1KLTA

Crystal structure of pmsf-treated human chymase at 1.9 angstroms resolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
226
structure length
226
Chain Sequence
IIGGTESKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of phenylmethanesulfonyl fluoride-treated human chymase at 1.9 A.
pubmed doi rcsb
molecule keywords CHYMASE
molecule tags Serine protease
source organism Homo sapiens
total genus 45
structure length 226
sequence length 226
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 1997-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kltA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kltA02
3LONA 2FEQH 2ZFQH 1C1QA 4WJG2 1AUTC 2IOTA 4D7FA 1O3LA 3SHAH 1D3QB 2BDBA 2TBSA 4ZXXH 3E3TA 2A2QH 3D65E 2ZZUH 1W10U 5L2ZH 2AGGX 1MQ6A 4X2VA 2BDYA 2BZAA 1TOMH 1ELAA 2LNCA 2NU4E 1M9UA 3T5FH 5CMXH 3H5CB 4K3JA 4DT7B 4WMFA 1BA8B 1MMJN 2A4RA 5C1UA 1MKWK 1KIGH 4FUDA 1LQEA 3TGIE 2VIPA 1J9CH 2XWAA 3MNCA 4NIVA 2ZDNA 1FZZA 2HWLB 1FAXA 5C5NA 3KQDA 1C2HA 2FO9A 1QRZA 1PQAA 3SI4H 2A32A 1GHBG 1AWHB 4ABFA 5HM9A 4XBCA 1B0EA 1YPLH 4MLFB 3U8RH 3F9FA 2VU8E 1HJAC 2FYRA 1MTNC 4X6NA 3LDXH 1FY1A 1O2WA 5A0BA 1EB1H 1OWEA 1E38B 4CR9A 3SJ9A 1BTHH 1BTZA 1B5GH 1CBWC 1GI1A 4ABEA 4A1XA 4UE7H 4CH2B 1SHYA 2BLVA 3A8CA 3D23A 2ALVA 2QXJA 3D49H 1TPOA 1Y5BT 1CHOG 2PSXA 3LC5A 3TNTA 1AKSA 1GJ5H 4NA9H 4I33A 2QC2A 5E8EH 3L6PA 3QK1A 1EZSC 1QJ7B 1MTWA 2ZU1A 3NZIA 2FX6A 5C3NA 1V3XA 1MQ5A 1T4UH 1DSTA 2A0QB 4CRBA 5I46H 5EOKA 3UNQA 1S85A 1SBWA 2BQ7B 2PTNA 1P3CA 2H9TH 3HGPA 2Z3CA 1QGFA 2ODYB 2ZGHA 1XVMA 2AS9A 2R0LA 4CH8B 3ZVGA 1BRUP 3ZZAA 3ODFA 1F5RA 1V2NT 1O5GH 3OSYA 4YOGA 3LOXA 4AB8A 2GDDA 3SNBA 1SLXB 5ESBA 3BF6H 3MYWA 4I8HA 3ZZ4A 4WWYA 2ZFRH 2AFQB 4BXSA 5AFZH 2JETB 1GHZA 1ZRKA 2D8WA 2G52A 3KL6A 3E16B 3PWCA 1AB9C 3A82A 1F7ZA 1HB0B 1C1RA 1KXBA 1XUKA 2ZCLP 4ASHA 1K28D 8ESTE 2GVFA 1AGJA 1VITF 1NC6A 2P16A 1ARBA 1NU7B 1K1LA 3NPSA 3SV2H 2XBWA 3PTBA 4AFZA 1DPOA 4IS5A 3M5MA 2BYAX 3I29A 1DUAA 4OS6A 1YCPK 1CHGA 2ZO3H 1Q3XA 1A2CH 1V2VT 3SV8A 2HGTH 4B1TA 1XUHA 2BD5A 1G3CA 1V2KT 2BX4A 1OSSA 3P8FA 4BAOB 2H2ZA 1ESBA 4U01A 3DT0H 3LGUA 2P93A 2G5NA 2AYWA 2R3UA 1VITH 4D76A 2BLOA 2LPRA 1SGIB 2TGDA 2Y82A 4B2CA 1Y8TA 1A46H 3RU4T 1PYTC 3ESTA 2XC4A 1SGPE 1V2JT 3EDXB 4JYTA 3BTQE 1ELFA 2P3UB 4UEHH 1HIAB 1QA7A 3BIUH 1GHVH 3EA9A 4NIXA 1PYTD 4I32A 2H9HA 4FUFA 1TNGA 4LOYH 1S6FA 3A83A 1O5FH 2CHAB 2BOHB 4CHAB 2I6SA 4JK6A 2EI8A 4MPUA 5LPRA 1Z8JB 3FP8E 1ARCA 3SNDA 2J94A 2A5IA 2PKSC 1RTLA 3UIRA 1ORFA 1AIXH 1A5HA 4K2YA 3AAVA 4IN2A 2C8XB 2XBXA 1SGFG 4FUGA 3K9XB 4ZMAH 1EXFA 1ZPZA 2FTLE 3U8TH 4BAQB 1NM6A 2B0FA 4KKDA 2H5DA 1MU6B 2A4GA 1EATA 1OPHB 2QXGA 1KXEA 3MWIU 5EXMA 3HATH 3SBKA 1KTSB 1IQNA 3P92A 1O2XA 4GHQA 4ABIA 1C5LH 2P8OC 4AYYB 1MUEB 3B23B 3MOCA 1HAHH 3BG4C 3ZZ9A 3OYPA 3GCNA 1WU1A 2OC1A 2ASUB 3UNSA 1WTGH 4NSVA 1J14A 3SUFA 3EYDA 3F9EA 2BQWB 1P2JA 1XUIA 3P8OA 1O2SA 2FOAA 3RXJA 1O39A 4MPWA 5EQSA 5EU8A 1UK2A 3BV9B 3ITIA 1WAYB 2Y7ZA 3SQHE 1O31A 2OP9A 1AVGH 3H7TA 1GMCG 4HZHA 1IOEA 1LHDH 3EQ0H 4FVBA 2QY0B 1PPGE 1UTLM 3VB6A 1UCYK 1C5VA 3M61U 4R0IA 2A7HA 1FPCH 2G8TA 1GMDF 4MNWA 2EI6A 1C5YB 3RM0H 3O8RA 1P03A 4AFQA 1TX8A 2ZU3A 3M35A 1LVOA 1P01A 1TBQH 5T6FA 1GBIA 1SG8B 1HAYB 4Y0ZE 1CA8B 1BMMH 3ZVEA 1O5DH 3E0PB 2SNVA 1FV9A 4MDSA 1D6WA 1Y5UT 4XDEA 1VCQA 1H8IH 3B8JA 4D9QA 1O2PA 3D62A 3RMOH 2F9NA 4GCHF 3R0FA 3RM2H 4TY6A 1OYQA 1S84A 1EAXA 3BTDE 2O8LA 1INCA 2ZIQH 1TRNA 1RIWB 1Y5AT 5IYTA 1C2GA 1EPTB 2ANMH 5FBEA 3RXLA 1O2IA 3F9HA 4FXGH 3FZDA 1FMGA 3UQVA 1W3CA 1DXPA 2CF9H 2SGPE 1EZXC 5AVDA 4NZLA 1C2LA 1QTFA 1GL1A 1QRWA 2B9LA 3BTWE 3SJIA 1HBTH 5F8TA 4ZUHA 1C2IA 3ODDA 1NPMA 3FANA 5AFYH 3A7YA 1MBQA 2Y81A 1T4VH 1YPGH 2XBVA 4ISHH 1TALA 1PPZA 4HGCA 1DX5M 1KDQB 1NFXA 2SGFE 3KIDU 5FCRA 4K1TA 2F83A 2ZTYA 4FU7A 1LVMA 1EQ9A 2VWNA 2OQ5A 5GPIB 1GBBA 1FXYA 3QGJA 3MI4A 1C2JA 1T8LA 1JWTA 3AASA 1G36A 3RXRA 1CA0C 2OLGA 3QDZB 4X2XA 1DDJA 2FP7B 1O3PB 1D3DB 2HPQH 4E7RG 3ZV8A 2PUQH 1DANH 3P17H 3EGKH 1UTOA 2VGCB 3RXPA 3WY8A 1D6RA 4ZKSU 1O3IA 1C5SA 1GI8B 2C8ZB 2WPKS 2ZECA 1FIWA 1HJ8A 1VJ9U 1WUNH 3QZQA 3RXTA 3UWIA 4B76A 1ZYOA 1KXCA 3E6PH 4K8BA 3KQCA 1WV7H 1THRH 5JPMH 5SGAE 2Z9KA 1YPKH 4ABDA 1J16A 1SGRE 1O5CB 4FU9A 1SB1H 2ZTZA 2FESH 1MKXK 4NZQA 3MMGA 1TGCA 5DK1A 5T6DA 3EA7A 1AZ8A 3MTYA 1C1TA 1IHTH 4MG3A 2OC0A 3BSQA 4LK4A 4YTAA 1BMAA 1F0RA 3QGNB 1A0HB 1QY6A 1W7XH 3PYHA 1FONA 1GBLA 1C4V2 1IQEA 5GIBA 4IBLH 5GDSH 3TH3H 1LTOA 1O3BA 1HGTH 1VGCC 2HOBA 1X7AC 2WUCA 1Y59T 3LGVA 3UY9A 5F03A 2ZF0H 1GJ6A 4OGXA 3ATIA 1OP2A 9LPRA 2BMGB 4J2YB 3RUOA 1EB2A 1GL0E 3W95A 1FN8A 4XBDA 5LPEA 2BY9X 3PB1E 4WXVA 4CR5A 3QLPH 3RXHA 2EEKA 1JBUH 2PW8H 2XCFA 1HAVB 1SQTA 2ODQA 2V6NA 1QIXB 3CP7A 1G3DA 2TIOA 1TLDA 1N8OC 4KTCA 2PFEA 1TGSZ 3GCTF 1YP9A 1O0DH 3GDSA 4O3UA 4JZDH 1DWBH 1FY8E 2C90B 4JCNA 4ABBA 3UNRA 1O2JA 1Z6EA 6GCHF 1YLDA 4XOJA 3ATLA 1V2PT 1Y3WA 3H7OA 2A7CA 2TPIZ 2CXVA 3BEUA 5CHAC 1UTJA 4YT7H 3RU4D 1QR3E 1FNIA 2ZCHP 1GJCB 5C2ZA 4TY7A 1MTVA 1Q31A 2R9PA 4AYVB 3KNXA 1ESTA 3AVZA 1ZTJA 3T27A 4Q80A 1LDTT 2R2MB 4AN7A 3ZZ8A 3RC6A 1P2QA 1AHTH 5DP7A 2RG3A 4YM9A 8GCHF 2PUXB 3SHCH 5CE1A 3VXEH 4ZKOU 8KME2 5LH8A 3ZZ6A 1SFIA 2Q6DA 2GTBA 4DW2U 5A8YA 4I7YH 1OOKB 2IPHA 6ESTA 1A61H 3BN9A 4LZ4B 3A8AA 3CS7A 1JOUB 1KY9A 4DOQA 2BVSH 3MFJA 2XW9A 1DUEA 2VWMA 2ZGJA 4O97A 3SUEA 4BTUB 3QTOH 1QQ4A 3GDUA 2G00A 1EZUC 1QURH 1P2OA 4E05H 1IQIA 1HAPH 3SN8A 2NU3E 5JBBS 4TPYA 2BD2A 1ZOMA 2BLWA 1O2OA 1HUTH 1NY22 3AAUA 4Q2KA 1BOQA 1LO6A 1A4WH 2KAIA 1F92A 1A1RA 1PPBH 4VGCC 1TGBA 5T3HA 2AGIX 1G32B 1AY6H 2QN5T 1GJAB 1O2ZA 4UFFH 1SGQE 1QB6A 1ESAA 4X1QU 2P59A 2FWWA 2FLBH 2R2WU 1AI8H 1QBVH 1P3EA 2FM2A 1A0JA 3PO1B 1GJ7B 1K1PA 1K2I1 3MU1A 1LPGB 2QV1A 4YOIA 1WBGB 1FY5A 1S0RA 4DJZB 2FOBA 1VITG 1T8OA 1UVTH 1HXFH 5FPYA 4Y76A 1C1WH 6CHAB 2P95A 1MBMA 1SVPA 1GGDB 2GDEH 3O8BA 1TBZH 1GCTC 1LKAA 3O8DA 1SLWB 4BAMB 2ANYA 1DSUA 1F0SA 1LVYA 1O2MA 4GLYA 2XWBI 3BTKE 3FP6E 1UVSH 3K2UA 2Z9GA 4JZIA 1P11E 3TH4H 2GV6A 3PLPA 2O8WA 4AG1A 1GI0A 4RKJB 1IQFA 3S9CA 3VB5A 2Y5HA 4X1RU 5JBTA 2W7UA 3SGQE 3DA9B 1H8DH 2A2XH 2OTVA 2FX4A 4DCDA 4I8GA 1P2KA 1T32A 1DM4B 1GCDA 1GDQA 2GD4B 1O2KA 3A7WA 3FFGA 1ETRH 1ELVA 3HGNA 1CGIE 3MH6A 1D4PB 2JH0D 1C5RA 2TGTA 4LZ1H 1C9PA 5A2MH 1F5LA 1ETSH 1UVPA 3NUMA 4KP0A 9ESTA 1O34A 3EAJA 4NWLA 4MNXA 4NFEA 3KN2A 3MO3A 5H4IB 1BDAA 3S69A 1C1SA 4Y71A 3A7XA 3DHKH 3LIWA 3BTEE 1HAIH 5FCKA 1TABE 1UCYE 1C4U2 3CENA 3LGWA 5PTPA 3OU0A 1E35B 2FXRA 4U2WA 3V7TA 1QRXA 2Z3EA 7KMEH 1TWXB 4UDWH 2GP9B 3LH3A 2GX4A 1PQ8A 1EAUA 4UONA 1HJAB 1YC0A 2THFB 5EPNA 3RLWH 3LKWA 3DFLA 4ZKRU 1V2RT 1MTNB 2BD3A 2W3KA 2BDCA 2BM2A 2VIWA 2Y5GA 2ZFPH 2QF0A 3P95A 4XFQA 2ANWA 4BTTB 1FPHH 1GI6A 4Y7BA 1OYTH 1MAXA 2XTTB 1Y3YA 2GCHF 1CBWB 3RDZA 1SGYE 4INKA 2PV9B 1O3NA 1YCPM 3ZYDA 1P2IA 2BHGA 3TK5A 1OXGA 1HRTH 2QCYA 1HAOH 4SGAE 1SR5C 2UUFB 1TQ7B 4CRGA 1XUJA 3RXOA 2ZGXH 3GY5A 2J92A 1BMLA 1H9HE 1W13U 2C4FH 3MU0A 3SGBE 1GBJA 1TPSA 1Z6JH 3GY4A 1AN1E 3HKIB 4ISLA 3T62A 1FQ3A 2O8MA 3M7UA 1QL8A 1GVZA 3BTME 1O37A 3GY3A 1BBRK 4BANB 4XBBA 3MO6A 4I31A 5DPAA 1UTMA 5DP6A 4FUCA 4AZ2B 2ILNA 1GMDG 4IN1A 1O2RA 3RXAA 3R3GB 3BTGE 3OTJE 2RDLA 1NFYA 4JZEH 4K8YA 3MH5A 2A45B 8LPRA 3S9BA 3BEFB 1GBEA 1Z8RA 2A7JA 4F49A 1O32A 4Y79A 7GCHG 1TMBH 5JDUB 1JIMA 1ZMLA 2AERH 1AB9B 1D3TB 1CGHA 1UMAH 1ZZZA 2HLCA 1OWJA 4NA8A 3ZZDA 1Z8IB 2BD9A 3GY6A 5E2OA 4IGDA 5BRRE 2O8UA 4AFUA 1NN6A 1C5PA 4TPIZ 4K5ZA 2F9BH 2FLRH 1W8BH 2W26A 1TYNA 1RFNA 4RKOB 1TX7A 3OX7U 1ANDA 4B74A 4GCHG 2A4QA 2PKAB 1UK4A 1G2MA 1A7SA 2WV4A 1OS8A 3MNBA 2ZG0H 3UREA 1V2OT 4CBNA 2FTMA 1KYNA 1D9IA 1O5BB 2Y6TA 3SV7A 1NO9H 2OBOA 2ZTXA 1GBAA 2CJIA 1CU1A 4X8VH 1F2SE 1C5UA 2QXIA 2XXLA 2TRMA 4I8JA 3SNAA 3T28A 1XXFA 5AF9H 1AVWA 2BD8A 2GV7A 1MZAA 3A81A 5EODA 4FUEA 4INHA 2CHAC 4OS1A 2F91A 4CHAC 1IHSH 1DWCH 4NFFA 1Y3UA 2J95A 2B5TB 2P3FH 1QBOA 2ZEBA 1QB1A 4A6LA 2H1UA 3M7QA 5EG4A 5HGGA 3TLOA 1DLKB 2UUYA 2Z7FE 1LPKB 3ZZ3A 2QIQA 2FOHA 3MO9A 1EZQA 2Z9LA 3LGIA 4ISOA 4OS4A 3M3SA 1WQVH 1VCPA 1IQKA 1EUFA 2VWLA 1ETTH 2J34A 3LC3A 3IWMA 4FUJA 4WVPE 2FOEA 4OS5A 4MPVA 3GOVB 1XUGA 2ZWLH 3U98H 3V0XA 3SNCA 1O3DA 1W14U 1SGDE 1UHBB 1H4WA 2ZPRA 1HAGE 4I8KA 1O33A 1SGTA 3A8DA 5DP4A 3TNSA 4LXBH 2A4OA 1A5IA 1ACBE 1QJ1B 5FXLA 2P8OB 3P70B 1YPJH 1C2MA 1W0ZU 3BIVH 4GSOA 1D3PB 3BG4B 1MKWH 1AZZA 1JIRA 2GZ9A 2GCTC 1A3EH 3TITA 4OS2A 4NIWA 2IJOB 4UFEH 1H9LB 2Z3DA 1NT1A 2C8YB 1V2UT 3KQEA 3P8GA 5B6OA 2M5TA 1LHFH 3RXUA 1UTNA 3I78A 5FAHA 2A31A 3GCOA 3S7KB 2G4UA 1FDPA 2PTCE 1Y3XA 4FUBA 1RS0A 1E37B 2ZQ1A 1GI5A 1THPB 1PQ5A 2VVUA 1DS2E 5J4SA 1O35A 3M3TA 1C1MA 3MH7A 4ABJA 1SLUB 3LGYA 2ZFSA 1BHXB 3QX5H 1P05A 4RN6A 3RC4A 5L6NH 4Y6DA 1V2ST 2SGQE 2J4IA 4TYDA 3TJNA 2WINI 2ZGBH 4DVAU 1OKXA 5DJ7A 1ZSKA 2GT8A 2F9UA 1JRSA 2WPJS 4Q7ZA 4YLUA 1PQ7A 1FY3A 2BVRH 1LPZB 2ZCKP 3PV4A 1C5XB 2XNIA 2BXUH 3M7TA 4X2WA 3GCTG 5E0HA 1O3AA 1PPHE 1SGEE 3K6YA 3PTNA 2BVXH 1HCGA 2YNBA 1YYY1 1GMHF 3RXKA 1O3OA 6GCHG 1BTPA 1T8MA 1O2HA 2XYAA 1C1VH 1GPZA 3VB3A 1ANCA 3TJVA 1EP5A 1NROH 2Y7XA 1DXWA 1RRKA 1SGFA 1YGCH 4AFSA 4WY3A 3TGJE 3FAOA 1NZQH 1OX1A 2PR3A 2ZHFH 4Z6AH 1C5NH 4B2BA 4IC5A 4GUXA 1G3BA 2RCEA 3MU4A 2SGAA 1NRPH 4NSYA 3T29A 2XRCA 3B9FH 4ZKNU 3LH1A 4CRAA 2XBYA 1MTUA 8GCHG 1C4Y2 2AEIH 1O5EH 1PPEE 2FPZA 3AW1A 4IMZA 1G9IE 3MNSA 3U69H 3VGCC 2AGEX 1GVLA 1TBRH 1AE5A 3GYMA 2BQ6B 2C8WB 2ANKH 3SU2A 1L2EA 4MTBA 1TOCB 2WYJA 4Y8ZA 3I77A 5EW2H 1HAZB 2DUCA 1EAIA 5TCCA 3T26A 1ABIH 1MD7A 4WF8A 5GXPA 2QA9E 1O3JA 3F68H 1LHGH 1Z71A 3FZZA 4SGBE 5FPSA 2ZP0H 3SU4A 1WQSA 1NFWA 3URCA 4ZH8A 1YCPH 2PWXA 2YOLA 4X6MA 3SW2B 4AX9H 1O3MA 2PGBB 1CA0B 3M5NA 1W2KH 2EA3A 4X1PU 1GHAF 1F0TA 3A89A 1KTTB 1XKBC 3M5LA 1BHXF 3N7OA 2ALPA 2K1QA 4HFPB 1ZTLA 5FBIA 1EPTA 2FI4E 3Q3KA 3EA8A 4Y7AA 5C20A 1PJPA 1QNJA 1GHWH 2ZU5A 3E0NB 4Y8XA 1BJVA 1IQLA 1T7CA 2BD4A 1O3CA 2A5KA 2DE9A 4IW4E 2VINA 2DE8A 4X6OA 1MCTA 3ATKA 1GJ8B 1PFXC 1CGJE 1L1NA 1ELCA 1P10A 1TGNA 2STAE 1RGQA 2HPPH 1O36A 5E0GA 4WMDA 1ZMNA 1C9TA 2ZU4A 2H5CA 3RC5A 3SGAE 2ZDMA 5FPTA 5JB9S 3GY2A 2QF3A 3TIUA 2VH6A 1SGCA 1TA2A 3UUZA 2EC9H 3VFEA 1KDQA 1RTKA 1JMOH 1KXAA 1G37A 1VGCB 3VXFH 1RJXB 3NCLA 3ZVAA 3L3TA 4Q7YA 1A5GH 1ZPCA 4GHTA 1EOJA 1NRSH 1BBRE 1YPHC 1BRAA 2FMJA 2PSYA 3NKKA 2NU2E 1KLTA 4K1EA 7LPRA 1KLIH 2AIQA 1N8OB 3NWUA 4A1VA 3L33A 2V3OH 4KTSA 1ELEE 3RXQA 1ID5H 2OQUA 1N6XA 1XUFA 5G4BA 1TQ0B 4O9VA 2FS8A 1XX9A 4R8TB 3OY6U 1DE7H 1TMUH 4UFGH 4FU8A 2GZ7A 4A7IB 5C1XA 1PPCE 5L2YH 4MNYA 1GJ9B 1SOZA 2ZPSA 1KXFA 5CHAB 2QAAA 1OP0A 1DITH 2J38A 2W7SA 1GJ4H 2BB4A 3FVFB 2OUAA 1RTFB 2HNTE 2GCHG 4CBOA 1YM0A 1EKBB 1WCZA 2ZQ2A 4CREA 2HRVA 5HXFA 1AFQC 1SGNE 4H6SB 2ESTE 1IQMA 1UCYH 1NESE 2GKVE 3C1KA 3BTHE 2JH5D 4AG2A 3ZVFA 2VVCA 1W11U 2BZ6H 4UD9H 1GG6C 3F6UH 3M36A 1S81A 1F0UA 3GCHC 1MCVA 2V0BA 3RP2A 1K1NA 2FI5E 1TGTA 2Z94A 1HAVA 4AGJA 3KF2A 2BDHA 1O2GH 1P2NA 1AO5A 3M37A 4JMYA 2SNWA 4A1TA 2OCVB 1O2UA 4DY7B 5TJXA 1J17T 2FYQA 3SOSA 1DT2A 3SU1A 2ZKSA 4BTIB 1SC8U 3SUGA 1ZGVA 2GMTC 3SUDA 1CVWH 1BJUA 1SFQB 2ZPQA 1GI7B 1HFDA 1QCPA 5F8ZA 2BXTH 1C2EA 2BDGA 1FAKH 3ZVBA 1XKAC 5EW1H 1E34B 1J8AA 4U32A 4FUIA 3A7VA 1O2LA 3A80A 4YT6H 3RXEA 3KEEA 4A92A 4I8LA 1Y3VA 1Z1JA 4VGCB 4ZHLU 2CN0H 1DFPA 3A7ZA 1TPPA 3SZNA 1S6HA 1LMWB 2PGQB 2WPHS 3GICB 5GCHF 1L1GA 1VZQH 3A8BA 5ETXA 1ANBA 2R3YA 1ANEA 3SU5A 5DO4H 2STBE 2D1JA 1NRRH 1C2DA 1LVBA 3TK6A 1AKSB 3GDVA 2VWOA 2C93B 1P9UA 4NWKA 1UVOA 1IAUA 3MH4A 1GCTB 1HNEE 4E7NA 1GJDB 1UJ1A 3SV9A 1C1PA 1ELBA 3TH2H 1H1BA 1BB0B 1O2QA 2Q1JA 3QUMP 1CT4E 5F6MA 4KELA 1DY9A 2BD7A 4J1YA 4F4OC 2WPIS 1CT2E 3HK6B 1EX3A 2H6MA 1YBWA 2OBQA 2WUBA 1S0QA 1WSSH 1DLEA 4THNH 3GISB 4X8SH 4H4FA 1SQAA 4ESTE 1L1JA 2Y80A 3UR9A 1AVXA 2OC8A 1BTXA 3W94A 5A0AE 1TA6A 2FOCA 1O2VA 2PLXA 2VB0A 3HPTB 4NCYA 1DOJA 3QTVH 3ZVCA 1FI8A 1S83A 2FZZA 5DP3A 4YESB 4DURA 3SI3H 5EXLA 1QL7A 4WMEA 5HM2A 4ZHAA 1V2WT 3T25A 2VIQA 2ZDAH 2H9EH 3U9AH 1DICA 1A3BH 1PPFE 1S82A 1UTKA 4UFDH 2D2DA 1G2LA 1BTUA 1MKXH 1TNHA 4B71A 1CSOE 1SLVB 1C1OA 3MU8A 1EAWA 3QO6A 2VNTA 5LGOA 2QXHA 1QFKH 1B7XB 4ZHMU 3TGKE 1WOFA 4X1NU 1GVKB 1P9SA 5DP5A 3RXDA 2NWNA 5E2PA 3V13A 1DVAH 4B73A 1P12E 1VJAU 3ATMA 3V3MA 2UWLA 4NIYA 5FX6A 3ZZ7A 4Y0YE 3P8NA 2FOFA 1UO6A 1SMFE 4X6PA 1U6QA 2OC7A 1BZXE 1RXPA 2VIOA 1QA0A 4DIHH 1UTPA 4X8UH 5A0CA 1CQQA 3DUXH 4JZFH 2JETC 3LPRA 1GI2A 1K1JA 1NRNH 4FVDA 5ESTE 2VIVA 2WYGA 1BCUH 3SJ8A 2GT7A 3SO3A 4JYVH 5DGJA 4CRFA 3Q77A 3Q3YA 1G3EA 3U1IB 1TNKA 2P3TB 3E90B 1FLEE 1O2TA 3Q00A 3LGTA 1VCWA 2BLQA 4B75A 2BDIA 2EI7A 3TPIZ 5ABWA 1GBTA 1GJBB 3RMNH 2VH0A 4MNVA 5TCAA 1MU8B 3KHVA 3UOPA 1IQHA 3F9GA 4GPGA 3LT3A 4BAHB 1FY4A 3G01A 1SL3A 1V2TT 1TAWA 5EXNA 3M5OA 3QZRA 2YNAA 1C2FA 1KSNA 1KXDA 1HV7A 4GAWA 1TMTH 1TX6A 2Q6GA 4OS7A 4O03A 2TGPZ 4DIIH 1FIZA 4MPXA 1YPHE 1O3GA 1P04A 2F3CE 5K0HA 2Y5FA 1GMHG 1TNIA 2AMDA 1FJSA 3UOUA 1VR1H 4NGAH 1E0FD 5LPFA 4QT8C 1P57B 1LQDB 1TRYA 3FP7E 3DFJA 3LU9B 4X0WU 2OXSA 2SFAA 3RXMA 3U1JB 1BIOA 2UUJB 1DY8A 3LJJA 4BAKB 1TIOA 3KCGH 3RU4E 1LKBA 1O2YA 2G81E 3U8OH 2WPLS 1EOLA 5L30H 5EGMA 2P94A 1GHBF 2J9NA 1NU9A 2AMQA 3VB4A 2B7DH 3AW0A 4FUHA 4K69A 1CT0E 2CMYA 3A88A 1IQJA 2G5VA 3MNXA 1L4DA 3UWJH 1GDNA 2PKSB 1H9IE 1ZJKA 4JZ1A 1SI5H 2WV5A 5JYIA 2BY8X 2NU0E 5GJ4B 2Z6BD 3RXFA 3K65B 2XC0A 1FUJA 4CRCA 2BX3A 1NFUA 1F5KU 5EQQA 4AORA 1THSH 1O5AB 4IMQA 1ABJH 2WPMS 2HNTC 4TWWA 4X8TH 1CHOF 1S5SA 2C3SA 1LHCH 4WH8A 2FI3E 2PKAA 1GI3A 1AMHA 4ISIH 5BPEA 5EPYA 2IN2A 1BRCE 2G4TA 1GHAG 4AB9A 3PWBA 1YPMH 3ZVDA 3SJOA 1GI4A 1HIAA 4MQAA 4TWYA 3SQEE 1HLTH 3ATWA 3CS0A 2ZFTA 1P2MA 1ZHMA 4GVUA 1ZHRA 1IQGA 1TFXA 2ZNKH 5JBCS 4X2YA 1K1IA 2VIDA 4Z0KA 1BMNH 2FOMB 3SU3A 1K22H 1AD8H 3BTTE 3PROA 3RXGA 4HI3A 5DP8A 2GCTB 1O2NA 1DWEH 1GDUA 5EQRA 5T6GA 1FN6A 1LCYA 1P0SH 1GHXH 4YO9A 1QL9A 3UFAA 1Z1IA 2GGVB 3UTUH 1ELGA 1P8VC 3NXPA 3TK9A 1HXEH 3C27B 3QN7A 3HK3B 1V6DA 1T8NA 3T2NA 2ULLA 4NG9H 1O30A 2BY6X 2AIPA 1ZSJA 1YPEH 2J2UA 1HYLA 1ZPBA 1AE8H 3GYLB 1TE0A 1BTYA 5DKMA 3SNEA 1ZTKA 7GCHF 4JYUH 1BITA 4A5TS 1LHEH 3K6ZA 1UHBA 1XXDA 4YOJA 2BTCE 1RIWC 1O38A 2CGAA 2AMPA 2UWPA 5A09A 4D7GA 2ZA5A 3NK8A 1EPTC 2ZC9H 3HKJB 1MD8A 5JBAS 4YZUA 3QWCH 1QQUA 2F9VA 3F1SB 3ZV9A 2UUKB 1GBHA 1HPGA 1YKTA 5C1YA 1O3KA 5E0JA 4ZAEA 1TRMA 2ODPA 2Z9IA 4ZXYH 3ZZ5A 2I6QA 1ZLRA 2G51A 2G55A 2OINA 1KLJH 3ENSB 3IITA 3SU0A 1ZHPA 1K21H 1QB9A 2AH4X 4X1SU 2QYIA 4MVNA 3UQOA 1MZDA 2V3HH 3PM3A 1ELTA 2W3IA 2PHBA 3A7TA 3PLKA 1ZRBA 3P6ZB 3PMJA 1MTSA 1K9OE 1NTPA 2RA0A 3PMHB 1BBRH 1HJ9A 1K1MA 2R0KA 1UK3A 1SOTA 3V12A 1A0LA 5DG6A 1NS3A 4XE4A 4O3TA 3E91A 2ZU2A 3GY7A 2HNTF 3RLYH 2HALA 2F9PA 4U30A 4ZROA 5HMAA 1EJNA 3STIA 2ZDVH 2XCNA 4K1SA 4KTUA 3A86A 1GHYH 2VGCC 3S7HB 4Y10E 3VGCB 3ZYEA 1QBNA 1V2MT 5HYOA 2QGRA 2O8TA 4M7GA 2W5EA 3M3VA 2NU1E 4CRDA 3GY8A 1W12U 5AHGH 1MAYA 1EJAA 1C5ZB 1Z7KA 1L0ZA 5C67A 2TGAA 1O3EA 1QHRB 5K7RA 1SQOA 1TB6H 2JH6D 1J15A 3EE0B 3ZZCA 5A8ZA 2CV3A 1EP6A 1O3HA 1GBCA 2ZGCA 2ZDLA 1OWHA 5A8XA 2BY7X 1RD3B 4YLQH 4PROA 1W0YH 3RMMH 3TU7H 3Q76A 2VJ1A 4E06H 1SSXA 4Y11E 5GCHG 3PMAB 1CE5A 1BQYA 1AFEH 3RXBA 4ABGA 1YLCA 1C5TA 4OGYA 1V2QT 1YF4A 1GMCF 1DWDH 1NRQH 4JK5A 1MH0A 1UTQA 1SHHB 1XM1A 1ELDE 3STJA 2UWOA 4INLA 1WTHD 1BUIA 3KQBA 1B0FA 2SGEE 1GI9B 1HDTH 1C5QA 3VB7A 1BT7A 2A1DB 1OP8A 1XVOA 3PLBA 1WYKA 2FOGA 1P02A 1T31A 1TPAE 2ZFFH 1ZGIA 1ZR0A 1N6YA 3RXVA 5J4QA 2ZI2H 3RMLH 4IC6A 3TJOA 1QJ6B 2XC5A 3Q3XA 3S0NA 3MU5A 4Q7XA 3VEQB 1JXPA 1TNJA 1BRBE 3ZZBA 2D26C 2ZHQH 1W7GH 5JB8S 1OWIA 1EASA 1GBDA 1GBKA 4BNRA 1AUJA 2BDAA 3ELAH 1P09A 2KAIB 1EJMA 1C5WB 4ISNA 1E36B 1V2LT 3A84A 3S9AA 1P06A 3UPEA 3A87A 4Y8YA 5F8XA 1C2KA 3TVJB 2B8OH 1AQ7A 3O8CA 1GBMA 4B2AA 3E8LA 4DG4A 3LJOA 4KGAA 1C5OH 4XSKU 4BOHA 1OWKA 2ZHDA 1TONA 3SV6A 2O9QA 3UR6A 2Z9JA 4ABHA 3URDA 1ZSLA 4H42U 1BTWA 1XMNB 1Q2WA 2ZHWH 1Z8GA 3OY5U 2HVXA 3RXIA 1CO7E 4AGKA 4K60A 1L4ZA 2ZHEH 4NA7A 4ABAA 2ZDKA 1HAXB 3BG8A 3MHWU 1AWFH 1OWDA 1JRTA 4D9RA 1C5MD 3KGPA 3PMBB 2Q6FA 3E1XB 3TJUA 4DGJA 7ESTE 2BOKA 4WH6A 1C1NA 2FS9A 3VPKA 3BEIB 2FODA 1AFQB 2VVVA 6LPRA 2V35A 3RXSA 5GWZA 1C1UH 3BTFE 3JZ1B 4HTCH 1GG6B 1AU8A 1UVUH 3RXCA 3SORA 3GCHB 3IG6B 2CF8H 5C5OA 4RSPA 4WXIA 4AOQA 5FX5A 5IDKA 1TNLA 3JZ2B 2GZ8A 1ZJDA 1G30B 3DD2H 1K1OA 2FDAA 5FHTA 2JKHA 2SGDE 3PO1C 1O3FA 2A5AA 5I25A 4BXWA 2FIRH 1GBFA 3A85A 3SU6A 1ZMJA 6CHAC 1GGDC 1SPJA 4H6TA 2F9OA 3SJKA 2RA3A 1GWAA 2GMTB 2BY5X 2OD3B 1N1LA 5DP9A 4D8NA
chains in the Genus database with same CATH superfamily
3LONA 2FEQH 2ZFQH 1C1QA 4WJG2 1AUTC 2IOTA 4D7FA 1O3LA 1SQRA 1D3QB 3SHAH 2BDBA 2TBSA 4ZXXH 3E3TA 2A2QH 3D65E 2ZZUH 1W10U 5L2ZH 2AGGX 1MQ6A 4X2VA 2BDYA 2BZAA 1TOMH 1ELAA 2LNCA 2NU4E 1M9UA 3T5FH 5CMXH 3H5CB 4K3JA 4DT7B 4WMFA 1BA8B 1MMJN 2A4RA 5C1UA 1MKWK 1KIGH 4FUDA 1LQEA 3TGIE 2VIPA 1J9CH 2XWAA 3MNCA 4NIVA 2ZDNA 1FZZA 2HWLB 3VG8A 3H09A 1FAXA 1MABB 5C5NA 3KQDA 1C2HA 3OAAD 2FO9A 1QRZA 1PQAA 3SI4H 2A32A 1GHBG 1AWHB 4ABFA 5HM9A 3PRBA 4XBCA 1B0EA 1YPLH 4MLFB 3U8RH 3PRDA 3F9FA 2VU8E 1HJAC 2FYRA 3WWBA 1MTNC 4X6NA 3LDXH 1FY1A 1O2WA 5A0BA 1EB1H 1OWEA 1E38B 4CR9A 3SJ9A 1BTHH 1BTZA 1B5GH 1CBWC 1GI1A 4ABEA 4A1XA 4UE7H 4CH2B 1SHYA 2BLVA 3A8CA 3D23A 2ALVA 2QXJA 4Q63A 3D49H 1TPOA 5FL7D 1Y5BT 1CHOG 2PSXA 3LC5A 3TNTA 1AKSA 1GJ5H 4NA9H 4I33A 2QC2A 5E8EH 3L6PA 3QK1A 1EZSC 1QJ7B 1MTWA 2ZU1A 3NZIA 2FX6A 5C3NA 1V3XA 1MQ5A 1T4UH 1DSTA 2A0QB 4CRBA 5I46H 5EOKA 3UNQA 1S85A 1SBWA 2BQ7B 2PTNA 1P3CA 1YWUA 2H9TH 3HGPA 2Z3CA 1QGFA 2ODYB 2ZGHA 1XVMA 2AS9A 2R0LA 4CH8B 3ZVGA 1BRUP 3ZZAA 3ODFA 1F5RA 5C17A 1V2NT 1O5GH 3OSYA 4YOGA 3LOXA 4AB8A 2GDDA 3SNBA 1SLXB 5ESBA 3BF6H 3MYWA 4I8HA 3ZZ4A 4WWYA 2ZFRH 2AFQB 4BXSA 5DSFA 5AFZH 2JETB 2J98A 1GHZA 1ZRKA 2D8WA 2G52A 3KL6A 3E16B 3PWCA 1AB9C 3A82A 1F7ZA 3UAIC 1HB0B 1C1RA 1KXBA 1XUKA 2ZCLP 4ASHA 3DSOA 1K28D 8ESTE 2GVFA 1AGJA 1VITF 1NC6A 2P16A 1ARBA 1NU7B 1K1LA 3NPSA 3FN8A 3SV2H 2XBWA 3PTBA 4AFZA 1DPOA 4IS5A 3M5MA 2KX4A 2BYAX 3I29A 1DUAA 4OS6A 1YCPK 1CHGA 2ZO3H 2JIZD 1Q3XA 1A2CH 1V2VT 3SV8A 2HGTH 4B1TA 1XUHA 2BD5A 1G3CA 1V2KT 2BX4A 1OSSA 3P8FA 4BAOB 2H2ZA 1ESBA 4U01A 3DT0H 3LGUA 2P93A 2G5NA 2AYWA 2R3UA 1VITH 4D76A 2BLOA 2LPRA 1SGIB 2TGDA 2Y82A 4B2CA 1Y8TA 1A46H 3FKSD 3RU4T 1PYTC 2QF4A 3ESTA 2XC4A 1SGPE 1V2JT 3EDXB 4JYTA 3BTQE 1ELFA 2P3UB 4UEHH 1HIAB 1QA7A 3BIUH 1GHVH 3EA9A 4NIXA 1PYTD 4I32A 2H9HA 4FUFA 1TNGA 4LOYH 1S6FA 3A83A 1O5FH 2CHAB 2BOHB 4CHAB 2I6SA 4JK6A 2EI8A 4MPUA 5LPRA 1Z8JB 3FP8E 1ARCA 3SNDA 2J94A 2CK3D 2A5IA 2J97A 2PKSC 1RTLA 3UIRA 1ORFA 1AIXH 1A5HA 2W6ID 4K2YA 3AAVA 4IN2A 2C8XB 2XBXA 1SGFG 4FUGA 3K9XB 4ZMAH 1EXFA 1ZPZA 2FTLE 3U8TH 4BAQB 1NM6A 2B0FA 4KKDA 2H5DA 1MU6B 2A4GA 1EATA 2L74A 1OPHB 2QXGA 1KXEA 3MWIU 5EXMA 3HATH 3SBKA 1KTSB 1IQNA 3P92A 1O2XA 1E79D 4GHQA 4ABIA 1C5LH 2P8OC 4AYYB 1MUEB 3B23B 3MOCA 1HAHH 3BG4C 3ZZ9A 3OYPA 3GCNA 1WU1A 2OC1A 2ASUB 3UNSA 2RFKC 1WTGH 4NSVA 1J14A 3SUFA 3EYDA 3F9EA 2BQWB 1P2JA 1XUIA 3P8OA 1O2SA 2FOAA 3RXJA 1O39A 4MPWA 5EQSA 5EU8A 1UK2A 3BV9B 3ITIA 1WAYB 2Y7ZA 3SQHE 1O31A 2OP9A 1AVGH 3H7TA 1GMCG 4HZHA 1IOEA 1LHDH 3EQ0H 4FVBA 2QY0B 1PPGE 1UTLM 3VB6A 1UCYK 1C5VA 3M61U 4R0IA 2A7HA 1FPCH 2G8TA 1GMDF 4MNWA 5HIYA 2EI6A 1C5YB 3RM0H 3O8RA 1P03A 4AFQA 1TX8A 2ZU3A 3FOAA 1LVOA 3M35A 1P01A 1TBQH 5T6FA 1GBIA 1SG8B 1HAYB 4Y0ZE 1CA8B 1BMMH 3ZVEA 1O5DH 3E0PB 2SNVA 1FV9A 4MDSA 1D6WA 1Y5UT 4XDEA 1VCQA 1H8IH 3B8JA 4D9QA 1O2PA 3D62A 3RMOH 2F9NA 4GCHF 3R0FA 3F3BA 3RM2H 4TY6A 1OYQA 1S84A 1EAXA 3BTDE 2O8LA 1INCA 2ZIQH 1TRNA 1RIWB 1Y5AT 3WW7A 5IYTA 1C2GA 1EPTB 2ANMH 5FBEA 3RXLA 1O2IA 3F9HA 4FXGH 3FZDA 1FMGA 3OEED 1W0KD 3UQVA 1W3CA 3N99A 1DXPA 2CF9H 2SGPE 1EZXC 5AVDA 4NZLA 1C2LA 1QTFA 1GL1A 1QRWA 2B9LA 3BTWE 3SJIA 1HBTH 5F8TA 4ZUHA 1C2IA 3ODDA 1NPMA 3FANA 5AFYH 3A7YA 1MBQA 1NBME 1YLNA 2Y81A 1T4VH 1YPGH 2XBVA 4ISHH 1TALA 1PPZA 4HGCA 1DX5M 1KDQB 1NFXA 2SGFE 3KIDU 5FCRA 4K1TA 2F83A 2ZTYA 4FU7A 1LVMA 1EQ9A 2VWNA 2OQ5A 5GPIB 1GBBA 1FXYA 3QGJA 3MI4A 1C2JA 1T8LA 1JWTA 3AASA 1G36A 3RXRA 1CA0C 2OLGA 3QDZB 4X2XA 1DDJA 2FP7B 1O3PB 1D3DB 2HPQH 4E7RG 3ZV8A 2PUQH 1DANH 3P17H 3EGKH 1UTOA 2VGCB 2JJ2D 3RXPA 4P02A 3WY8A 1D6RA 4ZKSU 1O3IA 1C5SA 1GI8B 2C8ZB 2WPKS 2ZECA 1FIWA 1HJ8A 1VJ9U 1WUNH 3QZQA 3RXTA 3UWIA 4B76A 1ZYOA 1KXCA 3E6PH 4K8BA 3KQCA 1WV7H 1THRH 5JPMH 5SGAE 2Z9KA 1YPKH 4ABDA 1J16A 1SGRE 1O5CB 4FU9A 1SB1H 2ZTZA 2FESH 1MKXK 4NZQA 3MMGA 1TGCA 5DK1A 5T6DA 3EA7A 1AZ8A 3MTYA 1C1TA 1IHTH 4MG3A 2OC0A 3BSQA 4LK4A 4YTAA 1BMAA 1F0RA 3QGNB 1A0HB 1QY6A 1W7XH 3PYHA 5EJZA 1FONA 1GBLA 1C4V2 1IQEA 5GIBA 4IBLH 5GDSH 3TH3H 1LTOA 1O3BA 1HGTH 1VGCC 2HOBA 1X7AC 2WUCA 1Y59T 3LGVA 3UY9A 5F03A 2ZF0H 1GJ6A 4OGXA 3ATIA 1OP2A 9LPRA 2BMGB 4J2YB 3RUOA 1EB2A 1GL0E 3W95A 1FN8A 4XBDA 5LPEA 2BY9X 2V3MA 3PB1E 4WXVA 4CR5A 3RXHA 3QLPH 2EEKA 1JBUH 2PW8H 2XCFA 1HAVB 1SQTA 2ODQA 2V6NA 1QIXB 3CP7A 1G3DA 2TIOA 1TLDA 1N8OC 4KTCA 2PFEA 1TGSZ 3GCTF 1YP9A 1O0DH 3GDSA 4O3UA 2F43B 4JZDH 1DWBH 1FY8E 2C90B 4JCNA 4ABBA 3UNRA 1O2JA 1Z6EA 6GCHF 1YLDA 2AHME 4XOJA 3ATLA 1V2PT 1Y3WA 3H7OA 2A7CA 4B6FA 2TPIZ 2CXVA 3BEUA 5CHAC 1UTJA 4YT7H 3RU4D 1QR3E 1FNIA 2ZCHP 1GJCB 5C2ZA 4M9FA 4TY7A 1MTVA 1Q31A 2R9PA 4AYVB 3KNXA 1ESTA 3AVZA 1ZTJA 3T27A 4Q80A 1LDTT 2R2MB 4AN7A 3ZZ8A 5CDFE 3RC6A 1P2QA 1AHTH 1WDIA 2RG3A 5DP7A 4YM9A 8GCHF 2PUXB 3SHCH 5CE1A 3VXEH 5C94A 4ZKOU 8KME2 5LH8A 3ZZ6A 1SFIA 2Q6DA 2GTBA 4DW2U 5A8YA 4I7YH 1OOKB 2IPHA 6ESTA 1A61H 3BN9A 5IK2D 5T1VA 4LZ4B 3A8AA 2GJGA 3CS7A 1JOUB 1H8HD 1KY9A 4DOQA 2BVSH 3MFJA 2XW9A 2WPDD 1DUEA 2VWMA 2ZGJA 4O97A 3SUEA 4BTUB 3QTOH 1QQ4A 3GDUA 2G00A 1EZUC 1QURH 1P2OA 4E05H 1IQIA 1HAPH 2PP6A 3SN8A 2NU3E 5JBBS 4TPYA 2BD2A 1ZOMA 2BLWA 4F48B 1O2OA 1HUTH 1NY22 3AAUA 4Q2KA 3OEHD 1BOQA 1LO6A 1A4WH 2KAIA 1F92A 1A1RA 1PPBH 4VGCC 1TGBA 5T3HA 2AGIX 2HVYB 1G32B 1AY6H 2QN5T 1GJAB 1O2ZA 4UFFH 1SGQE 1QB6A 1ESAA 4X1QU 2P59A 2FWWA 2FLBH 2R2WU 1AI8H 1QBVH 1P3EA 2FM2A 1A0JA 3PO1B 1GJ7B 1K1PA 1K2I1 3MU1A 1LPGB 2QV1A 4YOIA 1WBGB 1FY5A 1S0RA 4DJZB 2FOBA 1VITG 1T8OA 1EFRD 1UVTH 1HXFH 5FPYA 4Y76A 1C1WH 6CHAB 2P95A 1MBMA 2K0QA 1SVPA 1GGDB 2GDEH 3O8BA 1TBZH 1GCTC 1LKAA 3O8DA 1SLWB 4BAMB 2ANYA 1DSUA 1F0SA 1LVYA 2LELA 1O2MA 4GLYA 2XWBI 3BTKE 3FP6E 1UVSH 3K2UA 2Z9GA 4JZIA 1P11E 3TH4H 2GV6A 3PLPA 2O8WA 4AG1A 1GI0A 4RKJB 1IQFA 3S9CA 3VB5A 2Y5HA 4X1RU 5JBTA 2W7UA 3SGQE 3DA9B 1H8DH 2A2XH 2OTVA 2FX4A 2KZ4A 4DCDA 4I8GA 1P2KA 2YMSC 1T32A 1DM4B 1GCDA 1GDQA 2GD4B 1O2KA 3A7WA 3FFGA 1ETRH 1ELVA 3HGNA 1CGIE 3MH6A 1D4PB 2JH0D 1C5RA 2TGTA 4LZ1H 1C9PA 5A2MH 1F5LA 1ETSH 1UVPA 3NUMA 4KP0A 9ESTA 1O34A 3FO8D 3EAJA 4NWLA 4MNXA 4NFEA 3KN2A 3MO3A 5H4IB 1BDAA 3S69A 1C1SA 4I86A 4Y71A 3A7XA 3DHKH 3LIWA 3BTEE 1HAIH 5FCKA 1TABE 1UCYE 1C4U2 3CENA 3LGWA 5PTPA 3OU0A 1E35B 2FXRA 4U2WA 3V7TA 1QRXA 2Z3EA 7KMEH 1TWXB 4UDWH 2GP9B 3LH3A 2GX4A 1PQ8A 1EAUA 4UONA 1HJAB 1YC0A 2THFB 5EPNA 3RLWH 3LKWA 3DFLA 4ZKRU 1V2RT 1MTNB 2BD3A 2W3KA 2BDCA 2BM2A 2VIWA 2Y5GA 2ZFPH 2QF0A 3P95A 4XFQA 2ANWA 4BTTB 1FPHH 1GI6A 4Y7BA 1OYTH 1MAXA 2XTTB 1Y3YA 2GCHF 1CBWB 3RDZA 1SGYE 4INKA 2PV9B 1O3NA 1YCPM 3ZYDA 1P2IA 2BHGA 3TK5A 1OXGA 1HRTH 2QCYA 1NBMD 1HAOH 4SGAE 1SR5C 2UUFB 1TQ7B 4CRGA 1XUJA 3RXOA 2ZGXH 3GY5A 2XNDD 2J92A 1BMLA 1H9HE 1W13U 2C4FH 3MU0A 3SGBE 1GBJA 1TPSA 2HLDD 1Z6JH 3GY4A 1AN1E 3HKIB 4ISLA 3T62A 1FQ3A 2O8MA 3M7UA 1QL8A 1GVZA 3BTME 1O37A 3GY3A 1BBRK 4BANB 4XBBA 3MO6A 4I31A 5DPAA 1UTMA 5DP6A 4FUCA 4AZ2B 4FOUC 2ILNA 1GMDG 4IN1A 2KM0A 1O2RA 3RXAA 3R3GB 3BTGE 3OTJE 2RDLA 1NFYA 4JZEH 4K8YA 3MH5A 2A45B 8LPRA 3S9BA 3BEFB 1GBEA 1Z8RA 2A7JA 4F49A 1O32A 4Y79A 7GCHG 1TMBH 5JDUB 1JIMA 1ZMLA 2AERH 1AB9B 1D3TB 1CGHA 1UMAH 1ZZZA 2HLCA 1OWJA 4NA8A 3ZZDA 1Z8IB 2BD9A 3GY6A 5E2OA 4IGDA 5BRRE 2O8UA 4AFUA 1NN6A 1C5PA 4TPIZ 4K5ZA 4Z1MD 2F9BH 3PV5A 2FLRH 1W8BH 2W26A 1TYNA 1RFNA 4RKOB 1TX7A 3OX7U 1ANDA 4B74A 4GCHG 2A4QA 2PKAB 2KCPA 1UK4A 1G2MA 1A7SA 2WV4A 1OS8A 3MNBA 2ZG0H 3UREA 1V2OT 4CBNA 2FTMA 1KYNA 1D9IA 1O5BB 2Y6TA 3SV7A 1NO9H 2OBOA 2ZTXA 1GBAA 2CJIA 1CU1A 4X8VH 1F2SE 1C5UA 2QXIA 2XXLA 2TRMA 4I8JA 3SNAA 3T28A 1XXFA 5AF9H 1AVWA 2BD8A 2GV7A 1MZAA 3A81A 5EODA 3AK5A 4FUEA 4INHA 2CHAC 4OS1A 2F91A 4CHAC 5EJLA 1IHSH 1DWCH 4NFFA 1Y3UA 2J95A 2B5TB 2P3FH 1QBOA 2ZEBA 1QB1A 4A6LA 2H1UA 1OHHD 3M7QA 5EG4A 5HGGA 3TLOA 1DLKB 2UUYA 2Z7FE 5GNDA 1LPKB 3ZZ3A 2QIQA 2FOHA 3MO9A 1EZQA 2Z9LA 5F53A 3LGIA 4ISOA 4OS4A 3M3SA 1WQVH 1VCPA 3KYGA 1IQKA 1EUFA 2VWLA 1ETTH 2J34A 3LC3A 3IWMA 4FUJA 2KR7A 2OK5A 4WVPE 2FOEA 4OS5A 5DN6D 4MPVA 3GOVB 1XUGA 2ZWLH 3U98H 3V0XA 3SNCA 1O3DA 5EIYA 1W14U 1SGDE 1UHBB 1H4WA 2ZPRA 1HAGE 4I8KA 1O33A 1SGTA 3A8DA 5DP4A 3TNSA 4LXBH 2A4OA 4TT3D 1A5IA 1ACBE 1QJ1B 5FXLA 2P8OB 3P70B 1YPJH 2IJD1 1C2MA 1W0ZU 3BIVH 4GSOA 1D3PB 3BG4B 1MKWH 1AZZA 1JIRA 2GZ9A 2GCTC 1A3EH 3TITA 4OS2A 4NIWA 2IJOB 4UFEH 1H9LB 2Z3DA 1NT1A 2C8YB 1V2UT 3KQEA 3P8GA 4P00A 5B6OA 2M5TA 1LHFH 3RXUA 1UTNA 3I78A 5FAHA 2A31A 3GCOA 3S7KB 2G4UA 1FDPA 2PTCE 1Y3XA 4FUBA 3OE7D 1RS0A 1S6LA 1E37B 2ZQ1A 1GI5A 1THPB 1PQ5A 2VVUA 1DS2E 5J4SA 1O35A 3M3TA 1C1MA 3MH7A 4ABJA 1SLUB 3LGYA 2ZFSA 1BHXB 3QX5H 1P05A 4RN6A 3RC4A 5L6NH 4Y6DA 1V2ST 2SGQE 2J4IA 4TYDA 3TJNA 2WINI 2ZGBH 4DVAU 1OKXA 5DJ7A 1ZSKA 2GT8A 2F9UA 1JRSA 1BMFD 2WPJS 4Q7ZA 4ZCNA 4YLUA 1PQ7A 1FY3A 2BVRH 1LPZB 2ZCKP 3PV4A 1C5XB 2XNIA 2BXUH 3M7TA 4X2WA 3GCTG 5E0HA 1O3AA 1PPHE 1SGEE 2JDID 3K6YA 2BVXH 1HCGA 3PTNA 2YNBA 1YYY1 1GMHF 3RXKA 1O3OA 6GCHG 1BTPA 1T8MA 1O2HA 2XYAA 1C1VH 1GPZA 3VB3A 1ANCA 3TJVA 1EP5A 1NROH 2Y7XA 1DXWA 1RRKA 1SGFA 1YGCH 4AFSA 4WY3A 3TGJE 3FAOA 1NZQH 1OX1A 2PR3A 2ZHFH 4Z6AH 1C5NH 4B2BA 4IC5A 4GUXA 1G3BA 2RCEA 3MU4A 2SGAA 1NRPH 4NSYA 3T29A 2XRCA 3B9FH 4ZKNU 3LH1A 4CRAA 2XBYA 1MTUA 4B6EA 8GCHG 1C4Y2 1SKYE 1O5EH 2AEIH 1PPEE 2FPZA 3AW1A 2JJ1D 1G9IE 4IMZA 3MNSA 2KCYA 2WHXA 1K0HA 3U69H 3VGCC 2AGEX 1GVLA 1TBRH 1AE5A 3GYMA 2BQ6B 2C8WB 2ANKH 3SU2A 1L2EA 4MTBA 1TOCB 2WYJA 4Y8ZA 3I77A 5EW2H 1HAZB 2DUCA 1EAIA 5TCCA 3T26A 1ABIH 1MD7A 4WF8A 5GXPA 2QA9E 1O3JA 3F68H 1LHGH 1Z71A 3FZZA 4SGBE 5FPSA 2ZP0H 3SU4A 1WQSA 1NFWA 3URCA 4ACBA 4ZH8A 1YCPH 2PWXA 2YOLA 4X6MA 3SW2B 4AX9H 1O3MA 2PGBB 1CA0B 3M5NA 1W2KH 2EA3A 4X1PU 1GHAF 1F0TA 3A89A 1KTTB 1XKBC 3M5LA 1BHXF 3N7OA 2ALPA 2K1QA 4HFPB 1ZTLA 5FBIA 1EPTA 2FI4E 3Q3KA 3EA8A 4Y7AA 5C20A 1PJPA 1QNJA 1GHWH 2ZU5A 3E0NB 4Y8XA 1BJVA 1IQLA 1T7CA 3SYJA 2BD4A 1O3CA 2A5KA 2DE9A 4IW4E 4DT4A 2VINA 2DE8A 4X6OA 2WV9A 1MCTA 3ATKA 1GJ8B 1PFXC 1CGJE 1L1NA 1ELCA 1P10A 1TGNA 2STAE 1RGQA 2HPPH 1O36A 5E0GA 4WMDA 1ZMNA 1C9TA 2ZU4A 2H5CA 3RC5A 3SGAE 2ZDMA 5FPTA 5JB9S 3GY2A 2QF3A 3TIUA 2VH6A 1SGCA 1TA2A 3N7EA 3UUZA 2EC9H 3VFEA 1KDQA 1RTKA 1JMOH 1KXAA 1G37A 1VGCB 3VXFH 1RJXB 3NCLA 3ZVAA 3L3TA 4Q7YA 1A5GH 1ZPCA 4GHTA 1EOJA 1NRSH 1BBRE 1YPHC 1BRAA 2FMJA 2PSYA 3NKKA 2NU2E 1KLTA 4K1EA 7LPRA 1KLIH 2AIQA 1N8OB 3NWUA 4A1VA 3L33A 2V3OH 4KTSA 1ELEE 3RXQA 1ID5H 2OQUA 1N6XA 1XUFA 5G4BA 1TQ0B 3PV2A 4O9VA 2FS8A 1XX9A 4R8TB 3OY6U 1DE7H 1TMUH 4UFGH 4FU8A 2GZ7A 4A7IB 5C1XA 1PPCE 5L2YH 4MNYA 1GJ9B 1SOZA 2ZPSA 1KXFA 5CHAB 2QAAA 1OP0A 1DITH 2J38A 2W7SA 1GJ4H 3MQKC 2BB4A 3FVFB 2OUAA 1RTFB 2HNTE 2GCHG 4CBOA 1YM0A 1EKBB 1WCZA 2ZQ2A 4CREA 2HRVA 5HXFA 1AFQC 3DCLA 1SGNE 4H6SB 2ESTE 1IQMA 1UCYH 1NESE 2GKVE 3C1KA 3BTHE 2JH5D 4RT0A 4AG2A 3ZVFA 2VVCA 1W11U 3F2GA 2BZ6H 4UD9H 1GG6C 3F6UH 3M36A 1S81A 1F0UA 3GCHC 1MCVA 1YY3A 3NRLA 2V0BA 3RP2A 1K1NA 2FI5E 1TGTA 2Z94A 1HAVA 4AGJA 3KF2A 2BDHA 1O2GH 1P2NA 1AO5A 3M37A 4JMYA 2SNWA 4A1TA 2OCVB 1O2UA 4DY7B 5TJXA 1COWD 1J17T 2FYQA 3SOSA 1DT2A 3SU1A 2ZKSA 4BTIB 1SC8U 3SUGA 1ZGVA 2GMTC 3SUDA 1CVWH 1BJUA 1SFQB 2ZPQA 1GI7B 1HFDA 1QCPA 5F8ZA 2BXTH 1C2EA 2BDGA 1FAKH 3ZVBA 1XKAC 5EW1H 1E34B 1J8AA 4U32A 4FUIA 3A7VA 1O2LA 3A80A 4YT6H 3RXEA 3KEEA 4A92A 4I8LA 1Y3VA 1Z1JA 4VGCB 4ZHLU 2CN0H 1DFPA 3A7ZA 1TPPA 3SZNA 1S6HA 1LMWB 2PGQB 2WPHS 3GICB 5GCHF 3F2FA 1L1GA 1VZQH 3A8BA 5ETXA 1ANBA 2R3YA 1ANEA 3SU5A 5DO4H 2STBE 2D1JA 1NRRH 1C2DA 1LVBA 3TK6A 1AKSB 3GDVA 2VWOA 2C93B 1P9UA 4NWKA 1UVOA 1IAUA 3MH4A 1GCTB 1HNEE 4E7NA 1GJDB 1UJ1A 3SV9A 1C1PA 1ELBA 3TH2H 1H1BA 1BB0B 1O2QA 2Q1JA 3QUMP 1CT4E 5B6LA 5F6MA 4KELA 1DY9A 4ACAA 2BD7A 3F0OA 4J1YA 4F4OC 2WPIS 1CT2E 3HK6B 1EX3A 2H6MA 1YBWA 2OBQA 2YMSD 2WUBA 1S0QA 1WSSH 1DLEA 3OFND 4THNH 3GISB 4X8SH 4H4FA 1SQAA 4ESTE 2KFWA 1L1JA 2RDEA 2Y80A 3UR9A 1AVXA 2OC8A 1BTXA 3W94A 5A0AE 2YMSB 1TA6A 2FOCA 1O2VA 2PLXA 2VB0A 3HPTB 4NCYA 1DOJA 3QTVH 3ZVCA 5CHBA 1FI8A 1E1RD 1S83A 2FZZA 5DP3A 4YESB 4DURA 3SI3H 4OM9A 2J98B 2XOKD 5EXLA 1QL7A 4WMEA 2WSSD 5HM2A 4ZHAA 1V2WT 3T25A 2VIQA 2ZDAH 2H9EH 2KCAA 3U9AH 1DICA 1A3BH 1PPFE 1S82A 1UTKA 4UFDH 2D2DA 1G2LA 1BTUA 1MKXH 1TNHA 4B71A 1CSOE 1SLVB 1C1OA 3MU8A 1EAWA 3QO6A 2VNTA 5LGOA 2QXHA 1QFKH 1B7XB 4ZHMU 3TGKE 1WOFA 4X1NU 1GVKB 1P9SA 5DP5A 3OTPA 3RXDA 2NWNA 5E2PA 3V13A 1DVAH 1E1QD 2F4LA 4B73A 1P12E 1VJAU 2KCOA 3ATMA 3V3MA 2UWLA 4NIYA 5FX6A 3ZZ7A 4Y0YE 1UW7A 3P8NA 2FOFA 1UO6A 1SMFE 4X6PA 1U6QA 2OC7A 1BZXE 1RXPA 2VIOA 1QA0A 5KECA 4DIHH 1UTPA 3N7DA 4X8UH 5A0CA 1CQQA 3DUXH 4JZFH 2JETC 3LPRA 1GI2A 1K1JA 1NRNH 4FVDA 5ESTE 2VIVA 2WYGA 1BCUH 3SJ8A 2GT7A 3SO3A 4JYVH 2QF5A 5DGJA 4CRFA 3Q77A 3Q3YA 1G3EA 3U1IB 1TNKA 2P3TB 3E90B 1FLEE 1O2TA 3Q00A 3LGTA 1VCWA 2BLQA 4B75A 2BDIA 2EI7A 3TPIZ 5ABWA 1GBTA 1GJBB 3RMNH 2VH0A 4MNVA 5TCAA 1MU8B 3KHVA 3UOPA 1IQHA 3F9GA 4GPGA 3LT3A 4BAHB 1FY4A 3G01A 1SL3A 1V2TT 1TAWA 5EXNA 3M5OA 3QZRA 2YNAA 1C2FA 1KSNA 1KXDA 1HV7A 4GAWA 1TMTH 1TX6A 3SZEA 2Q6GA 4OS7A 4O03A 2TGPZ 4DIIH 1FIZA 4MPXA 1YPHE 1O3GA 1P04A 2F3CE 5K0HA 2Y5FA 1GMHG 1TNIA 2AMDA 1FJSA 3UOUA 1VR1H 4NGAH 1E0FD 5LPFA 4QT8C 1P57B 1LQDB 1TRYA 3FP7E 3DFJA 3LU9B 1FX0B 4X0WU 2OXSA 2SFAA 3RXMA 3U1JB 1BIOA 2UUJB 1DY8A 2LP6A 3LJJA 1TIOA 3U28C 3KCGH 3RU4E 4BAKB 3UB0A 2J5UA 1LKBA 1O2YA 2G81E 3U8OH 2WPLS 5HKKD 1EOLA 3KYFA 5L30H 5EGMA 4HG6A 2VBCA 2P94A 1GHBF 2J9NA 1NU9A 2AMQA 3VB4A 2B7DH 3AW0A 4FUHA 4K69A 1CT0E 2CMYA 3A88A 1IQJA 4YXWD 2G5VA 2M2AA 3MNXA 1L4DA 3UWJH 1GDNA 3GS9A 2PKSB 1H9IE 1ZJKA 4JZ1A 1SI5H 2WV5A 5JYIA 2BY8X 2NU0E 5GJ4B 2Z6BD 3RXFA 3K65B 2XC0A 1FUJA 4CRCA 3DSPA 2BX3A 1NFUA 1F5KU 5EQQA 4AORA 1THSH 1O5AB 4IMQA 1ABJH 2WPMS 2HNTC 4TWWA 4X8TH 4F55A 1CHOF 1S5SA 2C3SA 1LHCH 4WH8A 2FI3E 2PKAA 1GI3A 1AMHA 4ISIH 5BPEA 5EPYA 2IN2A 1BRCE 2G4TA 1GHAG 4AB9A 3PWBA 2L6OA 1YPMH 3ZVDA 3SJOA 1GI4A 1HIAA 4MQAA 4TWYA 3SQEE 1HLTH 3ATWA 3CS0A 2ZFTA 1P2MA 1ZHMA 4GVUA 3DSGA 1ZHRA 1IQGA 1TFXA 2ZNKH 5JBCS 4X2YA 1K1IA 2VIDA 4Z0KA 1BMNH 2FOMB 3SU3A 1K22H 1AD8H 3BTTE 3PROA 3RXGA 4HI3A 5DP8A 2GCTB 2EY4C 1O2NA 1DWEH 1GDUA 5EQRA 5T6GA 1FN6A 1LCYA 1P0SH 1GHXH 4YO9A 1QL9A 3UFAA 1Z1IA 2GGVB 3UTUH 1ELGA 1P8VC 3NXPA 3TK9A 1HXEH 3C27B 3QN7A 3HK3B 1V6DA 1T8NA 3T2NA 2ULLA 4NG9H 1O30A 2BY6X 2AIPA 1ZSJA 4XRNA 1YPEH 2J2UA 1HYLA 1ZPBA 1AE8H 3GYLB 1TE0A 1BTYA 5DKMA 3SNEA 5C0UA 1ZTKA 7GCHF 4JYUH 1BITA 4A5TS 1LHEH 3K6ZA 1UHBA 1XXDA 4YOJA 2BTCE 1RIWC 1O38A 2CGAA 2AMPA 2UWPA 5A09A 4D7GA 2ZA5A 2W6JD 1EPTC 3NK8A 2ZC9H 3HKJB 1MD8A 5JBAS 1KMHB 4YZUA 3QWCH 1QQUA 2F9VA 3F1SB 3ZV9A 2UUKB 1GBHA 1HPGA 1YKTA 5C1YA 1O3KA 5E0JA 4ZAEA 1TRMA 2ODPA 2Z9IA 4ZXYH 3ZZ5A 2I6QA 1ZLRA 2G51A 4FETA 2G55A 2OINA 1KLJH 3ENSB 3IITA 3SU0A 1ZHPA 5EJ1A 4XD7D 1K21H 1QB9A 2AH4X 4X1SU 2QYIA 4MVNA 3UQOA 1MZDA 2V3HH 3PM3A 1ELTA 2W3IA 2PHBA 3A7TA 3PLKA 1ZRBA 3P6ZB 3PMJA 1MTSA 1K9OE 1NTPA 2RA0A 3PMHB 1BBRH 1HJ9A 1K1MA 2R0KA 1UK3A 1SOTA 3V12A 2V7QD 1A0LA 2QE7D 5DG6A 1NS3A 4XE4A 4O3TA 3W1EA 3E91A 2ZU2A 3GY7A 2HNTF 3RLYH 2HALA 2F9PA 4U30A 4ZROA 5HMAA 1EJNA 2K8IA 3STIA 2ZDVH 2XCNA 5C0TA 4K1SA 4KTUA 3A86A 1GHYH 2VGCC 3S7HB 4Y10E 3VGCB 3ZYEA 2WZQA 1QBNA 1V2MT 5HYOA 2QGRA 2O8TA 4M7GA 2W5EA 3M3VA 2NU1E 4CRDA 3GY8A 1W12U 2EQNA 5AHGH 1MAYA 1EJAA 1C5ZB 1Z7KA 2IPQX 1L0ZA 4TSFD 5C67A 4AC9A 2TGAA 1O3EA 1QHRB 5K7RA 1SQOA 1TB6H 2JH6D 1J15A 3EE0B 3ZZCA 5A8ZA 2CV3A 3CNRA 1EP6A 1O3HA 5HIZA 1GBCA 2ZGCA 2ZDLA 3F2HA 1OWHA 3WWFA 2BY7X 1RD3B 4YLQH 4PROA 5A8XA 1W0YH 3RMMH 3TU7H 3Q76A 1WXRA 2VJ1A 3EE7A 4E06H 1SSXA 4Y11E 5GCHG 3PMAB 1CE5A 1BQYA 1AFEH 3RXBA 4ABGA 4ASUD 1YLCA 1C5TA 4OGYA 1V2QT 1YF4A 1GMCF 1DWDH 1NRQH 4JK5A 1MH0A 1UTQA 1SHHB 1XM1A 4Q4LA 1ELDE 3STJA 2UWOA 4INLA 1WTHD 1BUIA 3KQBA 1B0FA 2SGEE 1GI9B 1HDTH 1C5QA 3VB7A 1BT7A 2A1DB 1OP8A 1XVOA 3PLBA 1WYKA 5KEDA 2FOGA 1P02A 1T31A 1TPAE 2ZFFH 1ZGIA 1ZR0A 1N6YA 3RXVA 5J4QA 2ZI2H 3RMLH 4IC6A 4RI0A 3TJOA 1QJ6B 2XC5A 3Q3XA 3S0NA 3MU5A 4Q7XA 3VEQB 1JXPA 1TNJA 1BRBE 3ZZBA 2D26C 2ZHQH 1W7GH 5JB8S 1OWIA 1EASA 1GBDA 1GBKA 4BNRA 1AUJA 2BDAA 3ELAH 1P09A 2KAIB 1EJMA 1C5WB 4ISNA 1E36B 1V2LT 3A84A 3S9AA 1P06A 5KGOA 3UPEA 3A87A 4Y8YA 5F8XA 1C2KA 3TVJB 2B8OH 1AQ7A 3O8CA 1GBMA 4B2AA 3E8LA 4DG4A 1QZ8A 3LJOA 1VKYA 4KGAA 1C5OH 4XSKU 4BOHA 1OWKA 2ZHDA 1TONA 3SV6A 2O9QA 3UR6A 2Z9JA 4ABHA 3URDA 1ZSLA 4H42U 1BTWA 1XMNB 1Q2WA 2ZHWH 1Z8GA 3OY5U 2HVXA 3RXIA 1CO7E 4AGKA 3F0PA 4K60A 1L4ZA 2ZHEH 4NA7A 4ABAA 2ZDKA 1HAXB 1H8ED 3BG8A 3MHWU 1AWFH 1OWDA 1JRTA 4D9RA 1C5MD 3KGPA 3PMBB 2Q6FA 3E1XB 3TJUA 4DGJA 7ESTE 2BOKA 4WH6A 1C1NA 2FS9A 3VPKA 3KQ5A 3BEIB 2FODA 1AFQB 2VVVA 6LPRA 2V35A 3RXSA 5GWZA 1C1UH 3BTFE 3JZ1B 4HTCH 1GG6B 1AU8A 1UVUH 3RXCA 3SORA 3GCHB 3IG6B 2CF8H 5C5OA 4RSPA 4WXIA 4AOQA 5FX5A 5IDKA 1TNLA 1W0JD 3JZ2B 2GZ8A 1ZJDA 1G30B 3DD2H 1K1OA 2FDAA 5FHTA 2JKHA 2SGDE 3ZIAD 3PO1C 1O3FA 2A5AA 5I25A 4BXWA 2FIRH 1GBFA 3A85A 3SU6A 1ZMJA 6CHAC 1GGDC 1SPJA 4H6TA 2F9OA 3SJKA 2RA3A 1GWAA 2GMTB 2BY5X 2OD3B 1N1LA 5DP9A 4RT1A 4D8NA
chains in the Genus database with same CATH topology
3LONA 2FEQH 2ZFQH 1C1QA 4WJG2 1AUTC 2IOTA 4D7FA 1O3LA 3SHAH 1D3QB 2BDBA 2TBSA 4ZXXH 3E3TA 2A2QH 3D65E 2ZZUH 1W10U 5L2ZH 2AGGX 1MQ6A 4X2VA 2BDYA 2BZAA 1TOMH 1ELAA 2LNCA 2NU4E 1M9UA 3T5FH 5CMXH 3H5CB 4K3JA 4DT7B 4WMFA 1BA8B 1MMJN 2A4RA 5C1UA 1MKWK 1KIGH 4FUDA 1LQEA 3TGIE 2VIPA 1J9CH 2XWAA 3MNCA 4NIVA 2ZDNA 1FZZA 2HWLB 1FAXA 5C5NA 3KQDA 1C2HA 2FO9A 1QRZA 1PQAA 3SI4H 2A32A 1GHBG 1AWHB 4ABFA 5HM9A 4XBCA 1B0EA 1YPLH 4MLFB 3U8RH 3F9FA 2VU8E 1HJAC 2FYRA 1MTNC 4X6NA 3LDXH 1FY1A 1O2WA 5A0BA 1EB1H 1OWEA 1E38B 4CR9A 3SJ9A 1BTHH 1BTZA 1B5GH 1CBWC 1GI1A 4ABEA 4A1XA 4UE7H 4CH2B 1SHYA 2BLVA 3A8CA 3D23A 2ALVA 2QXJA 3D49H 1TPOA 1Y5BT 1CHOG 2PSXA 3LC5A 3TNTA 1AKSA 1GJ5H 4NA9H 4I33A 2QC2A 5E8EH 3L6PA 3QK1A 1EZSC 1QJ7B 1MTWA 2ZU1A 3NZIA 2FX6A 5C3NA 1V3XA 1MQ5A 1T4UH 1DSTA 2A0QB 4CRBA 5I46H 5EOKA 3UNQA 1S85A 1SBWA 2BQ7B 2PTNA 1P3CA 2H9TH 3HGPA 2Z3CA 1QGFA 2ODYB 2ZGHA 1XVMA 2AS9A 2R0LA 4CH8B 3ZVGA 1BRUP 3ZZAA 3ODFA 1F5RA 1V2NT 1O5GH 3OSYA 4YOGA 3LOXA 4AB8A 2GDDA 3SNBA 1SLXB 5ESBA 3BF6H 3MYWA 4I8HA 3ZZ4A 4WWYA 2ZFRH 2AFQB 4BXSA 5AFZH 2JETB 1GHZA 1ZRKA 2D8WA 2G52A 3KL6A 3E16B 3PWCA 1AB9C 3A82A 1F7ZA 1HB0B 1C1RA 1KXBA 1XUKA 2ZCLP 4ASHA 1K28D 8ESTE 2GVFA 1AGJA 1VITF 1NC6A 2P16A 1ARBA 1NU7B 1K1LA 3NPSA 3SV2H 2XBWA 3PTBA 4AFZA 1DPOA 4IS5A 3M5MA 2BYAX 3I29A 1DUAA 4OS6A 1YCPK 1CHGA 2ZO3H 1Q3XA 1A2CH 1V2VT 3SV8A 2HGTH 4B1TA 1XUHA 2BD5A 1G3CA 1V2KT 2BX4A 1OSSA 3P8FA 4BAOB 2H2ZA 1ESBA 4U01A 3DT0H 3LGUA 2P93A 2G5NA 2AYWA 2R3UA 1VITH 4D76A 2BLOA 2LPRA 1SGIB 2TGDA 2Y82A 4B2CA 1Y8TA 1A46H 3RU4T 1PYTC 3ESTA 2XC4A 1SGPE 1V2JT 3EDXB 4JYTA 3BTQE 1ELFA 2P3UB 4UEHH 1HIAB 1QA7A 3BIUH 1GHVH 3EA9A 4NIXA 1PYTD 4I32A 2H9HA 4FUFA 1TNGA 4LOYH 1S6FA 3A83A 1O5FH 2CHAB 2BOHB 4CHAB 2I6SA 4JK6A 2EI8A 4MPUA 5LPRA 1Z8JB 3FP8E 1ARCA 3SNDA 2J94A 2A5IA 2PKSC 1RTLA 3UIRA 1ORFA 1AIXH 1A5HA 4K2YA 3AAVA 4IN2A 2C8XB 2XBXA 1SGFG 4FUGA 3K9XB 4ZMAH 1EXFA 1ZPZA 2FTLE 3U8TH 4BAQB 1NM6A 2B0FA 4KKDA 2H5DA 1MU6B 2A4GA 1EATA 1OPHB 2QXGA 1KXEA 3MWIU 5EXMA 3HATH 3SBKA 1KTSB 1IQNA 3P92A 1O2XA 4GHQA 4ABIA 1C5LH 2P8OC 4AYYB 1MUEB 3B23B 3MOCA 1HAHH 3BG4C 3ZZ9A 3OYPA 3GCNA 1WU1A 2OC1A 2ASUB 3UNSA 1WTGH 4NSVA 1J14A 3SUFA 3EYDA 3F9EA 2BQWB 1P2JA 1XUIA 3P8OA 1O2SA 2FOAA 3RXJA 1O39A 4MPWA 5EQSA 5EU8A 1UK2A 3BV9B 3ITIA 1WAYB 2Y7ZA 3SQHE 1O31A 2OP9A 1AVGH 3H7TA 1GMCG 4HZHA 1IOEA 1LHDH 3EQ0H 4FVBA 2QY0B 1PPGE 1UTLM 3VB6A 1UCYK 1C5VA 3M61U 4R0IA 2A7HA 1FPCH 2G8TA 1GMDF 4MNWA 2EI6A 1C5YB 3RM0H 3O8RA 1P03A 4AFQA 1TX8A 2ZU3A 3M35A 1LVOA 1P01A 1TBQH 5T6FA 1GBIA 1SG8B 1HAYB 4Y0ZE 1CA8B 1BMMH 3ZVEA 1O5DH 3E0PB 2SNVA 1FV9A 4MDSA 1D6WA 1Y5UT 4XDEA 1VCQA 1H8IH 3B8JA 4D9QA 1O2PA 3D62A 3RMOH 2F9NA 4GCHF 3R0FA 3RM2H 4TY6A 1OYQA 1S84A 1EAXA 3BTDE 2O8LA 1INCA 2ZIQH 1TRNA 1RIWB 1Y5AT 5IYTA 1C2GA 1EPTB 2ANMH 5FBEA 3RXLA 1O2IA 3F9HA 4FXGH 3FZDA 1FMGA 3UQVA 1W3CA 1DXPA 2CF9H 2SGPE 1EZXC 5AVDA 4NZLA 1C2LA 1QTFA 1GL1A 1QRWA 2B9LA 3BTWE 3SJIA 1HBTH 5F8TA 4ZUHA 1C2IA 3ODDA 1NPMA 3FANA 5AFYH 3A7YA 1MBQA 2Y81A 1T4VH 1YPGH 2XBVA 4ISHH 1TALA 1PPZA 4HGCA 1DX5M 1KDQB 1NFXA 2SGFE 3KIDU 5FCRA 4K1TA 2F83A 2ZTYA 4FU7A 1LVMA 1EQ9A 2VWNA 2OQ5A 5GPIB 1GBBA 1FXYA 3QGJA 3MI4A 1C2JA 1T8LA 1JWTA 3AASA 1G36A 3RXRA 1CA0C 2OLGA 3QDZB 4X2XA 1DDJA 2FP7B 1O3PB 1D3DB 2HPQH 4E7RG 3ZV8A 2PUQH 1DANH 3P17H 3EGKH 1UTOA 2VGCB 3RXPA 3WY8A 1D6RA 4ZKSU 1O3IA 1C5SA 1GI8B 2C8ZB 2WPKS 2ZECA 1FIWA 1HJ8A 1VJ9U 1WUNH 3QZQA 3RXTA 3UWIA 4B76A 1ZYOA 1KXCA 3E6PH 4K8BA 3KQCA 1WV7H 1THRH 5JPMH 5SGAE 2Z9KA 1YPKH 4ABDA 1J16A 1SGRE 1O5CB 4FU9A 1SB1H 2ZTZA 2FESH 1MKXK 4NZQA 3MMGA 1TGCA 5DK1A 5T6DA 3EA7A 1AZ8A 3MTYA 1C1TA 1IHTH 4MG3A 2OC0A 3BSQA 4LK4A 4YTAA 1BMAA 1F0RA 3QGNB 1A0HB 1QY6A 1W7XH 3PYHA 1FONA 1GBLA 1C4V2 1IQEA 5GIBA 4IBLH 5GDSH 3TH3H 1LTOA 1O3BA 1HGTH 1VGCC 2HOBA 1X7AC 2WUCA 1Y59T 3LGVA 3UY9A 5F03A 2ZF0H 1GJ6A 4OGXA 3ATIA 1OP2A 9LPRA 2BMGB 4J2YB 3RUOA 1EB2A 1GL0E 3W95A 1FN8A 4XBDA 5LPEA 2BY9X 3PB1E 4WXVA 4CR5A 3QLPH 3RXHA 2EEKA 1JBUH 2PW8H 2XCFA 1HAVB 1SQTA 2ODQA 2V6NA 1QIXB 3CP7A 1G3DA 2TIOA 1TLDA 1N8OC 4KTCA 2PFEA 1TGSZ 3GCTF 1YP9A 1O0DH 3GDSA 4O3UA 4JZDH 1DWBH 1FY8E 2C90B 4JCNA 4ABBA 3UNRA 1O2JA 1Z6EA 6GCHF 1YLDA 4XOJA 3ATLA 1V2PT 1Y3WA 3H7OA 2A7CA 2TPIZ 2CXVA 3BEUA 5CHAC 1UTJA 4YT7H 3RU4D 1QR3E 1FNIA 2ZCHP 1GJCB 5C2ZA 4TY7A 1MTVA 1Q31A 2R9PA 4AYVB 3KNXA 1ESTA 3AVZA 1ZTJA 3T27A 4Q80A 1LDTT 2R2MB 4AN7A 3ZZ8A 3RC6A 1P2QA 1AHTH 5DP7A 2RG3A 4YM9A 8GCHF 2PUXB 3SHCH 5CE1A 3VXEH 4ZKOU 8KME2 5LH8A 3ZZ6A 1SFIA 2Q6DA 2GTBA 4DW2U 5A8YA 4I7YH 1OOKB 2IPHA 6ESTA 1A61H 3BN9A 4LZ4B 3A8AA 3CS7A 1JOUB 1KY9A 4DOQA 2BVSH 3MFJA 2XW9A 1DUEA 2VWMA 2ZGJA 4O97A 3SUEA 4BTUB 3QTOH 1QQ4A 3GDUA 2G00A 1EZUC 1QURH 1P2OA 4E05H 1IQIA 1HAPH 3SN8A 2NU3E 5JBBS 4TPYA 2BD2A 1ZOMA 2BLWA 1O2OA 1HUTH 1NY22 3AAUA 4Q2KA 1BOQA 1LO6A 1A4WH 2KAIA 1F92A 1A1RA 1PPBH 4VGCC 1TGBA 5T3HA 2AGIX 1G32B 1AY6H 2QN5T 1GJAB 1O2ZA 4UFFH 1SGQE 1QB6A 1ESAA 4X1QU 2P59A 2FWWA 2FLBH 2R2WU 1AI8H 1QBVH 1P3EA 2FM2A 1A0JA 3PO1B 1GJ7B 1K1PA 1K2I1 3MU1A 1LPGB 2QV1A 4YOIA 1WBGB 1FY5A 1S0RA 4DJZB 2FOBA 1VITG 1T8OA 1UVTH 1HXFH 5FPYA 4Y76A 1C1WH 6CHAB 2P95A 1MBMA 1SVPA 1GGDB 2GDEH 3O8BA 1TBZH 1GCTC 1LKAA 3O8DA 1SLWB 4BAMB 2ANYA 1DSUA 1F0SA 1LVYA 1O2MA 4GLYA 2XWBI 3BTKE 3FP6E 1UVSH 3K2UA 2Z9GA 4JZIA 1P11E 3TH4H 2GV6A 3PLPA 2O8WA 4AG1A 1GI0A 4RKJB 1IQFA 3S9CA 3VB5A 2Y5HA 4X1RU 5JBTA 2W7UA 3SGQE 3DA9B 1H8DH 2A2XH 2OTVA 2FX4A 4DCDA 4I8GA 1P2KA 1T32A 1DM4B 1GCDA 1GDQA 2GD4B 1O2KA 3A7WA 3FFGA 1ETRH 1ELVA 3HGNA 1CGIE 3MH6A 1D4PB 2JH0D 1C5RA 2TGTA 4LZ1H 1C9PA 5A2MH 1F5LA 1ETSH 1UVPA 3NUMA 4KP0A 9ESTA 1O34A 3EAJA 4NWLA 4MNXA 4NFEA 3KN2A 3MO3A 5H4IB 1BDAA 3S69A 1C1SA 4Y71A 3A7XA 3DHKH 3LIWA 3BTEE 1HAIH 5FCKA 1TABE 1UCYE 1C4U2 3CENA 3LGWA 5PTPA 3OU0A 1E35B 2FXRA 4U2WA 3V7TA 1QRXA 2Z3EA 7KMEH 1TWXB 4UDWH 2GP9B 3LH3A 2GX4A 1PQ8A 1EAUA 4UONA 1HJAB 1YC0A 2THFB 5EPNA 3RLWH 3LKWA 3DFLA 4ZKRU 1V2RT 1MTNB 2BD3A 2W3KA 2BDCA 2BM2A 2VIWA 2Y5GA 2ZFPH 2QF0A 3P95A 4XFQA 2ANWA 4BTTB 1FPHH 1GI6A 4Y7BA 1OYTH 1MAXA 2XTTB 1Y3YA 2GCHF 1CBWB 3RDZA 1SGYE 4INKA 2PV9B 1O3NA 1YCPM 3ZYDA 1P2IA 2BHGA 3TK5A 1OXGA 1HRTH 2QCYA 1HAOH 4SGAE 1SR5C 2UUFB 1TQ7B 4CRGA 1XUJA 3RXOA 2ZGXH 3GY5A 2J92A 1BMLA 1H9HE 1W13U 2C4FH 3MU0A 3SGBE 1GBJA 1TPSA 1Z6JH 3GY4A 1AN1E 3HKIB 4ISLA 3T62A 1FQ3A 2O8MA 3M7UA 1QL8A 1GVZA 3BTME 1O37A 3GY3A 1BBRK 4BANB 4XBBA 3MO6A 4I31A 5DPAA 1UTMA 5DP6A 4FUCA 4AZ2B 2ILNA 1GMDG 4IN1A 1O2RA 3RXAA 3R3GB 3BTGE 3OTJE 2RDLA 1NFYA 4JZEH 4K8YA 3MH5A 2A45B 8LPRA 3S9BA 3BEFB 1GBEA 1Z8RA 2A7JA 4F49A 1O32A 4Y79A 7GCHG 1TMBH 5JDUB 1JIMA 1ZMLA 2AERH 1AB9B 1D3TB 1CGHA 1UMAH 1ZZZA 2HLCA 1OWJA 4NA8A 3ZZDA 1Z8IB 2BD9A 3GY6A 5E2OA 4IGDA 5BRRE 2O8UA 4AFUA 1NN6A 1C5PA 4TPIZ 4K5ZA 2F9BH 2FLRH 1W8BH 2W26A 1TYNA 1RFNA 4RKOB 1TX7A 3OX7U 1ANDA 4B74A 4GCHG 2A4QA 2PKAB 1UK4A 1G2MA 1A7SA 2WV4A 1OS8A 3MNBA 2ZG0H 3UREA 1V2OT 4CBNA 2FTMA 1KYNA 1D9IA 1O5BB 2Y6TA 3SV7A 1NO9H 2OBOA 2ZTXA 1GBAA 2CJIA 1CU1A 4X8VH 1F2SE 1C5UA 2QXIA 2XXLA 2TRMA 4I8JA 3SNAA 3T28A 1XXFA 5AF9H 1AVWA 2BD8A 2GV7A 1MZAA 3A81A 5EODA 4FUEA 4INHA 2CHAC 4OS1A 2F91A 4CHAC 1IHSH 1DWCH 4NFFA 1Y3UA 2J95A 2B5TB 2P3FH 1QBOA 2ZEBA 1QB1A 4A6LA 2H1UA 3M7QA 5EG4A 5HGGA 3TLOA 1DLKB 2UUYA 2Z7FE 1LPKB 3ZZ3A 2QIQA 2FOHA 3MO9A 1EZQA 2Z9LA 3LGIA 4ISOA 4OS4A 3M3SA 1WQVH 1VCPA 1IQKA 1EUFA 2VWLA 1ETTH 2J34A 3LC3A 3IWMA 4FUJA 4WVPE 2FOEA 4OS5A 4MPVA 3GOVB 1XUGA 2ZWLH 3U98H 3V0XA 3SNCA 1O3DA 1W14U 1SGDE 1UHBB 1H4WA 2ZPRA 1HAGE 4I8KA 1O33A 1SGTA 3A8DA 5DP4A 3TNSA 4LXBH 2A4OA 1A5IA 1ACBE 1QJ1B 5FXLA 2P8OB 3P70B 1YPJH 1C2MA 1W0ZU 3BIVH 4GSOA 1D3PB 3BG4B 1MKWH 1AZZA 1JIRA 2GZ9A 2GCTC 1A3EH 3TITA 4OS2A 4NIWA 2IJOB 4UFEH 1H9LB 2Z3DA 1NT1A 2C8YB 1V2UT 3KQEA 3P8GA 5B6OA 2M5TA 1LHFH 3RXUA 1UTNA 3I78A 5FAHA 2A31A 3GCOA 3S7KB 2G4UA 1FDPA 2PTCE 1Y3XA 4FUBA 1RS0A 1E37B 2ZQ1A 1GI5A 1THPB 1PQ5A 2VVUA 1DS2E 5J4SA 1O35A 3M3TA 1C1MA 3MH7A 4ABJA 1SLUB 3LGYA 2ZFSA 1BHXB 3QX5H 1P05A 4RN6A 3RC4A 5L6N