1KLTA

Crystal structure of pmsf-treated human chymase at 1.9 angstroms resolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
226
structure length
226
Chain Sequence
IIGGTESKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMASE
publication title Crystal structure of phenylmethanesulfonyl fluoride-treated human chymase at 1.9 A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Serine protease
total genus 45
structure length 226
sequence length 226
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 1997-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kltA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kltA02
1SC8U 4IC5A 5HGGA 1UTQA 3U8OH 1E38B 3NKKA 1TMBH 1H8DH 4OGYA 5A0BA 3RP2A 3RXPA 2OC1A 3QX5H 1CE5A 1ZRKA 1HAYB 1HAHH 1IQHA 1A3EH 2AFQB 1DOJA 2TGPZ 1LVMA 1C1TA 1C2HA 1B7XB 1DPOA 4ZHMU 1D3PB 3SV8A 3UOUA 2G55A 1TGSZ 3Q77A 3ZV9A 3P17H 1VJ9U 2H9HA 1AKSA 1BZXE 1CQQA 4RKJB 3T62A 4A5TS 2UUKB 3AW0A 5L6NH 6ESTA 1GMDG 2VGCC 3ODFA 1DX5M 3E90B 3MMGA 2QA9E 1Z6JH 2W7SA 1THRH 1HBTH 1QHRB 1RJXB 1LPGB 3GCHB 4X6NA 2JH6D 3KL6A 1C1QA 1C9TA 2SGFE 1DITH 1O2QA 4XBBA 4CHAB 1HAGE 1QA7A 4SGAE 6GCHF 2FOGA 1AHTH 3UFAA 1GI1A 2ZDNA 5FPTA 1UCYH 1ANBA 1O2KA 1A46H 1AFQB 1D6WA 1GHVH 3SV2H 2C3SA 2AYWA 3BG4C 4B71A 4FUGA 1C2DA 1P09A 4BAMB 3E3TA 2O9QA 2VIVA 1OWDA 2ZU4A 3FZZA 1SGQE 1J16A 2WYJA 1EB2A 3BSQA 2EA3A 2ZHEH 3S7KB 1TGBA 1RXPA 1V3XA 3GICB 5E8EH 3V7TA 3MO6A 4XE4A 2C8XB 4MDSA 1DY9A 3A89A 4DJZB 2BDAA 3F9EA 3PWBA 1DVAH 3U9AH 4RKOB 2FOFA 1GDUA 2AMDA 1O3GA 1YCPM 5C5OA 1EJAA 1DWCH 3PB1E 3RDZA 4MPVA 3A83A 3A80A 3MH5A 3ODDA 4MPWA 2BVXH 3NWUA 1O2VA 1CSOE 4R8TB 2BDGA 1JBUH 2CF9H 4E7RG 3BEIB 2ZIQH 1V2ST 1O3HA 1VITH 2HNTC 3ZZ8A 1C1RA 3KQCA 1S84A 4JZEH 3S9AA 3QO6A 1JOUB 3BEFB 3LGVA 1LMWB 1B0EA 1SGYE 2PR3A 2FI4E 3P92A 3MWIU 2VU8E 4X2VA 2AS9A 4GSOA 4AB8A 3DD2H 2Y82A 2G4TA 3ATKA 1N8OC 1O3EA 1C5XB 3H5CB 3U8TH 1NT1A 3H7TA 4ISIH 4OS2A 1MTUA 3UQOA 1YPMH 3EAJA 4M7GA 1NPMA 1OWJA 2BYAX 3LOXA 4Y76A 1BT7A 2K1QA 1EZSC 5FAHA 2NWNA 3K9XB 2GCTB 4AFUA 1PQ5A 1FUJA 3ZZ3A 1F0TA 3SO3A 4DGJA 2GVFA 2B9LA 1JRSA 3O8BA 2FOBA 1BBRH 2HVXA 1ELEE 2D1JA 2R0KA 1EAUA 2ZU5A 2ZFSA 1G30B 5C20A 4ESTE 1C1UH 5DP5A 1C5YB 1O2TA 2ZNKH 1ZSJA 2ZDLA 3BEUA 2VWOA 1QCPA 1MTNC 4Q2KA 2H5DA 3RMLH 3UREA 2KAIB 1HXEH 4INKA 1N1LA 2STAE 2FX4A 3STIA 1NRPH 2F3CE 3K6YA 1CU1A 1QGFA 2GV7A 3ZVCA 4UFFH 4GPGA 1MD8A 2H9EH 4WJG2 1H8IH 2R2WU 1C5SA 1QRXA 4DURA 3CS0A 4KKDA 1O3LA 3U8RH 1F0SA 3G01A 5BPEA 3TH2H 4NWKA 4K1EA 2ZDKA 3OX7U 1O3MA 1CHOG 1OXGA 2TRMA 1C4U2 1BUIA 2LNCA 4CRAA 1MBMA 1XM1A 3T2NA 3T29A 4WXVA 1GHAG 3VGCC 1GBMA 1PYTD 1K22H 3GY6A 1C1NA 1XUFA 2ZQ1A 1JIRA 3EA7A 3ZZ4A 3EQ0H 5FXLA 4BTUB 1K21H 7GCHF 1ZHPA 2QIQA 1S85A 1P9UA 1GL0E 4CRDA 3EDXB 2BQWB 2XWAA 4R0IA 1BOQA 5DGJA 2BY5X 1PPHE 4IN2A 1S6HA 4TY6A 4Y0YE 1NESE 4UONA 1TMTH 3PM3A 1TNKA 1W13U 1QURH 4THNH 2F9PA 5ESBA 3GY7A 1C5TA 3LIWA 2WUCA 3UIRA 3MO3A 1GHBF 2BD8A 3VB4A 1BIOA 2BLWA 3A82A 3RXTA 4OS4A 1TRYA 5GJ4B 1MMJN 1C2JA 3SNEA 1O2LA 2P94A 1G3BA 1SOTA 1V2WT 1N6YA 1BA8B 1YPGH 5C1YA 1KLIH 2LPRA 3NK8A 5DKMA 5DP9A 1YPKH 2D8WA 1CA0C 1TQ0B 1ELFA 4CR5A 1O2YA 1C2MA 5HM2A 3NZIA 4Y8XA 3OY5U 1UVTH 2PLXA 1HUTH 4H6SB 4UFEH 2BZ6H 1IOEA 1DUEA 2R3YA 3KHVA 2SGPE 1O39A 3OTJE 1QB1A 2QY0B 2DUCA 2ZTYA 1DE7H 1Z1IA 1J9CH 1MAYA 1J8AA 1P8VC 1T8NA 1FPCH 3ZZ9A 1C2EA 2FX6A 1Z8RA 1ZSLA 2BY7X 1KTSB 4NSVA 1ORFA 1NRQH 2P95A 1W0YH 5I25A 1GI6A 4AGKA 3OY6U 1W10U 2Q6FA 2NU4E 4ZUHA 2G00A 1FLEE 2XTTB 3QN7A 1O5AB 3GDVA 1VCWA 4Z0KA 4B76A 4UFDH 1LVBA 4IS5A 1D3TB 1IHTH 3A81A 2C93B 1PQAA 2F9BH 4E7NA 3BTME 2J34A 1TNLA 1Z8JB 2O8LA 2QV1A 2HRVA 4AORA 4ZKRU 3ATMA 2QXGA 1FNIA 4MVNA 1AVGH 1H9LB 1T8MA 2BD2A 3P8FA 3KCGH 4ISHH 1KLJH 4OS6A 1ELCA 1A3BH 2PSXA 1ETTH 4AOQA 4E06H 1DANH 1S5SA 2ZWLH 1GCDA 1TRNA 1IQKA 4X8VH 1GJ8B 5FBEA 4HFPB 2EI6A 1ZJDA 2M5TA 3PROA 4ABBA 1M9UA 1N6XA 1JIMA 2VVCA 5EW2H 2JETC 1MCTA 1L1NA 2SGDE 3SV6A 2HGTH 2THFB 3KQEA 3Q76A 1IQIA 1G2LA 3M36A 1BDAA 1CGHA 2QF3A 1E37B 1FXYA 2OQUA 4MNYA 2SGAA 4O03A 2XWBI 1OP8A 5DP8A 1V2KT 5LPRA 2AGEX 1HPGA 3LONA 2Z3CA 3NXPA 3URCA 4X8SH 1T32A 1TB6H 2G5NA 3V12A 1TQ7B 3LGYA 6CHAB 3UR9A 2F9UA 1TGTA 1JRTA 5LPEA 4IMZA 1GCTB 5JBAS 1IQMA 3LKWA 1BCUH 1HGTH 1NM6A 3EA9A 1SGDE 2ZFQH 1GHYH 1GJ4H 1QQUA 1LO6A 3VFEA 1GVLA 1SHYA 2VINA 5A0AE 2FTMA 5GIBA 4X1NU 1IQLA 1LKBA 2SGEE 9LPRA 4NFFA 3ELAH 1HAVA 1QR3E 5A8YA 2SGQE 2ZGJA 1BQYA 2WPJS 2HNTF 3T5FH 1OWHA 1K1MA 3RU4T 2IN2A 3TGKE 2CMYA 1UTMA 2C8YB 2TGAA 3L3TA 1LHDH 1WV7H 1GBCA 3FZDA 1FY1A 2Z7FE 4K3JA 1D4PB 4O97A 3BTDE 1EZQA 1O34A 4CRCA 5C67A 2XRCA 3VB3A 1TPSA 1GI3A 3PO1C 3U1JB 4U2WA 1G2MA 4DT7B 2AMQA 1O36A 2BX4A 3CS7A 4PROA 1TBQH 3GCTF 1FDPA 2ZFFH 1DLEA 1C2IA 1ZHMA 1O0DH 2FIRH 4LOYH 3RXAA 3U1IB 1ZJKA 4Y10E 4UEHH 4MG3A 1P06A 2YNAA 2XC0A 1O2GH 1W7GH 2Z9LA 1O32A 1RTFB 3DT0H 5EQQA 4ABGA 3TVJB 3EGKH 1GI4A 5LH8A 3RXDA 1LVYA 3FAOA 4K8BA 5G4BA 3M5LA 5FHTA 1O3JA 3URDA 1AVXA 2G51A 1LDTT 2VWLA 2ZFTA 4YLUA 1BTZA 3A7TA 3PYHA 1YGCH 1TOCB 3GY5A 4FVDA 1C4V2 3SOSA 2QYIA 5GCHF 3RXVA 1V2RT 1SQAA 3RXMA 1RIWB 2TPIZ 1ZPBA 5A09A 1LHEH 1TYNA 1THPB 1A2CH 2BY8X 3BG4B 4UE7H 1A7SA 1P57B 1MBQA 3PMBB 1XUHA 3SBKA 1LPZB 2A4GA 2PV9B 3RC4A 3PV4A 1MKWK 4Q7ZA 1RD3B 2A31A 1O3IA 2FM2A 1HIAA 1ZGIA 4X1PU 4UD9H 1Z7KA 1OWKA 2PKSB 1P10A 2EEKA 1K1NA 2CGAA 4ISOA 4K1TA 1WUNH 5EXMA 1AUTC 2ZO3H 1ZRBA 1CGIE 5EPNA 1OWEA 1J14A 1EAWA 4KGAA 1CVWH 1HAVB 2J4IA 1W3CA 4LZ4B 1WAYB 1O30A 1G9IE 2BVSH 1SLVB 5T3HA 3MNXA 2BD3A 1TFXA 3GCOA 1C5VA 3PLKA 4FU9A 1MKXK 4XOJA 2FXRA 1GJDB 1SGPE 1UO6A 4WWYA 1GI0A 3FP7E 2GZ7A 4X6OA 1P2QA 2OINA 2FLBH 2FP7B 3ATWA 2FYRA 3MH6A 1E36B 1VGCB 8LPRA 1BITA 3F1SB 2QAAA 1F5KU 1EJNA 4K60A 4TWYA 3TLOA 2VWNA 3FP6E 1N8OB 2FMJA 4BAQB 3L33A 3LGUA 2SFAA 4YESB 2C90B 2R9PA 5DP6A 1GMCF 4FXGH 2Y6TA 4JZFH 3W94A 2D2DA 1A0LA 1TOMH 1P2IA 1SPJA 2B8OH 3RXUA 1TGCA 1GBFA 3TU7H 4X1SU 2NU1E 1TWXB 2J92A 4DIHH 3GDUA 2ILNA 2ZPQA 5T6GA 1MU6B 2AMPA 1W2KH 1P12E 1GJBB 4TY7A 1LHGH 2WV4A 3MTYA 4DW2U 1FMGA 1AY6H 1INCA 1Y3XA 3S69A 1MTNB 1C5LH 1O3NA 1ANDA 1KXFA 1G37A 2Z9JA 4A1XA 8GCHG 1FY4A 1TAWA 2UUFB 4JMYA 3EYDA 3PLBA 2AIQA 4KTUA 1HJAC 5I46H 4X8UH 2CHAC 1P2OA 3A86A 4X1QU 3A84A 3SUFA 3LJOA 3SU2A 1O2WA 3RXGA 1MQ6A 4O3TA 1SFIA 1HIAB 3ZVEA 1EQ9A 1QB6A 1NFUA 1XUIA 5CE1A 1KLTA 2F91A 2OTVA 5JDUB 1TPOA 1ABJH 2ZPSA 4YO9A 5FBIA 3NCLA 3MNBA 2WPHS 5A8XA 4X1RU 4VGCC 2Q6GA 1QBVH 1GI7B 3AAVA 4WF8A 2QXJA 3STJA 3QTOH 2BD7A 3RMNH 1AB9B 1O3PB 1LHCH 1AMHA 1YYY1 3QTVH 3OU0A 1FIWA 2FS8A 4O9VA 1NFXA 2OD3B 2KAIA 3RXCA 4JZDH 1SGFG 1ARBA 1S82A 6LPRA 1U6QA 3D65E 3M3VA 1H9HE 4AB9A 2V35A 2ZQ2A 2ZHQH 3FP8E 3ZZ7A 2FPZA 1P03A 3M5MA 2CF8H 3MNCA 3VXFH 1Y59T 1GBLA 3V3MA 1V2UT 2GZ9A 2R2MB 3M3SA 1Z8IB 1CA0B 3F9HA 1EUFA 2O8UA 5B6OA 1WYKA 5L30H 3ZZ5A 1MAXA 3HGNA 3ZVAA 3O8RA 4NIWA 1G3CA 3BTGE 1SLWB 3MU1A 5JPMH 1OYQA 5ESTE 2ZGCA 4ASHA 3GYMA 1O5GH 3M3TA 3JZ2B 4AG1A 5C1UA 5ABWA 1A5HA 5C3NA 1L1GA 1MZDA 3TK6A 2BMGB 1EATA 3SJKA 1XX9A 2RCEA 2OBOA 1VITF 4GCHF 4JZIA 2PWXA 2Z9IA 2W3IA 1WU1A 2OC8A 1DXPA 4HGCA 4ZXXH 1QBNA 4SGBE 3OYPA 1EB1H 3UNRA 4FUFA 1UVUH 2CV3A 3K65B 3UQVA 1MD7A 1GHZA 1V2MT 2FOHA 2BLVA 4FU8A 1TNJA 1LCYA 1O2OA 1YLCA 2GMTB 1GG6C 1L4DA 2FOCA 3TNSA 2QXHA 1UMAH 1AIXH 3RXSA 2TBSA 3BTQE 1EPTC 3R0FA 4TWWA 5DP4A 5ETXA 1WQVH 2VJ1A 1SG8B 5E2OA 1QJ7B 4TYDA 1K2I1 2ZP0H 4LZ1H 4I33A 1TBZH 3SUDA 1RRKA 1TRMA 4JYVH 4YOIA 3UOPA 5HYOA 4YM9A 2UUJB 3TJUA 1HLTH 1UTPA 3RXQA 4TPYA 1P05A 1W14U 3GY2A 3HPTB 2ANYA 3GY4A 4OS5A 3VB7A 1P2JA 1GL1A 3I29A 2VIOA 3SNDA 5L2YH 2F9OA 2OXSA 1WTHD 2JETB 2Q6DA 3QLPH 3UR6A 1V2LT 2R0LA 5HXFA 5PTPA 4ABFA 3C27B 4BTTB 2BD5A 1WOFA 1PPEE 4B2CA 2Y5HA 1Y3WA 4INHA 1OSSA 2EI8A 2ZHWH 4B2BA 1DICA 3LH1A 2BQ7B 3T27A 3P6ZB 2PUXB 1HAPH 4JZ1A 1SL3A 3P70B 2Z94A 1A61H 2H5CA 2QXIA 1RFNA 1ACBE 4WXIA 4O3UA 2ZFRH 1W0ZU 1QIXB 1FONA 1TPAE 3M35A 5E0HA 1B0FA 1AUJA 3IITA 1L4ZA 2IJOB 3FVFB 1FAKH 1RTLA 2VH6A 2I6SA 1KY9A 1ZOMA 4ZAEA 1FIZA 5LGOA 2BQ6B 4DOQA 1CHGA 1GI2A 1MQ5A 1C5MD 1OPHB 1VR1H 1GVZA 2P3TB 4BAOB 5K7RA 4WMFA 1JWTA 1H9IE 5HM9A 1KDQA 1XKAC 2ZGXH 2GCHF 2BDBA 4NA7A 4I8KA 4DCDA 1UCYE 4IW4E 2VIDA 2FDAA 1OX1A 1HB0B 2QN5T 1GGDB 3GDSA 3RUOA 1ZTKA 4FUCA 4YT6H 3LDXH 4F49A 3A7VA 4X2YA 5LPFA 3ZZCA 1SVPA 4ISLA 5F03A 2OLGA 3EA8A 1MKWH 3HKJB 4AG2A 1UJ1A 1Y5BT 4B2AA 1ZHRA 1GWAA 1WQSA 1GI8B 2BXUH 2ZU1A 1SMFE 2GT8A 2FO9A 1BMMH 4FUBA 4Y79A 2A7CA 5EU8A 1XKBC 1S81A 1ESAA 1YLDA 3SORA 2ZZUH 1EAXA 1SHHB 3KQBA 5EXNA 3QGNB 2XCFA 5TJXA 2WPMS 5DPAA 2BD9A 4NSYA 1ELAA 2BOHB 3QWCH 1S0RA 1EZXC 1MKXH 1NO9H 3NUMA 3RXFA 3T28A 5EPYA 1TX6A 5E0GA 4KELA 1HRTH 2BD4A 2HALA 2GT7A 1P02A 3E6PH 1XVOA 4K1SA 4YOGA 5HMAA 3UNQA 4BANB 1ANCA 2GP9B 1ID5H 1TX8A 2GD4B 3MI4A 1ELDE 1KXAA 2UUYA 1O5CB 2FODA 2YOLA 1DSTA 1CT4E 1XUKA 1A5IA 1V2JT 4WH8A 1P3EA 1LQDB 1O2HA 1V2VT 1Q31A 5TCAA 1DLKB 1ESBA 1Y3UA 1GBTA 3LGTA 1UTKA 4RSPA 2O8TA 2G8TA 1O2JA 1O5FH 1S83A 4D76A 3RU4D 3S7HB 3PMHB 1C2LA 4I32A 4CH8B 2XW9A 1GHWH 2SNWA 1O3CA 1GMHG 2GCTC 2XC4A 1WTGH 4IMQA 4I8HA 2ZEBA 4Y71A 4AZ2B 4GLYA 2OQ5A 1HFDA 3JZ1B 1D9IA 1YKTA 1BBRE 1EOJA 2XBVA 5JBTA 1CBWC 1C1MA 1C2FA 1ZSKA 2CN0H 1PPGE 1O2UA 2JH0D 4KTSA 1KDQB 3MOCA 1OP2A 3UY9A 1P04A 1O31A 1SR5C 1BMLA 1K1IA 1P0SH 2IPHA 3QZQA 3SU5A 4BTIB 5JYIA 1DXWA 1HV7A 1UVPA 1SFQB 2J9NA 4KTCA 4AX9H 2BY6X 1ZLRA 1LHFH 4A7IB 4AFQA 4DVAU 1NROH 1KIGH 2Y7XA 3ZV8A 3SW2B 3QK1A 1Y5AT 3E16B 4F4OC 1TLDA 2Y81A 2ESTE 3A8DA 5CHAC 3P8NA 1DY8A 1G3EA 2A4RA 1C4Y2 1IQGA 1C1VH 1TABE 1SB1H 3T25A 1BRBE 3F6UH 1XMNB 1AWHB 1NU9A 3Q3XA 5T6FA 4B1TA 1QA0A 4ZHLU 4ISNA 2PKAA 2ZU2A 3GY3A 4WY3A 2H9TH 5DP3A 8GCHF 5DO4H 3A87A 1DWBH 2FOEA 1DWEH 2BX3A 3SI3H 1HXFH 4I31A 3KQDA 4OS7A 1C5UA 1E0FD 3P8OA 1S0QA 1YPEH 1KYNA 1W7XH 4U32A 3DA9B 1YC0A 2WV5A 1HJAB 1OOKB 2WYGA 2ZA5A 1GMDF 3GOVB 2CHAB 3PTBA 4ZMAH 3SGBE 1UTNA 3RLWH 4K8YA 3SQEE 3GY8A 1AVWA 4I8GA 4B75A 4ZKNU 1L0ZA 3BTKE 4XBCA 1TMUH 4BXSA 1MUEB 2P3FH 2EC9H 2HWLB 4UDWH 1VJAU 3MU0A 2VGCB 7LPRA 8KME2 2ZECA 1JMOH 5DP7A 3DFLA 3ZVDA 3MFJA 3M7TA 4DG4A 1IHSH 4FUDA 1O33A 3TGIE 3ZZBA 3SV7A 1HDTH 5DG6A 4DY7B 1EPTA 1P11E 1C5ZB 3SNCA 1GBIA 4AFSA 1O2PA 4H6TA 2OC7A 1Y3VA 1LQEA 3SU0A 2A4OA 1EKBB 4DIIH 1IQJA 3MO9A 5H4IB 1THSH 4WVPE 3UUZA 2Z3DA 5JB9S 1UK4A 1C5PA 1YPJH 2BZAA 3H7OA 3PMAB 1IAUA 2XBYA 1Z1JA 2W3KA 2B5TB 1CA8B 2AGIX 2OP9A 3SZNA 1FQ3A 1IQNA 1VZQH 1F5LA 4A1VA 4XFQA 5F8ZA 1NU7B 1SGFA 3QZRA 4JCNA 2ZPRA 5EODA 2FI3E 3TIUA 1HJ9A 2JKHA 3RXLA 5GDSH 4MLFB 3LH3A 4NWLA 5AHGH 3K2UA 3UTUH 3TJOA 1Z71A 2FTLE 1ZZZA 4MPXA 4YTAA 1TPPA 1UTJA 3F9GA 1EX3A 1C5QA 4NZLA 4A6LA 2NU2E 3UNSA 5E2PA 2YNBA 1Z6EA 1ANEA 1SOZA 4CBOA 1KTTB 1BRAA 2OUAA 4IBLH 5EGMA 1HCGA 1BHXB 2ZDVH 3FFGA 2PKAB 1BMNH 4ZKOU 1BTPA 1W11U 1HAIH 2GX4A 2ODYB 2DE9A 2ANMH 1DFPA 1C1WH 3LT3A 4MTBA 4NG9H 2RG3A 1BTUA 2ZG0H 2PW8H 2A32A 1EP6A 3I77A 1NFWA 5EQRA 1L1JA 4X2XA 2A7HA 2XBWA 4D9RA 1YP9A 3M61U 1F0UA 4IGDA 1AD8H 5EG4A 5A2MH 4YZUA 1AQ7A 3BTTE 3SNAA 2ANKH 3BTEE 3VB6A 2G52A 2GV6A 5TCCA 4FUEA 2TIOA 3E0NB 2QF0A 1PPFE 2PTNA 9ESTA 1K28D 3BIUH 1VCQA 2H6MA 1LTOA 1GG6B 1C2GA 3NPSA 1BTXA 4FUIA 3LU9B 3ZYEA 1O2IA 1A4WH 3S9CA 1OKXA 2ZCHP 1EPTB 1H1BA 4XBDA 4I7YH 3TJNA 4JYTA 2UWLA 4LK4A 4Q80A 3BG8A 3UPEA 4AFZA 1T31A 1TIOA 2WPLS 2Z3EA 1JXPA 1GCTC 3ATIA 3RMOH 1HAZB 3IWMA 1ZMNA 4MQAA 4Z6AH 2WUBA 2P8OC 4B73A 2C8ZB 1QFKH 1UK2A 5JBBS 2VIPA 5C1XA 1BJVA 3MYWA 2J95A 1CO7E 2ZKSA 3AAUA 2HNTE 2FZZA 5AVDA 1TONA 3SU4A 1CHOF 1Y8TA 1QL7A 1T4UH 4BOHA 3CP7A 1GHAF 2XCNA 1XUJA 4UFGH 1DM4B 1BTHH 1MTVA 1GBAA 1ESTA 1KSNA 2AGGX 1GHXH 3A85A 3AVZA 3SGQE 1AN1E 1SQOA 3OSYA 3VGCB 1O3BA 3VXEH 3TNTA 3RXEA 2FESH 3ENSB 3SN8A 4B74A 3Q3KA 3WY8A 3DFJA 3D62A 1TA6A 1T7CA 1GBJA 1NN6A 2B0FA 4X6MA 2PGQB 2QGRA 3GCTG 3LGWA 3HK3B 1O2RA 4GHTA 1FN8A 2PTCE 1PQ8A 3Q3YA 1H4WA 1T8LA 3TH4H 1UVOA 4XDEA 2ALVA 2RDLA 3KF2A 1EAIA 1K1OA 4WMDA 4NA9H 4K5ZA 3UWJH 5C5NA 1LVOA 2WPKS 1DWDH 3BN9A 3MH4A 2G4UA 3GCNA 4NCYA 2G5VA 1UHBA 1PQ7A 2ZHFH 1P2NA 5FX5A 1TNGA 1SLXB 3W95A 2VVVA 4HZHA 2XXLA 4BNRA 1RIWC 4H42U 1TA2A 3E0PB 3F9FA 3P8GA 3PLPA 1GVKB 3QUMP 3BF6H 4YT7H 3ESTA 3B8JA 5GCHG 3BIVH 3MH7A 1D6RA 1SLUB 1BTWA 3SU6A 3HGPA 4OS1A 2PGBB 4FU7A 5A8ZA 2GDEH 2PKSC 2AERH 2ZF0H 2ALPA 3R3GB 3SJ8A 1ZTJA 2XBXA 2FYQA 1BJUA 3MU8A 3BTWE 2FOMB 1YCPK 5EW1H 3SUGA 3ZYDA 1SQTA 1G32B 2HLCA 2A7JA 3PWCA 1C9PA 4I8LA 1SGEE 1C1PA 1FY5A 2ODQA 4ZH8A 3SU3A 2O8MA 3SI4H 8ESTE 4ABAA 1O5DH 3K6ZA 3A88A 3RXHA 1PYTC 2VIWA 1AE5A 3M5OA 5JBCS 2Y7ZA 3RU4E 1QJ6B 2FLRH 4Y6DA 3SV9A 1QJ1B 1NRSH 1O3DA 3HK6B 2GTBA 4NZQA 3ITIA 3T26A 4BAKB 1AKSB 1O2ZA 1FAXA 5C2ZA 1VGCC 2W7UA 4IC6A 1IQEA 1KXEA 1EZUC 3MU5A 3S9BA 1T4VH 5GPIB 1FI8A 2B7DH 3O8DA 1J17T 1GMHF 2A2XH 3E8LA 1WCZA 2BDYA 2STBE 1AWFH 1GBEA 2PUQH 2BDHA 4HTCH 5DK1A 1YBWA 4HI3A 5EXLA 1QY6A 2V0BA 4MNWA 2FI5E 1K1JA 1AZZA 1GJ6A 1P2KA 2BY9X 3MU4A 3TK5A 5JB8S 3IG6B 2Z9KA 2ANWA 1GMCG 4D7FA 1QRZA 1AGJA 1CBWB 4Y7BA 1ELVA 1SGNE 2HPPH 1UHBB 2PHBA 3RMMH 2J38A 2QC2A 1ZR0A 1BB0B 1NRRH 1O3OA 2J2UA 3SHCH 5E0JA 3GYLB 3MNSA 3RXJA 1TE0A 7KMEH 1O5EH 1HYLA 2NU3E 3RC5A 3U69H 3KEEA 3SQHE 3HATH 1OS8A 4Y8ZA 2P59A 4OGXA 4CRFA 5CHAB 3LJJA 1GDQA 1C5WB 3KNXA 1PPCE 3MHWU 1A1RA 4ABHA 1ABIH 1V2NT 1HJ8A 2H1UA 2A0QB 2BM2A 3B9FH 3A7WA 3ATLA 3RC6A 1P3CA 3TPIZ 5J4SA 2FWWA 3GCHC 2P3UB 1XUGA 1GDNA 1XXFA 2QCYA 2F9NA 4NGAH 3E91A 3ZVBA 1ZPZA 2AIPA 5BRRE 4FVBA 2PFEA 1MTSA 3HKIB 3KIDU 1DT2A 2F9VA 2P93A 2ZCKP 5F8XA 4CHAC 4CRBA 4J1YA 3VPKA 1AB9C 1UK3A 3SUEA 1SBWA 3PO1B 4X2WA 1O2XA 1O5BB 4U01A 4X0WU 1FN6A 3VB5A 1O2SA 1AFQC 3E1XB 6GCHG 2BLQA 5FX6A 2XNIA 1NS3A 4U30A 1K9OE 3DUXH 1Q2WA 1C5OH 1TALA 2ZC9H 4KP0A 1A0JA 3SJ9A 2GDDA 2BHGA 3SU1A 3CENA 2ASUB 3D23A 1AFEH 1OYTH 1UTOA 3ZZ6A 2O8WA 2PSYA 2ZU3A 1FY8E 2BB4A 1K1LA 4X6PA 4BXWA 1ZGVA 4J2YB 2SNVA 3LGIA 5DJ7A 4CRGA 4JK5A 2D26C 5FCKA 4YLQH 3ZVFA 2TGDA 2ZGHA 1UTLM 1NZQH 3TITA 4GHQA 3RLYH 4CH2B 3RXOA 1HAXB 1C5RA 3M7UA 2A4QA 1SGCA 2BOKA 2HOBA 1UCYK 4Y11E 1FZZA 1C2KA 1YPLH 1BRCE 2A45B 2V3HH 2RA3A 2VH0A 1AE8H 1Q3XA 1KXCA 4NIYA 3VEQB 1GBKA 1RGQA 1HNEE 4WMEA 1V2TT 2H2ZA 1VITG 4GCHG 3I78A 3SJIA 1SGIB 1QL9A 2ZDAH 2W5EA 1O38A 2ZTZA 1ELTA 3L6PA 1C1SA 3ZZDA 4Y8YA 1PFXC 1KXBA 2GMTC 4MNXA 1QTFA 5GWZA 1J15A 4MNVA 4XSKU 4CREA 1LPKB 1O3AA 2AH4X 2A5KA 3F68H 4AGJA 4FUHA 5IYTA 1GJ9B 1O3KA 1MU8B 1MCVA 3RXBA 1OWIA 3GISB 1FPHH 1WBGB 3KN2A 1PPZA 1CT2E 1Y3YA 2EI7A 3O8CA 1NFYA 1CT0E 1EJMA 2V6NA 3M5NA 5IDKA 1LKAA 1W8BH 1X7AC 3D49H 5FPSA 4GAWA 1RTKA 4YOJA 3RXKA 1TGNA 4QT8C 1A0HB 3SHAH 2F83A 3DHKH 2NU0E 1EXFA 3LPRA 3UWIA 2UWPA 3V0XA 1KXDA 4K69A 2A5AA 1YPHE 5L2ZH 1BHXF 2GZ8A 1AZ8A 4WH6A 1IQFA 4RN6A 1V6DA 2ULLA 4Q7YA 5EOKA 1QB9A 1NRNH 5SGAE 4Y0ZE 3EE0B 2VIQA 3U98H 2OCVB 1QNJA 5F8TA 3M7QA 3AW1A 1A5GH 2VVUA 2P16A 3FANA 3M37A 1F2SE 5T6DA 1BBRK 4IN1A 5AF9H 4D7GA 3PMJA 2C4FH 2P8OB 1G3DA 1GBBA 2FS9A 2JH5D 2RA0A 3A8BA 1Z8GA 2J94A 1TBRH 3C1KA 7GCHG 5GXPA 3BTFE 1NTPA 1D3QB 4D8NA 2WPIS 3SJOA 4ABJA 5CMXH 7ESTE 2A2QH 1WSSH 3A7XA 1QQ4A 3Q00A 1YF4A 1EASA 1DSUA 1E35B 4ABIA 2Q1JA 1SSXA 2ZHDA 3AASA 2DE8A 2AEIH 2G81E 1F5RA 3S0NA 2Y5FA 5A0CA 3SGAE 1MH0A 1DS2E 3RXRA 4AYYB 1GHBG 4X8TH 1GPZA 3A8CA 5FCRA 1GJ7B 1F7ZA 1SGTA 1GJCB 2ZGBH 4VGCB 1F0RA 1D3DB 1ZMLA 2GCHG 1GGDC 4CBNA 5J4QA 4Y7AA 2Y80A 1NY22 1E34B 4GUXA 3A7YA 1GBHA 2GKVE 3N7OA 1QBOA 3RM2H 4ZXYH 2TGTA 2ZI2H 1SGRE 1K1PA 1S6FA 1GJ5H 2OBQA 4H4FA 1YM0A 4D9QA 1MTWA 1EP5A 3QGJA 1DUAA 1O37A 1BTYA 4MPUA 2ZCLP 2XC5A 2WINI 1CGJE 1ZTLA 3TJVA 1YCPH 4NIVA 1XXDA 4A92A 1NC6A 1ETSH 4Q7XA 1V2QT 1RS0A 2BDCA 2A1DB 3RM0H 5F6MA 3V13A 1MZAA 1UVSH 1O3FA 1FY3A 1EOLA 2ODPA 1DDJA 1TX7A 2Z9GA 3A8AA 5AFYH 2V3OH 1AI8H 1P2MA 3KGPA 2C8WB 1AU8A 4ZROA 1T8OA 2BDIA 2Y5GA 4JK6A 2CJIA 5K0HA 1ETRH 4FUJA 1W12U 2XYAA 4ZHAA 2ZDMA 3LC3A 1YPHC 5AFZH 4NFEA 3RXIA 1C1OA 3PTNA 1V2OT 1TNHA 3TH3H 1QRWA 1P01A 4CR9A 4AN7A 1O2NA 1GI5A 2GGVB 3QDZB 1GI9B 1ZMJA 2CXVA 2FOAA 2HPQH 5FPYA 4NA8A 1ARCA 1O35A 4A1TA 3A7ZA 2W26A 1ZYOA 1TNIA 4LXBH 1BMAA 4BAHB 2VB0A 1PJPA 2BXTH 2FEQH 4INLA 1G36A 2OC0A 1AO5A 2R3UA 1OP0A 1GJAB 1XVMA 3ZZAA 1VCPA 4I8JA 3B23B 2ZFPH 3BTHE 4GVUA 1GBDA 1B5GH 2BVRH 4K2YA 1PPBH 4ABEA 2IOTA 1QL8A 4AYVB 1F92A 4TPIZ 1FV9A 1ZPCA 1L2EA 2A5IA 4ZKSU 1O2MA 2BTCE 4NIXA 2UWOA 2BLOA 2I6QA 2VWMA 3LC5A 1P9SA 1ELGA 4JYUH 4E05H 1Y5UT 1ELBA 3P95A 1C5NH 1V2PT 3TK9A 1SI5H 6CHAC 5EQSA 1BRUP 4ABDA 2Z6BD 2ZTXA 3ZVGA 2VNTA 1HAOH 3SNBA 3TGJE 3BV9B 1FJSA
chains in the Genus database with same CATH superfamily
1SC8U 4Q4LA 4IC5A 5HGGA 5CHBA 1UTQA 3U8OH 1E38B 5DSFA 3NKKA 1TMBH 1H8DH 4OGYA 5A0BA 3RP2A 3RXPA 2OC1A 3QX5H 1CE5A 1ZRKA 1HAYB 1HAHH 1IQHA 1A3EH 2AFQB 1DOJA 2TGPZ 1LVMA 1C1TA 1C2HA 1B7XB 1DPOA 4ZHMU 1D3PB 3SV8A 3UOUA 2G55A 5C94A 1TGSZ 3Q77A 3ZV9A 3P17H 1VJ9U 2H9HA 1AKSA 1BZXE 1CQQA 4RKJB 3T62A 4A5TS 2UUKB 3AW0A 5L6NH 6ESTA 1GMDG 2VGCC 3ODFA 1DX5M 3E90B 3MMGA 2QA9E 1Z6JH 2W7SA 1THRH 1HBTH 1QHRB 1RJXB 1LPGB 3GCHB 2WZQA 4X6NA 2JH6D 3KL6A 1C1QA 1C9TA 2SGFE 2KX4A 1DITH 1O2QA 4XBBA 4CHAB 1HAGE 1QA7A 4SGAE 6GCHF 2FOGA 1AHTH 3UFAA 1GI1A 2ZDNA 5FPTA 1UCYH 1ANBA 1O2KA 1A46H 1AFQB 1D6WA 1GHVH 1WDIA 3SV2H 2C3SA 2AYWA 3BG4C 4B71A 4FUGA 1C2DA 1P09A 4BAMB 3E3TA 2O9QA 2VIVA 1OWDA 2ZU4A 3FZZA 1SGQE 1J16A 2WYJA 1EB2A 3BSQA 2EA3A 2ZHEH 3S7KB 1TGBA 1RXPA 1V3XA 5HKKD 3GICB 5E8EH 3V7TA 2KCOA 3MO6A 4XE4A 2C8XB 4MDSA 1DY9A 3A89A 4DJZB 2BDAA 3F9EA 3PWBA 1DVAH 3U9AH 4RKOB 2FOFA 1GDUA 2AMDA 1O3GA 1YCPM 5C5OA 1EJAA 1DWCH 3PB1E 3RDZA 4MPVA 3A83A 3A80A 3MH5A 3ODDA 2LP6A 4MPWA 2BVXH 3NWUA 1O2VA 1CSOE 4R8TB 2BDGA 1JBUH 2CF9H 4E7RG 3BEIB 2ZIQH 1V2ST 1O3HA 1VITH 2HNTC 2W6JD 3ZZ8A 1C1RA 3KQCA 1S84A 4JZEH 1BMFD 3S9AA 3QO6A 3WW7A 1JOUB 3BEFB 3LGVA 1LMWB 1B0EA 1SGYE 2PR3A 2FI4E 3P92A 3MWIU 2VU8E 4X2VA 2AS9A 4GSOA 4AB8A 3DD2H 2Y82A 2G4TA 3ATKA 1N8OC 1O3EA 1C5XB 3H5CB 3U8TH 1NT1A 3H7TA 4ISIH 4OS2A 1MTUA 3DSOA 3UQOA 4FETA 1YPMH 3EAJA 4M7GA 1NPMA 1OWJA 2BYAX 3LOXA 4Y76A 1BT7A 2K1QA 1EZSC 5FAHA 2NWNA 3K9XB 2GCTB 4AFUA 1PQ5A 1FUJA 3ZZ3A 1F0TA 3SO3A 4DGJA 2GVFA 2B9LA 1JRSA 3O8BA 2FOBA 1BBRH 2HVXA 1ELEE 2D1JA 2R0KA 1EAUA 2ZU5A 2ZFSA 1G30B 1NBMD 5C20A 4ESTE 1C1UH 5DP5A 1C5YB 1O2TA 2ZNKH 1ZSJA 2ZDLA 3BEUA 2VWOA 1QCPA 1MTNC 4Q2KA 2H5DA 3RMLH 3UREA 2KAIB 1HXEH 4INKA 1N1LA 2STAE 2FX4A 3STIA 1NRPH 4FOUC 2F3CE 3K6YA 5KGOA 1CU1A 1QGFA 2GV7A 3ZVCA 4UFFH 4GPGA 1MD8A 2H9EH 4WJG2 1H8IH 2R2WU 1C5SA 1QRXA 4DURA 3CS0A 2WPDD 4KKDA 1O3LA 3U8RH 1F0SA 3G01A 5BPEA 3TH2H 4NWKA 4K1EA 2ZDKA 3OX7U 1O3MA 1CHOG 1OXGA 2TRMA 1C4U2 1BUIA 2LNCA 4CRAA 1MBMA 1XM1A 3T2NA 3T29A 4WXVA 1GHAG 3VGCC 1W0KD 1GBMA 1PYTD 1K22H 3GY6A 1C1NA 1XUFA 2ZQ1A 1JIRA 3EA7A 3ZZ4A 3EQ0H 5FXLA 2K0QA 2V7QD 4BTUB 1K21H 7GCHF 1ZHPA 4HG6A 2QIQA 1S85A 1P9UA 1GL0E 4CRDA 3EDXB 2BQWB 2XWAA 4R0IA 1BOQA 5DGJA 3CNRA 2BY5X 5EJLA 1PPHE 4IN2A 1S6HA 4TY6A 4Y0YE 1NESE 4UONA 1TMTH 3PM3A 1TNKA 1W13U 3N7DA 1QURH 2WHXA 4THNH 2F9PA 5ESBA 3GY7A 1C5TA 3LIWA 2WUCA 3UIRA 3MO3A 1GHBF 2BD8A 5T1VA 3VB4A 1BIOA 2BLWA 3A82A 3RXTA 4OS4A 1TRYA 5GJ4B 1MMJN 1C2JA 3SNEA 1O2LA 2P94A 1G3BA 1SOTA 1V2WT 4ASUD 1N6YA 1BA8B 1YPGH 5C1YA 1KLIH 2LPRA 3NK8A 5DKMA 5DP9A 1YPKH 2D8WA 1CA0C 1TQ0B 1ELFA 4CR5A 1O2YA 1C2MA 5HM2A 3NZIA 4Y8XA 3OY5U 4F55A 1UVTH 2PLXA 2PP6A 1HUTH 4H6SB 4UFEH 2BZ6H 1IOEA 1DUEA 2R3YA 3KHVA 2SGPE 1O39A 3OTJE 1QB1A 2QY0B 2DUCA 2ZTYA 1DE7H 3F0OA 1Z1IA 1J9CH 1MAYA 1J8AA 1P8VC 1T8NA 2OK5A 1FPCH 3ZZ9A 1C2EA 2FX6A 1Z8RA 1ZSLA 2BY7X 1KTSB 1UW7A 1ORFA 3OTPA 1NRQH 4NSVA 2J98B 2P95A 1W0YH 5I25A 1GI6A 1KMHB 4AGKA 3OY6U 1W10U 2Q6FA 2NU4E 4ZUHA 2G00A 2KCYA 1FLEE 2XTTB 3QN7A 1O5AB 3GDVA 1VCWA 4Z0KA 4B76A 4UFDH 1LVBA 4IS5A 1D3TB 1IHTH 3A81A 2C93B 1PQAA 2F9BH 4E7NA 3BTME 2J34A 1TNLA 1Z8JB 2O8LA 3F2FA 2QV1A 2HRVA 3ZIAD 4AORA 4ZKRU 3ATMA 2QXGA 1FNIA 4MVNA 1AVGH 1H9LB 1T8MA 2BD2A 3P8FA 3KCGH 4ISHH 1KLJH 4OS6A 1ELCA 1A3BH 2PSXA 1ETTH 4AOQA 4E06H 1DANH 1S5SA 2ZWLH 1GCDA 1TRNA 1IQKA 4X8VH 1GJ8B 5FBEA 4HFPB 2EI6A 1ZJDA 2M5TA 3PROA 4ABBA 1M9UA 1N6XA 1JIMA 2VVCA 5EW2H 4AC9A 2JETC 1MCTA 1L1NA 2SGDE 3SV6A 2HGTH 2THFB 3KQEA 3Q76A 1IQIA 1G2LA 3M36A 1BDAA 1CGHA 2QF3A 1E37B 1FXYA 2OQUA 4MNYA 2SGAA 4O03A 2XWBI 5F53A 1OP8A 5DP8A 1V2KT 5LPRA 2AGEX 1HPGA 3LONA 2Z3CA 3NXPA 3URCA 4X8SH 1T32A 1TB6H 2G5NA 3V12A 1TQ7B 3LGYA 6CHAB 3UR9A 2F9UA 1TGTA 1JRTA 5LPEA 4IMZA 1GCTB 4DT4A 5JBAS 1IQMA 3LKWA 1BCUH 1HGTH 1NM6A 3EA9A 1SGDE 2ZFQH 1GHYH 1GJ4H 1QQUA 1LO6A 3VFEA 1GVLA 1SHYA 2VINA 5A0AE 2FTMA 5GIBA 4X1NU 1IQLA 1LKBA 5CDFE 2SGEE 9LPRA 4NFFA 3ELAH 1HAVA 1QR3E 5A8YA 2SGQE 2ZGJA 1BQYA 2WPJS 2HNTF 3T5FH 1OWHA 1SQRA 1K1MA 3RU4T 2IN2A 3TGKE 2CMYA 1UTMA 2C8YB 2TGAA 3L3TA 1LHDH 1WV7H 1GBCA 3FZDA 4TSFD 1FY1A 2Z7FE 4K3JA 1D4PB 4O97A 3BTDE 5EIYA 1EZQA 1O34A 4CRCA 5C67A 2XRCA 3VB3A 1TPSA 1GI3A 3PO1C 3U1JB 2JDID 4U2WA 1G2MA 4DT7B 2AMQA 1O36A 2BX4A 3CS7A 4PROA 1TBQH 3GCTF 1FDPA 2ZFFH 1DLEA 1C2IA 1ZHMA 1O0DH 2FIRH 4LOYH 3RXAA 3U1IB 1ZJKA 4Y10E 4UEHH 4MG3A 1P06A 2YNAA 2XC0A 3FN8A 1O2GH 1W7GH 2Z9LA 1O32A 1RTFB 3DT0H 5EQQA 4ABGA 3TVJB 3EGKH 1GI4A 2KCPA 5LH8A 3RXDA 2HVYB 1LVYA 3FAOA 4K8BA 5G4BA 3M5LA 5FHTA 1O3JA 3URDA 1AVXA 2G51A 1LDTT 2VWLA 2ZFTA 4YLUA 1BTZA 3A7TA 3PYHA 1YGCH 1TOCB 3GY5A 3KYFA 4FVDA 1C4V2 3SOSA 2QYIA 5GCHF 3RXVA 1V2RT 1SQAA 3RXMA 1RIWB 2TPIZ 1ZPBA 5A09A 1LHEH 1TYNA 1THPB 1A2CH 2BY8X 3BG4B 4UE7H 2QF5A 1A7SA 2YMSD 1P57B 1MBQA 3PMBB 1XUHA 3SBKA 3U28C 1LPZB 2A4GA 2PV9B 3RC4A 3PV4A 1MKWK 4Q7ZA 1RD3B 3F3BA 2A31A 1O3IA 2FM2A 1HIAA 1ZGIA 4X1PU 4UD9H 1Z7KA 1OWKA 2PKSB 1P10A 2EEKA 1K1NA 2CGAA 4ISOA 4K1TA 5KECA 1WUNH 2JJ1D 1AUTC 2ZO3H 5EXMA 1ZRBA 1CGIE 5EPNA 1OWEA 1J14A 1EAWA 4KGAA 4ZCNA 1CVWH 1HAVB 2J4IA 1W3CA 4LZ4B 1WAYB 1O30A 1G9IE 2BVSH 3PRBA 1SLVB 5T3HA 3MNXA 2BD3A 1TFXA 3GCOA 1C5VA 3PLKA 4FU9A 1MKXK 4XOJA 2FXRA 1GJDB 1SGPE 1UO6A 4WWYA 1GI0A 3FP7E 1SKYE 2GZ7A 4X6OA 1P2QA 2OINA 2FLBH 2FP7B 3ATWA 1OHHD 2FYRA 3MH6A 1E36B 3OEED 1VGCB 2VBCA 8LPRA 1BITA 3F1SB 2QAAA 1NBME 1F5KU 1EJNA 4K60A 4TWYA 3TLOA 2F43B 2VWNA 3FP6E 1N8OB 2FMJA 4BAQB 3L33A 3LGUA 2SFAA 4YESB 2C90B 2R9PA 5DP6A 1GMCF 4FXGH 2Y6TA 4JZFH 3W94A 2D2DA 1A0LA 1TOMH 1P2IA 1SPJA 2B8OH 3RXUA 1TGCA 1GBFA 3TU7H 4X1SU 2NU1E 1TWXB 2J92A 4DIHH 3GDUA 2ILNA 2ZPQA 5T6GA 1MU6B 2AMPA 3AK5A 1W2KH 1P12E 1GJBB 4TY7A 1LHGH 2WV4A 3MTYA 4DW2U 1FMGA 1AY6H 1INCA 1Y3XA 3S69A 1MTNB 1C5LH 1O3NA 1ANDA 1KXFA 3SZEA 1G37A 2Z9JA 4A1XA 8GCHG 1FY4A 1TAWA 2UUFB 4JMYA 3EYDA 3PLBA 2AIQA 4KTUA 1HJAC 5I46H 4X8UH 2CHAC 2L6OA 1P2OA 3A86A 4X1QU 3A84A 3SUFA 3LJOA 3SU2A 2HLDD 1O2WA 3RXGA 3N99A 1MQ6A 4O3TA 1SFIA 1HIAB 3ZVEA 1EQ9A 1QB6A 1NFUA 1XUIA 5CE1A 1KLTA 2F91A 2OTVA 5JDUB 1TPOA 1ABJH 2ZPSA 4YO9A 5FBIA 3NCLA 3MNBA 2WPHS 5A8XA 4X1RU 4VGCC 2Q6GA 1QBVH 1GI7B 4XRNA 3AAVA 4WF8A 4YXWD 2QXJA 3STJA 3QTOH 2BD7A 3RMNH 1AB9B 1O3PB 1LHCH 1AMHA 1YYY1 3QTVH 3OU0A 1FIWA 2FS8A 4O9VA 1NFXA 2OD3B 2KAIA 3RXCA 4JZDH 1SGFG 1ARBA 1S82A 6LPRA 2XNDD 1U6QA 3D65E 3M3VA 1H9HE 4AB9A 2V35A 2ZQ2A 2ZHQH 3FP8E 3ZZ7A 2FPZA 1P03A 3M5MA 2CF8H 3MNCA 3VXFH 1Y59T 1GBLA 3V3MA 1V2UT 2GZ9A 2R2MB 3M3SA 1Z8IB 1CA0B 3F9HA 1EUFA 2O8UA 5B6OA 1WYKA 5L30H 3ZZ5A 1MAXA 3HGNA 3ZVAA 3O8RA 4NIWA 3H09A 1G3CA 3BTGE 1COWD 1SLWB 3MU1A 5JPMH 1OYQA 5ESTE 2ZGCA 4ASHA 3GYMA 1O5GH 3M3TA 3JZ2B 4AG1A 5C1UA 5ABWA 1A5HA 5C3NA 1L1GA 1MZDA 3TK6A 2BMGB 3GS9A 1EATA 3SJKA 1XX9A 2RCEA 2OBOA 1VITF 4GCHF 4JZIA 2PWXA 2Z9IA 2W3IA 1WU1A 2OC8A 1DXPA 4HGCA 4ZXXH 1QBNA 4SGBE 3OYPA 1EB1H 3UNRA 4FUFA 1UVUH 2CV3A 3K65B 3UQVA 1MD7A 1GHZA 1V2MT 2FOHA 2BLVA 4FU8A 1TNJA 1LCYA 1O2OA 1YLCA 3MQKC 2GMTB 1GG6C 3EE7A 1L4DA 2FOCA 3TNSA 2QXHA 1UMAH 1AIXH 3RXSA 2TBSA 3BTQE 1EPTC 3R0FA 4P00A 4TWWA 5DP4A 5ETXA 1WQVH 2VJ1A 1SG8B 5E2OA 1QJ7B 4TYDA 1K2I1 2ZP0H 4LZ1H 4I33A 1TBZH 3SUDA 1RRKA 1TRMA 4JYVH 4YOIA 3UOPA 5HYOA 4YM9A 2UUJB 3TJUA 1HLTH 1UTPA 3RXQA 4TPYA 1P05A 1W14U 3GY2A 3HPTB 2ANYA 3GY4A 4OS5A 3VB7A 1P2JA 1GL1A 3I29A 2VIOA 2QE7D 3SNDA 2F9OA 5L2YH 2OXSA 1WTHD 2JETB 2Q6DA 3QLPH 3UR6A 1V2LT 2R0LA 5HXFA 5PTPA 4ABFA 2J98A 3C27B 4ACBA 4BTTB 2BD5A 1WOFA 1PPEE 4B2CA 2Y5HA 1Y3WA 4INHA 1OSSA 2JIZD 2EI8A 2ZHWH 4B2BA 1DICA 3LH1A 2BQ7B 3T27A 3P6ZB 2PUXB 1HAPH 4JZ1A 1SL3A 3P70B 2Z94A 1A61H 2H5CA 2QXIA 1RFNA 1ACBE 4WXIA 4O3UA 2YMSB 2ZFRH 1W0ZU 1QIXB 1FONA 1TPAE 3M35A 5E0HA 1B0FA 1AUJA 3IITA 1L4ZA 2IJOB 3FVFB 1FAKH 1RTLA 2VH6A 2I6SA 1KY9A 1ZOMA 4ZAEA 1FIZA 5LGOA 2BQ6B 4DOQA 1CHGA 1GI2A 1MQ5A 4RT1A 1C5MD 1OPHB 1VR1H 1GVZA 2P3TB 4BAOB 5K7RA 4WMFA 1JWTA 1H9IE 5HM9A 4TT3D 1KDQA 1XKAC 2ZGXH 2GCHF 2BDBA 4NA7A 4I8KA 2EY4C 4DCDA 1UCYE 4IW4E 2VIDA 2FDAA 1OX1A 1HB0B 2QN5T 1GGDB 3GDSA 3RUOA 1ZTKA 4FUCA 5GNDA 4YT6H 3LDXH 4F49A 3A7VA 4X2YA 5LPFA 3ZZCA 1SVPA 4ISLA 5F03A 2OLGA 3EA8A 1MKWH 3HKJB 4AG2A 1UJ1A 1Y5BT 4B2AA 1ZHRA 4RI0A 1GWAA 1WQSA 1GI8B 2BXUH 2ZU1A 1SMFE 2GT8A 2FO9A 1BMMH 4FUBA 4Y79A 2A7CA 5EU8A 1XKBC 1S81A 1ESAA 1YLDA 3SORA 2ZZUH 1EAXA 1SHHB 3KQBA 5EXNA 3QGNB 2XCFA 5TJXA 2WPMS 5DPAA 2BD9A 4NSYA 1ELAA 2BOHB 3QWCH 1S0RA 1EZXC 1MKXH 2EQNA 1NO9H 2XOKD 3NUMA 3RXFA 3T28A 5EPYA 1TX6A 5E0GA 4KELA 1HRTH 2BD4A 2HALA 2W6ID 2GT7A 1P02A 3E6PH 1XVOA 4K1SA 4YOGA 5HMAA 3UNQA 4BANB 1ANCA 2GP9B 1ID5H 1TX8A 2GD4B 3MI4A 1ELDE 1KXAA 2UUYA 1E79D 1O5CB 2FODA 2YOLA 1DSTA 1CT4E 1XUKA 1A5IA 1V2JT 2KZ4A 1P3EA 4WH8A 4XD7D 1LQDB 1O2HA 1V2VT 1Q31A 5TCAA 1DLKB 1ESBA 2M2AA 3PRDA 1Y3UA 1GBTA 3LGTA 1UTKA 4RSPA 2O8TA 2G8TA 1O2JA 1O5FH 1S83A 3NRLA 4D76A 3RU4D 3S7HB 3PMHB 1C2LA 4I32A 4CH8B 2XW9A 1GHWH 2SNWA 1O3CA 1GMHG 2GCTC 2XC4A 1WTGH 4IMQA 4I8HA 2ZEBA 4Y71A 4AZ2B 4GLYA 2OQ5A 1HFDA 3JZ1B 1D9IA 1YKTA 1BBRE 1EOJA 2XBVA 5JBTA 1QZ8A 1CBWC 1C1MA 1C2FA 5EJ1A 1ZSKA 2CN0H 1PPGE 1O2UA 2JH0D 4KTSA 1KDQB 3MOCA 1OP2A 3UY9A 1P04A 1O31A 1SR5C 1BMLA 1K1IA 1P0SH 2IPHA 3QZQA 3SU5A 4BTIB 5JYIA 5C17A 2QF4A 1DXWA 1HV7A 1UVPA 1SFQB 2J9NA 4KTCA 4AX9H 2BY6X 1ZLRA 1LHFH 4A7IB 4AFQA 4DVAU 1NROH 1KIGH 2Y7XA 3ZV8A 3SW2B 3QK1A 1Y5AT 3E16B 1E1QD 4F4OC 1TLDA 2Y81A 2ESTE 3A8DA 5CHAC 2K8IA 3P8NA 1DY8A 1G3EA 2RDEA 2A4RA 1C4Y2 1IQGA 1C1VH 1TABE 1SB1H 3T25A 1BRBE 3F6UH 1XMNB 1AWHB 1NU9A 3Q3XA 5T6FA 4B1TA 1QA0A 4ACAA 4B6FA 4ZHLU 4ISNA 2PKAA 2ZU2A 3GY3A 4WY3A 2H9TH 5DP3A 8GCHF 5DO4H 3A87A 1DWBH 2FOEA 1DWEH 2BX3A 3SI3H 1HXFH 4I31A 3KQDA 4OS7A 1C5UA 1E0FD 3F2GA 3P8OA 1S0QA 1YPEH 1KYNA 1W7XH 4U32A 3DA9B 1WXRA 1YC0A 2WV5A 1HJAB 1OOKB 2WYGA 2ZA5A 1GMDF 3GOVB 2CHAB 1YLNA 3PTBA 3SGBE 4ZMAH 1UTNA 3RLWH 4K8YA 3SQEE 3GY8A 1AVWA 4I8GA 4B75A 4ZKNU 1L0ZA 3BTKE 4XBCA 1TMUH 4BXSA 1MUEB 2P3FH 2EC9H 2GJGA 2HWLB 4UDWH 1VJAU 3MU0A 2VGCB 7LPRA 8KME2 2ZECA 1JMOH 5DP7A 3DFLA 3ZVDA 3MFJA 3M7TA 4DG4A 2J5UA 1IHSH 4FUDA 2KCAA 1O33A 3TGIE 3ZZBA 3SV7A 1HDTH 5DG6A 4DY7B 1EPTA 1P11E 1C5ZB 3SNCA 1GBIA 4AFSA 1O2PA 4H6TA 2OC7A 1Y3VA 1LQEA 3SU0A 2A4OA 1EKBB 4DIIH 1YY3A 1IQJA 3MO9A 5H4IB 1THSH 4WVPE 3UUZA 2Z3DA 5JB9S 1UK4A 1C5PA 1YPJH 2BZAA 3H7OA 3PMAB 1IAUA 2XBYA 3W1EA 1Z1JA 2W3KA 2B5TB 1CA8B 2AGIX 2OP9A 3SZNA 1FQ3A 1IQNA 1VZQH 1F5LA 4A1VA 3VG8A 4XFQA 5F8ZA 1NU7B 1SGFA 3QZRA 4JCNA 2ZPRA 5EODA 2FI3E 3TIUA 1HJ9A 2JKHA 2L74A 3RXLA 5GDSH 4MLFB 3LH3A 4NWLA 5AHGH 3K2UA 3UTUH 3FOAA 3TJOA 1Z71A 2FTLE 1ZZZA 4MPXA 4YTAA 1TPPA 1UTJA 3F9GA 3SYJA 1EX3A 1C5QA 4NZLA 4A6LA 2NU2E 3UNSA 5E2PA 2YNBA 1Z6EA 1ANEA 1SOZA 4CBOA 1KTTB 1BRAA 2OUAA 4IBLH 5EGMA 1HCGA 1BHXB 2ZDVH 3FFGA 2PKAB 1BMNH 4ZKOU 1BTPA 1W11U 1HAIH 2GX4A 2ODYB 2DE9A 2ANMH 1DFPA 1C1WH 3LT3A 4MTBA 4NG9H 2RG3A 1BTUA 2ZG0H 2PW8H 2A32A 1EP6A 3I77A 1NFWA 5EQRA 1L1JA 4X2XA 2A7HA 2XBWA 4D9RA 1YP9A 3M61U 1F0UA 4IGDA 1AD8H 5EG4A 5A2MH 4YZUA 1AQ7A 3BTTE 3SNAA 2ANKH 3BTEE 3VB6A 2G52A 2GV6A 5TCCA 4FUEA 2TIOA 4OM9A 3E0NB 2QF0A 1PPFE 2PTNA 2CK3D 9ESTA 1K28D 3BIUH 1VCQA 2H6MA 1LTOA 1GG6B 1C2GA 3OEHD 3NPSA 1BTXA 4FUIA 3LU9B 3ZYEA 1O2IA 1A4WH 3S9CA 1OKXA 2ZCHP 1EPTB 1H1BA 4B6EA 4XBDA 4I7YH 3TJNA 4JYTA 2UWLA 3KYGA 4LK4A 4Q80A 3BG8A 3UPEA 4AFZA 1T31A 1TIOA 2WPLS 2Z3EA 1JXPA 1GCTC 3ATIA 3RMOH 5EJZA 1HAZB 3IWMA 1ZMNA 4MQAA 4Z6AH 2WUBA 2P8OC 4B73A 2C8ZB 1QFKH 1UK2A 5JBBS 2VIPA 5C1XA 1BJVA 3MYWA 2J95A 1CO7E 2ZKSA 3AAUA 2HNTE 2FZZA 1MABB 5AVDA 1TONA 2WV9A 5DN6D 3SU4A 1CHOF 1Y8TA 1QL7A 1T4UH 4BOHA 3CP7A 1GHAF 2XCNA 1XUJA 4UFGH 5FL7D 1DM4B 1BTHH 1MTVA 1GBAA 1ESTA 1KSNA 2AGGX 1GHXH 3A85A 3AVZA 3SGQE 1AN1E 1SQOA 3OSYA 3VGCB 1O3BA 3VXEH 3TNTA 3RXEA 3OE7D 2FESH 3N7EA 3ENSB 3SN8A 4B74A 3Q3KA 3WY8A 3DFJA 3D62A 1TA6A 1T7CA 1GBJA 3PV5A 1NN6A 2B0FA 4X6MA 2PGQB 2QGRA 3GCTG 3LGWA 3HK3B 1O2RA 4GHTA 1FN8A 2PTCE 1PQ8A 3Q3YA 1H4WA 1T8LA 3TH4H 1UVOA 4XDEA 2ALVA 2RDLA 3KF2A 1EAIA 1K1OA 4WMDA 4NA9H 4K5ZA 3UWJH 5C5NA 4Q63A 1LVOA 2WSSD 2WPKS 1DWDH 3BN9A 3MH4A 2G4UA 3GCNA 4NCYA 2G5VA 1UHBA 1PQ7A 2ZHFH 1P2NA 2IJD1 1FX0B 5FX5A 2KFWA 1TNGA 3F0PA 1SLXB 3W95A 2VVVA 4HZHA 2XXLA 4BNRA 1RIWC 4H42U 1TA2A 3E0PB 3F9FA 3P8GA 3PLPA 1GVKB 3QUMP 3BF6H 4YT7H 5HIYA 3ESTA 3B8JA 3DSGA 5GCHG 3BIVH 3MH7A 1D6RA 1SLUB 1BTWA 3SU6A 3HGPA 4OS1A 3DSPA 2PGBB 4FU7A 5A8ZA 2GDEH 2PKSC 2AERH 2ZF0H 2ALPA 3R3GB 3SJ8A 1ZTJA 2XBXA 2FYQA 1BJUA 3MU8A 3BTWE 2FOMB 1YCPK 5EW1H 3SUGA 3ZYDA 1SQTA 1G32B 2HLCA 2A7JA 3PWCA 1C9PA 4I8LA 1SGEE 1C1PA 1FY5A 2ODQA 3PV2A 4ZH8A 2O8MA 3SI4H 3SU3A 8ESTE 4ABAA 1O5DH 3K6ZA 3A88A 3RXHA 1PYTC 2VIWA 1AE5A 3M5OA 5JBCS 2Y7ZA 3RU4E 1QJ6B 4P02A 2FLRH 4Y6DA 3SV9A 1QJ1B 1NRSH 1O3DA 3HK6B 2GTBA 4NZQA 3ITIA 3T26A 4BAKB 1AKSB 1O2ZA 1FAXA 5C2ZA 1VGCC 2W7UA 2J97A 4IC6A 1IQEA 1KXEA 1EZUC 3MU5A 3S9BA 1T4VH 5GPIB 1FI8A 1H8HD 2B7DH 3O8DA 1J17T 1GMHF 2A2XH 3E8LA 1WCZA 2BDYA 2STBE 1AWFH 1GBEA 2PUQH 2BDHA 4HTCH 5DK1A 1YBWA 4HI3A 5EXLA 1QY6A 2V0BA 4MNWA 2FI5E 1K1JA 1AZZA 1GJ6A 1P2KA 2BY9X 3MU4A 3TK5A 5JB8S 3IG6B 1W0JD 2Z9KA 2ANWA 1GMCG 3OAAD 4D7FA 1QRZA 1AGJA 1CBWB 4Y7BA 1ELVA 1SGNE 2HPPH 1UHBB 2PHBA 3RMMH 2J38A 2QC2A 4F48B 1ZR0A 1BB0B 1NRRH 1O3OA 2J2UA 3SHCH 5E0JA 3GYLB 3MNSA 3RXJA 1TE0A 7KMEH 1O5EH 1HYLA 1S6LA 2NU3E 3RC5A 3U69H 5KEDA 3KEEA 3SQHE 3HATH 1OS8A 4Y8ZA 2P59A 4OGXA 4CRFA 5CHAB 3LJJA 1GDQA 1C5WB 3KNXA 1PPCE 3MHWU 1A1RA 4ABHA 1ABIH 3UAIC 1V2NT 1HJ8A 2H1UA 2A0QB 2BM2A 3B9FH 3A7WA 3ATLA 3OFND 3RC6A 1P3CA 3TPIZ 5J4SA 2FWWA 3GCHC 2P3UB 1XUGA 1GDNA 1XXFA 2QCYA 2F9NA 4NGAH 3E91A 3ZVBA 3DCLA 1ZPZA 2AIPA 5BRRE 4FVBA 2PFEA 1MTSA 3HKIB 3KIDU 1DT2A 2F9VA 2P93A 2ZCKP 5F8XA 4CHAC 4RT0A 4CRBA 4J1YA 3VPKA 5IK2D 1AB9C 1UK3A 3SUEA 1SBWA 3PO1B 4X2WA 1O2XA 1O5BB 4U01A 4X0WU 1FN6A 3VB5A 1O2SA 1AFQC 3E1XB 6GCHG 2BLQA 5FX6A 2XNIA 1NS3A 4U30A 1K9OE 3DUXH 1Q2WA 1C5OH 1TALA 2ZC9H 4KP0A 1A0JA 3SJ9A 2GDDA 2BHGA 3SU1A 3CENA 2ASUB 3D23A 1AFEH 1OYTH 1UTOA 3ZZ6A 2O8WA 2PSYA 2ZU3A 1FY8E 2BB4A 1K1LA 4X6PA 4BXWA 1ZGVA 4J2YB 2SNVA 3LGIA 5DJ7A 2JJ2D 4CRGA 4JK5A 2D26C 5FCKA 4YLQH 3ZVFA 2TGDA 2ZGHA 3FKSD 1UTLM 1NZQH 3TITA 4GHQA 3RLYH 4CH2B 3RXOA 1HAXB 3UB0A 1C5RA 3M7UA 2A4QA 1SGCA 2BOKA 2HOBA 1UCYK 4Y11E 1FZZA 1C2KA 1YPLH 1BRCE 2A45B 2V3HH 2RA3A 2VH0A 1AE8H 1Q3XA 1KXCA 4NIYA 3VEQB 1GBKA 1RGQA 3WWFA 1HNEE 4WMEA 3F2HA 1V2TT 2H2ZA 1VITG 4GCHG 3I78A 3SJIA 1SGIB 1QL9A 2ZDAH 2W5EA 1O38A 2ZTZA 3KQ5A 1ELTA 3L6PA 1C1SA 3ZZDA 4Y8YA 1PFXC 1KXBA 2GMTC 4MNXA 1QTFA 5GWZA 1J15A 4MNVA 4XSKU 1E1RD 1LPKB 4CREA 1O3AA 2IPQX 2AH4X 2A5KA 3F68H 4AGJA 4FUHA 5IYTA 1GJ9B 1O3KA 1MU8B 1MCVA 3RXBA 1OWIA 3GISB 1FPHH 1WBGB 3KN2A 1PPZA 1CT2E 1Y3YA 2EI7A 3O8CA 1NFYA 1CT0E 1EJMA 2V6NA 3M5NA 5IDKA 1LKAA 1W8BH 1X7AC 3D49H 5FPSA 4GAWA 1RTKA 4YOJA 3RXKA 1TGNA 2KR7A 4QT8C 1A0HB 3SHAH 2F83A 3DHKH 2NU0E 1EXFA 3LPRA 3UWIA 2UWPA 3V0XA 1KXDA 4K69A 2A5AA 1YPHE 5L2ZH 1BHXF 2GZ8A 5B6LA 1AZ8A 4WH6A 1IQFA 4RN6A 1V6DA 2ULLA 4Q7YA 5EOKA 1QB9A 1NRNH 5SGAE 2RFKC 4Y0ZE 3EE0B 1K0HA 2VIQA 3U98H 2OCVB 1QNJA 5F8TA 3M7QA 3AW1A 1A5GH 2VVUA 2P16A 3FANA 3M37A 1F2SE 5T6DA 1BBRK 4IN1A 5AF9H 2YMSC 1YWUA 4D7GA 3PMJA 2C4FH 1G3DA 2P8OB 1GBBA 2FS9A 2JH5D 2RA0A 3A8BA 1Z8GA 2J94A 1TBRH 3C1KA 7GCHG 5GXPA 3BTFE 1NTPA 1D3QB 4D8NA 2KM0A 2WPIS 3SJOA 5C0TA 4ABJA 5CMXH 7ESTE 2A2QH 1WSSH 3A7XA 1QQ4A 3Q00A 1YF4A 1EASA 1DSUA 1E35B 4ABIA 2Q1JA 1SSXA 2ZHDA 3AASA 2DE8A 2AEIH 2G81E 1F5RA 3S0NA 2Y5FA 5A0CA 3SGAE 1MH0A 1DS2E 3RXRA 4AYYB 1GHBG 4X8TH 1GPZA 3A8CA 5FCRA 1GJ7B 1F7ZA 1SGTA 1GJCB 1EFRD 2ZGBH 4VGCB 1F0RA 2GCHG 1D3DB 1ZMLA 1GGDC 4CBNA 5J4QA 1VKYA 4Y7AA 2Y80A 1NY22 1E34B 4GUXA 3WWBA 3A7YA 1GBHA 2GKVE 3N7OA 1QBOA 3RM2H 4ZXYH 2TGTA 4M9FA 2ZI2H 1SGRE 1K1PA 1S6FA 1GJ5H 2OBQA 4H4FA 1YM0A 4D9QA 1MTWA 1EP5A 3QGJA 1DUAA 1O37A 1BTYA 4MPUA 2ZCLP 2XC5A 4I86A 2WINI 1CGJE 1ZTLA 3TJVA 1YCPH 2LELA 4NIVA 1XXDA 4A92A 1NC6A 1ETSH 4Q7XA 1V2QT 1RS0A 2BDCA 2A1DB 3RM0H 5F6MA 3V13A 1MZAA 1UVSH 2AHME 1O3FA 1FY3A 1EOLA 2ODPA 1DDJA 1TX7A 2Z9GA 3FO8D 3A8AA 5AFYH 2V3OH 1AI8H 1P2MA 3KGPA 2C8WB 1AU8A 4ZROA 1T8OA 2BDIA 2Y5GA 4JK6A 2CJIA 5K0HA 1ETRH 4Z1MD 4FUJA 1W12U 2XYAA 4ZHAA 2ZDMA 3LC3A 1YPHC 5AFZH 4NFEA 3RXIA 2V3MA 1C1OA 3PTNA 1V2OT 1TNHA 3TH3H 1QRWA 1P01A 4CR9A 4AN7A 1O2NA 1GI5A 2GGVB 3QDZB 1GI9B 1ZMJA 2CXVA 2FOAA 2HPQH 5FPYA 4NA8A 1ARCA 1O35A 4A1TA 3A7ZA 2W26A 1ZYOA 1TNIA 4LXBH 1BMAA 4BAHB 2VB0A 1PJPA 2BXTH 2FEQH 4INLA 1G36A 2OC0A 1AO5A 2R3UA 1OP0A 1GJAB 5C0UA 1XVMA 3ZZAA 1VCPA 4I8JA 3B23B 2ZFPH 3BTHE 4GVUA 1B5GH 1GBDA 2BVRH 4K2YA 1PPBH 4ABEA 2IOTA 1QL8A 4AYVB 1F92A 4TPIZ 1FV9A 1ZPCA 1L2EA 2A5IA 4ZKSU 1O2MA 2BTCE 4NIXA 2UWOA 2BLOA 2I6QA 2VWMA 3LC5A 1P9SA 1ELGA 2F4LA 4JYUH 4E05H 5HIZA 1H8ED 1Y5UT 1ELBA 3P95A 1C5NH 1V2PT 3TK9A 1SI5H 6CHAC 5EQSA 1BRUP 4ABDA 2Z6BD 2ZTXA 3ZVGA 2VNTA 1HAOH 3SNBA 3TGJE 3BV9B 1FJSA
chains in the Genus database with same CATH topology
1SC8U 4IC5A 5HGGA 1UTQA 3U8OH 1E38B 3NKKA 1TMBH 1H8DH 4OGYA 5A0BA 3RP2A 3RXPA 2OC1A 3QX5H 1CE5A 1ZRKA 1HAYB 1HAHH 1IQHA 1A3EH 2AFQB 1DOJA 2TGPZ 1LVMA 1C1TA 1C2HA 1B7XB 1DPOA 4ZHMU 1D3PB 3SV8A 3UOUA 2G55A 1TGSZ 3Q77A 3ZV9A 3P17H 1VJ9U 2H9HA 1AKSA 1BZXE 1CQQA 4RKJB 3T62A 4A5TS 2UUKB 3AW0A 5L6NH 6ESTA 1GMDG 2VGCC 3ODFA 1DX5M 3E90B 3MMGA 2QA9E 1Z6JH 2W7SA 1THRH 1HBTH 1QHRB 1RJXB 1LPGB 3GCHB 4X6NA 2JH6D 3KL6A 1C1QA 1C9TA 2SGFE 1DITH 1O2QA 4XBBA 4CHAB 1HAGE 1QA7A 4SGAE 6GCHF 2FOGA 1AHTH 3UFAA 1GI1A 2ZDNA 5FPTA 1UCYH 1ANBA 1O2KA 1A46H 1AFQB 1D6WA 1GHVH 3SV2H 2C3SA 2AYWA 3BG4C 4B71A 4FUGA 1C2DA 1P09A 4BAMB 3E3TA 2O9QA 2VIVA 1OWDA 2ZU4A 3FZZA 1SGQE 1J16A 2WYJA 1EB2A 3BSQA 2EA3A 2ZHEH 3S7KB 1TGBA 1RXPA 1V3XA 3GICB 5E8EH 3V7TA 3MO6A 4XE4A 2C8XB 4MDSA 1DY9A 3A89A 4DJZB 2BDAA 3F9EA 3PWBA 1DVAH 3U9AH 4RKOB 2FOFA 1GDUA 2AMDA 1O3GA 1YCPM 5C5OA 1EJAA 1DWCH 3PB1E 3RDZA 4MPVA 3A83A 3A80A 3MH5A 3ODDA 4MPWA 2BVXH 3NWUA 1O2VA 1CSOE 4R8TB 2BDGA 1JBUH 2CF9H 4E7RG 3BEIB 2ZIQH 1V2ST 1O3HA 1VITH 2HNTC 3ZZ8A 1C1RA 3KQCA 1S84A 4JZEH 3S9AA 3QO6A 1JOUB 3BEFB 3LGVA 1LMWB 1B0EA 1SGYE 2PR3A 2FI4E 3P92A 3MWIU 2VU8E 4X2VA 2AS9A 4GSOA 4AB8A 3DD2H 2Y82A 2G4TA 3ATKA 1N8OC 1O3EA 1C5XB 3H5CB 3U8TH 1NT1A 3H7TA 4ISIH 4OS2A 1MTUA 3UQOA 1YPMH 3EAJA 4M7GA 1NPMA 1OWJA 2BYAX 3LOXA 4Y76A 1BT7A 2K1QA 1EZSC 5FAHA 2NWNA 3K9XB 2GCTB 4AFUA 1PQ5A 1FUJA 3ZZ3A 1F0TA 3SO3A 4DGJA 2GVFA 2B9LA 1JRSA 3O8BA 2FOBA 1BBRH 2HVXA 1ELEE 2D1JA 2R0KA 1EAUA 2ZU5A 2ZFSA 1G30B 5C20A 4ESTE 1C1UH 5DP5A 1C5YB 1O2TA 2ZNKH 1ZSJA 2ZDLA 3BEUA 2VWOA 1QCPA 1MTNC 4Q2KA 2H5DA 3RMLH 3UREA 2KAIB 1HXEH 4INKA 1N1LA 2STAE 2FX4A 3STIA 1NRPH 2F3CE 3K6YA 1CU1A 1QGFA 2GV7A 3ZVCA 4UFFH 4GPGA 1MD8A 2H9EH 4WJG2 1H8IH 2R2WU 1C5SA 1QRXA 4DURA 3CS0A 4KKDA 1O3LA 3U8RH 1F0SA 3G01A 5BPEA 3TH2H 4NWKA 4K1EA 2ZDKA 3OX7U 1O3MA 1CHOG 1OXGA 2TRMA 1C4U2 1BUIA 2LNCA 4CRAA 1MBMA 1XM1A 3T2NA 3T29A 4WXVA 1GHAG 3VGCC 1GBMA 1PYTD 1K22H 3GY6A 1C1NA 1XUFA 2ZQ1A 1JIRA 3EA7A 3ZZ4A 3EQ0H 5FXLA 4BTUB 1K21H 7GCHF 1ZHPA 2QIQA 1S85A 1P9UA 1GL0E 4CRDA 3EDXB 2BQWB 2XWAA 4R0IA 1BOQA 5DGJA 2BY5X 1PPHE 4IN2A 1S6HA 4TY6A 4Y0YE 1NESE 4UONA 1TMTH 3PM3A 1TNKA 1W13U 1QURH 4THNH 2F9PA 5ESBA 3GY7A 1C5TA 3LIWA 2WUCA 3UIRA 3MO3A 1GHBF 2BD8A 3VB4A 1BIOA 2BLWA 3A82A 3RXTA 4OS4A 1TRYA 5GJ4B 1MMJN 1C2JA 3SNEA 1O2LA 2P94A 1G3BA 1SOTA 1V2WT 1N6YA 1BA8B 1YPGH 5C1YA 1KLIH 2LPRA 3NK8A 5DKMA 5DP9A 1YPKH 2D8WA 1CA0C 1TQ0B 1ELFA 4CR5A 1O2YA 1C2MA 5HM2A 3NZIA 4Y8XA 3OY5U 1UVTH 2PLXA 1HUTH 4H6SB 4UFEH 2BZ6H 1IOEA 1DUEA 2R3YA 3KHVA 2SGPE 1O39A 3OTJE 1QB1A 2QY0B 2DUCA 2ZTYA 1DE7H 1Z1IA 1J9CH 1MAYA 1J8AA 1P8VC 1T8NA 1FPCH 3ZZ9A 1C2EA 2FX6A 1Z8RA 1ZSLA 2BY7X 1KTSB 4NSVA 1ORFA 1NRQH 2P95A 1W0YH 5I25A 1GI6A 4AGKA 3OY6U 1W10U 2Q6FA 2NU4E 4ZUHA 2G00A 1FLEE 2XTTB 3QN7A 1O5AB 3GDVA 1VCWA 4Z0KA 4B76A 4UFDH 1LVBA 4IS5A 1D3TB 1IHTH 3A81A 2C93B 1PQAA 2F9BH 4E7NA 3BTME 2J34A 1TNLA 1Z8JB 2O8LA 2QV1A 2HRVA 4AORA 4ZKRU 3ATMA 2QXGA 1FNIA 4MVNA 1AVGH 1H9LB 1T8MA 2BD2A 3P8FA 3KCGH 4ISHH 1KLJH 4OS6A 1ELCA 1A3BH 2PSXA 1ETTH 4AOQA 4E06H 1DANH 1S5SA 2ZWLH 1GCDA 1TRNA 1IQKA 4X8VH 1GJ8B 5FBEA 4HFPB 2EI6A 1ZJDA 2M5TA 3PROA 4ABBA 1M9UA 1N6XA 1JIMA 2VVCA 5EW2H 2JETC 1MCTA 1L1NA 2SGDE 3SV6A 2HGTH 2THFB 3KQEA 3Q76A 1IQIA 1G2LA 3M36A 1BDAA 1CGHA 2QF3A 1E37B 1FXYA 2OQUA 4MNYA 2SGAA 4O03A 2XWBI 1OP8A 5DP8A 1V2KT 5LPRA 2AGEX 1HPGA 3LONA 2Z3CA 3NXPA 3URCA 4X8SH 1T32A 1TB6H 2G5NA 3V12A 1TQ7B 3LGYA 6CHAB 3UR9A 2F9UA 1TGTA 1JRTA 5LPEA 4IMZA 1GCTB 5JBAS 1IQMA 3LKWA 1BCUH 1HGTH 1NM6A 3EA9A 1SGDE 2ZFQH 1GHYH 1GJ4H 1QQUA 1LO6A 3VFEA 1GVLA 1SHYA 2VINA 5A0AE 2FTMA 5GIBA 4X1NU 1IQLA 1LKBA 2SGEE 9LPRA 4NFFA 3ELAH 1HAVA 1QR3E 5A8YA 2SGQE 2ZGJA 1BQYA 2WPJS 2HNTF 3T5FH 1OWHA 1K1MA 3RU4T 2IN2A 3TGKE 2CMYA 1UTMA 2C8YB 2TGAA 3L3TA 1LHDH 1WV7H 1GBCA 3FZDA 1FY1A 2Z7FE 4K3JA 1D4PB 4O97A 3BTDE 1EZQA 1O34A 4CRCA 5C67A 2XRCA 3VB3A 1TPSA 1GI3A 3PO1C 3U1JB 4U2WA 1G2MA 4DT7B 2AMQA 1O36A 2BX4A 3CS7A 4PROA 1TBQH 3GCTF 1FDPA 2ZFFH 1DLEA 1C2IA 1ZHMA 1O0DH 2FIRH 4LOYH 3RXAA 3U1IB 1ZJKA 4Y10E 4UEHH 4MG3A 1P06A 2YNAA 2XC0A 1O2GH 1W7GH 2Z9LA 1O32A 1RTFB 3DT0H 5EQQA 4ABGA 3TVJB 3EGKH 1GI4A 5LH8A 3RXDA 1LVYA 3FAOA 4K8BA 5G4BA 3M5LA 5FHTA 1O3JA 3URDA 1AVXA 2G51A 1LDTT 2VWLA 2ZFTA 4YLUA 1BTZA 3A7TA 3PYHA 1YGCH 1TOCB 3GY5A 4FVDA 1C4V2 3SOSA 2QYIA 5GCHF 3RXVA 1V2RT 1SQAA 3RXMA 1RIWB 2TPIZ 1ZPBA 5A09A 1LHEH 1TYNA 1THPB 1A2CH 2BY8X 3BG4B 4UE7H 1A7SA 1P57B 1MBQA 3PMBB 1XUHA 3SBKA 1LPZB 2A4GA 2PV9B 3RC4A 3PV4A 1MKWK 4Q7ZA 1RD3B 2A31A 1O3IA 2FM2A 1HIAA 1ZGIA 4X1PU 4UD9H 1Z7KA 1OWKA 2PKSB 1P10A 2EEKA 1K1NA 2CGAA 4ISOA 4K1TA 1WUNH 5EXMA 1AUTC 2ZO3H 1ZRBA 1CGIE 5EPNA 1OWEA 1J14A 1EAWA 4KGAA 1CVWH 1HAVB 2J4IA 1W3CA 4LZ4B 1WAYB 1O30A 1G9IE 2BVSH 1SLVB 5T3HA 3MNXA 2BD3A 1TFXA 3GCOA 1C5VA 3PLKA 4FU9A 1MKXK 4XOJA 2FXRA 1GJDB 1SGPE 1UO6A 4WWYA 1GI0A 3FP7E 2GZ7A 4X6OA 1P2QA 2OINA 2FLBH 2FP7B 3ATWA 2FYRA 3MH6A 1E36B 1VGCB 8LPRA 1BITA 3F1SB 2QAAA 1F5KU 1EJNA 4K60A 4TWYA 3TLOA 2VWNA 3FP6E 1N8OB 2FMJA 4BAQB 3L33A 3LGUA 2SFAA 4YESB 2C90B 2R9PA 5DP6A 1GMCF 4FXGH 2Y6TA 4JZFH 3W94A 2D2DA 1A0LA 1TOMH 1P2IA 1SPJA 2B8OH 3RXUA 1TGCA 1GBFA 3TU7H 4X1SU 2NU1E 1TWXB 2J92A 4DIHH 3GDUA 2ILNA 2ZPQA 5T6GA 1MU6B 2AMPA 1W2KH 1P12E 1GJBB 4TY7A 1LHGH 2WV4A 3MTYA 4DW2U 1FMGA 1AY6H 1INCA 1Y3XA 3S69A 1MTNB 1C5LH 1O3NA 1ANDA 1KXFA 1G37A 2Z9JA 4A1XA 8GCHG 1FY4A 1TAWA 2UUFB 4JMYA 3EYDA 3PLBA 2AIQA 4KTUA 1HJAC 5I46H 4X8UH 2CHAC 1P2OA 3A86A 4X1QU 3A84A 3SUFA 3LJOA 3SU2A 1O2WA 3RXGA 1MQ6A 4O3TA 1SFIA 1HIAB 3ZVEA 1EQ9A 1QB6A 1NFUA 1XUIA 5CE1A 1KLTA 2F91A 2OTVA 5JDUB 1TPOA 1ABJH 2ZPSA 4YO9A 5FBIA 3NCLA 3MNBA 2WPHS 5A8XA 4X1RU 4VGCC 2Q6GA 1QBVH 1GI7B 3AAVA 4WF8A 2QXJA 3STJA 3QTOH 2BD7A 3RMNH 1AB9B 1O3PB 1LHCH 1AMHA 1YYY1 3QTVH 3OU0A 1FIWA 2FS8A 4O9VA 1NFXA 2OD3B 2KAIA 3RXCA 4JZDH 1SGFG 1ARBA 1S82A 6LPRA 1U6QA 3D65E 3M3VA 1H9HE 4AB9A 2V35A 2ZQ2A 2ZHQH 3FP8E 3ZZ7A 2FPZA 1P03A 3M5MA 2CF8H 3MNCA 3VXFH 1Y59T 1GBLA 3V3MA 1V2UT 2GZ9A 2R2MB 3M3SA 1Z8IB 1CA0B 3F9HA 1EUFA 2O8UA 5B6OA 1WYKA 5L30H 3ZZ5A 1MAXA 3HGNA 3ZVAA 3O8RA 4NIWA 1G3CA 3BTGE 1SLWB 3MU1A 5JPMH 1OYQA 5ESTE 2ZGCA 4ASHA 3GYMA 1O5GH 3M3TA 3JZ2B 4AG1A 5C1UA 5ABWA 1A5HA 5C3NA 1L1GA 1MZDA 3TK6A 2BMGB 1EATA 3SJKA 1XX9A 2RCEA 2OBOA 1VITF 4GCHF 4JZIA 2PWXA 2Z9IA 2W3IA 1WU1A 2OC8A 1DXPA 4HGCA 4ZXXH 1QBNA 4SGBE 3OYPA 1EB1H 3UNRA 4FUFA 1UVUH 2CV3A 3K65B 3UQVA 1MD7A 1GHZA 1V2MT 2FOHA 2BLVA 4FU8A 1TNJA 1LCYA 1O2OA 1YLCA 2GMTB 1GG6C 1L4DA 2FOCA 3TNSA 2QXHA 1UMAH 1AIXH 3RXSA 2TBSA 3BTQE 1EPTC 3R0FA 4TWWA 5DP4A 5ETXA 1WQVH 2VJ1A 1SG8B 5E2OA 1QJ7B 4TYDA 1K2I1 2ZP0H 4LZ1H 4I33A 1TBZH 3SUDA 1RRKA 1TRMA 4JYVH 4YOIA 3UOPA 5HYOA 4YM9A 2UUJB 3TJUA 1HLTH 1UTPA 3RXQA 4TPYA 1P05A 1W14U 3GY2A 3HPTB 2ANYA 3GY4A 4OS5A 3VB7A 1P2JA 1GL1A 3I29A 2VIOA 3SNDA 5L2YH 2F9OA 2OXSA 1WTHD 2JETB 2Q6DA 3QLPH 3UR6A 1V2LT 2R0LA 5HXFA 5PTPA 4ABFA 3C27B 4BTTB 2BD5A 1WOFA 1PPEE 4B2CA 2Y5HA 1Y3WA 4INHA 1OSSA 2EI8A 2ZHWH 4B2BA 1DICA 3LH1A 2BQ7B 3T27A 3P6ZB 2PUXB 1HAPH 4JZ1A 1SL3A 3P70B 2Z94A 1A61H 2H5CA 2QXIA 1RFNA 1ACBE 4WXIA 4O3UA 2ZFRH 1W0ZU 1QIXB 1FONA 1TPAE 3M35A 5E0HA 1B0FA 1AUJA 3IITA 1L4ZA 2IJOB 3FVFB 1FAKH 1RTLA 2VH6A 2I6SA 1KY9A 1ZOMA 4ZAEA 1FIZA 5LGOA 2BQ6B 4DOQA 1CHGA 1GI2A 1MQ5A 1C5MD 1OPHB 1VR1H 1GVZA 2P3TB 4BAOB 5K7RA 4WMFA 1JWTA 1H9IE 5HM9A 1KDQA 1XKAC 2ZGXH 2GCHF 2BDBA 4NA7A 4I8KA 4DCDA 1UCYE 4IW4E 2VIDA 2FDAA 1OX1A 1HB0B 2QN5T 1GGDB 3GDSA 3RUOA 1ZTKA 4FUCA 4YT6H 3LDXH 4F49A 3A7VA 4X2YA 5LPFA 3ZZCA 1SVPA 4ISLA 5F03A 2OLGA 3EA8A 1MKWH 3HKJB 4AG2A 1UJ1A 1Y5BT 4B2AA 1ZHRA 1GWAA 1WQSA 1GI8B 2BXUH 2ZU1A 1SMFE 2GT8A 2FO9A 1BMMH 4FUBA 4Y79A 2A7CA 5EU8A 1XKBC 1S81A 1ESAA 1YLDA 3SORA 2ZZUH 1EAXA 1SHHB 3KQBA 5EXNA 3QGNB 2XCFA 5TJXA 2WPMS 5DPAA 2BD9A 4NSYA 1ELAA 2BOHB 3QWCH 1S0RA 1EZXC 1MKXH 1NO9H 3NUMA 3RXFA 3T28A 5EPYA 1TX6A 5E0GA 4KELA 1HRTH 2BD4A 2HALA 2GT7A 1P02A 3E6PH 1XVOA 4K1SA 4YOGA 5HMAA 3UNQA 4BANB 1ANCA