1KLPA

The solution structure of acyl carrier protein from mycobacterium tuberculosis
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
115
structure length
115
Chain Sequence
MPVTQEEIIAGIAEIIEEVTGIEPSEITPEKSFVDDLDIDSLSMVEIAVQTEDKYGVKIPDEDLAGLRTVGDVVAYIQKLEEENPEAAQALRAKIESENPDAVANVQARLEAESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of acyl carrier protein from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligand transport
molecule keywords MEROMYCOLATE EXTENSION ACYL CARRIER PROTEIN
total genus 16
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2001-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1klpA00
1X3OA 2FVFA 1HQBA 5HV8A 2FQ1A 4PXHB 2JGPA 2KOOA 3RG2A 1DV5A 2EHTA 2KGAA 2ROQA 2CNRA 2CQ8A 2LIUA 2JQ4A 4H2YC 2K2QA 2MVVA 2KG9A 2N6ZA 2AFEA 3LMOA 2M5RA 5KP7B 2MR7A 2FQ0A 1T8KA 1ACPA 2JU2A 2L4BA 2LMLA 2KGCA 2K93A 2N6YA 2KW2A 4MRTC 2X2BA 2GDXA 4H2XC 2CG5B 2L9FA 2QNWA 3GZLA 4DG9A 2AVAA 1OR5A 2LIWA 2KOPA 3EJBA 4BPHA 3EJEA 1F80D 2GDWA 2KG6A 5KP8B 1DNYA 2PNGA 2MY5A 2KOQA 2MF4A 2AFDA 1VKUA 5KP6B 2N98A 3NY7B 4PWVB 2KG8A 2FADA 4CA3A 1HY8A 2MVUA 4BPFA 2FQ2A 2LTEA 2FVAA 2EHSA 2XZ0D 3GZMA 2L0QA 2VSQA 3CE7A 2LL8A 4IZ6A 2DNWA 2AF8A 2KORA 2N5HA 1L0IA 4NEOA 4HKGA 3EJDA 1AF8A 2K0YA 4H2WC 5CZDB 2KWLA 2KR5A 2FHSC 5HVCA 4BPGA 2KGEA 2JU1A 2MR8A 2K0XA 2N50A 2L22A 2FAEA 2K92A 2LPKA 1NQ4A 2K94A 2LOLA 2KOSA 2MD9A 2FVEA 2GDYA 1L0HA 2LKIA 2CGQA 2KGDA 4R0MA 2N5IA 5EJDA 2XZ1C 1KLPA 2FACA
chains in the Genus database with same CATH superfamily
2E1MA 4PH0A 4PXHB 3DTJA 2KOOA 1M6NA 3RG2A 2CNRA 2CQ8A 2LIUA 3CCEP 3CXCO 1BAJA 2K2QA 3DS3A 2M8LA 2P9XA 5KP7B 3H0DA 5F2OA 2KW2A 2X2BA 1RNIA 2QNWA 3GZLA 2XV6A 3EJEA 1E6JP 1VQLP 3CCUP 1EMVA 1QRJA 2OARA 2ERHA 2N98A 4QNBA 3CCSP 2LF4A 2EHSA 1Q81Q 3GZMA 1GPJA 2JBGA 4IZ6A 1E0HA 2KORA 4U0AA 3G26A 4IPYA 3H4EA 1M90Q 4HKGA 1N8RQ 3M1MA 4U0EA 1IUQA 2GZEA 2FHSC 2BHVA 3VRLC 4BPGA 3CCJP 3CCVP 2EFJA 3G1GA 1Q82Q 2K92A 2K94A 1VHNA 3G6EP 2DGYA 2KOSA 1Q86Q 2CWOA 1CEIA 4R0MA 2PEIA 3HZQA 3G71P 5HGMA 5HGNA 5HV8A 3CMAP 1DV5A 2KGAA 5BS1A 3DS5A 3Q20A 2JYGA 3LRYA 2N6ZA 2M5RA 1MZ8A 1VQKP 2GZJA 1IMQA 2FQ0A 2JU2A 4MRTC 1YI2P 4XROA 1K30A 3DS1A 2L6EA 4F37A 3CCLP 2LIWA 2KOPA 4BPHA 5JPAA 5F2KA 1F80D 2KG6A 1VQNP 1D1DA 2PNGA 2NO8A 1UNKA 2AFDA 1A43A 2BUOA 3MGEA 1K9MQ 2PEQA 4CA3A 2PENA 1YJ9P 4BPFA 3U43A 1UJZA 4U0BA 5HGOA 3P05A 3CCMP 3RG6C 2VSQA 3CE7A 1K8AQ 2LL8A 2AF8A 1RO2A 4NEOA 5I4TG 3DS4A 1AF8A 5CZDB 2KR5A 1VQ6P 2XT1A 1YIJP 1A8OA 2GZGA 1EIAA 2L22A 2EIAA 2FAEA 2LPKA 4U0DA 1IMPA 3I55P 2QA4P 2FVEA 1W2BO 1L0HA 2CGQA 2KGDA 1BXIA 1S72P 5EJDA 3CC2P 1KLPA 2JAZA 1QVGO 2FQ1A 2PEJA 4WYMA 2GYKA 2JGPA 2PY8A 4GR2A 3CCRP 1KC8Q 2ROQA 4H2YC 3CD6P 2KG9A 4PH1A 3LMOA 1AYIA 2K0DX 1YITP 2FACA 5BS2A 3CC7P 2K93A 2KGCA 1JJ2O 3G1IA 3H47A 4H2XC 3B5IA 2M8NA 1OR5A 3HYBA 4QKOA 3EJBA 2GDWA 2Z44A 7CEIA 5KP8B 1DNYA 3GKLC 3E2DA 1VKUA 3NTEA 2K5XA 3WBHA 2FADA 2PEOA 1VQ5P 4COCA 2FVAA 2XZ0D 2N5HA 1L0IA 4XFZA 3EJDA 1EOQA 4XFYA 2KWLA 2WPTA 2JO0A 1ZNVA 1Q7YQ 2KODA 2JU1A 2MR8A 4XFXA 2N50A 2ONTA 3DS0A 2JB0A 1NQ4A 1M1KQ 1VQMP 5HGLA 3G0VA 3I56P 1FR2A 2LKIA 2VLQA 1RO0A 1AUMA 2QEXP 1X3OA 2FVFA 3G28A 3GJNA 3DPHA 1HQBA 1VQOP 4GR6A 2EHTA 4U0FA 2PEKA 2OTLP 3DS2A 2JQ4A 4XRQA 2MVVA 2OTJP 1KQSO 2AFEA 3CCQP 2PEMA 1ZMBA 2MR7A 1T8KA 1ACPA 1GXHA 2L4BA 2LMLA 2N6YA 2GDXA 2CG5B 2Z46A 2L9FA 3G21A 3CMEP 4DG9A 2GZFA 2GZIA 2AVAA 1NJIQ 2MY5A 4M0IA 2KOQA 2MF4A 4UHPB 1GXGA 4COPA 5KP6B 3NY7B 4PWVB 2KG8A 3CC4P 1HY8A 2MVUA 1Z6MA 2FQ2A 2LTEA 1VQPP 1KD1Q 3B4QA 2L0QA 3G4SP 1YHQP 1QVFO 2DNWA 1M6EX 2XXMA 3CPWO 2K0YA 1VQ7P 1YJNP 5EW5E 4H2WC 2Z45A 5HVCA 1VQ8P 2JYLA 2KGEA 2K0XA 2VLOA 5DCKA 3OW2O 2LOLA 1VQ4P 2MD9A 2GDYA 1K73Q 2M8PA 1YJWP 3G29A 2N5IA 1M74A 1VQ9P 2VLNA 2XZ1C 2EG5A 5F2NA 4U0CA 2VLPA
chains in the Genus database with same CATH topology
1X3OA 2FVFA 1HQBA 5HV8A 2FQ1A 4PXHB 2JGPA 2KOOA 3RG2A 1DV5A 2EHTA 2KGAA 2ROQA 2CNRA 2CQ8A 2LIUA 2JQ4A 4H2YC 2K2QA 2MVVA 2KG9A 2N6ZA 2AFEA 3LMOA 2M5RA 5KP7B 2MR7A 2FQ0A 1T8KA 1ACPA 2JU2A 2L4BA 2LMLA 2KGCA 2K93A 2N6YA 2KW2A 4MRTC 2X2BA 2GDXA 4H2XC 2CG5B 2L9FA 2QNWA 3GZLA 4DG9A 2AVAA 1OR5A 2LIWA 2KOPA 3EJBA 4BPHA 3EJEA 1F80D 2GDWA 2KG6A 5KP8B 1DNYA 2PNGA 2MY5A 2KOQA 2MF4A 2AFDA 1VKUA 5KP6B 2N98A 3NY7B 4PWVB 2KG8A 2FADA 4CA3A 1HY8A 2MVUA 4BPFA 2FQ2A 2LTEA 2FVAA 2EHSA 2XZ0D 3GZMA 2L0QA 2VSQA 3CE7A 2LL8A 4IZ6A 2DNWA 2AF8A 2KORA 2N5HA 1L0IA 4NEOA 4HKGA 3EJDA 1AF8A 2K0YA 4H2WC 5CZDB 2KWLA 2KR5A 2FHSC 5HVCA 4BPGA 2KGEA 2JU1A 2MR8A 2K0XA 2N50A 2L22A 2FAEA 2K92A 2LPKA 1NQ4A 2K94A 2LOLA 2KOSA 2MD9A 2FVEA 2GDYA 1L0HA 2LKIA 2CGQA 2KGDA 4R0MA 2N5IA 5EJDA 2XZ1C 1KLPA 2FACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3O A;  2FVF A;  1HQB A;  5HV8 A;  2FQ1 A;  4PXH B;  2JGP A;  2KOO A;  3RG2 A;  1DV5 A;  2EHT A;  2KGA A;  2ROQ A;  2CNR A;  2CQ8 A;  2LIU A;  2JQ4 A;  4H2Y C;  2K2Q A;  2MVV A;  2KG9 A;  2N6Z A;  2AFE A;  3LMO A;  2M5R A;  5KP7 B;  2MR7 A;  2FQ0 A;  1T8K A;  1ACP A;  2JU2 A;  2L4B A;  2LML A;  2KGC A;  2K93 A;  2N6Y A;  2KW2 A;  4MRT C;  2X2B A;  2GDX A;  4H2X C;  2CG5 B;  2L9F A;  2QNW A;  3GZL A;  4DG9 A;  2AVA A;  1OR5 A;  2LIW A;  2KOP A;  3EJB A;  4BPH A;  3EJE A;  1F80 D;  2GDW A;  2KG6 A;  5KP8 B;  1DNY A;  2PNG A;  2MY5 A;  2KOQ A;  2MF4 A;  2AFD A;  1VKU A;  5KP6 B;  2N98 A;  3NY7 B;  4PWV B;  2KG8 A;  2FAD A;  4CA3 A;  1HY8 A;  2MVU A;  4BPF A;  2FQ2 A;  2LTE A;  2FVA A;  2EHS A;  2XZ0 D;  3GZM A;  2L0Q A;  2VSQ A;  3CE7 A;  2LL8 A;  4IZ6 A;  2DNW A;  2AF8 A;  2KOR A;  2N5H A;  1L0I A;  4NEO A;  4HKG A;  3EJD A;  1AF8 A;  2K0Y A;  4H2W C;  5CZD B;  2KWL A;  2KR5 A;  2FHS C;  5HVC A;  4BPG A;  2KGE A;  2JU1 A;  2MR8 A;  2K0X A;  2N50 A;  2L22 A;  2FAE A;  2K92 A;  2LPK A;  1NQ4 A;  2K94 A;  2LOL A;  2KOS A;  2MD9 A;  2FVE A;  2GDY A;  1L0H A;  2LKI A;  2CGQ A;  2KGD A;  4R0M A;  2N5I A;  5EJD A;  2XZ1 C;  1KLP A;  2FAC A; 
#chains in the Genus database with same CATH topology
 2E1M A;  4PH0 A;  4PXH B;  3DTJ A;  2KOO A;  1M6N A;  3RG2 A;  2CNR A;  2CQ8 A;  2LIU A;  3CCE P;  3CXC O;  1BAJ A;  2K2Q A;  3DS3 A;  2M8L A;  2P9X A;  5KP7 B;  3H0D A;  5F2O A;  2KW2 A;  2X2B A;  1RNI A;  2QNW A;  3GZL A;  2XV6 A;  3EJE A;  1E6J P;  1VQL P;  3CCU P;  1EMV A;  1QRJ A;  2OAR A;  2ERH A;  2N98 A;  4QNB A;  3CCS P;  2LF4 A;  2EHS A;  1Q81 Q;  3GZM A;  1GPJ A;  2JBG A;  4IZ6 A;  1E0H A;  2KOR A;  4U0A A;  3G26 A;  4IPY A;  3H4E A;  1M90 Q;  4HKG A;  1N8R Q;  3M1M A;  4U0E A;  1IUQ A;  2GZE A;  2FHS C;  2BHV A;  3VRL C;  4BPG A;  3CCJ P;  3CCV P;  2EFJ A;  3G1G A;  1Q82 Q;  2K92 A;  2K94 A;  1VHN A;  3G6E P;  2DGY A;  2KOS A;  1Q86 Q;  2CWO A;  1CEI A;  4R0M A;  2PEI A;  3HZQ A;  3G71 P;  5HGM A;  5HGN A;  5HV8 A;  3CMA P;  1DV5 A;  2KGA A;  5BS1 A;  3DS5 A;  3Q20 A;  2JYG A;  3LRY A;  2N6Z A;  2M5R A;  1MZ8 A;  1VQK P;  2GZJ A;  1IMQ A;  2FQ0 A;  2JU2 A;  4MRT C;  1YI2 P;  4XRO A;  1K30 A;  3DS1 A;  2L6E A;  4F37 A;  3CCL P;  2LIW A;  2KOP A;  4BPH A;  5JPA A;  5F2K A;  1F80 D;  2KG6 A;  1VQN P;  1D1D A;  2PNG A;  2NO8 A;  1UNK A;  2AFD A;  1A43 A;  2BUO A;  3MGE A;  1K9M Q;  2PEQ A;  4CA3 A;  2PEN A;  1YJ9 P;  4BPF A;  3U43 A;  1UJZ A;  4U0B A;  5HGO A;  3P05 A;  3CCM P;  3RG6 C;  2VSQ A;  3CE7 A;  1K8A Q;  2LL8 A;  2AF8 A;  1RO2 A;  4NEO A;  5I4T G;  3DS4 A;  1AF8 A;  5CZD B;  2KR5 A;  1VQ6 P;  2XT1 A;  1YIJ P;  1A8O A;  2GZG A;  1EIA A;  2L22 A;  2EIA A;  2FAE A;  2LPK A;  4U0D A;  1IMP A;  3I55 P;  2QA4 P;  2FVE A;  1W2B O;  1L0H A;  2CGQ A;  2KGD A;  1BXI A;  1S72 P;  5EJD A;  3CC2 P;  1KLP A;  2JAZ A;  1QVG O;  2FQ1 A;  2PEJ A;  4WYM A;  2GYK A;  2JGP A;  2PY8 A;  4GR2 A;  3CCR P;  1KC8 Q;  2ROQ A;  4H2Y C;  3CD6 P;  2KG9 A;  4PH1 A;  3LMO A;  1AYI A;  2K0D X;  1YIT P;  2FAC A;  5BS2 A;  3CC7 P;  2K93 A;  2KGC A;  1JJ2 O;  3G1I A;  3H47 A;  4H2X C;  3B5I A;  2M8N A;  1OR5 A;  3HYB A;  4QKO A;  3EJB A;  2GDW A;  2Z44 A;  7CEI A;  5KP8 B;  1DNY A;  3GKL C;  3E2D A;  1VKU A;  3NTE A;  2K5X A;  3WBH A;  2FAD A;  2PEO A;  1VQ5 P;  4COC A;  2FVA A;  2XZ0 D;  2N5H A;  1L0I A;  4XFZ A;  3EJD A;  1EOQ A;  4XFY A;  2KWL A;  2WPT A;  2JO0 A;  1ZNV A;  1Q7Y Q;  2KOD A;  2JU1 A;  2MR8 A;  4XFX A;  2N50 A;  2ONT A;  3DS0 A;  2JB0 A;  1NQ4 A;  1M1K Q;  1VQM P;  5HGL A;  3G0V A;  3I56 P;  1FR2 A;  2LKI A;  2VLQ A;  1RO0 A;  1AUM A;  2QEX P;  1X3O A;  2FVF A;  3G28 A;  3GJN A;  3DPH A;  1HQB A;  1VQO P;  4GR6 A;  2EHT A;  4U0F A;  2PEK A;  2OTL P;  3DS2 A;  2JQ4 A;  4XRQ A;  2MVV A;  2OTJ P;  1KQS O;  2AFE A;  3CCQ P;  2PEM A;  1ZMB A;  2MR7 A;  1T8K A;  1ACP A;  1GXH A;  2L4B A;  2LML A;  2N6Y A;  2GDX A;  2CG5 B;  2Z46 A;  2L9F A;  3G21 A;  3CME P;  4DG9 A;  2GZF A;  2GZI A;  2AVA A;  1NJI Q;  2MY5 A;  4M0I A;  2KOQ A;  2MF4 A;  4UHP B;  1GXG A;  4COP A;  5KP6 B;  3NY7 B;  4PWV B;  2KG8 A;  3CC4 P;  1HY8 A;  2MVU A;  1Z6M A;  2FQ2 A;  2LTE A;  1VQP P;  1KD1 Q;  3B4Q A;  2L0Q A;  3G4S P;  1YHQ P;  1QVF O;  2DNW A;  1M6E X;  2XXM A;  3CPW O;  2K0Y A;  1VQ7 P;  1YJN P;  5EW5 E;  4H2W C;  2Z45 A;  5HVC A;  1VQ8 P;  2JYL A;  2KGE A;  2K0X A;  2VLO A;  5DCK A;  3OW2 O;  2LOL A;  1VQ4 P;  2MD9 A;  2GDY A;  1K73 Q;  2M8P A;  1YJW P;  3G29 A;  2N5I A;  1M74 A;  1VQ9 P;  2VLN A;  2XZ1 C;  2EG5 A;  5F2N A;  4U0C A;  2VLP A; 
#chains in the Genus database with same CATH homology
 1X3O A;  2FVF A;  1HQB A;  5HV8 A;  2FQ1 A;  4PXH B;  2JGP A;  2KOO A;  3RG2 A;  1DV5 A;  2EHT A;  2KGA A;  2ROQ A;  2CNR A;  2CQ8 A;  2LIU A;  2JQ4 A;  4H2Y C;  2K2Q A;  2MVV A;  2KG9 A;  2N6Z A;  2AFE A;  3LMO A;  2M5R A;  5KP7 B;  2MR7 A;  2FQ0 A;  1T8K A;  1ACP A;  2JU2 A;  2L4B A;  2LML A;  2KGC A;  2K93 A;  2N6Y A;  2KW2 A;  4MRT C;  2X2B A;  2GDX A;  4H2X C;  2CG5 B;  2L9F A;  2QNW A;  3GZL A;  4DG9 A;  2AVA A;  1OR5 A;  2LIW A;  2KOP A;  3EJB A;  4BPH A;  3EJE A;  1F80 D;  2GDW A;  2KG6 A;  5KP8 B;  1DNY A;  2PNG A;  2MY5 A;  2KOQ A;  2MF4 A;  2AFD A;  1VKU A;  5KP6 B;  2N98 A;  3NY7 B;  4PWV B;  2KG8 A;  2FAD A;  4CA3 A;  1HY8 A;  2MVU A;  4BPF A;  2FQ2 A;  2LTE A;  2FVA A;  2EHS A;  2XZ0 D;  3GZM A;  2L0Q A;  2VSQ A;  3CE7 A;  2LL8 A;  4IZ6 A;  2DNW A;  2AF8 A;  2KOR A;  2N5H A;  1L0I A;  4NEO A;  4HKG A;  3EJD A;  1AF8 A;  2K0Y A;  4H2W C;  5CZD B;  2KWL A;  2KR5 A;  2FHS C;  5HVC A;  4BPG A;  2KGE A;  2JU1 A;  2MR8 A;  2K0X A;  2N50 A;  2L22 A;  2FAE A;  2K92 A;  2LPK A;  1NQ4 A;  2K94 A;  2LOL A;  2KOS A;  2MD9 A;  2FVE A;  2GDY A;  1L0H A;  2LKI A;  2CGQ A;  2KGD A;  4R0M A;  2N5I A;  5EJD A;  2XZ1 C;  1KLP A;  2FAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...