1KLPA

The solution structure of acyl carrier protein from mycobacterium tuberculosis
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
115
structure length
115
Chain Sequence
MPVTQEEIIAGIAEIIEEVTGIEPSEITPEKSFVDDLDIDSLSMVEIAVQTEDKYGVKIPDEDLAGLRTVGDVVAYIQKLEEENPEAAQALRAKIESENPDAVANVQARLEAESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MEROMYCOLATE EXTENSION ACYL CARRIER PROTEIN
publication title The solution structure of acyl carrier protein from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligand transport
total genus 16
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2001-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1klpA00
2MVUA 2GDWA 2CQ8A 2K0YA 2JU1A 2FVFA 2FQ2A 5KP6B 2MVVA 2KG6A 2MF4A 4BPHA 2LOLA 2N98A 3EJDA 2N50A 2LKIA 2N5HA 2K92A 2KG9A 2XZ1C 2VSQA 4H2YC 2FADA 4H2WC 2AVAA 5HVCA 1L0HA 3EJBA 2JU2A 3RG2A 2CNRA 2K0XA 4PXHB 2FVAA 2MR8A 2KGEA 4NEOA 3GZMA 2L0QA 2DNWA 2MR7A 5EJDA 3GZLA 2KOSA 4CA3A 4BPFA 2N6ZA 5KP8B 2XZ0D 2L22A 2QNWA 2FQ1A 2MD9A 1X3OA 3LMOA 1T8KA 2KWLA 2KGAA 1AF8A 2L4BA 1L0IA 4HKGA 2AFEA 2KW2A 5HV8A 1ACPA 2CG5B 1F80D 2AF8A 2GDYA 2KG8A 2L9FA 4MRTC 5KP7B 2LIWA 2GDXA 2KGDA 2ROQA 4R0MA 1DNYA 2KOQA 4H2XC 2EHSA 4PWVB 2KR5A 2X2BA 2FACA 4DG9A 2JGPA 4IZ6A 2PNGA 2LPKA 2KOPA 2K93A 2JQ4A 1KLPA 2K2QA 1HQBA 2KGCA 2LTEA 2N6YA 5CZDB 2FQ0A 2KORA 2LL8A 2K94A 1VKUA 2KOOA 2FVEA 2LMLA 3EJEA 2M5RA 2FHSC 3NY7B 2LIUA 1OR5A 2N5IA 1DV5A 2EHTA 2MY5A 2FAEA 4BPGA 2AFDA 1NQ4A 1HY8A 2CGQA 3CE7A
chains in the Genus database with same CATH superfamily
2JYLA 2K0YA 2MVVA 3WBHA 3G0VA 1VQ8P 1EOQA 2N98A 4U0FA 1IMPA 4M0IA 2M8LA 1A43A 2PENA 2VSQA 4H2YC 2JAZA 4H2WC 3CC2P 1EMVA 4U0AA 3RG2A 2JBGA 2K0XA 1VQLP 2MR8A 4NEOA 3GZMA 2L0QA 2PY8A 5EJDA 2VLNA 3CXCO 2PEKA 2EG5A 1EIAA 2N6ZA 1YJ9P 1YJWP 2FQ1A 1JJ2O 1VQKP 1N8RQ 1X3OA 2AFEA 2Z45A 3G29A 2PEQA 2KGDA 3RG6C 1D1DA 2KR5A 2X2BA 1FR2A 1K8AQ 2KOPA 4XRQA 1KLPA 2PEJA 1A8OA 1Q86Q 3CD6P 2QA4P 3DS0A 2LTEA 2PEMA 2FQ0A 2KORA 1CEIA 4F37A 1M6EX 1VKUA 2KODA 3EJEA 3P05A 2EFJA 3NY7B 3CMAP 2N5IA 2K5XA 1NJIQ 2EHTA 2FAEA 2AFDA 3H4EA 3Q20A 2FQ2A 2XV6A 2KG6A 1QVGO 4BPHA 3MGEA 1K73Q 2LOLA 2NO8A 2JO0A 2M8PA 2N50A 2K92A 2KG9A 1RNIA 4U0CA 1VQ7P 1M1KQ 3CPWO 5I4TG 5HVCA 1L0HA 2JU2A 1VQMP 4PXHB 2FVAA 2DNWA 1M90Q 2KOSA 4CA3A 5F2NA 1Q82Q 4BPFA 4XFXA 2L22A 2KWLA 2LF4A 1AF8A 2QEXP 2L4BA 2XT1A 1L0IA 4XROA 5HV8A 4GR6A 5HGLA 2JB0A 3I56P 2L9FA 4PH1A 3U43A 1GPJA 3VRLC 4UHPB 3G1IA 2KOQA 4PWVB 3CCUP 2PNGA 2LPKA 1VQ6P 2K93A 2OTJP 1BXIA 2K2QA 1W2BO 1RO2A 1QRJA 2WPTA 1VQPP 3CC4P 5HGOA 2K94A 4U0BA 2FVEA 2K0DX 2FHSC 3LRYA 5F2KA 2GYKA 2EIAA 1NQ4A 1KQSO 3I55P 2MVUA 3CC7P 3CCEP 3H0DA 1E0HA 1VQOP 5KP6B 3HYBA 5BS1A 2BUOA 1K30A 2GZIA 2DGYA 2LKIA 2XZ1C 4XFZA 1UJZA 5DCKA 1Q7YQ 2M8NA 2AVAA 5JPAA 4XFYA 2CNRA 1MZ8A 1ZNVA 5F2OA 3G6EP 1YJNP 2MR7A 2ERHA 2OTLP 3HZQA 4U0DA 3LMOA 1ZMBA 1ACPA 3G71P 2CG5B 2VLPA 4GR2A 2AF8A 2GDYA 3G26A 2Z44A 4MRTC 2GZEA 4R0MA 2EHSA 2VLQA 3B5IA 4DG9A 2JGPA 2ONTA 3CCVP 3GKLC 2JQ4A 1E6JP 3DS1A 1HQBA 2KGCA 1YHQP 2CWOA 1VQNP 2E1MA 2LL8A 1KD1Q 3CCQP 4WYMA 4COCA 2KOOA 4PH0A 2VLOA 5HGMA 2XXMA 3DS5A 3DS4A 1QVFO 1Z6MA 1M74A 2MY5A 2OARA 3CE7A 3CCSP 2GDWA 2CQ8A 2GZJA 3M1MA 2JU1A 1K9MQ 2FVFA 1YI2P 3DS3A 3E2DA 2MF4A 3CCMP 1VHNA 3G1GA 7CEIA 3DPHA 2PEIA 3EJDA 2N5HA 2Z46A 1YITP 2FADA 1GXHA 4COPA 1IMQA 1IUQA 3EJBA 5HGNA 3G28A 1BAJA 2KGEA 4QNBA 2L6EA 3GZLA 3OW2O 5KP8B 2XZ0D 1S72P 3G4SP 2QNWA 2MD9A 4IPYA 1T8KA 2KGAA 5BS2A 4HKGA 2KW2A 3CCRP 1M6NA 1KC8Q 1F80D 3B4QA 2KG8A 2JYGA 2P9XA 3G21A 5EW5E 2LIWA 5KP7B 2GDXA 2ROQA 3CCJP 1AUMA 1DNYA 4H2XC 2FACA 1YIJP 1RO0A 4IZ6A 2PEOA 2BHVA 2GZGA 3DTJA 4QKOA 3NTEA 1GXGA 2GZFA 3GJNA 4U0EA 2N6YA 5CZDB 1AYIA 2LMLA 3DS2A 2M5RA 1UNKA 2LIUA 1OR5A 1DV5A 3CMEP 1VQ5P 3H47A 1Q81Q 4BPGA 1VQ4P 1VQ9P 1HY8A 2CGQA 3CCLP
chains in the Genus database with same CATH topology
2MVUA 2GDWA 2CQ8A 2K0YA 2JU1A 2FVFA 2FQ2A 5KP6B 2MVVA 2KG6A 2MF4A 4BPHA 2LOLA 2N98A 3EJDA 2N50A 2LKIA 2N5HA 2K92A 2KG9A 2XZ1C 2VSQA 4H2YC 2FADA 4H2WC 2AVAA 5HVCA 1L0HA 3EJBA 2JU2A 3RG2A 2CNRA 2K0XA 4PXHB 2FVAA 2MR8A 2KGEA 4NEOA 3GZMA 2L0QA 2DNWA 2MR7A 5EJDA 3GZLA 2KOSA 4CA3A 4BPFA 2N6ZA 5KP8B 2XZ0D 2L22A 2QNWA 2FQ1A 2MD9A 1X3OA 3LMOA 1T8KA 2KWLA 2KGAA 1AF8A 2L4BA 1L0IA 4HKGA 2AFEA 2KW2A 5HV8A 1ACPA 2CG5B 1F80D 2AF8A 2GDYA 2KG8A 2L9FA 4MRTC 5KP7B 2LIWA 2GDXA 2KGDA 2ROQA 4R0MA 1DNYA 2KOQA 4H2XC 2EHSA 4PWVB 2KR5A 2X2BA 2FACA 4DG9A 2JGPA 4IZ6A 2PNGA 2LPKA 2KOPA 2K93A 2JQ4A 1KLPA 2K2QA 1HQBA 2KGCA 2LTEA 2N6YA 5CZDB 2FQ0A 2KORA 2LL8A 2K94A 1VKUA 2KOOA 2FVEA 2LMLA 3EJEA 2M5RA 2FHSC 3NY7B 2LIUA 1OR5A 2N5IA 1DV5A 2EHTA 2MY5A 2FAEA 4BPGA 2AFDA 1NQ4A 1HY8A 2CGQA 3CE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MVU A;  2GDW A;  2CQ8 A;  2K0Y A;  2JU1 A;  2FVF A;  2FQ2 A;  5KP6 B;  2MVV A;  2KG6 A;  2MF4 A;  4BPH A;  2LOL A;  2N98 A;  3EJD A;  2N50 A;  2LKI A;  2N5H A;  2K92 A;  2KG9 A;  2XZ1 C;  2VSQ A;  4H2Y C;  2FAD A;  4H2W C;  2AVA A;  5HVC A;  1L0H A;  3EJB A;  2JU2 A;  3RG2 A;  2CNR A;  2K0X A;  4PXH B;  2FVA A;  2MR8 A;  2KGE A;  4NEO A;  3GZM A;  2L0Q A;  2DNW A;  2MR7 A;  5EJD A;  3GZL A;  2KOS A;  4CA3 A;  4BPF A;  2N6Z A;  5KP8 B;  2XZ0 D;  2L22 A;  2QNW A;  2FQ1 A;  2MD9 A;  1X3O A;  3LMO A;  1T8K A;  2KWL A;  2KGA A;  1AF8 A;  2L4B A;  1L0I A;  4HKG A;  2AFE A;  2KW2 A;  5HV8 A;  1ACP A;  2CG5 B;  1F80 D;  2AF8 A;  2GDY A;  2KG8 A;  2L9F A;  4MRT C;  5KP7 B;  2LIW A;  2GDX A;  2KGD A;  2ROQ A;  4R0M A;  1DNY A;  2KOQ A;  4H2X C;  2EHS A;  4PWV B;  2KR5 A;  2X2B A;  2FAC A;  4DG9 A;  2JGP A;  4IZ6 A;  2PNG A;  2LPK A;  2KOP A;  2K93 A;  2JQ4 A;  1KLP A;  2K2Q A;  1HQB A;  2KGC A;  2LTE A;  2N6Y A;  5CZD B;  2FQ0 A;  2KOR A;  2LL8 A;  2K94 A;  1VKU A;  2KOO A;  2FVE A;  2LML A;  3EJE A;  2M5R A;  2FHS C;  3NY7 B;  2LIU A;  1OR5 A;  2N5I A;  1DV5 A;  2EHT A;  2MY5 A;  2FAE A;  4BPG A;  2AFD A;  1NQ4 A;  1HY8 A;  2CGQ A;  3CE7 A; 
#chains in the Genus database with same CATH topology
 2JYL A;  2K0Y A;  2MVV A;  3WBH A;  3G0V A;  1VQ8 P;  1EOQ A;  2N98 A;  4U0F A;  1IMP A;  4M0I A;  2M8L A;  1A43 A;  2PEN A;  2VSQ A;  4H2Y C;  2JAZ A;  4H2W C;  3CC2 P;  1EMV A;  4U0A A;  3RG2 A;  2JBG A;  2K0X A;  1VQL P;  2MR8 A;  4NEO A;  3GZM A;  2L0Q A;  2PY8 A;  5EJD A;  2VLN A;  3CXC O;  2PEK A;  2EG5 A;  1EIA A;  2N6Z A;  1YJ9 P;  1YJW P;  2FQ1 A;  1JJ2 O;  1VQK P;  1N8R Q;  1X3O A;  2AFE A;  2Z45 A;  3G29 A;  2PEQ A;  2KGD A;  3RG6 C;  1D1D A;  2KR5 A;  2X2B A;  1FR2 A;  1K8A Q;  2KOP A;  4XRQ A;  1KLP A;  2PEJ A;  1A8O A;  1Q86 Q;  3CD6 P;  2QA4 P;  3DS0 A;  2LTE A;  2PEM A;  2FQ0 A;  2KOR A;  1CEI A;  4F37 A;  1M6E X;  1VKU A;  2KOD A;  3EJE A;  3P05 A;  2EFJ A;  3NY7 B;  3CMA P;  2N5I A;  2K5X A;  1NJI Q;  2EHT A;  2FAE A;  2AFD A;  3H4E A;  3Q20 A;  2FQ2 A;  2XV6 A;  2KG6 A;  1QVG O;  4BPH A;  3MGE A;  1K73 Q;  2LOL A;  2NO8 A;  2JO0 A;  2M8P A;  2N50 A;  2K92 A;  2KG9 A;  1RNI A;  4U0C A;  1VQ7 P;  1M1K Q;  3CPW O;  5I4T G;  5HVC A;  1L0H A;  2JU2 A;  1VQM P;  4PXH B;  2FVA A;  2DNW A;  1M90 Q;  2KOS A;  4CA3 A;  5F2N A;  1Q82 Q;  4BPF A;  4XFX A;  2L22 A;  2KWL A;  2LF4 A;  1AF8 A;  2QEX P;  2L4B A;  2XT1 A;  1L0I A;  4XRO A;  5HV8 A;  4GR6 A;  5HGL A;  2JB0 A;  3I56 P;  2L9F A;  4PH1 A;  3U43 A;  1GPJ A;  3VRL C;  4UHP B;  3G1I A;  2KOQ A;  4PWV B;  3CCU P;  2PNG A;  2LPK A;  1VQ6 P;  2K93 A;  2OTJ P;  1BXI A;  2K2Q A;  1W2B O;  1RO2 A;  1QRJ A;  2WPT A;  1VQP P;  3CC4 P;  5HGO A;  2K94 A;  4U0B A;  2FVE A;  2K0D X;  2FHS C;  3LRY A;  5F2K A;  2GYK A;  2EIA A;  1NQ4 A;  1KQS O;  3I55 P;  2MVU A;  3CC7 P;  3CCE P;  3H0D A;  1E0H A;  1VQO P;  5KP6 B;  3HYB A;  5BS1 A;  2BUO A;  1K30 A;  2GZI A;  2DGY A;  2LKI A;  2XZ1 C;  4XFZ A;  1UJZ A;  5DCK A;  1Q7Y Q;  2M8N A;  2AVA A;  5JPA A;  4XFY A;  2CNR A;  1MZ8 A;  1ZNV A;  5F2O A;  3G6E P;  1YJN P;  2MR7 A;  2ERH A;  2OTL P;  3HZQ A;  4U0D A;  3LMO A;  1ZMB A;  1ACP A;  3G71 P;  2CG5 B;  2VLP A;  4GR2 A;  2AF8 A;  2GDY A;  3G26 A;  2Z44 A;  4MRT C;  2GZE A;  4R0M A;  2EHS A;  2VLQ A;  3B5I A;  4DG9 A;  2JGP A;  2ONT A;  3CCV P;  3GKL C;  2JQ4 A;  1E6J P;  3DS1 A;  1HQB A;  2KGC A;  1YHQ P;  2CWO A;  1VQN P;  2E1M A;  2LL8 A;  1KD1 Q;  3CCQ P;  4WYM A;  4COC A;  2KOO A;  4PH0 A;  2VLO A;  5HGM A;  2XXM A;  3DS5 A;  3DS4 A;  1QVF O;  1Z6M A;  1M74 A;  2MY5 A;  2OAR A;  3CE7 A;  3CCS P;  2GDW A;  2CQ8 A;  2GZJ A;  3M1M A;  2JU1 A;  1K9M Q;  2FVF A;  1YI2 P;  3DS3 A;  3E2D A;  2MF4 A;  3CCM P;  1VHN A;  3G1G A;  7CEI A;  3DPH A;  2PEI A;  3EJD A;  2N5H A;  2Z46 A;  1YIT P;  2FAD A;  1GXH A;  4COP A;  1IMQ A;  1IUQ A;  3EJB A;  5HGN A;  3G28 A;  1BAJ A;  2KGE A;  4QNB A;  2L6E A;  3GZL A;  3OW2 O;  5KP8 B;  2XZ0 D;  1S72 P;  3G4S P;  2QNW A;  2MD9 A;  4IPY A;  1T8K A;  2KGA A;  5BS2 A;  4HKG A;  2KW2 A;  3CCR P;  1M6N A;  1KC8 Q;  1F80 D;  3B4Q A;  2KG8 A;  2JYG A;  2P9X A;  3G21 A;  5EW5 E;  2LIW A;  5KP7 B;  2GDX A;  2ROQ A;  3CCJ P;  1AUM A;  1DNY A;  4H2X C;  2FAC A;  1YIJ P;  1RO0 A;  4IZ6 A;  2PEO A;  2BHV A;  2GZG A;  3DTJ A;  4QKO A;  3NTE A;  1GXG A;  2GZF A;  3GJN A;  4U0E A;  2N6Y A;  5CZD B;  1AYI A;  2LML A;  3DS2 A;  2M5R A;  1UNK A;  2LIU A;  1OR5 A;  1DV5 A;  3CME P;  1VQ5 P;  3H47 A;  1Q81 Q;  4BPG A;  1VQ4 P;  1VQ9 P;  1HY8 A;  2CGQ A;  3CCL P; 
#chains in the Genus database with same CATH homology
 2MVU A;  2GDW A;  2CQ8 A;  2K0Y A;  2JU1 A;  2FVF A;  2FQ2 A;  5KP6 B;  2MVV A;  2KG6 A;  2MF4 A;  4BPH A;  2LOL A;  2N98 A;  3EJD A;  2N50 A;  2LKI A;  2N5H A;  2K92 A;  2KG9 A;  2XZ1 C;  2VSQ A;  4H2Y C;  2FAD A;  4H2W C;  2AVA A;  5HVC A;  1L0H A;  3EJB A;  2JU2 A;  3RG2 A;  2CNR A;  2K0X A;  4PXH B;  2FVA A;  2MR8 A;  2KGE A;  4NEO A;  3GZM A;  2L0Q A;  2DNW A;  2MR7 A;  5EJD A;  3GZL A;  2KOS A;  4CA3 A;  4BPF A;  2N6Z A;  5KP8 B;  2XZ0 D;  2L22 A;  2QNW A;  2FQ1 A;  2MD9 A;  1X3O A;  3LMO A;  1T8K A;  2KWL A;  2KGA A;  1AF8 A;  2L4B A;  1L0I A;  4HKG A;  2AFE A;  2KW2 A;  5HV8 A;  1ACP A;  2CG5 B;  1F80 D;  2AF8 A;  2GDY A;  2KG8 A;  2L9F A;  4MRT C;  5KP7 B;  2LIW A;  2GDX A;  2KGD A;  2ROQ A;  4R0M A;  1DNY A;  2KOQ A;  4H2X C;  2EHS A;  4PWV B;  2KR5 A;  2X2B A;  2FAC A;  4DG9 A;  2JGP A;  4IZ6 A;  2PNG A;  2LPK A;  2KOP A;  2K93 A;  2JQ4 A;  1KLP A;  2K2Q A;  1HQB A;  2KGC A;  2LTE A;  2N6Y A;  5CZD B;  2FQ0 A;  2KOR A;  2LL8 A;  2K94 A;  1VKU A;  2KOO A;  2FVE A;  2LML A;  3EJE A;  2M5R A;  2FHS C;  3NY7 B;  2LIU A;  1OR5 A;  2N5I A;  1DV5 A;  2EHT A;  2MY5 A;  2FAE A;  4BPG A;  2AFD A;  1NQ4 A;  1HY8 A;  2CGQ A;  3CE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...