VSQ A;  2KOS A;  5F2K A;  2L9F A;  4COP A;  2KGD A;  1CEI A;  2GZF A;  4BPG A;  1VQL P;  1UJZ A;  2KG8 A;  1M1K Q;  2JU2 A;  4QNB A;  2QEX P;  1RNI A;  2N50 A;  1Q86 Q;  2OTJ P;  4U0A A;  2KG9 A;  2CG5 B;  1YIT P;  2GDW A;  3CCM P;  2XZ1 C;  4IPY A;  1VQ4 P;  2VLQ A;  2LOL A;  2XZ0 D;  2K0Y A;  3CCR P;  1E0H A;  4GR6 A;  5KP8 B;  2PEO A;  2JGP A;  2PEJ A;  1VQK P;  3EJE A;  2L6E A;  1M6N A;  3I55 P;  2KOO A;  2LL8 A;  2E1M A;  3H0D A;  1E6J P;  2EHT A;  2PEQ A;  2CGQ A;  2JYL A;  1EOQ A;  4PWV B;  5HGL A;  3DS2 A;  1RO2 A;  2MR8 A;  3DTJ A;  5KP7 B;  5JPA A;  2JU1 A;  3DS5 A;  1IMP A;  2KOQ A;  4M0I A;  3EJD A;  2N6Z A;  4H2X C;  1VQ6 P;  1FR2 A;  2K94 A;  2CNR A;  3NY7 B;  3WBH A;  1NQ4 A;  2FAD A;  4GR2 A;  1VQP P;  1GXH A;  3NTE A;  2L22 A;  2FVE A;  3CCU P;  1K73 Q;  2DGY A;  1EIA A;  4HKG A;  2LKI A;  5HVC A;  3G28 A;  2PY8 A;  5HGO A;  2JAZ A;  3CXC O;  5HGM A;  5HV8 A;  1AYI A;  1A43 A;  1YI2 P;  3DS1 A;  5EJD A;  3G29 A;  3G1I A;  2KOR A;  2MD9 A;  3HZQ A;  2JO0 A;  2K93 A;  1Q82 Q;  2K0D X;  1AF8 A;  1BXI A;  1M74 A;  2K92 A;  2JB0 A;  2K5X A;  2M8L A;  2Z46 A;  5KP6 B;  2QA4 P;  2ERH A;  2GDY A;  2KWL A;  2JQ4 A;  4DG9 A;  2OAR A;  2PNG A;  4CA3 A;  4UHP B;  2LIU A;  1KQS O;  1D1D A;  2CQ8 A;  3CC2 P;  2PEK A;  4U0E A;  2XXM A;  1OR5 A;  4PH0 A;  1F80 D;  1IUQ A;  2AF8 A;  1HY8 A;  2LPK A;  3LMO A;  5EW5 E;  3VRL C;  2P9X A;  2LTE A;  1VQO P;  1QVG O;  3CE7 A;  3Q20 A;  3U43 A;  2VLP A;  2BHV A;  3CCS P;  1RO0 A;  1YHQ P;  1YIJ P;  1M90 Q;  1IMQ A;  4U0F A;  2L4B A;  1ACP A;  2KW2 A;  2AFD A;  3GJN A;  1GPJ A;  1K8A Q;  2K0X A;  1M6E X;  2Z45 A;  2CWO A;  2GZE A;  2PEM A;  5I4T G;  2VLN A;  3G26 A;  3GKL C;  5F2N A;  1YJW P;  3CD6 P;  1QRJ A;  2WPT A;  1K30 A;  2MF4 A;  2M8P A;  4IZ6 A;  1KLP A;  1ZNV A;  2PEN A;  1MZ8 A;  1KC8 Q;  3G0V A;  4BPH A;  2AFE A;  2KOD A;  2N5H A;  3EJB A;  1KD1 Q;  3CMA P;  3H4E A;  3GZL A;  1N8R Q;  2MR7 A;  3G21 A;  1ZMB A;  1L0I A;  1X3O A;  1DNY A;  3H47 A;  3I56 P;  4QKO A;  3DS3 A;  2GZJ A;  2L0Q A;  1S72 P;  2KGE A;  2LML A;  2FQ1 A;  3RG6 C;  3HYB A;  1VQM P;  1NJI Q;  1UNK A;  3OW2 O;  5CZD B;  2PEI A;  4BPF A;  4U0D A;  2ROQ A;  3GZM A;  1AUM A;  3M1M A;  2X2B A;  2GYK A;  7CEI A;  1VKU A;  1VQ9 P;  5BS1 A;  2KGA A;  4NEO A;  1VQ8 P;  2MVU A;  2FHS C;  2DNW A;  3G1G A;  3DS4 A;  1VQ5 P;  4MRT C;  4U0B A;  3G71 P;  4PH1 A;  4COC A;  1YJN P;  4XFX A;  3DS0 A;  2FVF A;  1L0H A;  2JYG A;  2GZG A;  2N98 A;  2KG6 A;  2AVA A;  5F2O A;  3CC4 P;  2K2Q A;  3CCE P;  2MVV A;  2EHS A;  4R0M A;  1Q7Y Q;  3CCJ P;  2KOP A;  1Z6M A;  3G4S P;  4XFY A;  1VHN A;  4XFZ A;  2N5I A;  1T8K A;  2FAC A;  2FQ2 A;  1HQB A;  2N6Y A;  3B5I A;  2GZI A;  3CCL P;  3P05 A;  3CCQ P;  3MGE A;  4H2W C;  3RG2 A;  2LF4 A;  5HGN A;  4WYM A;  2FVA A;  1Q81 Q;  1VQN P;  2EG5 A;  1EMV A;  2M5R A;  2XV6 A;  4U0C A;  1YJ9 P;  3DPH A;  5DCK A;  2JBG A;  4H2Y C;  2LIW A;  3CC7 P;  2FAE A;  3CCV P;  2KR5 A;  1JJ2 O;  1QVF O;  2EIA A;  5BS2 A;  2XT1 A;  2MY5 A;  2BUO A;  3G6E P;  2VLO A;  3CPW O;  1VQ7 P;  3LRY A;  2KGC A;  4PXH B;  1DV5 A;  2ONT A;  4F37 A;  2OTL P;  1GXG A;  1BAJ A;  2M8N A;  4XRQ A;  1A8O A;  2QNW A;  2Z44 A;  2FQ0 A;  3CME P;  3B4Q A;  3E2D A;  4XRO A;  2GDX A; 
#chains in the Genus database with same CATH homology
 2MF4 A;  4IZ6 A;  2FVF A;  1L0H A;  2L22 A;  2VSQ A;  1KLP A;  2FVE A;  2KOS A;  2N98 A;  2KG6 A;  2AVA A;  2L9F A;  4BPH A;  4HKG A;  2KGD A;  2AFE A;  2LKI A;  2K2Q A;  5HVC A;  2MVV A;  2EHS A;  2N5H A;  1NQ4 A;  3EJB A;  4R0M A;  2KOP A;  4BPG A;  5HV8 A;  2KG8 A;  3GZL A;  2MR7 A;  2JU2 A;  2N5I A;  1T8K A;  2FAC A;  2FQ2 A;  1HQB A;  2N6Y A;  1L0I A;  1X3O A;  2N50 A;  1DNY A;  5EJD A;  2KG9 A;  2KOR A;  2MD9 A;  2CG5 B;  2K93 A;  4H2W C;  1AF8 A;  2GDW A;  2K92 A;  2L0Q A;  2XZ1 C;  3RG2 A;  2KGE A;  5KP6 B;  2LML A;  2FQ1 A;  2LOL A;  2XZ0 D;  2GDY A;  2K0Y A;  2KWL A;  5KP8 B;  2JGP A;  2FVA A;  2JQ4 A;  4DG9 A;  2PNG A;  2M5R A;  4CA3 A;  3EJE A;  2LIU A;  5CZD B;  4H2Y C;  2CQ8 A;  2KOO A;  2LIW A;  2LL8 A;  2FAE A;  4BPF A;  2EHT A;  2KR5 A;  1OR5 A;  2ROQ A;  2CGQ A;  1F80 D;  2AF8 A;  1HY8 A;  2LPK A;  3GZM A;  4PWV B;  3LMO A;  2X2B A;  2LTE A;  2MY5 A;  3CE7 A;  2MR8 A;  5KP7 B;  2JU1 A;  1VKU A;  2KGC A;  4PXH B;  2L4B A;  2KOQ A;  2KW2 A;  2AFD A;  2KGA A;  4NEO A;  1ACP A;  1DV5 A;  3EJD A;  2K0X A;  2N6Z A;  2MVU A;  4H2X C;  2FHS C;  2DNW A;  2QNW A;  4MRT C;  2FQ0 A;  2K94 A;  2CNR A;  3NY7 B;  2GDX A;  2FAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...