1KLPA

The solution structure of acyl carrier protein from mycobacterium tuberculosis
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
115
structure length
115
Chain Sequence
b'MPVTQEEIIAGIAEIIEEVTGIEPSEITPEKSFVDDLDIDSLSMVEIAVQTEDKYGVKIPDEDLAGLRTVGDVVAYIQKLEEENPEAAQALRAKIESENPDAVANVQARLEAESK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MEROMYCOLATE EXTENSION ACYL CARRIER PROTEIN
publication title The solution structure of acyl carrier protein from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligand transport
total genus 16
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2001-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1klpA00
2CGQA 2JU1A 2MR7A 3EJEA 1ACPA 2KGAA 5KP6B 2N50A 1DV5A 1KLPA 1VKUA 1X3OA 2AFEA 3EJDA 2MR8A 2KGDA 1OR5A 2XZ0D 3GZMA 3NY7B 4H2XC 2FQ1A 2LTEA 4MRTC 2K0YA 2LPKA 5CZDB 2JQ4A 2FHSC 2FQ0A 5KP8B 2DNWA 2KG9A 2EHTA 2KWLA 2LOLA 2KGEA 2K0XA 4CA3A 2GDYA 2L0QA 1L0HA 2M5RA 2FADA 2L4BA 2XZ1C 2N6ZA 2KR5A 5EJDA 4R0MA 2VSQA 2CNRA 2FVEA 3RG2A 1NQ4A 2KOPA 2KOSA 2KW2A 4PWVB 1T8KA 2AFDA 2K94A 2PNGA 2MY5A 2MVUA 3EJBA 2L9FA 4H2WC 3CE7A 3LMOA 2N6YA 4DG9A 2FAEA 2N5IA 2K92A 2GDWA 2JU2A 4PXHB 5HV8A 5HVCA 1AF8A 1F80D 2KG8A 2LMLA 2K93A 4H2YC 2QNWA 4NEOA 2CG5B 4HKGA 2LKIA 2LIWA 2FVFA 3GZLA 2FQ2A 2K2QA 2ROQA 4BPFA 2MD9A 1HY8A 2MVVA 2FACA 2GDXA 2AVAA 4IZ6A 2KOQA 2KOOA 2JGPA 2LL8A 2L22A 4BPGA 2N5HA 1L0IA 2X2BA 1HQBA 2FVAA 2KG6A 2KORA 4BPHA 5KP7B 2MF4A 2AF8A 1DNYA 2KGCA 2LIUA 2CQ8A 2N98A 2EHSA
chains in the Genus database with same CATH superfamily
2MR7A 3EJEA 3VRLC 4XFZA 1X3OA 3DS2A 2JB0A 4IPYA 1N8RQ 1YJ9P 5HGLA 2VLQA 3NY7B 4U0BA 2Z45A 2WPTA 1QVGO 2FQ0A 1AYIA 4WYMA 2KGEA 2L0QA 4U0FA 3G28A 2M5RA 2L4BA 3DTJA 1VQMP 2KW2A 3CXCO 3G1IA 1K8AQ 1MZ8A 4PH0A 1M90Q 2FAEA 2Z46A 2JU2A 1E0HA 2KODA 1VQLP 1EIAA 1CEIA 3U43A 2XV6A 4PXHB 1VQPP 5F2KA 1M74A 2EIAA 3CCEP 1M6NA 4H2YC 3GZLA 2JBGA 2ROQA 2GZFA 2XT1A 1HY8A 1M1KQ 2MVVA 5BS2A 2FACA 1D1DA 4IZ6A 2KOQA 2LL8A 3CCMP 1IUQA 2VLPA 1K73Q 2FVAA 1ZMBA 2KORA 2MF4A 1E6JP 2BUOA 1IMQA 1Q7YQ 3DS1A 5EW5E 2L6EA 2CQ8A 3CMEP 2JU1A 1VQ8P 3CD6P 4M0IA 5KP6B 2QEXP 2N50A 1ACPA 1DV5A 2JO0A 1VQ4P 2K0DX 2MR8A 1GXHA 3H4EA 1OR5A 2XZ0D 3WBHA 3M1MA 1VQ5P 2FQ1A 2LTEA 3H0DA 2DNWA 2E1MA 2KG9A 2KWLA 2OTLP 1YIJP 2K0XA 2GDYA 4GR6A 2VLNA 1L0HA 5F2OA 3DS5A 2FADA 2JYGA 2N6ZA 3G21A 5EJDA 4R0MA 2VSQA 3RG2A 1NQ4A 2K5XA 1Q86Q 1T8KA 2PNGA 2MVUA 3HYBA 3EJBA 5HGOA 3OW2O 4H2WC 2PY8A 2N5IA 2GDWA 3DS0A 4PH1A 1Z6MA 4F37A 4XFYA 3MGEA 1QVFO 1AF8A 3G71P 2K93A 3G4SP 2EG5A 2QNWA 4NEOA 2CG5B 4HKGA 2LKIA 2FVFA 2K2QA 3H47A 4U0DA 4U0AA 1BXIA 1VQKP 3RG6C 2GDXA 1YHQP 2JYLA 2ONTA 2KOOA 2JGPA 7CEIA 2KG6A 3CCUP 2XXMA 1VQOP 3CPWO 3CC4P 4QNBA 3G0VA 1K30A 2PENA 2CGQA 3CCQP 2KGAA 5JPAA 1KLPA 1ZNVA 4U0EA 2KGDA 3GZMA 1Q82Q 1UJZA 2LPKA 2JQ4A 4XFXA 2DGYA 1YITP 1KD1Q 1VQ7P 1YI2P 2FHSC 5KP8B 3NTEA 2EHTA 3P05A 3DPHA 3LRYA 2P9XA 1IMPA 3GJNA 1W2BO 3CCJP 2KOPA 2KOSA 5I4TG 2GZIA 4PWVB 2AFDA 2L9FA 1YJNP 3CE7A 3LMOA 1FR2A 2N6YA 2K92A 1Q81Q 5HGNA 1K9MQ 1M6EX 4QKOA 5HVCA 1KC8Q 2LMLA 5F2NA 2LIWA 4XRQA 2FQ2A 2PEKA 2M8PA 2MD9A 2PEJA 2Z44A 1GXGA 3DS3A 1AUMA 2L22A 2PEMA 4BPGA 2N5HA 2LF4A 4BPHA 5KP7B 2M8NA 2EFJA 4COCA 2GYKA 2KGCA 3DS4A 2ERHA 2NO8A 1NJIQ 2LIUA 2N98A 2GZJA 1QRJA 1VKUA 3E2DA 3B5IA 3CCLP 2AFEA 3EJDA 1RO2A 4U0CA 3CCRP 1VQ6P 4H2XC 1GPJA 3G26A 4MRTC 2K0YA 5CZDB 3CC7P 2PEIA 3HZQA 1RNIA 3G1GA 3CMAP 3CCVP 2PEQA 2LOLA 4CA3A 3CCSP 1S72P 2CWOA 1VHNA 2GZEA 2XZ1C 2QA4P 2KR5A 4GR2A 2CNRA 2FVEA 2OARA 1YJWP 3B4QA 3GKLC 2K94A 2MY5A 4UHPB 3G29A 2BHVA 4DG9A 1EMVA 1A43A 1EOQA 5HV8A 4XROA 3I56P 1F80D 2KG8A 2JAZA 2OTJP 5HGMA 3CC2P 2PEOA 3Q20A 5DCKA 4BPFA 5BS1A 2M8LA 2AVAA 1BAJA 3I55P 1RO0A 1L0IA 2X2BA 2VLOA 1VQ9P 1HQBA 1VQNP 1JJ2O 1A8OA 1UNKA 2AF8A 1DNYA 3G6EP 2GZGA 4COPA 2EHSA 1KQSO
chains in the Genus database with same CATH topology
2CGQA 2JU1A 2MR7A 3EJEA 1ACPA 2KGAA 5KP6B 2N50A 1DV5A 1KLPA 1VKUA 1X3OA 2AFEA 3EJDA 2MR8A 2KGDA 1OR5A 2XZ0D 3GZMA 3NY7B 4H2XC 2FQ1A 2LTEA 4MRTC 2K0YA 2LPKA 5CZDB 2JQ4A 2FHSC 2FQ0A 5KP8B 2DNWA 2KG9A 2EHTA 2KWLA 2LOLA 2KGEA 2K0XA 4CA3A 2GDYA 2L0QA 1L0HA 2M5RA 2FADA 2L4BA 2XZ1C 2N6ZA 2KR5A 5EJDA 4R0MA 2VSQA 2CNRA 2FVEA 3RG2A 1NQ4A 2KOPA 2KOSA 2KW2A 4PWVB 1T8KA 2AFDA 2K94A 2PNGA 2MY5A 2MVUA 3EJBA 2L9FA 4H2WC 3CE7A 3LMOA 2N6YA 4DG9A 2FAEA 2N5IA 2K92A 2GDWA 2JU2A 4PXHB 5HV8A 5HVCA 1AF8A 1F80D 2KG8A 2LMLA 2K93A 4H2YC 2QNWA 4NEOA 2CG5B 4HKGA 2LKIA 2LIWA 2FVFA 3GZLA 2FQ2A 2K2QA 2ROQA 4BPFA 2MD9A 1HY8A 2MVVA 2FACA 2GDXA 2AVAA 4IZ6A 2KOQA 2KOOA 2JGPA 2LL8A 2L22A 4BPGA 2N5HA 1L0IA 2X2BA 1HQBA 2FVAA 2KG6A 2KORA 4BPHA 5KP7B 2MF4A 2AF8A 1DNYA 2KGCA 2LIUA 2CQ8A 2N98A 2EHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CGQ A;  2JU1 A;  2MR7 A;  3EJE A;  1ACP A;  2KGA A;  5KP6 B;  2N50 A;  1DV5 A;  1KLP A;  1VKU A;  1X3O A;  2AFE A;  3EJD A;  2MR8 A;  2KGD A;  1OR5 A;  2XZ0 D;  3GZM A;  3NY7 B;  4H2X C;  2FQ1 A;  2LTE A;  4MRT C;  2K0Y A;  2LPK A;  5CZD B;  2JQ4 A;  2FHS C;  2FQ0 A;  5KP8 B;  2DNW A;  2KG9 A;  2EHT A;  2KWL A;  2LOL A;  2KGE A;  2K0X A;  4CA3 A;  2GDY A;  2L0Q A;  1L0H A;  2M5R A;  2FAD A;  2L4B A;  2XZ1 C;  2N6Z A;  2KR5 A;  5EJD A;  4R0M A;  2VSQ A;  2CNR A;  2FVE A;  3RG2 A;  1NQ4 A;  2KOP A;  2KOS A;  2KW2 A;  4PWV B;  1T8K A;  2AFD A;  2K94 A;  2PNG A;  2MY5 A;  2MVU A;  3EJB A;  2L9F A;  4H2W C;  3CE7 A;  3LMO A;  2N6Y A;  4DG9 A;  2FAE A;  2N5I A;  2K92 A;  2GDW A;  2JU2 A;  4PXH B;  5HV8 A;  5HVC A;  1AF8 A;  1F80 D;  2KG8 A;  2LML A;  2K93 A;  4H2Y C;  2QNW A;  4NEO A;  2CG5 B;  4HKG A;  2LKI A;  2LIW A;  2FVF A;  3GZL A;  2FQ2 A;  2K2Q A;  2ROQ A;  4BPF A;  2MD9 A;  1HY8 A;  2MVV A;  2FAC A;  2GDX A;  2AVA A;  4IZ6 A;  2KOQ A;  2KOO A;  2JGP A;  2LL8 A;  2L22 A;  4BPG A;  2N5H A;  1L0I A;  2X2B A;  1HQB A;  2FVA A;  2KG6 A;  2KOR A;  4BPH A;  5KP7 B;  2MF4 A;  2AF8 A;  1DNY A;  2KGC A;  2LIU A;  2CQ8 A;  2N98 A;  2EHS A; 
#chains in the Genus database with same CATH topology
 2MR7 A;  3EJE A;  3VRL C;  4XFZ A;  1X3O A;  3DS2 A;  2JB0 A;  4IPY A;  1N8R Q;  1YJ9 P;  5HGL A;  2VLQ A;  3NY7 B;  4U0B A;  2Z45 A;  2WPT A;  1QVG O;  2FQ0 A;  1AYI A;  4WYM A;  2KGE A;  2L0Q A;  4U0F A;  3G28 A;  2M5R A;  2L4B A;  3DTJ A;  1VQM P;  2KW2 A;  3CXC O;  3G1I A;  1K8A Q;  1MZ8 A;  4PH0 A;  1M90 Q;  2FAE A;  2Z46 A;  2JU2 A;  1E0H A;  2KOD A;  1VQL P;  1EIA A;  1CEI A;  3U43 A;  2XV6 A;  4PXH B;  1VQP P;  5F2K A;  1M74 A;  2EIA A;  3CCE P;  1M6N A;  4H2Y C;  3GZL A;  2JBG A;  2ROQ A;  2GZF A;  2XT1 A;  1HY8 A;  1M1K Q;  2MVV A;  5BS2 A;  2FAC A;  1D1D A;  4IZ6 A;  2KOQ A;  2LL8 A;  3CCM P;  1IUQ A;  2VLP A;  1K73 Q;  2FVA A;  1ZMB A;  2KOR A;  2MF4 A;  1E6J P;  2BUO A;  1IMQ A;  1Q7Y Q;  3DS1 A;  5EW5 E;  2L6E A;  2CQ8 A;  3CME P;  2JU1 A;  1VQ8 P;  3CD6 P;  4M0I A;  5KP6 B;  2QEX P;  2N50 A;  1ACP A;  1DV5 A;  2JO0 A;  1VQ4 P;  2K0D X;  2MR8 A;  1GXH A;  3H4E A;  1OR5 A;  2XZ0 D;  3WBH A;  3M1M A;  1VQ5 P;  2FQ1 A;  2LTE A;  3H0D A;  2DNW A;  2E1M A;  2KG9 A;  2KWL A;  2OTL P;  1YIJ P;  2K0X A;  2GDY A;  4GR6 A;  2VLN A;  1L0H A;  5F2O A;  3DS5 A;  2FAD A;  2JYG A;  2N6Z A;  3G21 A;  5EJD A;  4R0M A;  2VSQ A;  3RG2 A;  1NQ4 A;  2K5X A;  1Q86 Q;  1T8K A;  2PNG A;  2MVU A;  3HYB A;  3EJB A;  5HGO A;  3OW2 O;  4H2W C;  2PY8 A;  2N5I A;  2GDW A;  3DS0 A;  4PH1 A;  1Z6M A;  4F37 A;  4XFY A;  3MGE A;  1QVF O;  1AF8 A;  3G71 P;  2K93 A;  3G4S P;  2EG5 A;  2QNW A;  4NEO A;  2CG5 B;  4HKG A;  2LKI A;  2FVF A;  2K2Q A;  3H47 A;  4U0D A;  4U0A A;  1BXI A;  1VQK P;  3RG6 C;  2GDX A;  1YHQ P;  2JYL A;  2ONT A;  2KOO A;  2JGP A;  7CEI A;  2KG6 A;  3CCU P;  2XXM A;  1VQO P;  3CPW O;  3CC4 P;  4QNB A;  3G0V A;  1K30 A;  2PEN A;  2CGQ A;  3CCQ P;  2KGA A;  5JPA A;  1KLP A;  1ZNV A;  4U0E A;  2KGD A;  3GZM A;  1Q82 Q;  1UJZ A;  2LPK A;  2JQ4 A;  4XFX A;  2DGY A;  1YIT P;  1KD1 Q;  1VQ7 P;  1YI2 P;  2FHS C;  5KP8 B;  3NTE A;  2EHT A;  3P05 A;  3DPH A;  3LRY A;  2P9X A;  1IMP A;  3GJN A;  1W2B O;  3CCJ P;  2KOP A;  2KOS A;  5I4T G;  2GZI A;  4PWV B;  2AFD A;  2L9F A;  1YJN P;  3CE7 A;  3LMO A;  1FR2 A;  2N6Y A;  2K92 A;  1Q81 Q;  5HGN A;  1K9M Q;  1M6E X;  4QKO A;  5HVC A;  1KC8 Q;  2LML A;  5F2N A;  2LIW A;  4XRQ A;  2FQ2 A;  2PEK A;  2M8P A;  2MD9 A;  2PEJ A;  2Z44 A;  1GXG A;  3DS3 A;  1AUM A;  2L22 A;  2PEM A;  4BPG A;  2N5H A;  2LF4 A;  4BPH A;  5KP7 B;  2M8N A;  2EFJ A;  4COC A;  2GYK A;  2KGC A;  3DS4 A;  2ERH A;  2NO8 A;  1NJI Q;  2LIU A;  2N98 A;  2GZJ A;  1QRJ A;  1VKU A;  3E2D A;  3B5I A;  3CCL P;  2AFE A;  3EJD A;  1RO2 A;  4U0C A;  3CCR P;  1VQ6 P;  4H2X C;  1GPJ A;  3G26 A;  4MRT C;  2K0Y A;  5CZD B;  3CC7 P;  2PEI A;  3HZQ A;  1RNI A;  3G1G A;  3CMA P;  3CCV P;  2PEQ A;  2LOL A;  4CA3 A;  3CCS P;  1S72 P;  2CWO A;  1VHN A;  2GZE A;  2XZ1 C;  2QA4 P;  2KR5 A;  4GR2 A;  2CNR A;  2FVE A;  2OAR A;  1YJW P;  3B4Q A;  3GKL C;  2K94 A;  2MY5 A;  4UHP B;  3G29 A;  2BHV A;  4DG9 A;  1EMV A;  1A43 A;  1EOQ A;  5HV8 A;  4XRO A;  3I56 P;  1F80 D;  2KG8 A;  2JAZ A;  2OTJ P;  5HGM A;  3CC2 P;  2PEO A;  3Q20 A;  5DCK A;  4BPF A;  5BS1 A;  2M8L A;  2AVA A;  1BAJ A;  3I55 P;  1RO0 A;  1L0I A;  2X2B A;  2VLO A;  1VQ9 P;  1HQB A;  1VQN P;  1JJ2 O;  1A8O A;  1UNK A;  2AF8 A;  1DNY A;  3G6E P;  2GZG A;  4COP A;  2EHS A;  1KQS O; 
#chains in the Genus database with same CATH homology
 2CGQ A;  2JU1 A;  2MR7 A;  3EJE A;  1ACP A;  2KGA A;  5KP6 B;  2N50 A;  1DV5 A;  1KLP A;  1VKU A;  1X3O A;  2AFE A;  3EJD A;  2MR8 A;  2KGD A;  1OR5 A;  2XZ0 D;  3GZM A;  3NY7 B;  4H2X C;  2FQ1 A;  2LTE A;  4MRT C;  2K0Y A;  2LPK A;  5CZD B;  2JQ4 A;  2FHS C;  2FQ0 A;  5KP8 B;  2DNW A;  2KG9 A;  2EHT A;  2KWL A;  2LOL A;  2KGE A;  2K0X A;  4CA3 A;  2GDY A;  2L0Q A;  1L0H A;  2M5R A;  2FAD A;  2L4B A;  2XZ1 C;  2N6Z A;  2KR5 A;  5EJD A;  4R0M A;  2VSQ A;  2CNR A;  2FVE A;  3RG2 A;  1NQ4 A;  2KOP A;  2KOS A;  2KW2 A;  4PWV B;  1T8K A;  2AFD A;  2K94 A;  2PNG A;  2MY5 A;  2MVU A;  3EJB A;  2L9F A;  4H2W C;  3CE7 A;  3LMO A;  2N6Y A;  4DG9 A;  2FAE A;  2N5I A;  2K92 A;  2GDW A;  2JU2 A;  4PXH B;  5HV8 A;  5HVC A;  1AF8 A;  1F80 D;  2KG8 A;  2LML A;  2K93 A;  4H2Y C;  2QNW A;  4NEO A;  2CG5 B;  4HKG A;  2LKI A;  2LIW A;  2FVF A;  3GZL A;  2FQ2 A;  2K2Q A;  2ROQ A;  4BPF A;  2MD9 A;  1HY8 A;  2MVV A;  2FAC A;  2GDX A;  2AVA A;  4IZ6 A;  2KOQ A;  2KOO A;  2JGP A;  2LL8 A;  2L22 A;  4BPG A;  2N5H A;  1L0I A;  2X2B A;  1HQB A;  2FVA A;  2KG6 A;  2KOR A;  4BPH A;  5KP7 B;  2MF4 A;  2AF8 A;  1DNY A;  2KGC A;  2LIU A;  2CQ8 A;  2N98 A;  2EHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...