1KLUD

Crystal structure of hla-dr1/tpi(23-37) complexed with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
239
structure length
230
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Minor structural changes in a mutated human melanoma antigen correspond to dramatically enhanced stimulation of a CD4+ tumor-infiltrating lymphocyte line.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/toxin
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR ALPHA CHAIN
total genus 67
structure length 230
sequence length 239
ec nomenclature
pdb deposition date 2001-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1kluD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1kluD02
1AW7A 1F77A 3BZDB 1BXTA 2O2LD 1PTOB 5FK9C 4RGMA 1SE3A 3BYYB 5I4DA 1S5DD 1SXTA 3GP7A 1LTRD 1QILA 1S5ED 1LLRD 1V1PB 1KLGD 2XRSD 1FNWA 1BCPF 3DWQA 3R8BA 5TSSA 3BYTB 2WV6D 4NZLB 3TSSA 1CT1D 1RF2D 1I4XA 1PTOC 1JWSD 1SJED 1LT4D 1YN3A 1PYWD 1LTSD 1SBBB 1RDPD 1L0YB 2AQ2B 1XXGA 4TSSA 5ELDA 5FKAC 1DYQA 1FD7D 1I4GA 1ET9A 1S5BD 4L63B 1TS3A 1JR0D 1FGBD 1PRTB 1TS2A 4C56C 2Z8LA 1I4HA 2ICIA 1SE4A 2XNAC 1JWMD 1PRTD 4RH6A 4RFBA 1UUPA 1ENFA 3DWAA 1B1ZA 1B44D 1CHQD 1FNVA 2J4XA 2R61A 2CHBD 3R2IA 1S5CD 1ESFA 1KLUD 1RCVD 2AQ1B 1PRTC 2XN9C 2XRQD 3MFGA 4ZYSA 2AQ3B 1RD9D 2TSSA 1EEFD 4DXGA 1TY0A 4OHJA 1YN4A 1SEBD 1TY2A 2IJ0A 1EU3A 4RHSA 1SE2A 3BVMA 1LTID 4RGOS 5ELBA 1PTOF 1LTAD 4UDUC 5ELCA 1V1OA 1ET6A 1LT5D 1T5XD 3EFXD 1BCPC 1GOZA 4DXFA 3EA6A 1PZID 2SEBD 4RGTA 1EFID 1CHPD 1I4RA 1JWUD 4RCOA 1AN8A 1CQVA 1YN5A 1HA5A 1STEA 3URYA 1PZJD 5D3IB 1HXYD 1CK1A 4K6LA 4RHRA 5ELFA 1D5ZC 5ELEA 1G8ZD 1LTBD 1LT3D 1DJRD 1LT6D 4BWGB 1V1PA 2NTTA 3KLSX 3SEBA 3W2DA 4L6TB 1JCKB 1JQYD 3V05A 1I4PA 1L0XB 4Z9CB 1SJHD 1HQRD 1PRTF 2IPKD 3MC0B 3CHBD 1BCPD 1MD2D 2QILA 1D6EC 1TS4A 5D3DA 1LTGD 3BVZA 4O1NA 3R2TA 1TS5A 2QEJC 1BCPB 1PZKD 2RDGA 4RGNA 1XTCD 1LTTD 1D5XC 1UNSA 2RDHA 1HTLD 1FNUA 1KTKA 1PTOH 1EEID 2NTSA 1LO5D 1D5MC 3DWPA 3O13A 3OWEB 1I4QA 1S5FD 1EU4A 3BVGA 1PTOD 2G9HD 1EWCA 1M4VA
chains in the Genus database with same CATH superfamily
2QGQA 5IGBA 1O80A 1BXTA 3HOXH 1EM7A 2O2LD 2NZHA 4K3CA 1J5EQ 4G0NB 1M8AA 1CKMA 1DGSA 3A8KE 3S24A 4ZAIA 5I6YA 5JEAG 2UU9Q 1G6JA 3MVVA 1Q3LA 5HFYA 2UUBQ 4LF7L 1QQRA 1IBXB 3RLOA 3FILB 1WJJA 3STBC 4YCVA 4FF4A 3K81C 5C23A 4WQOB 3LXFA 1KRSA 4C2MH 1QVGA 3HOZG 5K36H 1CT1D 3DUZA 4LFAQ 1UD7A 1VR9A 1VQ9A 2EYFA 5IYDH 4LDTD 5DLQE 3GTQH 3DVNU 1XMQL 3C46A 3DBHB 1RDPD 4UY8C 2WDTB 3QA8A 1EL0A 4RMAA 3E3XA 1PH5A 4ANWA 4M8NA 1KAWA 2D2CC 1S5BD 1VQLA 4YSYB 5JHAA 2ZTEA 1D8LA 1T9HA 1KNEA 2R93G 3ZNZB 3TL5A 3NS8A 4XYCA 4DXAB 3GZNB 4B3TQ 1YNND 2AEHA 3DVGY 4LUVA 1HPCA 5M3MG 3MEHA 1Z6HA 1UE1A 5E6NA 3CF6E 4DWFA 3KBGA 3MA2B 4ANVA 1YHQA 3J81i 4APVA 1J19A 4LUOA 4YTNB 3RZWC 2LHEA 1DONA 3UQAA 2C9WB 2F0TA 3VQIA 3IXSA 4NJCA 4ABNA 3OWFA 4ZYSA 4LF6L 4A3IH 5G3LD 1N63A 1G51A 1IYFA 1X56A 3PO0A 3CPWA 5D14A 4LLGM 3A8IE 5C1ZA 3MXUA 2EMTA 3QWNA 1J0GA 2C5CA 3AFPA 4RHSA 1K0SA 1N8RC 3GS2A 3AE4B 4A8XC 1F2LA 1ICWA 4FNFA 1V5OA 3HOXB 2ZJQA 3D6CA 1HTOA 2GOWA 4GLSC 4LJPB 1ET6A 3N20C 1E2ZA 4LFBL 2OCEA 5IN7A 5IP7H 2ATWA 3T56B 3CU7A 1FEHA 1LTLA 4I6LB 4A3BB 1UBIA 4IFDG 1SNCA 3N1YC 1CKNB 1CZGA 3FVQA 3PHXB 2VZAA 5IGCA 1RFAA 3OHXC 4KK7A 3EQLC 3KOJA 2F52A 2JZPA 3AEVA 2BE5C 1AN8A 3ZNID 2OQ0A 1R4PB 4X3SA 3S1RB 2F4IA 1UE7A 3F2BA 4K7WA 1S3SG 5IP9G 2KWUB 2NN6H 2NVYH 4OZCA 4XT1B 4EZKA 3CC4A 2QW7A 4FVMA 3NP8A 2JSVX 3AXCA 1R4MB 2W55A 3MHSD 1VZ6A 2M0AA 2KJHB 1DJRD 3KUDB 4XT3B 3T53B 4A9AA 3KWLA 1WCMG 4CKBA 1J7CA 4ACFA 3K8AA 3PTFC 4DFAA 4XDXA 4DR4L 2B63G 2LXJA 1E90A 2H1EA 2L12A 3ZLZA 3Q8BA 1TIID 1HNZQ 2DENB 4O0AA 1L6VA 3PO3G 4A3GH 1XLOA 2K14A 2V3SA 4QMGA 4C3HH 1SGHA 5D3DA 4JI7Q 2K5WA 4FJVB 4IQZA 4ZRIA 2LS01 3I9V1 1LTTD 1D5XC 2VQFQ 1PFNA 3H91A 4H7BA 1LO5D 1SROA 4B3RQ 1G291 4JBKA 1KHIA 2R92G 2ZW1A 3ETRA 1EU4A 1PGAA 3LDZE 5BMHA 1PXUA 3KJOA 2BKFA 4IFDJ 2GLSA 4I6NB 1F1HA 1BUIC 4CDCC 3S17B 4X6AH 2Q2HA 3VDZA 5I2YA 1E1TA 2JWUA 2LI5A 4KZ0A 5CTRC 4RWSC 2EQSA 1E8YA 3DEOA 4KKTA 4XYQA 2G4DB 1Q8KA 2FUHB 4DNRB 5JEAH 3NS1A 2K5PA 4LDTB 3H0GG 3ZNHB 1W6KA 3BJUA 4NXMQ 1KH0A 4PYZA 1P16A 1P0RA 1PH4A 4GDLA 1VQ5A 5IWAL 2NVTB 1XXGA 5ELDA 3GTOH 2F0IA 5A2QL 2N9LA 2RPQA 2B3AA 2CS4A 4P6VF 2HHHQ 1J7BA 2INDC 4X64L 4JW0A 4A3CH 4A3DH 2X69A 4QY7A 1PLFA 1PRTD 1FR3A 1QOAA 3Q14C 1HZ5A 1EZ8A 4B0MA 5DM63 4M01A 1C4CA 2K5VA 3DVGX 3IFWB 4KKSA 3X23A 2ID0A 2F0KA 1TWAH 1U0LA 4C3IB 3GTMH 4A3DG 2JZZA 3W5UB 1B9NA 3QHTA 3VYSA 3MXNA 3KF6A 4CQNA 1Q7YC 4LNQA 2KMCA 2QHOA 3PO2G 3SVMA 2KOXA 4P7IA 3KF6B 2BH2A 3D0FA 4BY7B 4P75A 4QQBX 1XNRQ 1Q12A 2VS1A 4NPNA 2JRHA 1LTID 2Q2UA 3B6YA 3HOYB 1RKNA 2K3UA 5T1GA 4LF8Q 3GE8C 1FXAA 2ZPYA 1I50B 2Q8IB 2IW3A 4EQPA 2ICEC 2BKRB 2BYTA 4DUZL 2B8GA 4HRSA 1FMAD 4RGTA 3QOJA 1AARA 4EEWA 4EZJA 1VQ8A 1SSOA 2F0LA 4KJNA 3H15A 2JPHA 3MC9A 3LWUA 1EIHA 4ZHPA 3P20A 5EBCA 2K03A 3EIVA 1UE5A 4H2AA 1HFNA 3ZXVA 3AU5A 4IZ8A 5ELFA 4AYBB 2GBJA 4OO1H 1RM6C 4PT5A 1EY0A 1GC7A 2DJGC 1WXVA 1VQHA 1FJGL 4K1RB 1YJJA 2EPBA 4FF1A 1JWAD 5C5MA 5JH5C 2JA7G 2NVYB 5C44G 4DPGA 3TBLD 3UIOB 2MGSA 2O2VA 1L0XB 2OF1A 1C1YB 3P7JA 2ON8A 3MTSA 2AYOB 2IYDB 1PMRA 2F0SA 1KFYB 4RF1A 4G11A 5AJ3Q 2O2VB 4RNAA 3HM6X 1WGRA 4CO7A 3V61A 4LTUA 1K50A 2QEJC 1BCPB 1PZKD 2RDGA 5M3FB 5GADC 2L55A 1I6HH 4N59A 3SXHA 2MBQA 4XC2A 1F9QA 2KEEA 4QB4A 1FNUA 4WWPA 1JB3A 1NI3A 3I3TB 1QE6A 2WXIA 4KKUA 4C3HG 2JYEA 2HQLA 1TBEA 3I3CA 1XJVA 2G9HD 1VZ8A 3FAHA 1IL8A 1M4VA 3EFXD 2INNE 1IBKL 1SNDA 2UXBL 4AH6A 4KDIC 2QJLA 3MJWA 2KQ3A 3VFKA 4W9DA 3D4RA 1VD2A 1QILA 2JYTA 4JI2Q 4DR6Q 3EFUA 1IKLA 2J52A 4HMIA 4GDKA 1YVCA 3DWQA 2K0PA 2KXJA 2OJRA 3E9IA 2NN6G 3U9SA 2NPTA 2DAJA 3V96A 1W2BA 1TIFA 4DUZQ 3NRZA 3PUXA 2YEPF 4JWUC 1LV9A 1L0VB 1YN3A 2EXDA 3AB9A 4E3CA 2EYJA 4JI3Q 4A3EH 3RNBC 4OELB 5AZGA 3I4MH 1KABA 1MSGA 1STHA 1TWFB 4LF8L 3A1QA 5KRUA 3IT4B 1FGBD 3U58A 5IA7A 3SR1A 2W82A 2BBCA 1F52A 1QNKA 4O42A 3U9OA 2INCC 5C4JH 3Q24A 1XTDA 4IPCA 4B3SL 1WWTA 2K9XA 1YMHE 1ICFB 2V1CC 5J17A 2QKIC 3S1RH 5C3XA 2PPHA 1B1ZA 4YWLA 4NXNQ 4IM3A 2LD9A 4P71A 1S5CD 5C3EH 3CCJA 1A70A 1OFFA 2G1EA 3VYUA 3B08A 2RBMA 3RN2A 4KD3A 2XN9C 5BR8L 2C35B 3Q8DA 2X6LA 3E0EA 3NJTA 1ASZA 4MGKE 2ZTDA 1X3FA 3PF5A 1GG3A 2EYLA 1TY2A 2E2JB 2MPMA 3UE1A 1YITA 1VQBA 3RN5A 3ABVB 2L00B 3H3VH 1SYDA 5IODA 4GKJQ 4ZRPA 2RF4A 3PO2H 2V4IB 3SDZA 2R7ZH 1NMFA 1QJOA 5DNFA 4BBRB 2J53A 2JXTA 2IL8A 1YEZA 5FLMG 4DK0A 4MM3A 1FL0A 2ZJPA 3CCVA 3WCQA 2B2TA 2XTIA 2KWVB 3H8HA 2KOLA 3KWVA 4HKQA 1PDQA 3KF8B 3L0OA 2K8CA 2UU9L 3H0GH 1I4RA 1E9MA 3IT6B 3RUIB 1VQPA 1V97A 2A68C 2J7ZA 2WLBA 1R4NI 4MH0E 1GB4A 2G5DA 4HXDA 2FXQA 5FJ8H 1QCBD 2TMPA 3NENA 4X64Q 2KKCA 1D5ZC 1LTBD 2MFIA 2D2QA 2Y5PA 4R4IA 2KLCA 3I8ZA 5EJWA 4K8JA 2KJ6A 4M0WB 4DQOC 3T9LA 5FR6A 1SJHD 3UDFA 3TUOA 3DHGC 2O6VD 2WAQE 2D3GA 3ZDMC 1HTQA 4HLEA 2ZW0A 3BY4B 2D10A 1VMCA 1WZ3A 2L05A 2KN5A 2YTVA 1CZPA 4IPDA 1BQQT 2QILA 2I5HA 1N32L 1MPEA 2ASQA 3AI5A 4IUMB 1SYFA 5DPTA 3DWMA 5IIFA 2WXFA 2F0GA 3HOUH 1N6ZA 2ZTCA 1XMOL 3U2SC 3V05A 3I2ZA 1PTOH 1F9SA 1DOKA 4NQKE 4YY3Q 1JWBD 4K81A 2GB1A 1VQAA 5L95C 5KHQA 2MBOA 2FHTA 4C4VB 2OWOA 3DHHC 1TT5B 3EUB2 4ITKA 2KD0A 1WE7A 4CYEA 4G4KA 2ES2A 1TWGH 4OEMB 4RGMA 3TZDA 2GMIC 4A93B 2L0FA 3OMGA 1B70B 4C4VA 1GPXA 4DV0Q 1SXTA 1ZGUB 2KHWB 4X65Q 1G2SA 4DV2L 5D7GA 4LWCA 3GTLB 3L4PA 1JE4A 4MSQB 4TKNA 3W1GA 1XPUA 1QB5D 2D11A 1X3PA 1B2TA 2UUAL 1SIFA 3DWGC 1OXXK 1Y8PB 2K33A 2VQEL 1AZQA 4CDEC 2WXHA 2UUAQ 1DOIA 2QSDA 2RCFA 1SMYD 2PMVA 2N1WA 1PYWD 2EY1A 4X3UA 4XGAB 3ZW3A 1HH2P 1SYCA 2PW7A 1TVXA 2UUCL 3ECIA 2RA4A 1B8AA 3KDFA 4FXKC 1YI2A 3GTKB 4ZLTF 2JSOA 3K7AH 1CSQA 1JR0D 3NHEB 2JUOA 1TS2A 1LM8B 3HKZG 1N34L 2P5ZX 1M94A 2QF7A 3J80L 4S3SA 4X3KA 1ZUD2 2KC1A 4B95A 1R7SA 4ZKCB 5IE8A 4PG3A 1B44D 1VF7A 3N30A 1NYRA 2HIVA 1KLUD 2AQ1B 2PW9A 2YV5A 4KSLC 4HTHA 4PV1C 5LNK1 3HIZA 2LUEA 4E74A 1WTPA 4AWJA 1PV4A 1F2RC 5CHFA 2EJFC 3QJYA 4BA1I 1I94Q 2L0TA 1EY9A 3E56A 2XGTA 1C7YA 1T0YA 2B29A 2A74C 3CW2C 3MP9A 2QMTA 2IO3B 3I72A 5DPWA 1BNZA 3K5MA 2WB1G 2E2IB 1ZDVA 2E5LQ 1V1OA 2XWJB 4A3EB 4W9HA 4GGQA 5E6OA 1L4ZB 4WJNA 1GOZA 2B2VC 5A2QE 5DM73 2K6QA 1N36L 2VW9A 4ZRQA 2LZ6A 3QARA 1KDBA 3L3OC 1PZID 3DEPA 2SEBD 3DM1A 1EY7A 3RMHA 1BMLC 1WX8A 1WYWB 3DHIC 3H9DA 1AP0A 3S9WA 4QUCA 2KHSA 3RR5A 1Y1VH 3S1MH 4HVBA 2Q2TA 4W9JA 3J7YW 2Y0SB 4IM0A 5DPRA 1IBXA 1F9JA 3NQIA 2KACA 4RM9A 5IYDG 5C44H 4JI6Q 4K8IA 3W1YA 1UZXB 2K01A 1B53A 4B9XA 4A3JB 4IC7B 1UELA 1OXTA 1E3PA 2VL6A 4A3LG 4HCPB 1YX5B 2N55A 1OTRB 2BWFA 3PHWB 2PQEA 3C0RB 1PFBA 3IBEA 4JGHB 2E5LL 3A5UA 2R2QA 3RZDH 1D6EC 1EQTA 5LL6X 5IP4D 2BYVE 4MJSA 4YXDB 5JZEB 4JI6L 1KJTA 1ZEQX 2MJEA 4RGNA 1G6PA 4MTKA 4MJSB 1A3UA 5HG2A 4W9CA 2N7JA 3CMEA 4G7HC 5IP9H 3AEBB 5CV6A 1YIWA 1WGKA 4ASWC 2M17A 2A69D 4A3PA 4LMQD 3CMMB 1QG7A 2PW5A 1IXRA 1N60A 2GBNA 3HK0A 1I7HA 1T6BX 1L4DB 2C7NB 1PH2A 1PTOB 4NAMA 2Z6KC 1SE3A 3CQZH 1H9MA 2PJHA 4I7ZC 4A3FG 3WAMA 3KUZA 1DOMA 2F4VQ 3T1YQ 2NVXH 3RMKC 2L9HA 1PYBA 1V1QA 1EYDA 2A19A 3HP3A 4N8FA 3HS0C 1WTHA 3OYYA 4UPAA 3K6OA 1GKHA 3W1SA 3BYTB 2A68D 5T8IA 3LWEA 4A3GG 3DOWA 1RWSA 1KAAA 5LMUQ 5IY0A 1MJCA 2ZM6Q 4IN3A 3CQZB 4YIJA 4DV3Q 4KHPQ 1EWYC 4PS8A 5EE0A 1LTSD 2FFKB 1DYQA 2CWAA 1HTPA 2F0UA 3IRBA 1CFMA 1I50H 1WM3A 2X8XX 5FO7B 5CHVC 2SNMA 1GXDC 3SU8X 5AJ3L 4ALPA 3JAMc 1PFSA 3UDGA 1SN8A 4A3KG 2LXAA 2MA9B 3NHHA 2JYOA 4YHHL 2MQJA 4KX6B 1JB7A 5IYBH 4MEMA 4ICVA 1SYBA 2EVBA 4CKEA 3VRBB 4XWTA 3S14H 3QR8A 5JAVA 1F2RI 2PKOA 4N8X1 3T3NA 2FCMA 4G7ZC 2FBWB 2L15A 1S1QB 3A9KA 2NUCA 4TQUS 1SMXA 2TSSA 4QGUA 1XEEA 5MPOA 1U4RA 2K1FA 2EJMA 2G3QB 2BS3B 3KYHC 1YN4A 4DR4Q 3T1HL 1NBWA 3R7RA 5C4XB 2BA1A 3OLMD 4DV0L 3B2GA 1N9WA 4DV1Q 1FJGQ 2CW0C 3K7UC 1MG4A 4NY0A 2NS5A 2N1VA 3VR3A 1XT9B 4DN4M 1DCZA 1P1AA 2WP9B 5C4JB 4M00A 2ZJRA 1N33Q 2LMCA 2RD0A 2PQAA 4FLHA 4BY1G 4DHZE 3V6EB 3TMPB 1BBUA 3DBRI 5C2TB 2HTME 1CQVA 2SNSA 1DOLA 1X3QA 5J22A 4LF4L 1WGGA 2MUYA 4X3TA 3NVYA 1Q1EA 1IP9A 2NB0A 1Q0WB 3GDEA 4LFCQ 2HT1A 3EBEA 1XYIA 3JVZX 3TCAA 1EOVA 4TUUA 3V6CB 3VR8B 1KL9A 1G8ZD 3AE2B 3B0AA 2R93H 2WS3B 4JI1L 3FILA 3HOZB 1UF0A 2KO3A 3B1LX 1YX6B 4JG2A 5JXVA 5ELNA 1VJKA 1RODA 2Q8RE 1ENCA 2DYBA 1HQRD 2IX1A 2CQOA 3A1QB 1PH1A 3CHBD 3UDXA 4DAPA 1MD2D 3HOZH 2BDNA 2EIFA 4KIKB 2PZWA 1EIGA 1HZ6A 2R93B 2HDLA 1LTGD 2L7RA 1NAPA 3JC66 3Q22A 3GTGB 2PE9A 4XXEA 2OOBB 4PZ6A 2EYPA 1ZOYB 2ZVOA 2CCZA 3PT2B 2N9XA 4N9F4 3J7ZC 2BE5D 2NTSA 4PNYA 3CCRA 1WTQA 3H6MA 2DZKA 2K8HA 4YWKA 1PTOD 3Q3JA 2G45B 2F0VA 4MN3A 4A4IA 4IUQA 5J3BA 4DF7A 3BS1A 3TEXA 3MTNB 3QOLA 3NTKA 1TU2B 5C0XJ 4KHVA 2M19A 1PH7A 4HJGE 4BOZB 4PMWA 3GB1A 3S16B 3A7AB 3HOXG 4GXBA 3R8BA 1Y1WG 2WXKA 2RSUA 1AH9A 4K6DA 2ZNVC 1X9NA 1I4XA 4DAMA 4DKAC 2DYMA 4O2DA 4A3BG 1LT4D 4FF2A 4HKZE 5AEKB 1U4LA 1CJEA 1I6HB 1K8RB 4PMCA 1VQGA 4JPBW 1A0IA 4R4CA 1A62A 3T51B 3ER0A 3IL8A 4C3JH 1P98A 2HUGA 2LRUA 1PRTB 4KHZA 2H5XA 2KDBA 5E4XA 2PZUA 1NENB 3HHMA 1HEZE 2Y5CA 3AM9A 5BYRA 1FIQA 2K22A 1H95A 1E7PB 1UUPA 5IYCH 1ACCA 4GU2A 5BN5A 3DWAA 2J4XA 4TQ1A 3CPFA 2CHBD 1AE2A 3N1ZC 2JY6A 3VTVA 3GTPB 2DZJA 1C9OA 1HFGA 2VUMG 4CHTB 4GKKL 1SEBD 1U4MA 2IJ0A 2DNFA 3PO3B 4L1BA 3BVMA 4A3MH 1WX7A 3AECB 3CWIA 5IO9A 4DR6L 3SK8A 3A33B 1P3QU 4JIOU 4HN7A 3PIO3 1YJWA 5CYUA 4MDKE 3M4OB 2VUMH 5NUCA 3EFCA 5HHDG 4PZ8A 2K5DA 2EYOA 1A5RA 2R6GA 4GNXC 4DXFA 4JI0Q 3IAS1 5BYQA 5E3FA 3N32A 3NELA 1IBKQ 3W3AA 2M2LA 3I73A 3H1UA 1HA6A 2KECA 3ZJUA 2E6XA 2UWQA 1A8VA 1HA5A 1L1OB 3P4QB 4NAWA 2I2YA 4J6IA 5D3IB 2EKIA 1QOFA 3AH7A 1R4MI 5CMDA 2YLMA 2PI2A 2WXJA 3JAML 1WTOA 2EOTA 4GDKB 2BS2B 2D0OA 5EE9A 3S2HB 5ELEA 1S72A 4GSWA 1NR2A 4DK5A 3S1NB 3CP0A 1NCVA 1LT6D 2UXDQ 3H0GB 2BS4B 1CSPA 1GVPA 4C1NK 4OWTB 5KYIA 1JQYD 4EFOA 1H9SA 2PNRC 4Z9CB 1C78A 4W9KA 3P4RB 2KQSA 1AWDA 4BBRH 4CGYB 3K5OA 5L83A 2LFIA 1M1KC 2WX1A 1KC8C 3MC0B 1G2TA 1HE8A 1BCPD 2BA0A 4J1MA 2E2HB 2DAFA 4N9PA 1ILQA 3K5NA 1HR0L 4HWIB 2O5JC 3EVQA 1K8OA 3I4OA 1VQDA 1TWAB 3A54A 4C3IH 1MHWC 1SE8A 5C4HA 1HNXL 4A6QA 1C79A 3BDLA 2WXQA 1ZXTA 3WA0A 1HZ9A 2KZRA 2KAJA 1GD7A 5FLXc 3QC8B 3OOCA 1IHZA 4WJOA 3ZGZA 4ICUA 1J6QA 1MIUA 3HGBA 1WMHB 2BB6A 3A9JA 1EWCA 2ZXRA 4C3IG 4A3DB 4GZYC 2AL3A 3AEDB 4L2YA 5M9OA 1WMHA 3A9JB 1K53A 3LGJA 3BYYB 4FYDA 1S5DD 1QF6A 2AWOA 2I38A 4DGZA 1YJ1A 2B76B 2KANA 4N58A 3HOYG 4DK3C 1K28A 1BCPF 3O65B 1PH8A 5TSSA 3QAQA 4ME3A 4KLKA 4AOFA 3NSWA 2B3GA 5EDSA 4RKBA 4WFN3 1A2TA 2WP8J 4GKJL 2KHJA 2UYZB 1TXYA 4JI8Q 1JWSD 1VQKA 2F03A 2W9NA 3SFEB 4BBNF 4II3B 3P75A 4X66L 4C80A 1XLNA 2LHDA 3IAM1 1ZDXA 1WIAA 1GAQB 3HZXA 4LCDE 1ET9A 2QCZA 2WU5B 5AUIA 4IJHA 2UXCL 1GUTA 3VR4A 4X57B 2MBEA 1QZHA 4KSKC 3HKSA 4ARCA 1PYSB 2A73B 1PDXA 1YHBA 1B3AA 1OEYA 2BOSA 2CU3A 1C77A 3T8MA 4RM8A 2PNHA 1L0WA 1JOQA 2IBIB 3VR5A 3NBIA 1X32A 2M1MA 3S1QH 4HIOA 3D3RA 1VCBA 4BZAA 1UE6A 5IWAQ 1WR1A 4C00A 5IYCG 1RD9D 2N8NA 3WAPA 2M9VA 3ZTCA 3ULPA 3A0JA 1B3QA 3FKYA 4WORA 2E3TA 4JBJA 4K5VA 3L9AX 3PV1A 2MJ8A 3H09A 4RGOS 3U7DA 2RDBC 4GLXA 3S1QB 3L08A 3G6EA 1ZYRC 3U30A 4R9WA 1SF0A 5M3FG 1MSHA 4CHKA 4MT5A 3H6NA 1PGBA 1E7VA 1Z5SB 4KN4C 5K36G 4A93H 1JMCA 3HRDD 1NTGA 2OTJA 1E0BA 4P16A 4IOIE 1SLJA 3ZUNA 2XSCA 4AQYL 2KT7A 1Q82C 2D0PA 2WXRA 3B2FA 4RA8A 3ONSA 3J7A5 3DBHI 1JW9D 2A8VA 3H3VC 5I6WA 3U4VA 4OVVA 2RR9A 1CK1A 2GA4B 2K05A 3IVFA 2MQHA 2WXOA 4G3XB 1VCIA 1HUNA 3VUYA 1MKHA 4IO9A 3D4WA 1JE5A 2FCNA 3GZNI 5EKLA 2DZIA 1LT3D 4GLAC 1A63A 4BWGB 2IWHA 1JORA 3I57A 2DGYA 3I7FA 4L6TB 2C7HA 3DDCB 3I4NB 2E2DC 3FHWA 4NMZA 1PA6A 4XDCA 3KUCB 2KC2A 2CVRA 3A7LA 3HUIA 3T3OA 2QDFA 3VR9B 3PLVA 3P2BA 1O7IA 1PQSA 4A76A 1WTVA 3PZ8A 1TKEA 4FJYA 4FJZA 2D9UA 1KQSA 1P7EA 1C76A 3FPPA 3JAME 4B0EA 2OJWA 3UGBB 4IG7B 2PIAA 3WDNA 2MBBB 2MJDA 2KCCA 4C3JG 3CCMA 2BDOA 1S5FD 2CH4A 1QVFA 2B2WA 2GI9A 3HVZA 1O7YA 1RTNA 2VRRB 1AW7A 4R1JA 4HPLB 1F77A 3R7QA 4G57A 4IFDI 1L5PA 2F0FA 2MBHA 3GE3C 2O6VA 3WAOA 2CW0D 3ZQ4A 2F0WA 2UXBQ 4GMVA 2MO1A 3DQVA 5ELOA 2AL6A 1OTCA 5I4DA 4MGYE 5KGUA 3RNFC 3M85A 2B63H 5E1FA 5CHWA 1U5KA 4DAYB 1LLRD 1V1PB 3ND9A 4YWMA 1JICA 4L5RC 3J80c 3BIID 2F4VL 1MBYA 2VB2X 5CV8A 1ILPA 1WJUA 2K6AA 4JC0A 2L0CA 3V62A 2NWGA 3K59A 2XK5A 2WIIB 1FO4A 2RCNA 1XMQQ 4KD4A 2JA9A 3PGZA 1FGUA 4QL5A 4ULLA 3AEFB 4ZHOA 3RFZB 3C2PA 2NBUA 3TMEA 4LNFA 3QWZB 4BKSD 4L63B 3KF8A 1X54A 1UEAB 1X65A 3TN2A 1B4OA 1I4HA 1WTWA 3U50C 1LM0A 2LASA 2LUMA 2L1BA 1WSPA 5IT9L 1SE4A 2XNAC 3T13A 2J0KA 3PLUA 2Y5BB 2IO2B 1TWFH 4DHZB 3L17A 4IM2A 2R61A 3A56A 4TV3A 5EBDA 3VYRA 3NWTA 2X38A 2LRWA 4KDLB 1IYJB 2M00A 4GDLB 2KMMA 3Q6SA 4PS3A 1SNMA 1KIXA 1XNQL 1V80A 1SNOA 3PSEB 4KIKA 1QOGA 2EY2A 2EYMA 3CCLA 4YTMB 2ZXOA 5G2NA 2IY5B 1N5WA 4LF7Q 4HDQA 2N88A 4NDXA 1E2WA 1OO9B 3W5OA 1IKMA 3I4MB 1TQOA 1L1OC 1TGZB 1PFMA 2N78A 4GOPA 3RD4A 4X66Q 2DLBA 3APFA 5JJLA 4GOPB 1KDCA 4A3CG 3D31A 1WZ0A 1SNPA 5C0XI 1M90C 3DCGA 5IYBG 1R4NB 2ACZB 3VTUA 1JWUD 1ZKHA 3MXNB 4LF4Q 1NVID 3LB8C 4F88A 3KLSA 5FR3A 3EGRA 5CORA 3VHTC 1L2FA 4A93G 1RLFA 2LWPA 3ITPA 1YQ4B 3F8TA 1HXYD 1P7FA 2XVSA 1KRHA 3RNEC 1WX9A 1MGSA 4RHRA 2HE7A 2WAQG 2RVLA 4MM3B 4YCWA 4FDBA 4NXML 3FC4A 3Q0AA 4WWMA 3CXCA 1W6JA 2EE1A 1MI0A 3CC7A 3L16A 3HRZC 3K9OB 4ZUIA 2Q2IA 1FPYA 2WNMA 1JCKB 1I5FA 2NBVB 1VQMA 1E8ZA 3OG5A 3U52E 2WX0A 1SDFA 1E0ZA 1PRTF 3MXGA 5M5WH 2QA4A 3PQIA 1K73C 1XO3A 2PEAA 4XDDA 3CCUA 1OQRA 1RFKA 4BBSH 2M56B 2ZCBA 5JOBA 2K5HA 2MCNB 4NPSA 5DEHA 3RLNA 5GXGB 1T5EA 4XQJA 2R92H 3PIP3 2KVZA 4KKJA 3BVZA 2JP1A 1HRJA 5D94A 1XLPA 1U9RA 3BZCA 3Q3FA 2FIDA 4ZOHC 3NK9A 4LUZA 4BKSA 4JI1Q 1C9FA 1HTLD 1KTKA 1EEID 3OWEB 3PVLA 4FA6A 4FHJA 4NNJB 3G48A 1SE9A 1C4QA 2CHZA 3BZDB 4JBMA 2HCIA 4LK1C 1WXMA 4BKGA 2AUJD 4XZ4A 2D5GA 1X1MA 3ZDTA 5I9OA 1IUEA 3UF8A 2MHJA 3J80E 1HR0W 1X3EA 4DNIA 3CCQA 2RDFA 2IO1B 4NJ6A 1TKYA 4DV2Q 2KDEB 4DDID 2B39A 3KUPA 1WI0A 2WB1B 4LFBQ 2WXGA 3K9PB 5KNDA 1Q1BA 3PZ7A 4K2LA 5M5XB 3NWSA 2SAKA 2CJNA 2MJ3A 4HPPA 5EAYA 4MIUA 2K25A 2DZMA 1JRPA 1C0AA 2WKDA 4EQNA 3HOUB 1Z2MA 1K3BC 2E74C 2DHZA 2MH7A 3NY5A 1K3RA 2K04A 2IHFA 4OO1G 3TRZA 2MO0A 2NVQB 1EYGA 3AE9B 4C56C 2CH4W 3DM3A 1VQFA 2F0MA 1CI3M 2Y0SG 3BG3A 4ID6A 3ND8A 3WOFA 5HURA 1EYCA 4X62L 3GTQB 2BWES 5CR3A 2JZ3B 1UWMA 1S4ZA 2F0NA 1V86A 2JJQA 2IY0B 1J9OA 1N61A 4XWWA 2LVQA 4A3JG 2WXMA 4ANXA 5BO4B 1ESFA 2G9DA 1VQIA 1RCVD 2JQRB 4A3MG 2Y3AA 1Q10A 2XRQD 1SIJA 4HK2A 3KJPA 2ZPNA 1WGHA 4HJ5A 1WJ4A 1KLVA 2KCNA 1E1OA 2PPBC 2JA5G 1JRUA 2NVUI 4TQ0A 4IPGA 3ALBA 3G6JB 2BQQA 5CBEE 2N3SA 2RPVA 3M9BA 4A75A 2N0SB 1LTAD 2XEWA 3SK6A 5LMUL 4DV3L 1K8AC 1BF4A 4DR7L 3Q6BA 2WU2B 1RTOA 3GTKH 1YQBA 3S17H 5CC4A 3PPAA 4A55A 2B2UC 4ME5A 4POFA 3KLRA 1GHJA 3CCEA 1IBLQ 3Q3MC 3EJIA 4N6EB 4KY7A 2NN6I 2K28A 4CDFC 2QDLA 2F0JA 2Z6BA 3DXJC 5IOCA 1TJEA 2C7MB 3S1NH 1KOTA 2K50A 4XX5A 2PI2E 3LNNA 2KX3A 3CKIB 3VRAB 3ZVVA 4FN2A 4IJLA 3GOEA 1GNUA 3FKIH 4A3BH 2CU1A 3W1BA 5IGEA 1WH3A 2EKEC 3BDCA 4H02A 2EZVA 2PTLA 1TWGB 3VAWA 3J81c 3NPPA 3DBLI 4II2B 1H8CA 2ALYB 4DV4Q 3PO3H 4A3GB 1YJIA 2ZEQA 2V4DA 3F2UA 5LL6S 4HJ8A 1F2ZA 2QCPX 2KYWA 2L76A 5F2DA 2QIEB 2A6EC 4GNXA 5LXIB 4LW1A 4DR7Q 1FXIA 4EQ5A 1TS4A 4HIKA 1Q81C 4KY5A 1Q5WB 3K57A 1P9DU 3SHLA 4WH4A 2K32A 4A3KB 2OEOA 2KQ7A 2Z59B 2GVBA 5TR5A 2CR5A 4DK1A 5GMVA 3VXWA 1NEKB 3I70A 4Q2JA 4PK1A 1UEBA 2MLBA 3F2CA 4L23A 5E7NA 4LF5Q 2A4ZA 4OX9L 1PH6A 2PO4A 1LUZA 2GBKA 2RHQB 3AU7A 3N52A 3PS6A 4N9TA 2WFWA 1ENAA 1EF5A 1A3TA 4IUUA 2HDMA 1ESRA 1TWCB 1RYJA 4HMJA 4F7ZA 5EQ0A 4HAEA 4JOIC 2EXZA 1HUMA 5C4XG 5E6PA 1VDZA 1EWHA 3N9YC 4WIPA 1STGA 2XRSD 4JBWA 4DR3Q 1NMGA 4WAFA 1CA5A 4MGIE 2IT1A 2KWCA 5G5GA 4NZLB 3TSSA 3V3XA 2CQAA 4JL9A 1HNXQ 2J0MA 2X6GA 3K58A 1RRBA 3L10B 2R7ZB 4OWXB 1HCZA 1FD7D 1TS3A 4ANUA 1OQQA 2RHSB 1EYAA 2W3RA 4EOYA 2ENBA 5C3EB 5JJKA 1V9PA 2VB3X 3QIAA 2JA6B 2M4NA 1MJEA 2IDYA 3F2DA 1HQMC 1E2VA 4BBSG 4JYAL 1V49A 4BY1H 4S0RA 1ENFA 2FJ2A 4JYAQ 1IPGA 1QOBA 3TIXA 1E22A 2LGSA 1EQQA 2MRPA 3OW7A 1RIPA 4HJ9A 1LACA 2B2UA 2D3AA 1TWHH 3VH3B 1VQJA 4XQNA 4GOPC 1GO3E 3SR6A 3VTWA 1EY6A 3WOEA 5JVG3 4Y7NB 2H4OA 2BH8A 1EQRA 4I65A 3AQQA 2V4LA 4ZKBB 1AZPA 1V5TA 5ELBA 3QQ8B 4YHHQ 4EE2A 5C6AA 3G71A 4A3IG 3A74A 1JJCB 4BXXH 2ONQA 4EVOA 1UWVA 3VA5A 1T5XD 3KLWA 1SFOH 3R66C 5HGQA 2J7QB 5FOBB 4HIDA 4CBVA 2DNEA 4DUYL 1EO6A 2LGYA 4AQ7A 4K5WA 2NYZD 4JI5L 4P72A 4DHJB 4HPMB 5DCNA 2BF8B 3MJ5A 5D2MB 3GTGH 5GAEC 1MVKA 2YEPB 2Z9HA 4K7UA 4RKLA 4LJOB 3AULA 4IFDH 2KNBA 1OXUA 3M7NA 1GUAB 4K14A 3PUWA 4AYBE 4RAUC 4BBNC 1WOCA 4DV4L 4JV5Q 1XCTL 2IY1B 3P63A 4MH8A 3T16A 1QT9A 1Y1WB 4IWPA 3QK0A 1O78A 3J7AF 5FLXL 4ZRJA 4QUFA 3GTLH 5G5HA 1JT8A 1A15A 2DYOA 3TEZA 4RF0A 2V3PA 1D1KA 3H7PA 3RZOH 2N7EA 4AIMA 5M3FH 5LMNQ 4FULA 4JK1C 4NJ7A 4BVUC 1G6ZA 4ILWA 3Q23A 4DV6L 3RNUA 1QUQB 4B9KA 4YSZB 4URKA 2QEXA 3BINA 4DDGD 1WCMH 4B3TL 3P1HA 4JX1C 3SHQA 4JI4L 2B2YA 2LGDA 4KN7C 1YNNC 3NOBA 2N9EB 4KVGB 5IAAC 1HZCA 1WE6A 3PCOB 2B2TC 4LF5L 2JA5H 1F2MA 3QB3A 1Y1VB 2RQXA 3S1MB 3VUXA 2RDHA 5C3JB 2FCSA 3DPDA 3O13A 1VQCA 2WXPA 2KTFA 4V190 1NNXA 2N49A 1N36Q 2R3ZA 4H44C 3RNCC 2JU6X 2VUMB 5J18A 3J9CA 4OO1I 1ZXHA 4FHKA 1IW7D 1A6XA 1FRDA 2WACA 2EJGC 1TZOA 4ZUJA 4I6PA 4L5QA 3TP6A 2W54A 2J42A 1F9RA 1Y8OB 2A6ED 3GV6A 3E6ZX 1V2YA 3UINB 3FMCA 3S2DH 2I1KA 3NZ3A 2WYQA 1O7ZA 2ASBA 1GUNA 1TKWB 2BCOA 5C3WA 4DUYQ 5KHOA 1SJED 2KLGA 2BYEA 5G55A 3BDOA 2LKVA 2L5TA 3S16H 1YJNA 4UP7A 1HR0Q 3W5VB 1I4GA 1PFDA 2K75A 4MHEA 4F8CB 4R4OA 2Z8LA 3QCAA 3UE0A 4JI4Q 5H1SE 3HOWB 3B9JA 4DV7Q 2ICIA 2Z4IA 1WD0A 1MFWA 2INPE 2L11A 4R4QA 4RFBA 5KIXA 2KVMA 2D3BA 4US9A 1WTRA 3GO5A 3MXPA 4NKLA 3ZKJC 2UXDL 2WKCA 4NXNL 1ZPSA 4QCLA 5AZFA 4WJ4A 3AE7B 3OAWA 3AFQA 3R3OA 2VNUD 3J81E 2WQYB 4AS1A 4R4TA 2FMMA 1SSNA 3UI3A 3OTOL 1C3TA 2JT4B 2Z6KA 5IP7G 3VH4B 1N34Q 4F87A 1J7AA 4MGZE 4LAAA 4IOCA 3OMCA 3UDIA 5C0XH 2LEKA 2Z0SA 4QAYA 1SRUA 4Q0FA 5C5LA 2N9KA 3CF5A 3JW0X 1HZBA 4JI0L 1VQNA 1LT5D 4A90A 2DUDA 3J81L 3TP8A 3D6WA 4IALA 3HOVB 4JI5Q 3PREA 3U8ZA 3V60A 2QDBA 3HOYH 1STNA 3NG0A 4B6WA 2F3WA 2K5QA 2KTRB 2B2YC 3FKIB 3WIMA 3NE5B 3NUCA 2I5MX 2SDFA 2AUKA 3ZNGC 1E8XA 3BZKA 1QNUA 2KTRA 3U4ZA 5C4ZA 1SYGA 4KV6A 4C1NI 4DU9A 4X65L 2N9PC 4LJZC 3RT3B 5JVH3 2IHEA 3VDYA 5GAGC 3AMZA 3RI7C 2D62A 5KNBA 1WD1A 4REZA 4BFRA 4TKOB 1YJ9A 1WFQA 2JA8G 1TZ1A 2EYHA 2EMSA 4P1BC 1EIYB 2C9OA 4ZQ3A 1VRAB 2KMAA 2L32A 2PLPA 3APDA 2E8GA 1XX8A 2NTTA 3PGEA 3N3KB 1WI5A 4Y7NH 4KGTA 2G4SA 4OX9Q 5EKKA 3PMFA 3APCA 3S15H 5GROA 2M8SA 3DBSA 1EFWA 1XNRL 3P1MA 5JHBA 4EQOA 2HD5B 3Q2AC 1CM9A 3VYTA 2FMCA 1ROEA 4XQQA 1T0SC 1GJZA 1QUQA 3RD2A 1TTNA 1RL2A 1Q90A 1WJNA 4JOIA 1N32Q 2F1MA 2WB1E 2Z4HA 1TS5A 1PUTA 4UHVA 4KJOA 1W3SA 3RYTA 3EN2A 5G3LF 3TZUA 1AYFA 2B2VA 3M4QA 1VF5C 4UAIA 2PZTA 3JAMi 4WWNA 1NY4A 1LABA 2HDEA 2OQKA 1EOTA 5BN3A 4WJPA 5J2RA 1GUSA 2ZNVB 2E2IH 1I3QH 2I07B 1K0RA 2L1AA 5CV7A 2ZT9C 3ZIMA 4YCUA 5HY6A 1WTXA 4GB9A 3M7GA 1S5ED 2LY7A 1OGWA 4CDDC 2UUBL 4G50A 3CIRB 1GM5A 2OHFA 1RF2D 4P2CB 3AE3B 1JOOA 1YD8U 4JVZA 4GLVB 4R8IA 1VS0A 2CWPA 2GBRA 3QG1A 4TRDA 1ZXIA 2KEDA 4E6IA 4NW2A 2KWDA 5HKHA 2LXKA 2KK8A 3AE1B 1XNQQ 2OXPA 3L7ZC 2E75C 2KDMA 3MZ5A 4F8MA 3I5JC 3FDTA 1GUWA 2HD3A 1MJDA 5K5PA 1KD1C 4QJFA 1XPOA 3F1ZA 4MNOA 4YL8A 3FP9A 1GC6A 2M0XA 4HDOA 1TT2A 5BR8Q 2VQFL 1X6OA 1XD3B 4OZBA 1U4PA 3ZJYC 4KMUC 3AV8A 3I4NG 4W9IA 1G91A 2AQ3B 4DV6Q 3Q3NC 5AUKA 3TP7A 1EEFD 4H0LC 4DXGA 5ISRA 1FRRA 2PMZB 4GNXB 3AB5A 2F0OA 3KW5B 3J7AV 2Z0DB 1SB3C 1Y69U 2MEKA 5AZHA 5COYA 1DM0B 1PTOF 4JLCA 3TREA 4OGQC 3TDQA 1VQOA 1IYVA 5EGTA 4JV5L 1EUJA 4KTAA 1LGRA 2BTEA 4FXDA 2HJ8A 1JJ2A 3M63B 3RCZA 3CD6A 2KDFB 3ZJVA 3JSVB 4C3JB 2YYZA 3CMAA 3Q8AA 4XIGS 1TKGA 2NCNA 2B8FA 1WF9A 1WGYA 2EELA 3VUWA 3M3JA 4JWSC 1KRTA 3KQ4A 3OJ3A 4AJWA 5H92C 2E76C 2VH2A 2A5HA 2JVCA 1YN5A 1STEA 2DNCA 4JI2L 1PGXA 3VR2A 1GJXA 4USAA 3ZJTA 2O6VB 5J1ZA 4MZ9A 5M3MB 4DV5Q 3GTPH 4GN1A 4P73A 1V1PA 2KN4A 5IKCM 2F0PA 3SK5A 1DXMA 2V0GA 3AE6B 4BS9A 1IBML 2MP2B 3AU4A 4LNIA 2IGDA 4WURA 2WHIA 4UP8A 2KJXA 1EZ6A 1UGJA 2MP2A 3KYDD 1B9MA 1YNTE 4FADA 3X3NA 1SMYC 4A3LH 1QWYA 1HNZL 5EE1A 5IT9c 3A4RA 4IOAA 2QC8A 2XWBB 3R2TA 4DV5L 1HJPA 4EGVA 4OZAA 2NVTH 4YWGG 1QLBB 1FYCA 5KEEA 2V9HA 2LJIA 2N4FA 5CV4A 2IX3A 2L8JA 3G7LA 3SK4A 1OXSC 1JROA 4BAXA 3BVGA 4LNNA 4U673 5A35A 4M8AA 1Y1WH 1D1IA 2F0QA 4AQYQ 3L13A 4DR2L 2JX5A 3DMUA 3GP7A 3PIOA 1T0RC 4W9EA 1JC7A 3V2TA 2A6HD 1FNWA 1WJ6A 1K83B 3OIQA 1B7YB 2NZOA 1IGCA 3I4MG 4LFAL 5EPKA 1X3GA 2WV6D 3TEHB 1OEYJ 4MTNA 1UGMA 3EHVA 1EY8A 5FJ8G 1WCMB 2F3VA 4FO2A 1BBWA 4FBJB 2B63B 1EWIA 1Z7TA 4DBGA 2DY7A 4TSSA 1L0YB 3HFZB 2XBBC 3CRKC 3ICEA 5FLXE 5FO8B 2R7DA 1SFOB 5M5YB 3KYCD 3C1EA 3FEWX 4DAYA 3HOVH 1EUVB 2H88B 2VZKB 4NQLB 4HCEA 1VDVA 1TYGB 1JWMD 5BMGA 1TWHB 3G4SA 2WAQB 4Q5VA 2KCMA 1NR4A 3M4PA 2R92B 1ZKOA 2Z1CA 4B9WA 4HR7B 1PHJA 3GTOB 3PUYA 1FXTB 2ZVNA 4AP4C 2KX0A 3SD5A 4CJ1B 4OL7A 2KVRA 1NDDA 2MSED 2YU9B 3EECA 1BVSA 2K39A 4KV2A 1SYEA 2CJOA 4NB3A 2JA6H 4MSMB 4DK6C 2JEBI 1J5EL 3LJ3A 3CSFA 4OHJA 5H8YE 2HCCA 3DLLA 3VVWB 3HG9A 1XWEA 3MFYA 4DNTB 3A55A 3S15B 1WR6E 3E9HA 3I4NH 3P42A 1FVIA 2O4XA 4UDUC 3PRZA 5ELCA 3CSTA 1CA6A 2HHHL 2AWNA 4M0WA 1T0QC 1WY8A 4US8A 1Z9FA 3C1FA 4L5SA 1E24A 4FF3A 2Q5WD 4RMFA 4KZCA 3PUZA 2AKWB 2HQEA 2EY5A 3CC2A 1K51A 1GB1A 4GN5A 3A5ZB 1B50A 4RCOA 4XE0A 5HI1A 3M62B 3P4SB 1I94L 3GD7A 5CV5A 3AEGB 3NZSA 4OVZA 4RCNA 1Y8NB 3I4LA 4HSPA 2I1JA 2DJFC 3N6RA 1Y8RC 1BOSA 3ULLA 1JQ4A 4CKCA 5IOIA 3H7SA 1CZWA 2JWZA 5E4WC 4AUQC 3PSIA 3W2DA 4WJ3M 3IFDA 2KENA 5JEAJ 1I4PA 5M3MH 3RNAC 3EROA 1OQYA 3RZFA 3A8JE 1H4RA 2UU7A 3AE5B 3PO2B 2J0TD 2PCFB 2GVAA 3HOUG 4QIWE 2R2OA 1YOVB 2WDVB 2I0QA 3Q3OC 4BY7G 3PRMB 2CKHB 4DV1L 1UBQA 1IZ6A 2K8BA 2DWQA 3J80i 2C60A 2B2WC 4YT0B 4KGSA 1QOHA 3T4AC 3PRPB 4NP5A 2PE6B 2EY6A 4K3BA 3TQYA 2LGIA 1EF1A 2K6DB 1JMLA 4LK0M 1UNSA 3KBXA 1D5MC 2HJ1A 4JCVE 4YTPB 1KDAA 1A3VA 5KYLA 4HSVA 3HOWH 1E6EB 4WQMA 4A3MB 1CKNA 1N33L 2JN4A 4KHPL 2ZZPB 4DR2Q 1H9SB 3X0WA 1DD2A 1BR9A 5IGFA 4I7AA 1JJGA 3IHPC 4HIMA 4W9FA 5FK9C 2BB5A 3DHQA 1CKOA 3RUZA 2JA5B 3C3LA 2FCQA 2JA7H 2GBMA 1HZAA 1V43A 4AYBG 3MHBA 1C8CA 1EY4A 4JI7L 1GUGA 1FCLA 3QIJA 1BKBA 1WXAA 4J15A 2A1AA 2NR2A 4KGRA 4BKTA 1DOYA 5EPLA 3MAQA 1WRIA 1WVLA 4YY3L 2WWZA 3NVVA 5CX3A 4DAVA 2E2JH 2JA7B 5C44B 5JJIA 1S40A 2DX5B 3I90A 1YNXA 4GN4B 1SBBB 3K80C 5AFWA 1K83H 3I55A 2AQ2B 2ZM6L 3HVDA 5FKAC 4FXCA 1SAPA 2KFKB 4FP5D 3CAMA 2VZKD 1Y56A 2REXA 3D4DA 3AYHB 4TVAB 3I56A 3ZO5B 3OW2A 4OIKA 1I42A 2D07B 1GUOA 4OXPA 3RN9C 2JF5A 4Y52H 3K5LA 4CJ0B 2V3NA 1K9MC 1Z47A 3R2IA 4C3HB 2IZVB 3UI2A 3Q8FA 4IWQA 3L2PA 4KY6A 3WANA 5LHY1 4POGA 4M1UB 3C8YA 1QZEA 3NZUA 4MELA 1KXLA 4WJQA 1CUKA 3KFUA 4GKKQ 4BA2I 1V8QA 3R93A 1ONLA 3OIPA 1P8LA 3S14B 2BYFA 1YNJD 4J6HA 5M5XH 3L54A 4D2KA 5E6JA 1EU3A 3E5SA 1WYDA 1AE3A 2IGGA 1SE2A 1VQ6A 3H94A 2KUMA 2WGSA 1Q1OA 1BBXC 2DY8A 1C4AA 1YHAA 5JJZA 3CCSA 3T1YL 1WFYA 4IWOA 2DN8A 3FRPB 1IBLL 1YBYA 3PUVA 4A3FH 4WJWA 3AEAB 1TR5A 3MEFA 4A20A 1CTMA 5CBAE 4DHJD 5C4XH 5CV9A 1CQFA 4JI8L 3E0JA 4B3MQ 2BW2A 1ISNA 1JALA 2K52A 1E7ZA 1XLQA 2HTHA 4B3ML 3TJPA 4FXGC 1RAXA 1IYUA 3ONAB 3TEYA 1GHKA 4WAAA 3R3MA 4JPSA 3S2DB 2I5LX 3KK7A 1PZJD 3D32A 1R9TH 2RSNA 4TMAB 1I35A 3QO2A 4RG1A 2BVCA 4DR5L 1NSNS 1IL2A 1VZ7A 3SEBA 1MHHE 2MWSB 1QVCA 5JPNC 1XF5L 3M3YH 2HIXA 2IO0B 4IUNA 2R7ZG 2IPKD 2JQOA 4PMBA 1Q86C 1ASYA 1HNWQ 2WINB 1LXDA 3ZTDA 5FLMH 2L52A 4J3OD 3C19A 4ZRKA 2KHIA 3S2HH 4HEDA 1MG8A 1H9JA 4F7XA 5C3EG 1ZE3D 2FAZA 2SOBA 1RHPA 3NTHA 5FO9B 5M5WB 2JA6G 2UXCQ 5DAUA 4C7YA 1XTCD 4GN3B 1VLBA 1L2NA 4BBRG 4BBSB 1STYA 1PH3A 3DWPA 1WRDB 3NTIA 4XYOA 3K0YA 2A5UA 2KDIA 1MI2A 5GQOA 3E9SA 4BXXG 2KBNA 1H9KA 4S17A 1D2BA 1WXQA 5C0XG 2JE6I 4B08A 2L83A 2LVPA 5GAHC 2MP1A 3U4EG 4W9LA 1WYGA 3RLFA 4ZK9B 1DGJA 4KKIA 4LNOA 2AWTA 3L0WB 2F0DA 4HEA1 1KM7A 3A4SC 4A3IB 2YU9H 3VR6A 4R3DA 1ZW7A 1NUCA 1XCQL 3ZRCA 2Z0EB 4PS7A 2PMZE 4ODGA 3ML9A 1D3ZA 1PTOC 3X3MA 1H9RA 1E10A 1AFPA 4HJKA 4C7ZA 4C2MB 1N5XA 4UP9A 4EKUA 3GTMB 2JA8H 3BU2A 4WWOA 4BOSC 2KFKA 1PVOA 4GS3A 1LYLA 3D8GA 3NXWA 1UAPA 1BUVT 1T3QA 3IAYA 3PIPA 2RGFA 5IGDA 1CHQD 4HROA 4A3OA 3H3VI 4IURA 3BK1A 2OTLA 1IBMQ 3GV3A 1WM2A 2WDQB 4QIWB 2XK5B 2ZJDA 3SDLC 2PQAB 5BYSA 2UUCQ 2RMMA 3JSVA 4EZLA 5I2XA 1FD6A 5EPJA 3T1HQ 3TBIB 3ENEA 3IFTA 1YZ6A 2JXMB 4HCSA 2EDGA 3OTOQ 2L4NA 1IGDA 4R8NA 3WWVA 3H7PB 4IPHA 4HCNB 4LF9Q 4U68A 2Y0SE 2AMCB 2JXXA 3OSOA 3RPFC 1FFUA 3UQBA 1AEXA 3K7AB 1K8MA 2MNAA 3IG3A 2XIWA 2GRIA 1Y1VG 1BCPC 2YTXA 4DR5Q 4BY7H 4PQXA 5IGGA 3KVFB 2NVQH 3EA6A 2O5IC 2BGFA 3BK2A 3LYYA 1OXVA 1FFVA 1KNAA 4IUVA 2A6HC 1CHPD 4DR1Q 1NJIC 1K8GA 1KF6B 5EE3A 3TS2A 4AJYB 4A3JH 1HNWL 4K0KL 3AEEB 3ZYYX 3URYA 1XMOQ 1UWXA 3HKZB 5LMNW 4DR3L 3JYUA 1V9JA 4J8QA 4JQWC 4OW0A 4H13C 1V81A 2A69C 1F9PA 1F2YA 3NQTA 2YVCA 3MC8A 3KLSX 5L37A 2NMQA 1S3OA 2NVXB 5J39A 2NBWB 1XPRA 1EY5A 3RNGC 4ZDVA 1STBA 5IT9E 2RKSA 3QX1A 1LFDA 5LMNL 4LF6Q 2PVGC 3EC8A 3TS0A 3I63C 1NBFC 3S2AA 1L7YA 3ZXRA 1J8IA 2VY3A 2MW5A 4O1NA 4B3SQ 4V0BA 3K0XA 3HOWG 2FNJB 4GIVA 3U7ZA 3Q69A 4A3EG 3UIPB 4K0KQ 2VXWA 2K1BA 2WXNA 1VQ7A 1BDOA 3ULJA 1YNJC 4DR1L 2YTYA 2E2HH 1FM0D 3ZRFA 1FCCC 4P1CC 1I4QA 4E71A 3ML8A 3MFGA 4KI0A 3M4OH 5KNCA 3RZDB 1K52A 1E7UA 2Q8TA 2CFMA 5JPMC 1II3A 4K5XA 1C48A 1JOKA 2WXLA 4LNKA 1D4BA 4ARIA 3HEJA 5D6JB 2KA7A 4XTCS 5HGTA 4QF4A 4ZRZA 5LLIA 1LTRD 2IGHA 3LX0A 2L3ZA 2CHWA 2LGXA 5D65A 3QJZA 3SFDB 2V1YA 1KLGD 2BT6A 1F0ZA 3Q8EA 3Q8CA 2OT2A 1X55A 3P4PB 4B3RL 1YIJA 3ERSX 2R7FA 3HOVG 3M4YA 1QKZA 4PYUA 4A3KH 5DPSA 3VA7A 3DBLB 4DA2A 1EQVA 3STBD 1L6UA 4GOCA 2C5LC 5LXHA 3IKJA 3FKIG 3A9KB 3AN1A 3ERQA 3NVWA 5BN4A 3BWUD 3NVZA 1YQ3B 2J0JA 1J8CA 4LFCL 4X62Q 2H89B 2FE8A 2OEDA 1E8WA 2CHXA 2PVOD 1NE3A 2RSOA 4P74A 1SNQA 2KCTA 2ZCCA 3SGIA 2IX0A 4OONA 4RH6A 3KH0A 1LQBA 1TWCH 2JA8B 1B9RA 1FNVA 1BO0A 1NI2A 1Y14B 2PYKA 3DVNV 2JK8A 1ML0D 4L5TA 4CJ2C 1PRTC 4JI3L 1E5WA 2K5NA 5I9PA 1SR3A 2GN5A 4PZ7A 4OWWB 1C4PA 2BPSA 1L1OA 2LJ5A 2LXCA 1VMPA 4K2KA 4NAWB 4A3FB 1TY0A 3AMUA 2MX2A 2KJRA 3I91A 1MHXA 1DOXA 2WDRB 3MHZA 1EIFA 4IDIA 3NBHA 4HJAA 4WRDA 4LF9L 3GQBA 1I3QB 1VQEA 3M3YB 1DZ1A 3N1XC 3RZOB 3NBHB 3M95A 1ZYRD 3HKZE 5M5YH 2KQ4X 1CMXB 2VQEQ 1U4AA 4ZYNA 5EKIA 1Q46A 3TP5A 2NPTB 4IW0A 1XQQA 3NEMA 1HHVA 2DBYA 3PF4A 2FIFA 2LVOA 1R4QB 1R9TB 4JE3B 1EFID 2W3SA 2MHVA 2D5DA 1RJTA 2FINB 3KDFB 3MWYW 1PH9A 4W9GA 1Q8IA 1V6EA 4K7SA 4IUPA 1STAA 2CKZB 2I46A 2D3CA 4M02A 4K6LA 3SE0A 3DBRB 3W9CB 3J81j 1WGDA 2AX5A 4OIJA 5CGKA 1UH6A 3AE8B 4ZCKA 3RULA 1VQ4A 4IKGA 2AHOB 4L8JA 3GTJH 4OVUA 3W1SC 2F0HA 3NUHB 3PV0A 1QZGA 4G7OC 1I6VC 2NBFA 2N7DA 4YSXB 3WALA 4EX5A 2F0EA 2LFNA 2JEAI 1ZP0B 3HM3A 2KFJA 2LSSA 2JRIB 4M8MA 3GTJB 3CRLC 1BT0A 4EUTA 1V8CA 4MACA 4DV7L 4F1SA 1IW7C 2NZ1D 3FPUB 1D7QA 4HJ7A 2ZXPA 3TEWA 1N62A 1WXSA 5T1IA 4IUTA 2K7VA 1NYQA 2FUG1 2VH1A 2F3IA 2LMCB 5BMIA 3OPOA 3OJ4B 1A2UA 1O7LA 3PZDA 2K4KA 4BY1B
chains in the Genus database with same CATH topology
5IGBA 1O80A 1BXTA 1EM7A 2O2LD 1M8AA 5JEAG 3A8KE 5I6YA 4ZAIA 3MVVA 1Q3LA 5HFYA 1QQRA 1IBXB 3FILB 4FF4A 3LXFA 1CT1D 3DUZA 1VR9A 2EYFA 3C46A 1RDPD 1EL0A 2D2CC 1S5BD 4YSYB 1KNEA 1YNND 1HPCA 3MEHA 1Z6HA 3KBGA 3MA2B 4YTNB 2LHEA 1DONA 2F0TA 3VQIA 3IXSA 4NJCA 4ABNA 3OWFA 4ZYSA 5G3LD 1N63A 3PO0A 4LLGM 5D14A 3A8IE 3MXUA 3QWNA 2C5CA 4RHSA 3GS2A 3AE4B 4A8XC 1F2LA 1ICWA 4FNFA 3HOXB 3D6CA 4GLSC 1ET6A 1E2ZA 3T56B 3CU7A 1FEHA 4A3BB 4IFDG 1SNCA 1CZGA 3FVQA 5IGCA 3OHXC 4KK7A 3EQLC 2JZPA 2BE5C 1AN8A 1R4PB 4X3SA 3S1RB 2F4IA 2NN6H 4OZCA 4XT1B 4FVMA 3NP8A 2JSVX 2W55A 1VZ6A 2M0AA 1DJRD 4XT3B 3T53B 4A9AA 3KWLA 4CKBA 1J7CA 4DFAA 4XDXA 2H1EA 2L12A 3Q8BA 1TIID 1L6VA 1XLOA 4QMGA 5D3DA 2K5WA 4IQZA 2LS01 3I9V1 1LTTD 1D5XC 1PFNA 3H91A 4H7BA 1LO5D 1G291 2ZW1A 3ETRA 1EU4A 1PGAA 5BMHA 1PXUA 4IFDJ 1BUIC 3S17B 5I2YA 2JWUA 4RWSC 3DEOA 4KKTA 4XYQA 4DNRB 5JEAH 3NS1A 2K5PA 1W6KA 1KH0A 2NVTB 1XXGA 5ELDA 2F0IA 5A2QL 2N9LA 4P6VF 1J7BA 2X69A 1PLFA 1PRTD 1FR3A 1QOAA 1HZ5A 1EZ8A 4B0MA 5DM63 1C4CA 4KKSA 2ID0A 2F0KA 4C3IB 3W5UB 1B9NA 3VYSA 3MXNA 4CQNA 3SVMA 4BY7B 1Q12A 1LTID 3HOYB 1RKNA 2K3UA 5T1GA 1FXAA 1I50B 2Q8IB 2IW3A 4EQPA 2ICEC 2BYTA 2B8GA 4HRSA 1FMAD 4RGTA 3QOJA 1SSOA 2F0LA 4KJNA 3LWUA 1EIHA 4ZHPA 3P20A 5EBCA 2K03A 4H2AA 1HFNA 4IZ8A 5ELFA 4AYBB 4OO1H 1RM6C 4PT5A 1EY0A 1YJJA 2EPBA 4FF1A 1JWAD 5C5MA 2NVYB 2MGSA 1L0XB 2OF1A 2ON8A 3P7JA 3MTSA 4RF1A 1PMRA 2F0SA 1KFYB 4RNAA 4LTUA 1K50A 2QEJC 1BCPB 1PZKD 2RDGA 5M3FB 4N59A 2L55A 3SXHA 1F9QA 2KEEA 4QB4A 1FNUA 1JB3A 1NI3A 1QE6A 2WXIA 4KKUA 4C3HG 2JYEA 3I3CA 2G9HD 1VZ8A 3FAHA 1IL8A 1M4VA 3EFXD 2INNE 1SNDA 2QJLA 2KQ3A 3D4RA 1QILA 2JYTA 1IKLA 2J52A 4HMIA 3DWQA 2K0PA 3U9SA 2NN6G 3NRZA 3V96A 4JWUC 3PUXA 2YEPF 1LV9A 1L0VB 1YN3A 3AB9A 2EYJA 1KABA 1MSGA 1STHA 1TWFB 5KRUA 3IT4B 1FGBD 3SR1A 2W82A 2BBCA 1QNKA 4O42A 3U9OA 3Q24A 1WWTA 2K9XA 1YMHE 2QKIC 5C3XA 1B1ZA 1S5CD 1A70A 1OFFA 2G1EA 3VYUA 2RBMA 4KD3A 2XN9C 2X6LA 2EYLA 1TY2A 2E2JB 2MPMA 3ABVB 1SYDA 5IODA 4ZRPA 2V4IB 3SDZA 1QJOA 5DNFA 4BBRB 2J53A 2JXTA 2IL8A 4DK0A 3WCQA 2B2TA 3KWVA 3H8HA 2KOLA 4HKQA 1PDQA 1I4RA 1E9MA 3IT6B 1V97A 2A68C 2J7ZA 2WLBA 1GB4A 1QCBD 2TMPA 1D5ZC 1LTBD 2Y5PA 3I8ZA 5EJWA 4K8JA 4DQOC 1SJHD 3TUOA 2ZW0A 1VMCA 1CZPA 1MPEA 1BQQT 2QILA 1SYFA 3DWMA 5IIFA 2WXFA 2F0GA 3U2SC 3V05A 1F9SA 1PTOH 1DOKA 1JWBD 2GB1A 2FHTA 3EUB2 4ITKA 4G4KA 3TZDA 4RGMA 4A93B 3OMGA 1GPXA 1SXTA 1G2SA 5D7GA 3GTLB 3L4PA 1JE4A 1QB5D 1X3PA 1B2TA 3DWGC 1OXXK 1Y8PB 2K33A 1AZQA 2WXHA 1DOIA 2QSDA 2PMVA 1SMYD 1PYWD 2EY1A 4X3UA 4A55A 1SYCA 2PW7A 1TVXA 2RA4A 4FXKC 3GTKB 4ZLTF 2JSOA 1JR0D 1TS2A 2QF7A 3J80L 4S3SA 4X3KA 1ZUD2 1R7SA 4ZKCB 1B44D 1VF7A 1NYRA 1KLUD 2AQ1B 2PW9A 4HTHA 4PV1C 5LNK1 1WTPA 1F2RC 2EJFC 3QJYA 4BA1I 1EY9A 3E56A 2A74C 3MP9A 2QMTA 3I72A 1BNZA 3K5MA 2E2IB 1ZDVA 1V1OA 2XWJB 4A3EB 1L4ZB 1GOZA 2B2VC 5A2QE 5DM73 4ZRQA 1KDBA 3L3OC 1PZID 3DEPA 2SEBD 3DM1A 1EY7A 3RMHA 1BMLC 1AP0A 3S9WA 4QUCA 2KHSA 3J7YW 2Y0SB 1IBXA 2KACA 3NQIA 4K8IA 2K01A 1B53A 4B9XA 4A3JB 1OXTA 2N55A 2PQEA 1PFBA 1D6EC 1EQTA 5LL6X 4YXDB 1ZEQX 2MJEA 4RGNA 1A3UA 5HG2A 2N7JA 4G7HC 3AEBB 5CV6A 1WGKA 2A69D 4LMQD 1QG7A 2PW5A 1N60A 1I7HA 1T6BX 1L4DB 1PTOB 4NAMA 1SE3A 1H9MA 4I7ZC 1DOMA 2L9HA 1EYDA 3HP3A 3HS0C 3K6OA 3W1SA 3BYTB 2A68D 5T8IA 3LWEA 1RWSA 1KAAA 4IN3A 3CQZB 4YIJA 5EE0A 1EWYC 1LTSD 2FFKB 1DYQA 1HTPA 2F0UA 1CFMA 5FO7B 2SNMA 1GXDC 4KX6B 3NHHA 2JYOA 1SYBA 2EVBA 4CKEA 3VRBB 4XWTA 5JAVA 1F2RI 2PKOA 3T3NA 4G7ZC 2FBWB 2NUCA 4TQUS 2TSSA 1XEEA 5MPOA 1U4RA 2EJMA 2BS3B 1YN4A 5C4XB 2BA1A 3B2GA 2CW0C 3VR3A 4DN4M 1DCZA 2WP9B 5C4JB 2LMCA 5C2TB 2HTME 1CQVA 2SNSA 1DOLA 1X3QA 5J22A 2MUYA 4X3TA 3NVYA 1Q1EA 2NB0A 1XYIA 3VR8B 1G8ZD 3AE2B 2WS3B 3FILA 3HOZB 5JXVA 1VJKA 1RODA 2Q8RE 1ENCA 1HQRD 2IX1A 3CHBD 4DAPA 1MD2D 2BDNA 2PZWA 1EIGA 1HZ6A 2R93B 2HDLA 1LTGD 1NAPA 3Q22A 3GTGB 4XXEA 2EYPA 1ZOYB 2BE5D 2NTSA 4PNYA 1WTQA 3H6MA 1PTOD 2F0VA 4MN3A 4IUQA 4DF7A 3BS1A 3TEXA 3QOLA 3NTKA 1TU2B 5C0XJ 4KHVA 2M19A 4HJGE 4PMWA 3GB1A 3S16B 3A7AB 3R8BA 2WXKA 4K6DA 1I4XA 2DYMA 1LT4D 4FF2A 4HKZE 1U4LA 1CJEA 1I6HB 4PMCA 3T51B 3IL8A 2HUGA 1PRTB 4KHZA 5E4XA 2PZUA 1NENB 1HEZE 2Y5CA 3AM9A 5BYRA 1FIQA 2K22A 1E7PB 1UUPA 1ACCA 5BN5A 3DWAA 2J4XA 4TQ1A 2CHBD 3GTPB 1HFGA 4CHTB 1SEBD 1U4MA 2IJ0A 3PO3B 4L1BA 3BVMA 3AECB 3CWIA 3SK8A 4HN7A 3PIO3 5CYUA 3M4OB 5NUCA 5HHDG 2K5DA 2EYOA 2R6GA 3IAS1 4DXFA 5BYQA 5E3FA 3W3AA 2M2LA 3I73A 3ZJUA 1HA6A 2KECA 2E6XA 1HA5A 3P4QB 2I2YA 5D3IB 2EKIA 1QOFA 3AH7A 5CMDA 2WXJA 3JAML 1WTOA 2EOTA 4GDKB 2BS2B 5EE9A 3S2HB 5ELEA 1NR2A 3S1NB 1NCVA 1LT6D 3H0GB 2BS4B 4C1NK 5KYIA 1JQYD 1H9SA 2PNRC 4Z9CB 1C78A 3P4RB 1AWDA 4CGYB 3K5OA 2LFIA 3MC0B 1G2TA 1BCPD 2BA0A 4J1MA 2E2HB 4N9PA 1ILQA 3K5NA 2O5JC 3EVQA 1K8OA 1TWAB 3A54A 5C4HA 4A6QA 1C79A 3BDLA 2WXQA 1ZXTA 2KAJA 3ZGZA 3OOCA 1IHZA 3HGBA 2BB6A 1EWCA 2ZXRA 4C3IG 4A3DB 4GZYC 3AEDB 4L2YA 5M9OA 1K53A 3BYYB 4FYDA 1S5DD 1QF6A 2AWOA 2I38A 4DGZA 2B76B 4N58A 1BCPF 5TSSA 3NSWA 4WFN3 4RKBA 1A2TA 2WP8J 1JWSD 3SFEB 2F03A 3P75A 4C80A 1XLNA 2LHDA 3IAM1 1ZDXA 1GAQB 3HZXA 1ET9A 5AUIA 2WU5B 1GUTA 3VR4A 4ARCA 2A73B 1PDXA 1B3AA 2BOSA 2CU3A 1C77A 1JOQA 3VR5A 3NBIA 1X32A 3D3RA 1RD9D 2M9VA 4WORA 2E3TA 4K5VA 3L9AX 2MJ8A 3H09A 4RGOS 3S1QB 1ZYRC 4R9WA 1SF0A 1MSHA 4MT5A 1PGBA 4KN4C 5K36G 3HRDD 1E0BA 4P16A 4IOIE 2XSCA 2WXRA 3B2FA 4RA8A 1JW9D 3H3VC 5I6WA 1CK1A 2GA4B 2K05A 2WXOA 1VCIA 1HUNA 3D4WA 5EKLA 1LT3D 1JORA 3I57A 4BWGB 2IWHA 4L6TB 3I4NB 2E2DC 4NMZA 4XDCA 2CVRA 3A7LA 3HUIA 3T3OA 3VR9B 1WTVA 3PZ8A 1TKEA 2D9UA 1P7EA 1C76A 3FPPA 3JAME 4B0EA 2PIAA 3WDNA 2MJDA 2KCCA 4C3JG 2BDOA 1S5FD 3HVZA 2GI9A 2B2WA 1O7YA 1RTNA 1AW7A 1F77A 4G57A 4IFDI 1L5PA 2F0FA 2CW0D 3ZQ4A 2F0WA 5I4DA 5KGUA 3M85A 5E1FA 1LLRD 1V1PB 3ND9A 3BIID 1JICA 1MBYA 2VB2X 5CV8A 1ILPA 2K6AA 2L0CA 2NWGA 3K59A 2WIIB 1FO4A 4KD4A 4ULLA 4ZHOA 3AEFB 3RFZB 3C2PA 3TMEA 4L63B 3KF8A 1UEAB 3TN2A 1B4OA 1I4HA 1WTWA 2LUMA 2L1BA 1WSPA 5IT9L 1SE4A 2XNAC 3T13A 2R61A 3A56A 5EBDA 3VYRA 3NWTA 2X38A 2M00A 4GDLB 2KMMA 3Q6SA 1SNMA 1SNOA 1QOGA 2EY2A 2EYMA 4YTMB 2ZXOA 1N5WA 2N88A 4NDXA 1E2WA 1OO9B 1IKMA 3I4MB 1TQOA 1PFMA 3RD4A 2DLBA 1KDCA 3D31A 1SNPA 5C0XI 2ACZB 1JWUD 3LB8C 1NVID 4F88A 3KLSA 5FR3A 3EGRA 5CORA 3ITPA 1YQ4B 1HXYD 1P7FA 2XVSA 1KRHA 1MGSA 4RHRA 2RVLA 4MM3B 3FC4A 3Q0AA 4WWMA 1W6JA 2EE1A 1MI0A 3HRZC 4ZUIA 2WNMA 1JCKB 3U52E 1SDFA 1E0ZA 1PRTF 3MXGA 1XO3A 4XDDA 1OQRA 1RFKA 2M56B 5JOBA 5DEHA 5GXGB 1T5EA 4XQJA 4KKJA 3PIP3 3BVZA 2JP1A 1HRJA 1XLPA 1U9RA 1C9FA 4ZOHC 3NK9A 1HTLD 1KTKA 1EEID 3OWEB 1C4QA 3BZDB 2HCIA 4LK1C 2AUJD 2D5GA 5I9OA 1IUEA 3J80E 2RDFA 1TKYA 2B39A 3KUPA 2WB1B 2WXGA 5KNDA 1Q1BA 3PZ7A 4K2LA 5M5XB 3NWSA 2SAKA 2CJNA 2MJ3A 4MIUA 1JRPA 2MH7A 2WKDA 4EQNA 3HOUB 2E74C 2K04A 4OO1G 2NVQB 3AE9B 4C56C 3ND8A 2F0MA 1CI3M 3WOFA 3BG3A 4ID6A 5K36H 5HURA 1EYCA 3GTQB 5CR3A 1UWMA 1S4ZA 2F0NA 4XWWA 1J9OA 1N61A 2WXMA 1ESFA 2G9DA 1RCVD 2JQRB 2Y3AA 1Q10A 2XRQD 1SIJA 2KCNA 2PPBC 4TQ0A 3G6JB 5CBEE 2RPVA 2N0SB 1LTAD 3SK6A 1BF4A 2WU2B 1RTOA 5CC4A 2B2UC 4ME5A 3KLRA 1GHJA 3EJIA 4N6EB 4KY7A 2NN6I 2K28A 5IOCA 2F0JA 1TJEA 3DXJC 3VRAB 3LNNA 3CKIB 5IGEA 2PTLA 3BDCA 2EZVA 1TWGB 3NPPA 1YJIA 4A3GB 2V4DA 3F2UA 5LL6S 1F2ZA 2QCPX 5F2DA 2QIEB 2A6EC 1FXIA 1TS4A 4WH4A 4KY5A 3K57A 3SHLA 2K32A 4A3KB 2OEOA 4DK1A 1NEKB 3I70A 4Q2JA 4L23A 2PO4A 3N52A 3AU7A 4N9TA 1ENAA 1A3TA 4IUUA 2HDMA 1ESRA 1TWCB 1RYJA 4HMJA 5EQ0A 4HAEA 2EXZA 1HUMA 1VDZA 1EWHA 3N9YC 4WIPA 1STGA 2XRSD 4JBWA 4WAFA 1CA5A 2IT1A 5G5GA 4NZLB 3TSSA 3V3XA 2CQAA 2X6GA 3K58A 2R7ZB 1HCZA 1FD7D 1TS3A 1OQQA 1EYAA 2W3RA 2ENBA 5C3EB 2VB3X 3QIAA 2JA6B 2IDYA 1HQMC 1E2VA 1ENFA 2FJ2A 1QOBA 3OW7A 1LACA 2B2UA 4XQNA 3SR6A 1EY6A 3WOEA 5JVG3 4Y7NB 2H4OA 4I65A 4ZKBB 1AZPA 5ELBA 4EE2A 5C6AA 2ONQA 4EVOA 3VA5A 1T5XD 5FOBB 4CBVA 2DNEA 4AQ7A 4K5WA 2NYZD 3MJ5A 1MVKA 2YEPB 4RKLA 4IFDH 1OXUA 3M7NA 4K14A 3PUWA 4RAUC 1XCTL 3P63A 4MH8A 3T16A 1QT9A 1Y1WB 1O78A 3J7AF 5FLXL 4QUFA 5G5HA 3TEZA 1A15A 2DYOA 4RF0A 2V3PA 1D1KA 4JK1C 1G6ZA 4ILWA 3Q23A 4YSZB 4JX1C 3P1HA 2B2YA 4KN7C 1YNNC 2B2TC 1F2MA 3QB3A 1Y1VB 2RQXA 3S1MB 2RDHA 5C3JB 3O13A 2WXPA 4V190 2R3ZA 4H44C 2JU6X 2VUMB 3J9CA 4OO1I 1ZXHA 1IW7D 1A6XA 1FRDA 2WACA 2EJGC 1TZOA 4ZUJA 3TP6A 2W54A 2J42A 1F9RA 1Y8OB 2A6ED 3GV6A 3E6ZX 3FMCA 3NZ3A 1O7ZA 5C3WA 1GUNA 1TKWB 2BCOA 1SJED 3BDOA 2LKVA 2L5TA 3W5VB 1I4GA 1PFDA 4MHEA 2Z8LA 3B9JA 3HOWB 2ICIA 2Z4IA 1WD0A 2INPE 2L11A 4RFBA 5KIXA 2KVMA 4US9A 1WTRA 3GO5A 3MXPA 4NKLA 2WKCA 1ZPSA 4QCLA 3AE7B 2VNUD 3R3OA 2WQYB 3J81E 4AS1A 2FMMA 1SSNA 3UI3A 4F87A 1J7AA 4LAAA 3OMCA 5C0XH 2LEKA 2N9KA 4Q0FA 5C5LA 1LT5D 4A90A 3J81L 3TP8A 3D6WA 4IALA 3HOVB 2QDBA 1STNA 2F3WA 2K5QA 2B2YC 3FKIB 3NE5B 3NUCA 2SDFA 2AUKA 1QNUA 5C4ZA 1SYGA 4KV6A 4C1NI 4DU9A 4LJZC 5JVH3 3AMZA 2D62A 5KNBA 1WD1A 4REZA 4TKOB 2EYHA 1VRAB 2C9OA 4ZQ3A 2L32A 2PLPA 1XX8A 2NTTA 4KGTA 5EKKA 3PMFA 3P1MA 4EQOA 1CM9A 3VYTA 2FMCA 1ROEA 4XQQA 1Q90A 2F1MA 2Z4HA 1TS5A 1PUTA 4KJOA 5G3LF 3TZUA 1AYFA 2B2VA 1VF5C 4UAIA 2PZTA 1LABA 2HDEA 5BN3A 1EOTA 1GUSA 2I07B 2L1AA 5CV7A 2ZT9C 1WTXA 3M7GA 1S5ED 2LY7A 3CIRB 2OHFA 1RF2D 4P2CB 3AE3B 1JOOA 3TEYA 4R8IA 3QG1A 4TRDA 1ZXIA 2KEDA 4E6IA 4NW2A 2KWDA 3AE1B 2OXPA 3L7ZC 2E75C 2KDMA 3MZ5A 4F8MA 3FDTA 1GUWA 5K5PA 1TT2A 4OZBA 1U4PA 4KMUC 3AV8A 1G91A 2AQ3B 5AUKA 3TP7A 1EEFD 4H0LC 4DXGA 5ISRA 1FRRA 2PMZB 3AB5A 2F0OA 3J7AV 1SB3C 1Y69U 5COYA 1DM0B 1PTOF 4OGQC 3TDQA 1IYVA 5EGTA 4KTAA 2BTEA 4FXDA 3ZJVA 4C3JB 2YYZA 3Q8AA 4XIGS 1TKGA 2B8FA 2EELA 4JWSC 3KQ4A 5H92C 2E76C 2A5HA 1YN5A 1STEA 2DNCA 1PGXA 3VR2A 1GJXA 4USAA 3ZJTA 5J1ZA 5M3MB 1V1PA 2KN4A 2F0PA 3SK5A 1DXMA 2V0GA 3AE6B 4BS9A 4WURA 2IGDA 2KJXA 1EZ6A 1UGJA 1B9MA 1YNTE 3X3NA 1SMYC 1QWYA 5EE1A 2XWBB 3R2TA 4OZAA 4EGVA 4YWGG 1QLBB 1FYCA 5KEEA 2LJIA 5CV4A 2IX3A 3G7LA 3SK4A 1OXSC 1JROA 3BVGA 4U673 5A35A 4M8AA 1D1IA 2F0QA 2JX5A 3DMUA 3GP7A 1JC7A 3V2TA 2A6HD 1FNWA 1K83B 3OIQA 1IGCA 5EPKA 2WV6D 1EY8A 1WCMB 2F3VA 4FO2A 2B63B 1Z7TA 2DY7A 4TSSA 1L0YB 3CRKC 5FLXE 5FO8B 1SFOB 5M5YB 3C1EA 3FEWX 4DAYA 2H88B 2VZKB 4HCEA 1VDVA 1TYGB 1JWMD 5BMGA 1TWHB 2WAQB 4Q5VA 1NR4A 2R92B 1ZKOA 2Z1CA 4B9WA 4HR7B 3GTOB 3PUYA 4CJ1B 4OL7A 2YU9B 1SYEA 2CJOA 2JEBI 4OHJA 5H8YE 2HCCA 3HG9A 1XWEA 3MFYA 4DNTB 3A55A 3S15B 3P42A 2O4XA 4UDUC 5ELCA 1CA6A 2AWNA 4M0WA 4US8A 2Q5WD 3C1FA 4FF3A 3PUZA 2HQEA 2EY5A 1K51A 1GB1A 1B50A 4RCOA 4XE0A 5HI1A 3P4SB 3AEGB 3GD7A 5CV5A 4OVZA 4RCNA 1Y8NB 3I4LA 4HSPA 3N6RA 1BOSA 1JQ4A 4CKCA 1CZWA 5E4WC 3W2DA 3IFDA 5JEAJ 1I4PA 3EROA 3A8JE 3AE5B 3PO2B 2J0TD 2PCFB 2WDVB 2DWQA 2B2WC 4YT0B 4KGSA 1QOHA 3T4AC 4NP5A 2EY6A 2LGIA 1JMLA 4LK0M 1UNSA 3KBXA 1D5MC 4YTPB 1KDAA 1A3VA 5KYLA 4HSVA 1E6EB 4WQMA 4A3MB 4C7YA 1H9SB 1DD2A 1BR9A 5IGFA 5FK9C 2BB5A 3DHQA 3RUZA 2JA5B 3C3LA 1V43A 3MHBA 1C8CA 1EY4A 1FCLA 1GUGA 4KGRA 1DOYA 5EPLA 3MAQA 1WRIA 1WVLA 3NVVA 4DAVA 2JA7B 5C44B 3I90A 1SBBB 5AFWA 4FXCA 2AQ2B 3HVDA 5FKAC 1SAPA 4FP5D 2VZKD 1Y56A 3D4DA 4OIKA 1GUOA 3K5LA 4CJ0B 2V3NA 1Z47A 3R2IA 4C3HB 3UI2A 3Q8FA 4KY6A 5LHY1 4M1UB 3C8YA 4BA2I 1V8QA 3R93A 1ONLA 3OIPA 3S14B 1YNJD 4J6HA 4D2KA 5E6JA 1EU3A 3E5SA 2IGGA 1SE2A 3H94A 2KUMA 1BBXC 2DY8A 1C4AA 5JJZA 2DN8A 3FRPB 3PUVA 3AEAB 4WJWA 1TR5A 1CTMA 5CBAE 5CV9A 1CQFA 3E0JA 2BW2A 1JALA 1XLQA 4FXGC 1IYUA 3ONAB 1GHKA 4JPSA 3S2DB 3KK7A 1PZJD 2RSNA 4TMAB 3QO2A 1NSNS 1VZ7A 3SEBA 1MHHE 5JPNC 1XF5L 4IUNA 2IPKD 4PMBA 2WINB 2L52A 4J3OD 4HEDA 1H9JA 4F7XA 1ZE3D 2SOBA 1RHPA 3NTHA 5FO9B 5M5WB 5DAUA 1XTCD 1VLBA 4BBSB 1STYA 3DWPA 3NTIA 4XYOA 3K0YA 1MI2A 3E9SA 1H9KA 1D2BA 1WXQA 5C0XG 2JE6I 4B08A 2L83A 2MP1A 3U4EG 1WYGA 3RLFA 4ZK9B 1DGJA 4KKIA 2F0DA 4HEA1 4A3IB 3VR6A 4R3DA 1NUCA 1XCQL 4ODGA 1PTOC 3X3MA 1H9RA 1E10A 1AFPA 4C7ZA 4C2MB 1N5XA 3GTMB 3D8GA 3NXWA 1UAPA 1BUVT 1T3QA 3IAYA 5IGDA 1CHQD 4HROA 4IURA 3BK1A 3GV3A 2WDQB 4QIWB 5BYSA 2RMMA 5I2XA 1FD6A 5EPJA 3TBIB 3IFTA 2JXMB 4HCSA 2EDGA 2L4NA 1IGDA 4R8NA 4U68A 3OSOA 3RPFC 1FFUA 1AEXA 3K7AB 1K8MA 2XIWA 2GRIA 1BCPC 4PQXA 5IGGA 3EA6A 2O5IC 3BK2A 3LYYA 1OXVA 1FFVA 1KNAA 2A6HC 4IUVA 1CHPD 1KF6B 5EE3A 3AEEB 3ZYYX 3URYA 1UWXA 3HKZB 4J8QA 4OW0A 4H13C 2A69C 1F9PA 1F2YA 3NQTA 3KLSX 2NMQA 2NVXB 5J39A 1EY5A 1STBA 5IT9E 2RKSA 2PVGC 1J8IA 4O1NA 4V0BA 3U7ZA 3Q69A 2VXWA 2K1BA 2WXNA 1BDOA 1YNJC 1FM0D 1FCCC 1I4QA 3MFGA 4KI0A 5KNCA 3RZDB 1K52A 2Q8TA 5JPMC 1II3A 4K5XA 1C48A 1JOKA 2WXLA 1D4BA 4ARIA 3HEJA 2KA7A 4XTCS 5HGTA 4QF4A 4ZRZA 1LTRD 2IGHA 3LX0A 5D65A 3SFDB 1KLGD 2BT6A 1F0ZA 3Q8EA 3Q8CA 2OT2A 3P4PB 1QKZA 3M4YA 3VA7A 4DA2A 1EQVA 1L6UA 3IKJA 3AN1A 3ERQA 3NVWA 5BN4A 3BWUD 3NVZA 1YQ3B 2H89B 2OEDA 2FE8A 2PVOD 2RSOA 1SNQA 2IX0A 4RH6A 2JA8B 1B9RA 1FNVA 1BO0A 2PYKA 1ML0D 4CJ2C 1PRTC 5I9PA 1C4PA 4NAWB 1VMPA 4K2KA 4A3FB 1TY0A 3AMUA 3I91A 1MHXA 1DOXA 2WDRB 3MHZA 4IDIA 3NBHA