1KLUD

Crystal structure of hla-dr1/tpi(23-37) complexed with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
239
structure length
230
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Minor structural changes in a mutated human melanoma antigen correspond to dramatically enhanced stimulation of a CD4+ tumor-infiltrating lymphocyte line.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/toxin
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR ALPHA CHAIN
total genus 67
structure length 230
sequence length 239
ec nomenclature
pdb deposition date 2001-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1kluD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1kluD02
1JQYD 1PRTD 1I4XA 1FNVA 1V1PB 1TS3A 1CHQD 3R2TA 1PRTF 3SEBA 3BVZA 1JWMD 1EU3A 2J4XA 2QEJC 2G9HD 1PTOF 4DXGA 1S5ED 1JR0D 1TS5A 1V1PA 1LT6D 3MC0B 1ENFA 4RH6A 1PZJD 1I4RA 5ELBA 4OHJA 5ELFA 1B1ZA 1EEFD 1CQVA 1TS2A 3DWQA 1L0XB 1LTSD 4UDUC 4C56C 3MFGA 1PTOD 1LT3D 1D5ZC 2TSSA 5ELEA 1ET9A 2NTTA 4TSSA 5I4DA 4RGNA 5ELDA 4DXFA 1LT5D 2AQ2B 1D5MC 4K6LA 1SEBD 2AQ3B 1PRTC 1PRTB 1S5FD 1G8ZD 1I4GA 1PZKD 1LTID 4RGMA 1HQRD 1HXYD 1BCPF 1XTCD 2ICIA 3BVGA 1S5DD 4RHSA 1LTRD 1YN4A 1SJHD 1QILA 1LTGD 1TS4A 3DWAA 1D6EC 1I4PA 1SE2A 2R61A 1M4VA 4L63B 2QILA 2XRSD 1ESFA 2CHBD 1PZID 2RDGA 1BXTA 4RGOS 4RHRA 1UNSA 1RF2D 1YN5A 1SE3A 4RCOA 4Z9CB 3URYA 2IPKD 1RD9D 1TY0A 2SEBD 1MD2D 3V05A 1PTOC 1FGBD 1PTOB 2AQ1B 1PTOH 3BZDB 2XNAC 2NTSA 2O2LD 3EFXD 1HA5A 1L0YB 5FKAC 4ZYSA 3R8BA 1CHPD 1BCPC 1BCPB 3BYTB 2XN9C 1CK1A 2RDHA 1EWCA 1GOZA 1S5BD 1ET6A 3W2DA 1EU4A 1JCKB 1EFID 1JWUD 1S5CD 3DWPA 1SXTA 4L6TB 1RCVD 3CHBD 4NZLB 1LTTD 1LO5D 1TY2A 4RFBA 1LTBD 3BVMA 1YN3A 3R2IA 1I4QA 1D5XC 5TSSA 1RDPD 1DYQA 3OWEB 1CT1D 1AW7A 2Z8LA 1HTLD 3TSSA 1FD7D 4O1NA 1KLGD 5FK9C 1LTAD 1DJRD 1I4HA 3GP7A 3KLSX 4BWGB 1PYWD 1LT4D 1JWSD 1FNUA 3O13A 5ELCA 1T5XD 2WV6D 1V1OA 1F77A 5D3DA 1AN8A 5D3IB 1KTKA 1LLRD 1UUPA 2IJ0A 1BCPD 1SBBB 1B44D 4RGTA 1SJED 3BYYB 1KLUD 1XXGA 1SE4A 1STEA 3EA6A 1FNWA 1EEID 2XRQD
chains in the Genus database with same CATH superfamily
2ZTEA 4BVUC 2CKZB 2O6VD 5CHWA 4BXXG 1VCBA 5E6OA 4DQOC 2RSOA 3AEEB 4XYOA 1JRPA 2PW9A 4EQ5A 2O5IC 2GVBA 5CMDA 3NZSA 1V80A 3M4OB 1XLQA 2G9HD 2VB3X 4NXNQ 2JZ3B 1YQ4B 1JR0D 1VQKA 2PE9A 1B9RA 1U5KA 3ML9A 3RN2A 4K3CA 2A69C 1F0ZA 1O7LA 3IT4B 2BH2A 1IBLL 5FOBB 3AECB 3PF5A 3JSVA 1VQ6A 1X65A 3Q22A 4OX9Q 1HNWQ 1WJ4A 3A1QA 2G5DA 3D31A 1J0GA 4F7ZA 4FF3A 2BOSA 4ICVA 2ZM6Q 4X3TA 1CZWA 3N1YC 4DV1Q 5C4XB 4DUZQ 2MPMA 2KWUB 4LLGM 3OG5A 3S2AA 2KQ3A 1C77A 2F3VA 1A2UA 1IBKL 3WIMA 3CSTA 2BBCA 4RF0A 1A3TA 1STNA 3HS0C 3VYUA 2O4XA 2QEXA 1Q1BA 4OIKA 4BAXA 4XWWA 2JF5A 1HFGA 1CZGA 1IGDA 3T56B 3M3JA 1EY5A 3MTSA 3APDA 3AFPA 3BDOA 3A56A 4TRDA 1J7AA 1HUNA 1GM5A 3A9JB 2F1MA 2DBYA 1WCMG 3C1EA 3E56A 2WXGA 2WX0A 3L2PA 2J0JA 1PZID 2RVLA 4FBJB 3QA8A 4KDIC 1Y1WB 1VQEA 5T1IA 2JA8G 3C19A 3ZKJC 1CKNB 2F0KA 2AWNA 1F9JA 1K0RA 1EO6A 3I9V1 2F0PA 3MXUA 4DV3Q 4FVMA 2N9LA 4ANUA 3R3OA 1J8CA 1K8OA 3W9CB 2V3NA 2R3ZA 4C3IB 2LJIA 2LRUA 5AUIA 1T3QA 1JT8A 3QAQA 4KDLB 4NXNL 2A6HC 2HDMA 1XMQQ 4Y7NH 2BDNA 3PT2B 1EIGA 4KGTA 1XNQQ 4LUZA 1GOZA 2E2DC 1FD6A 1CKMA 4EKUA 2PZUA 2BA0A 5G3LF 3PHXB 2LMCB 3FKIH 4WWOA 3OTOL 4KTAA 3RLFA 1JROA 3E9SA 3P4RB 1YNTE 4GOCA 4IDIA 1DOMA 2RSUA 4IM2A 3CWIA 1YX5B 3KLSA 3Q69A 3HOVH 3K0YA 1C8CA 4GKKQ 3QARA 1VF5C 1XCTL 2DNFA 4DHZE 3KYCD 5TSSA 4WJOA 3TEYA 1ZXHA 4H2AA 3SVMA 2Q5WD 4DHJD 3Q8CA 4IUNA 4M02A 4CDFC 3IXSA 3PO3H 2VS1A 1KL9A 3K5NA 1BNZA 1J9OA 3TP7A 1RLFA 3EECA 1JE4A 4LF8L 4ZRIA 2F0MA 3J81i 1V5OA 2GMIC 4K81A 4DWFA 2INDC 1PH7A 2N7EA 2UU7A 1I4HA 3G4SA 3MP9A 5IE8A 2PQEA 2VQFQ 1N5XA 2IO3B 5ELCA 4KN4C 2HQLA 2K04A 2M1MA 3QWZB 1IBMQ 1NNXA 4BXXH 3TP6A 2AUJD 3X3NA 3M85A 2RBMA 3NZ3A 5D3DA 4XE0A 2NVXH 1J7BA 4UP8A 5J3BA 2L11A 1C1YB 3D32A 2NUCA 3VYTA 1Q90A 1FXIA 2QCZA 1L7YA 3JC66 2JU6X 4NAMA 2ZVNA 1EEID 3H15A 1GHKA 3FILB 4ZOHC 2LXAA 4B3TQ 2IGHA 5I9PA 4CBVA 5M3FH 3U4ZA 4DUZL 1P1AA 2D0OA 3R2TA 1WTWA 2PKOA 1D8LA 1H9RA 4BBRB 2GN5A 3S1QB 1C7YA 3AU4A 2E76C 2K4KA 1B9NA 3VQIA 2PVOD 5C4JH 3DVGX 1JICA 1EYCA 4LAAA 2G3QB 3K9PB 3UI2A 4I6PA 3PS6A 3J81L 3HKSA 3RNAC 2UXDQ 1L0VB 5ELBA 3BDLA 1XLOA 2FMCA 4IJHA 3TS2A 2LASA 2NR2A 1YZ6A 3HOYG 2PQAB 3NHEB 3CIRB 3ENEA 4LNFA 1Q81C 1VQOA 4POGA 1ET9A 2PPHA 5C2TB 5KNBA 2F3IA 5GQOA 1I6HH 3KUZA 4L23A 1ZE3D 4EQPA 4DR5Q 4R8NA 1EIYB 1VS0A 2B2WC 2NPTB 4C1NI 1PRTC 3VDZA 4DV1L 2LGYA 5HKHA 1WXAA 1N34L 2D11A 2KENA 4OWXB 2BE5D 2K5HA 1YX6B 2ICIA 3H91A 4IWOA 3VVWB 5C4ZA 4C3JB 4B3MQ 3TMPB 3G48A 1J5EQ 2JA5B 4NQKE 4C2MB 2INCC 4CGYB 1Q12A 3PO3G 2K0PA 2KANA 1OFFA 3NOBA 4L63B 2VQEL 2QILA 4K2LA 3N3KB 3WWVA 4KZCA 1SFOB 1KC8C 1TJEA 4NPSA 3I70A 1K8MA 1DOXA 2D2CC 1P3QU 4RCOA 3PTFC 4P6VF 3ULJA 1Z47A 1UGMA 4BOZB 4F8CB 1PDXA 3I63C 4CJ0B 4HTHA 4GXBA 2CU3A 1IW7C 4TKOB 3EFXD 1PH9A 2DZIA 3PO2G 5BN4A 2I5MX 2I1JA 4KGSA 3Q8EA 4PYUA 1AZQA 2EYOA 3BYTB 4RKBA 1FCCC 3NE5B 2R92G 2YU9B 1MKHA 3D8GA 1F52A 3ND9A 4YWMA 1PH1A 2UUAQ 2JA6B 3I4MB 3IHPC 5GAGC 3GTMB 1MG8A 2Q2UA 4OO1G 1LTTD 5HHDG 1HNXQ 3CF5A 4RFBA 3P20A 2IO1B 4IUTA 2SOBA 1CA6A 2C60A 4UHVA 1XNQL 4X6AH 3DVGY 1QJOA 3NTHA 4HK2A 4WIPA 3RCZA 2KCMA 4GNXC 2OQKA 1KLGD 3K7AH 2AEHA 2B2YA 1WGRA 3TIXA 2FHTA 2LHDA 4AS1A 1SYFA 3HKZE 4DV0Q 4B3RQ 1ENAA 1WOCA 2EMSA 2H4OA 3RNGC 2A73B 2B2TC 1QVGA 3LXFA 4A93B 3TMEA 4IQZA 5D3IB 3G6EA 1FFUA 5D94A 2DZKA 3G7LA 4QIWE 5DPWA 4BKSA 1EY7A 1VZ8A 2NBVB 4DA2A 1HRJA 1Q46A 2F0VA 2HD3A 1W6KA 1UE5A 2M2LA 3GTLB 3PLVA 4FJZA 4ZYNA 4CQNA 2PQAA 2OCEA 2KC2A 4BA1I 3AU5A 2KUMA 2JYTA 3K81C 1ZXTA 2FINB 3HM6X 1KRTA 2MGSA 5KIXA 2WAQE 4JVZA 1TKEA 1E5WA 1GNUA 3WALA 3NS1A 2JQRB 2F0GA 2B2UA 5AZGA 2PVGC 3PF4A 1Q1OA 2NN6G 2EZVA 4KX6B 1B1ZA 2JA6H 1TTNA 1KABA 3GTOH 2C7NB 3FILA 4X57B 3I4NG 1LM8B 1UBIA 4DK3C 2Z0DB 1QB5D 1GAQB 4YWKA 3BWUD 1SE9A 1LT5D 4ZRZA 3DBRI 1K51A 4IO9A 2E3TA 2XTIA 4K6LA 4V190 2O5JC 1K8RB 1KH0A 4AWJA 2N9XA 4MJSB 5KYIA 1JC7A 3FKYA 5K36H 1AWDA 1LTID 1R4NI 3I4NH 4RGMA 1HNZQ 4GNXA 1N34Q 4GKJQ 2Y5BB 4XZ4A 3SU8X 5CV9A 3S16B 2EYFA 2WX1A 3KF6B 2PO4A 5C44G 4Y52H 1V6EA 1VLBA 4A3BB 1XO3A 4NB3A 5E6JA 4ARCA 3SGIA 1NEKB 1Q86C 1OXTA 2O6VA 1P7EA 1X9NA 1M4VA 4HJ8A 4A3DH 3KUPA 2R93H 2F3WA 5ELOA 3I56A 1QOAA 3A8JE 1NUCA 2YLMA 1SNOA 5IT9c 3H7PB 4ZKBB 2JEBI 2BWES 4Y7NB 4GLSC 3ZNGC 3ZVVA 2BPSA 1U4LA 3RZFA 1JMCA 2DJGC 2R7ZG 5M5YH 3HG9A 4RCNA 3T1YL 4KKIA 2A5HA 5JEAG 2LXKA 3IRBA 2M0AA 4JX1C 1K3BC 4DNRB 2NTSA 2K52A 3ECIA 4YTPB 3W1SC 5IA7A 2MW5A 4GGQA 1RODA 3E0EA 4IWPA 1SYBA 3W1SA 4BBNF 1SIFA 3ZXVA 2BDOA 3NUCA 3K5MA 3NQIA 2NVQH 1HUMA 1CSQA 2J42A 3U7ZA 1IP9A 4GLVB 4NZLB 2I5LX 1SXTA 4KY5A 1JQ4A 1EF5A 5BMIA 3HK0A 1FYCA 1W6JA 2PIAA 3CPWA 2WDTB 1D5XC 4JI5Q 3PUWA 5AZHA 4OZBA 4GDLB 3L17A 3AFQA 4JI3L 4L2YA 5CGKA 3MAQA 2B8GA 3PO3B 4YTMB 3A9JA 1YNJC 2CKHB 4HRSA 4KI0A 4OONA 4C3IG 5E6PA 1L5PA 5AZFA 1QZHA 1XMOQ 4PNYA 5C5MA 3HOUG 3CF6E 4N59A 3P7JA 2UWQA 1SSOA 3NBIA 1HPCA 2ZNVB 4BKSD 2MJ3A 2NWGA 2I07B 3MXPA 4LF4Q 1C76A 2K6QA 2A68D 4W9IA 1T5XD 2RCFA 3J81c 1TKGA 5J18A 1VQGA 4KJNA 2G1EA 3LNNA 1TZ1A 3VA5A 2WP8J 5H8YE 1X3EA 2ZCBA 2KAJA 3HZXA 1WXVA 3TBIB 2KMAA 1L1OA 3OAWA 3W1BA 2EY6A 3Q0AA 3FPPA 1QZEA 1UE1A 1PXUA 3ZNZB 2WU2B 4K2KA 2UUBL 1CHQD 1NMGA 1VQDA 3ZNID 3UQAA 3S1QH 1JW9D 1C3TA 3T3NA 1A15A 1UE7A 3GTGB 3WANA 3ICEA 4A55A 2I2YA 1A8VA 4DV4L 1YNXA 4YIJA 3P42A 2NCNA 4ZRPA 3STBC 2V3PA 2W54A 3CXCA 2EXZA 3SK5A 2K03A 2B63H 1FMAD 5FLMH 2BQQA 2MBHA 3J9CA 1ACCA 4DR4L 2B3AA 1PVOA 1CMXB 2VZKD 4LF5Q 3SDLC 4II3B 2HDLA 4GMVA 1P7FA 3HUIA 5G55A 1O7YA 2RQXA 1D5MC 2L55A 4BS9A 1TWCB 4JV5L 2ZJRA 2KLCA 5C4XH 4R1JA 1DD2A 2BYVE 4XXEA 3F2UA 2AX5A 1G8ZD 4CHTB 1XMOL 2EIFA 1M8AA 2LSSA 1BMLC 2HTME 1F2MA 3AEDB 3NVYA 3W5UB 1G291 1T0QC 1XX8A 1D3ZA 4LNKA 1S5DD 4HMJA 4AYBB 3L54A 1R4PB 3HEJA 3LB8C 3T53B 2B2YC 5EGTA 2IY5B 1KHIA 3T13A 3DBLB 1VMCA 2ZM6L 4HIDA 1WZ0A 3VUXA 2RHQB 2BYTA 3S1RH 4JBMA 5L95C 1L2NA 1ESFA 3EROA 2FIDA 2CHBD 4K0KQ 2KWDA 1F9PA 4KN7C 3DEOA 5DLQE 2HJ8A 4MDKE 2OF1A 4Z9CB 3S1RB 3CCQA 1OQQA 3GTKB 2VXWA 2L0TA 2ASQA 2KWCA 3NRZA 1WGYA 2N7JA 5AFWA 2F0HA 5CHVC 3T51B 4A3IH 2MRPA 2QMTA 4ZYSA 1JORA 4ACFA 4K3BA 5C0XH 1G6PA 2L7RA 4IUVA 4FDBA 1M94A 2ZEQA 1KLVA 1YI2A 1QE6A 3Q8DA 4A4IA 3J81j 5G3LD 2E6XA 3FMCA 3W2DA 2A8VA 4CJ1B 1U4RA 1EU4A 4KSLC 2G45B 3CHBD 3DUZA 1UF0A 3HVDA 3VTUA 3ZLZA 1HEZE 1I3QH 4C7YA 2KJRA 1VDZA 1QLBB 1WCMB 4I65A 1UZXB 4WAFA 1DXMA 3A55A 3PMFA 4XDDA 1EQTA 1X1MA 3HKZG 4XYQA 2CFMA 1KIXA 3K0XA 3OIPA 2MA9B 1A63A 2F0TA 2GVAA 2KACA 4ASWC 1WCMH 1E8WA 3A9KB 4W9JA 2KMMA 1Q10A 4C3JG 1YHQA 4DK6C 1LTAD 1F1HA 2MHJA 3UGBB 3T3OA 3KWLA 4OWTB 4KZ0A 1JWSD 1RJTA 3J7AV 4RKLA 3SHLA 1WF9A 2KQSA 3PUZA 4DV7L 5M5XB 2OTJA 1WGGA 1HR0Q 4R4QA 5GAEC 4DNTB 5C4XG 2N4FA 2WXNA 3Q14C 2LFIA 3VRAB 3BIID 4DV5Q 1WY8A 1BKBA 3MC9A 2K05A 1PGAA 3KF8B 4X66Q 1SJED 1YITA 2Z4HA 3BYYB 4A3BG 1J6QA 4HN7A 3EA6A 1GJXA 3BG3A 2KHSA 4DR7Q 2N1WA 5BR8Q 1JJGA 2HIXA 1PH6A 1V8QA 1WJJA 3I5JC 3Q3NC 1VZ6A 3EIVA 3SEBA 3BVZA 1JWMD 1EU3A 1VD2A 4E74A 1YOVB 2WFWA 1Q5WB 4NY0A 1VQ7A 3AE3B 3GZNB 1V1PA 2KCNA 1K50A 2K22A 4EFOA 1SNQA 5A35A 4RH6A 2CJNA 2CU1A 3DHGC 4B0EA 3ALBA 2KJ6A 4FXDA 3S2DH 5ELEA 1E7UA 3T8MA 5M3MG 5D6JB 4X62Q 5JVG3 4Q0FA 2FUG1 1VCIA 2CHXA 2I5HA 1IL2A 4PS7A 1SEBD 2K6AA 1GKHA 5HGQA 4GIVA 1S5FD 2KCTA 2Z0SA 4WFN3 1W3SA 1S3SG 3DCGA 3KJOA 2RF4A 1E1TA 4X3UA 5IP9H 1MG4A 1K83H 1OO9B 1ZKHA 1TWCH 1VRAB 2KJXA 4ARIA 1SJHD 2DZMA 3E9IA 3O65B 1EY0A 4DGZA 3DBHI 3MHBA 1RFKA 4M01A 3AE8B 4TMAB 2Q8RE 5COYA 4KIKA 1DOYA 3KBGA 3VAWA 4C3JH 4WAAA 4X62L 3LDZE 1R9TH 1ILPA 1JOOA 2J0KA 3D4DA 1GC6A 2PLPA 3NQTA 5GROA 1Z7TA 3GTQH 3JYUA 1QUQA 1OEYA 3F1ZA 3GTJH 2LI5A 1RHPA 2CQAA 2AQ1B 4FO2A 3PUVA 3J80L 3A0JA 1MPEA 4NJ7A 3N20C 4ZDVA 4M8MA 4DR6Q 4YCWA 4A90A 1EWHA 4JGHB 4JI8Q 2KHJA 3DXJC 4JG2A 1AP0A 1STHA 3AE4B 1EY8A 1RM6C 4RM9A 4DAVA 3PIO3 1UGJA 1WI0A 4A3FH 2DLBA 1X56A 2A6ED 5ELNA 1TKWB 2A68C 3UE1A 2K1BA 2K7VA 2KN4A 1NSNS 4NNJB 4XIGS 2QCPX 2F0JA 4JC0A 3CCLA 3GTPB 2P5ZX 3U58A 3NPPA 3B6YA 1Y8OB 3ZYYX 1M1KC 2CWAA 1WMHA 4W9HA 1ONLA 3L0OA 3NBHB 2R7DA 3F2DA 2KO3A 4JLCA 1Y14B 1CT1D 1IL8A 1AW7A 2KHIA 1ILQA 5IGCA 1XPOA 4II2B 1IYJB 2KXJA 5C3JB 4OO1I 4A3DB 3DQVA 3P1MA 3PGEA 1XPUA 1MGSA 3AXCA 3N30A 4LW1A 3JAMc 1VQHA 2WINB 5M3MH 4MSMB 5JAVA 1DJRD 2UXCL 1GXDC 2MX2A 5IOIA 4GKKL 3PV0A 3K57A 2BVCA 2ZNVC 4UPAA 4S0RA 2XSCA 1EYAA 4XGAB 3TBLD 2BE5C 4MM3B 4AQ7A 4M8AA 1V97A 1HQMC 3TP8A 3KK7A 1LLRD 1E8YA 2LGDA 4ANVA 2E5LL 5LL6X 2N8NA 2ZPYA 1RYJA 2DAJA 4J3OD 3GTJB 4HSPA 1VJKA 4LF4L 5JJKA 2QDLA 2Q2IA 1GUSA 3UDIA 2WDVB 4MSQB 4FLHA 1G51A 1WTXA 1SGHA 2J52A 1FNVA 3QC8B 5EKLA 3I55A 3PZ7A 4TQUS 2LWPA 2QEJC 3RD2A 1OQRA 3AMUA 2B63B 1S40A 4MH0E 5DM63 1ZDXA 4HMIA 3MJWA 2K5NA 4CKEA 1HHVA 4R9WA 3QJZA 2EQSA 2L8JA 4USAA 2PYKA 2FUHB 4M1UB 1OTCA 4X3KA 4C3IH 5LMUQ 1TBEA 1STYA 4JPBW 3I4MH 2MBBB 5CV6A 4IKGA 4AIMA 2LHEA 2B2UC 1FR3A 3T1HL 3N1XC 1GB1A 2F0QA 2JPHA 1H9MA 3AN1A 2AWOA 1WJUA 3B0AA 2NN6I 2XK5A 2MWSB 1EIFA 4KV2A 2M0XA 2HE7A 2RPQA 4JQWC 2N1VA 2A1AA 1EL0A 1B3QA 3KDFB 1I3QB 1U4AA 5LXIB 2MO0A 2RD0A 1X3QA 2KEEA 3S16H 2JZZA 2MUYA 5CTRC 3R7QA 4PV1C 1ZW7A 1PGBA 1GO3E 1SNPA 4E3CA 1UWVA 4FULA 4EZKA 1UELA 4L1BA 1T0RC 1LTLA 1XTDA 1K83B 2F0SA 3KF8A 2LRWA 4HDQA 4DV2Q 3M9BA 3VR6A 2DNCA 2RDGA 4L5TA 4LF5L 4LFCL 1LV9A 3S1MH 4JBKA 2JA5H 1FEHA 3SFEB 3ITPA 3HOWH 3GQBA 3QIAA 4DK1A 2DN8A 1NJIC 2UYZB 3H6NA 4P1CC 2K25A 1NR2A 1VQCA 5DCNA 4AOFA 1YIJA 2FE8A 2EDGA 3S1MB 4A3DG 2JA9A 2WKDA 2XNAC 2JWUA 3L0WB 3K5LA 4JE3B 1Y1VG 5FKAC 2WLBA 4BFRA 2YV5A 2HJ1A 1F2RC 2M8SA 4R4TA 3BY4B 4H13C 3EVQA 3AEAB 2JK8A 5KNCA 2GRIA 2CVRA 5EE0A 1YJ1A 3NTIA 2EJMA 1YQ3B 4DK0A 3V3XA 1JWUD 2L3ZA 2FNJB 4L6TB 5C3EG 1RCVD 2Q8TA 3UE0A 4DV2L 3L08A 4IC7B 2IW3A 3VR4A 2PE6B 3PUYA 5CORA 3C2PA 1WE6A 3M3YH 2IO0B 2NZOA 5IYDG 4JI8L 3ZJUA 3HP3A 1TR5A 1VDVA 4LK1C 5F2DA 1N33Q 1YD8U 5IGBA 1YJ9A 4C4VA 4P7IA 3I8ZA 1X32A 5IIFA 4H0LC 4DHJB 1HTLD 2IY0B 2QSDA 3A8IE 1PYBA 4DDGD 4XQNA 3H8HA 2WIIB 3KLSX 3GP7A 3CCEA 1EF1A 1RTNA 4IPGA 1FNUA 2F0EA 4N9PA 2UUCL 2GBMA 2V1CC 2MBOA 5A2QE 1FPYA 4ME3A 2KDFB 1AE2A 3AEFB 2H89B 4BKTA 2PMZE 4FF2A 4JL9A 3VR5A 5T8IA 3U50C 4K0KL 5I6WA 4IUPA 3BK1A 3STBD 4DV6Q 1N63A 2AWTA 4IZ8A 1SMYD 2I1KA 2KDBA 2PTLA 3RNCC 4LJZC 2HD5B 2YYZA 3M7NA 2IZVB 3E5SA 2PZTA 4JI2Q 1YJWA 3AE6B 3VR2A 3PRMB 1TS3A 1EUVB 2WWZA 1IUEA 2J4XA 1MSGA 1NR4A 5A2QL 2UU9Q 5T1GA 3GTGH 1K53A 2HCCA 1SIJA 4JOIC 3ZRCA 1ENFA 3W5VB 5J39A 2MLBA 4W9DA 1PZJD 1YQBA 4IFDH 3DWQA 1EEFD 5EE1A 4C56C 4BA2I 3FKIB 1IBXA 4L8JA 4B9WA 1JWAD 3PREA 4ZUJA 4LF6Q 4BY1B 1L4DB 4NXMQ 1SAPA 2AQ3B 5MPOA 2FIFA 4QY7A 2E74C 1QZGA 5JPNC 1PZKD 1NY4A 3ZJVA 2UU9L 4P75A 4GN5A 4KKJA 3U9OA 2JP1A 1STAA 1VQLA 1MIUA 2XWJB 3K5OA 5IYDH 1CZPA 3GTPH 3G71A 2MP2A 2NVTB 2DAFA 3I7FA 4JCVE 4KLKA 4R4OA 4FF4A 1TS4A 2Y5PA 4FXGC 4A3EG 3QCAA 1P0RA 3TQYA 5BYQA 3VHTC 1QCBD 2YTYA 4X64Q 3I4LA 3H3VH 5K36G 1PDQA 1WVLA 3KYDD 2EYMA 4ZQ3A 2RGFA 4KV6A 3TJPA 5NUCA 4GN1A 2KTRB 4MEMA 1VMPA 3NEMA 3FVQA 4I6NB 2BB5A 1RTOA 2SEBD 4XX5A 3V05A 3Q3JA 3NVWA 4UP7A 3BINA 4JI4L 3DMUA 4NDXA 5JOBA 4OVVA 3NWSA 2O2LD 3FP9A 4OO1H 1MHXA 2BKFA 2DHZA 1YMHE 5EPJA 4RAUC 5IO9A 1D4BA 1N61A 4MGYE 4F8MA 3AU7A 1WXMA 3RI7C 3K58A 2KWVB 1HZAA 4MHEA 2WB1G 4A3GG 3HKZB 3KDFA 1WTRA 4GDLA 4GN3B 5M3FG 4LUOA 4OWWB 1QG7A 4CKCA 1YEZA 3HGBA 5IP7G 3OSOA 1YIWA 2PZWA 3EQLC 2ZZPB 2L00B 2JA7B 1BF4A 3IAM1 4WJPA 4HCNB 4A3GH 1T5EA 2D9UA 1OXVA 3Q8AA 1GHJA 2HUGA 1WZ3A 2GBNA 3WOFA 1ESRA 1J7CA 1TIID 1XLPA 4IUUA 1I5FA 4HCEA 4W9FA 1PFNA 1HZCA 3NK9A 2L5TA 4R4IA 3H6MA 1TIFA 4FA6A 1HTOA 1I42A 2LY7A 4L5SA 3P2BA 4J6HA 4A3KG 2HT1A 2R7FA 4DBGA 4LUVA 2MJEA 3H7PA 2RKSA 4DR2L 4OX9L 1HNWL 4JWUC 1XD3B 2JZPA 4IURA 1KLUD 3P63A 2N7DA 2MEKA 4POFA 4BBNC 2N0SB 4FNFA 4QAYA 2ASBA 2VUMG 4ODGA 5E4WC 4B9KA 1J5EL 3J7A5 3KF6A 3LJ3A 1EQVA 4K5XA 2N3SA 3TUOA 2LXJA 4LFBQ 1I94L 1MJDA 4U68A 2V4LA 2ZVOA 2KMCA 2KQ7A 3A7LA 1RIPA 3MC0B 3K6OA 4NKLA 4MJSA 3K9OB 5BN3A 1E10A 2OWOA 2W82A 4H7BA 1HE8A 3EFCA 4WWPA 3F2BA 1BBXC 4A3MG 4DR5L 2F0IA 2MO1A 1F2LA 3GV3A 4FXKC 2ZJPA 3C3LA 2R92B 1T0SC 2KVZA 2LXCA 3AQQA 3UF8A 2UUBQ 1FJGQ 4UDUC 3MEHA 4GLXA 3NBHA 4K7WA 2JSVX 1PTOD 1LT3D 1D5ZC 2M00A 1O7ZA 1WMHB 1WRDB 3A54A 1N36Q 1HNXL 4RGNA 4QMGA 2R92H 5EPLA 4DV7Q 3DVNV 4M0WA 3CMAA 1WGKA 2RMMA 4F1SA 5JJZA 3U9SA 4CHKA 4KMUC 4ZCKA 1SNDA 1UWXA 4WJ4A 3NG0A 4RM8A 4FP5D 4IUQA 1CFMA 5IGDA 1I94Q 2NBFA 2V4DA 3QG1A 1XT9B 3PVLA 1LM0A 3M3YB 4EVOA 4HR7B 1CTMA 3OMGA 3DOWA 1WYDA 1L2FA 2NVXB 3JAME 2WB1B 1VQPA 1B9MA 2Z1CA 4A3GB 3I2ZA 1WTOA 1E7VA 1QVCA 1BBUA 4JI7Q 2R7ZH 3AULA 3NSWA 5CHFA 4XTCS 3CKIB 3ND8A 4P2CB 1DCZA 1JRUA 2AL6A 5D65A 1C9OA 5IYBH 1ZGUB 1QUQB 1SN8A 2I46A 1I7HA 1WX9A 1VQ9A 2KFKA 4DNIA 1RF2D 1YN5A 2ZCCA 1TWAH 3U30A 5LL6S 4DV3L 2NB0A 2KQ4X 3DBHB 1P16A 4W9KA 1NENB 4KIKB 1ZYRD 3OW2A 1IBXB 2A6HD 4TV3A 1IW7D 4A3CH 3H0GH 2MP1A 2N78A 1H9JA 4KVGB 3QOLA 2K8CA 2JEAI 4C3HG 5FJ8G 5JVH3 3HOYB 5DEHA 1NBWA 1ZYRC 4ILWA 3R8BA 2MJ8A 3VUYA 1CK1A 1Z9FA 4DV0L 2BF8B 3CC7A 1XNRL 1L6VA 3AH7A 2G4DB 1SYDA 1G6JA 3DBLI 3VRBB 1YJJA 1CM9A 1I50H 4DXAB 2WXMA 1ISNA 2W55A 4N6EB 2ZTDA 4JI0L 2L4NA 4FXCA 3SR1A 4BBRG 1X3FA 3R3MA 4PZ7A 1Y1WG 4YTNB 2OTLA 2JA7H 5M3MB 2R2QA 4DHZB 5JHAA 4A3KH 2XGTA 4KHPL 1V86A 2KYWA 1SE8A 1I6HB 2KT7A 3FKIG 1C4AA 3N9YC 3Q3MC 4HXDA 2VRRB 2H1EA 2HIVA 2KVMA 3S9WA 1IBKQ 4JOIA 2ACZB 1XMQL 1ZKOA 3OJ3A 3AYHB 4BWGB 1E2VA 1GD7A 1PFSA 1QNUA 5BR8L 3U4EG 1WXQA 4A93H 3JAMi 4OEMB 3VR9B 2UXBL 4I7AA 5LMNW 1VQ8A 4IG7B 4HLEA 3RNEC 2JE6I 3I73A 2PJHA 2Y0SB 4KY7A 4CYEA 3ONAB 5HG2A 3IFWB 2KEDA 3APCA 1LXDA 3H0GB 1JQYD 1PRTD 1FXTB 1FVIA 2X8XX 3CW2C 2SAKA 1R4QB 3MTNB 1HR0L 2K01A 3P4QB 5IAAC 2KFJA 4LFBL 4FYDA 3QK0A 2B2TA 4IN3A 2D3BA 4MACA 1FGUA 1X55A 1WIAA 1DGJA 3RNFC 4DXGA 1TS5A 2D3CA 1LT6D 4B3ML 2PW7A 2NPTA 3CCRA 4KD3A 2J7ZA 2KKCA 3AEGB 3ETRA 1TWAB 5IKCM 2IY1B 4L5RC 1V49A 4GLAC 1JE5A 2EE1A 3RT3B 1WTHA 1LFDA 4EOYA 4TKNA 3V96A 4YWLA 5JEAH 5IWAQ 3S1NH 3S2HH 3DBSA 1LABA 1L0XB 4K5WA 2J7QB 3ABVB 1TWGB 3HOXH 1MVKA 4TSSA 3SR6A 1Z5SB 3J80c 1PH8A 1XJVA 3M7GA 3HOZG 4MZ9A 3NXWA 2EJGC 4GOPA 5M5XH 3ULLA 1E8ZA 2AHOB 1OGWA 3P1HA 2EXDA 1E8XA 4KKSA 1II3A 2JYOA 2K14A 2SDFA 4PZ6A 3FAHA 2O2VB 1SMYC 3AE7B 4TQ0A 2B2VC 3KFUA 3ZTCA 1WYWB 2GLSA 1EFWA 2JUOA 2RSNA 1TVXA 3E0JA 2MQJA 4OIJA 1QOBA 2L9HA 4JI7L 3IVFA 5KRUA 2IT1A 4AUQC 2B3GA 2V3SA 4HSVA 1D6EC 2E2JH 4YT0B 4OL7A 1ROEA 3NWTA 3A33B 5HGTA 1TYGB 4YHHL 1KF6B 3TRZA 2XRSD 4UY8C 4HPMB 4W9LA 2KZRA 4RMAA 4RGOS 1HZ9A 1YNND 5J1ZA 1JWBD 3AEBB 1JOQA 3PLUA 2BCOA 4YCUA 2ZXOA 2LUMA 3RMHA 1R4MB 4K7SA 4RMFA 4A3FG 1MD2D 4I6LB 2Y0SE 2DY7A 5LNK1 4C4VB 4KGRA 3IFDA 2HQEA 2KD0A 1BDOA 3K80C 3ZQ4A 2LS01 5EDSA 3H09A 4A75A 1WTVA 2XIWA 4AYBG 1WTQA 2VH1A 1V1QA 4WORA 2WDRB 4FADA 2GOWA 1OXUA 4JYAQ 3ZJTA 4NP5A 4IOIE 5FO7B 2UUAL 1S5CD 3FEWX 4JI4Q 1Q8KA 5IGFA 3VTVA 1KRSA 2KTFA 4QB4A 1TY2A 5JPMC 2HHHL 3BVMA 1PUTA 2YVCA 2LMCA 1AEXA 4XYCA 3ZUNA 4ZUIA 1RDPD 1OQYA 4G7OC 3DHIC 5TR5A 4CJ2C 5H92C 2ES2A 1XWEA 2OEDA 1JMLA 4MTNA 1Q0WB 4JBJA 2VB2X 3BZKA 5FK9C 5FLMG 1WM2A 1SF0A 4GU2A 2EY1A 1KDCA 3DPDA 3C1FA 1PYWD 3QWNA 3HOWG 3MXNB 2F0DA 4XT3B 4GN4B 2F0LA 3CP0A 1KM7A 1YJIA 4QGUA 1EUJA 3E6ZX 3TP5A 3CRLC 3RN5A 2IBIB 3VR3A 1RAXA 4RA8A 1Y1VH 3ZW3A 1XXGA 2EPBA 3D3RA 4IM0A 4ZK9B 1N62A 5IN7A 1EZ6A 4HIOA 3L4PA 1L1OB 2WDQB 3OMCA 1I4XA 1PH5A 1JB3A 2LJ5A 3CPFA 3TDQA 1PRTF 1PQSA 2C5CA 4XT1B 3H3VC 3HOVB 3B1LX 2F0UA 2WB1E 3MA2B 4TQ1A 2VW9A 5ISRA 2KA7A 3CCVA 1DOLA 3TS0A 3GTQB 4A8XC 3KVFB 3HRZC 1J8IA 3W3AA 1D2BA 2V1YA 5LLIA 3H0GG 1R4MI 2E75C 1H95A 1K8GA 3A1QB 4DN4M 3QOJA 4HJGE 3BU2A 1S1QB 1WFQA 2TSSA 1WFYA 3VFKA 3QQ8B 4MNOA 2Y0SG 1V43A 4PMCA 1EM7A 4KSKC 4QUFA 1Q1EA 5E3FA 1EYGA 4K5VA 2LVQA 3EHVA 1XYIA 2PW5A 2QDBA 1UEAB 1GC7A 2NBUA 5D14A 3V2TA 1IBLQ 2JA6G 4G57A 2KX3A 2L52A 3IT6B 3M62B 2JJQA 1XF5L 4HVBA 4LNQA 4S3SA 3I4MG 1PA6A 3KBXA 3GZNI 1ZPSA 1BCPF 2VQFL 1C0AA 3BVGA 4O42A 4OW0A 1GPXA 3TEZA 2ZXPA 1ZEQX 2K50A 2VUMH 2EKEC 4LFAL 1BT0A 2IGGA 4K14A 4A3LG 1UD7A 1NBFC 3U4VA 1E7ZA 3K8AA 3MVVA 5IY0A 1ZXIA 3TEWA 4P72A 2NYZD 1VQ5A 1F2RI 1NE3A 3EN2A 4H44C 3AB5A 2RHSB 5EJWA 1UNSA 5CBAE 5G5GA 4A3IB 2OQ0A 3I3TB 5JHBA 1YNJD 4DAPA 1WTPA 1RD9D 4BZAA 3U7DA 2M9VA 4A3EH 1CJEA 3A74A 2EMTA 1PTOC 2WXKA 1RFAA 1V81A 2KOXA 4PS3A 1HZBA 1JB7A 4DV5L 4P1BC 2KOLA 3KOJA 3SK4A 2F4VL 4WURA 3V6EB 1VR9A 3NZUA 1EOVA 2BWFA 4K7UA 5CV5A 3H7SA 3D6WA 1HNZL 2QKIC 2CHZA 2NZHA 1KDBA 1BCPC 2K1FA 3CSFA 2XN9C 4C3HB 3PZDA 2JXMB 5GAHC 2BGFA 4IALA 4N9F4 4LMQD 2G4SA 1AE3A 2NVQB 4ULLA 2LGSA 3V6CB 3L16A 4YHHQ 3JW0X 4OELB 5HI1A 4FN2A 1LTBD 3GO5A 2NVYH 1WR1A 2C5LC 4DFAA 3HOUB 2Q8IB 5CV8A 1PH3A 2UUCQ 1O78A 1IXRA 3VYRA 1M90C 1AZPA 1UEBA 2FBWB 4G11A 5KHQA 5CBEE 2OT2A 2KN5A 4J15A 2O2VA 1WH3A 3SE0A 3OW7A 1LACA 4ZLTF 3OHXC 4IUMB 4BOSC 2CW0C 4JK1C 2UXDL 2BW2A 3A4RA 3RN9C 3PPAA 3CC2A 1O80A 4X65Q 2JN4A 2LGIA 5C23A 2R6GA 2LUEA 3OOCA 4UAIA 4UP9A 2LEKA 1N32L 1GB4A 1EY6A 3CQZH 2K5QA 1U0LA 5G2NA 2IX3A 3VH4B 2JYEA 4QUCA 2XRQD 2PI2E 3OPOA 2MBEA 1R9TB 3PGZA 2GBRA 1WGDA 1K28A 2K8HA 5CV7A 2RCNA 1GVPA 3M95A 1Y56A 2K5VA 2EOTA 2VL6A 4HAEA 5AJ3L 2F0OA 2N55A 2ATWA 5KYLA 1F2ZA 3NENA 2NS5A 5IT9L 1VQMA 2LVOA 3ZO5B 2EYLA 2W3SA 4RNAA 1G2SA 1K8AC 3FPUB 1SNCA 5I6YA 2GBJA 3M4OH 3CCUA 5BYRA 5FO8B 2CCZA 3S2DB 2WP9B 3A7AB 3PO2H 2JQOA 3HFZB 2NTTA 2ZT9C 2H88B 1OEYJ 3N1ZC 1IYFA 1BUVT 3P75A 3VH3B 5E1FA 3MWYW 2RR9A 3I90A 3E3XA 4LF9Q 1IYVA 1Q7YC 1SRUA 3C46A 3A5UA 3IKJA 2JX5A 2OJWA 1BOSA 4ITKA 4MGKE 1KRHA 4LF7L 3MXNA 2L05A 4ZRQA 3S14H 2FCSA 1EQQA 4PZ8A 1HZ6A 1DONA 4LFAQ 2A19A 4BBSH 1WM3A 2JXXA 4G7ZC 1FFVA 1SE2A 1GUWA 1NCVA 1TWFH 4S17A 4DDID 1AYFA 4WJ3M 1SSNA 5JJLA 5LXHA 3ZGZA 1V8CA 1PMRA 1V9JA 5CYUA 3IAYA 5C3EB 3ER0A 3QB3A 1F9RA 3HOWB 3W1YA 2ENBA 3R66C 2ALYB 2IPKD 4Q2JA 1FL0A 2JSOA 3I72A 1L0WA 3VTWA 5M5YB 4W9CA 5IYBG 4FF1A 2BS3B 1B7YB 1H9SB 2F03A 2F4VQ 4HJ5A 1HA5A 3SDZA 1S72A 4PYZA 2KK8A 3KH0A 1CHPD 5FR6A 4MTKA 3D4RA 4NPNA 1XQQA 2A6EC 5GXGB 5CV4A 2DUDA 1BO0A 3FDTA 4WRDA 4AJYB 2AL3A 4A3CG 1XCQL 1I50B 2D0PA 1X6OA 4LJOB 2WU5B 2Z6BA 1UAPA 3RPFC 1Z2MA 4EZLA 2HCIA 4ZRJA 4C3HH 4EEWA 4EUTA 1Q82C 5IP9G 4IM3A 1R7SA 2L1AA 4DAMA 2ZXRA 3R2IA 1KJTA 4FHJA 3SFDB 4ZKCB 4MGIE 3N32A 5IP4D 5AEKB 4KKTA 2EELA 5JZEB 5IODA 2VUMB 4F7XA 1B2TA 4KD4A 2B39A 1ICFB 1HZ5A 5C44B 3PSIA 3RNUA 3C8YA 3EUB2 4HCPB 5JH5C 1B3AA 4DV6L 5EE9A 1X3PA 3UDXA 1EWYC 1LGRA 4RWSC 2ZJQA 1IGCA 4IPCA 2KNBA 1SYCA 2R7ZB 4MN3A 3AV8A 1TXYA 4P71A 1OXXK 1HTPA 3UQBA 1E0ZA 3RR5A 2MNAA 1B70B 4URKA 4G4KA 2M4NA 3CCSA 2AYOB 4X3SA 1UH6A 4XDXA 1UUPA 1MFWA 5M9OA 2K32A 1BCPD 4GOPB 3M4QA 2N9PC 1Y69U 4REZA 2Z8LA 4IOCA 1L1OC 3A4SC 3CU7A 2DWQA 1MJEA 2DZJA 2DYMA 2J0TD 1KXLA 3PIP3 2IHEA 4Q5VA 3ZJYC 2WQYB 3TCAA 1LUZA 3E9HA 4OVZA 1PYSB 1FJGL 3PRZA 1E3PA 2B63G 3VYSA 1FCLA 1FXAA 4BBRH 3OYYA 2WNMA 3HOVG 1SR3A 3FHWA 3CCMA 4HJ9A 1KD1C 2ID0A 1JJ2A 1UWMA 4B6WA 1TT5B 3AMZA 5HY6A 5M3FB 1QF6A 4JYAL 3W5OA 4I7ZC 3HIZA 1DZ1A 2HTHA 5DPSA 1VQAA 4C1NK 4DPGA 1N6ZA 1UBQA 5BMHA 1I4RA 3Q3FA 1CQVA 3BZCA 4YY3Q 1B4OA 2WXOA 4ANXA 3MFGA 3JAML 1NI3A 3L13A 4XWTA 3RULA 4DXFA 2AMCB 1N8RC 2V9HA 2K5PA 2X69A 3NELA 4MELA 4A93G 2KCCA 2A4ZA 2DGYA 5DM73 4LNNA 2F4IA 3ZRFA 1I4GA 2W9NA 2WHIA 3VUWA 4AJWA 3GV6A 4M8NA 3HOZB 1VF7A 2WS3B 3HOXG 2BH8A 4HDOA 4LF7Q 3C0RB 1LTRD 1T9HA 5C3XA 2BYFA 2KDIA 2E2HB 4IWQA 1LTGD 2QGQA 1PHJA 2IYDB 3WDNA 3N52A 2V4IB 1QQRA 4RF1A 1K0SA 1NYQA 3DDCB 3RD4A 2QA4A 5C5LA 1SYEA 4D2KA 2VY3A 1SFOH 3OLMD 2M17A 1TZOA 4DK5A 1CKNA 1KAAA 2L0CA 4O0AA 4JI5L 3J80i 1BR9A 3LWUA 1XNRQ 4B3SQ 2K75A 1WGHA 4BY1G 1C4CA 1E22A 2CH4A 3QO2A 3TEHB 3UDGA 1IBML 1PTOB 1FGBD 2FXQA 3L9AX 1QOFA 4N58A 4LDTD 5J17A 1I35A 5LMNL 1E9MA 1S4ZA 3DM1A 1ZDVA 3M63B 4HIKA 3SK6A 3L3OC 3A8KE 1BCPB 1IYUA 2RDFA 1V5TA 2KDMA 3UIPB 2Z6KA 3PIOA 1C48A 1IPGA 2FCMA 4JI2L 2KTRA 4CDCC 1E7PB 1SDFA 1JCKB 3DWPA 2ICEC 3T1YQ 4QCLA 3Q6SA 1VQIA 2BTEA 1ICWA 1WXSA 2WXJA 1LO5D 1RKNA 4X66L 4GSWA 1R4NB 5IYCG 2KFKB 3HRDD 4BBSB 2C9OA 3OWEB 3DHQA 1A2TA 1OXSC 3JSVB 4WQOB 2MP2B 2K8BA 2WXHA 4X64L 3I4NB 4WH4A 2QW7A 4IFDG 1QT9A 4WQMA 3B9JA 4EGVA 1H9KA 4G50A 2UXCQ 3K7AB 2PEAA 2IWHA 2DNEA 4G3XB 4DUYL 1Y1WH 2E2HH 1FRRA 2ON8A 3U2SC 2EYJA 5IYCH 2D2QA 3Q6BA 3QX1A 2BB6A 4B08A 1NYRA 4ICUA 4KHPQ 3J7ZC 1F77A 2RPVA 2F0WA 1N9WA 3RZOH 5M5WH 2QHOA 1YBYA 3EC8A 3APFA 1WRIA 4DF7A 4CO7A 1GJZA 2IJ0A 1SROA 3X23A 4M0WB 4LF8Q 1GUGA 4GS3A 1SE4A 3K7UC 1O7IA 3EJIA 3T1HQ 2D10A 3PHWB 1MSHA 1VZ7A 4K8IA 5KEEA 1F9QA 2G9DA 3DWGC 1TWHB 4A3MH 5GMVA 2CH4W 5C1ZA 3TL5A 1TGZB 3QIJA 3DWMA 4DR1Q 1TWFB 4LNOA 3AE2B 4HPPA 4HJKA 4EQNA 2MCNB 3ZIMA 2NVYB 2JA8B 1KNEA 1S5ED 5E4XA 2JY6A 3NUHB 2IHFA 1C4QA 1NMFA 4GDKA 4KKUA 2JXTA 4OGQC 3OJ4B 1Z6HA 2K39A 4W9GA 5ELFA 4DR4Q 1TS2A 2OJRA 3RZWC 3VXWA 1CI3M 1QNKA 4IPHA 3GTOB 1FRDA 1PFDA 1G6ZA 5I4DA 3HVZA 1H4RA 3VDYA 2MHVA 2BA1A 2Q2HA 4DV4Q 3I91A 3NY5A 2E2IB 1WD0A 4DR2Q 1EWIA 1DOIA 2EYHA 4IJLA 4JI0Q 1HQRD 4PMWA 1HXYD 4TUUA 4B95A 3GS2A 4DU9A 2B29A 1YHBA 4XQJA 3RZOB 1PV4A 3RLNA 5C0XI 1AARA 1TT2A 1C78A 4OXPA 2N88A 4C2MH 2VNUD 3HHMA 2IGDA 1HJPA 1Y1VB 2FJ2A 3EFUA 3D6CA 3MHZA 4FJYA 1RL2A 3KYHC 2PPBC 3SHQA 2R93B 1B8AA 3GTKH 5KHOA 4WJWA 4YSZB 3AB9A 1BXTA 3MEFA 4RHRA 1L6UA 2INPE 4ZHPA 2DYBA 2V0GA 5H1SE 2C7HA 4P73A 1SE3A 2D07B 3PIPA 1GUAB 2QF7A 1NAPA 4DR1L 2PMVA 2KHWB 3ML8A 2MSED 3OTOQ 2E8GA 3PV1A 3BZDB 2JVCA 4YWGG 4NMZA 4RG1A 3HOYH 5LMNQ 1D1IA 3TEXA 1HCZA 2K3UA 2L83A 4HCSA 2JA5G 2DENB 2JA7G 2RDHA 3L7ZC 3KJPA 1Q8IA 4MIUA 3GDEA 1K73C 2M56B 4LCDE 1S5BD 3NVZA 3EBEA 4B9XA 1EQRA 4ZHOA 3PSEB 1A0IA 3BJUA 1A70A 1YN3A 3J80E 4YSYB 3MXGA 2PNRC 1I4QA 3U8ZA 4QQBX 4PMBA 2VQEQ 2A5UA 1HTQA 3H9DA 1FD7D 4ABNA 5J22A 3KQ4A 3ZNHB 1VQ4A 3RLOA 4QF4A 4A3BH 4IOAA 1KFYB 3HOXB 2MBQA 4C00A 4J6IA 4YSXB 5JXVA 1VQNA 1WX7A 2XK5B 1GUNA 2B2VA 3Q23A 2OHFA 1A62A 5CR3A 2XBBC 4OZCA 4OZAA 3TN2A 5C4HA 1V1OA 3PRPB 2K28A 2BS4B 1AN8A 2CW0D 3NTKA 2IDYA 2MJDA 3AI5A 1KTKA 2YTXA 3M4YA 5LMUL 3IL8A 1TKYA 4GOPC 3WA0A 3Q8FA 2QDFA 1FNWA 1WX8A 4B3RL 4G0NB 4JI3Q 3K59A 2WYQA 4A3MB 2YEPF 2KJHB 1YJNA 4GB9A 1YHAA 4QJFA 4X65L 3ONSA 2ONQA 3N6RA 1DGSA 1CUKA 1PFBA 1SNMA 1WE7A 2CR5A 2L32A 3P4PB 1N32Q 1PTOF 2VH2A 2Y3AA 2JA8H 3FC4A 2MH7A 5FLXc 4AYBE 1QOGA 3NP8A 1NI2A 5EAYA 2F0NA 4ID6A 3G6JB 1TU2B 4A3PA 2WXPA 4KHVA 2X6GA 2QIEB 4JWSC 3EGRA 4MH8A 3ZDMC 2K5WA 4CDDC 1MI2A 3HOUH 2FCNA 4HPLB 4N8FA 2MQHA 2X38A 2WGSA 2XEWA 5D7GA 3WAPA 4MM3A 3RYTA 2YU9H 2BYEA 4GDKB 2K6DB 5M5WB 4U673 4A3LH 4A3KB 3NVVA 1C4PA 4K8JA 5LHY1 3D0FA 1ZUD2 1PH2A 2N9KA 1T6BX 1C79A 1FO4A 2Z4IA 2NVUI 2Z9HA 1XTCD 1A6XA 1YN4A 1E1OA 3QHTA 1VQBA 4JI6Q 3AM9A 3ULPA 3MJ5A 4JV5Q 1SMXA 2E2JB 3KLRA 1STGA 1AH9A 4K6DA 5EQ0A 1GUTA 2KX0A 2SNMA 4PS8A 1FIQA 3T16A 4W9EA 2N49A 1IKMA 1NVID 2D3AA 4AH6A 5GADC 1IKLA 3J81E 4BY7G 1MHHE 4JIOU 4BY7B 1BQQT 3URYA 2REXA 4LF6L 1H8CA 1HH2P 1PGXA 3JVZX 4EQOA 3S1NB 3S2HB 4A6QA 3GE3C 5KNDA 3IBEA 4DAYB 3WOEA 5FO9B 3GOEA 2H5XA 4XC2A 2B8FA 3D4WA 5HURA 4GZYC 4LNIA 1EFID 1CQFA 1QWYA 1RRBA 4HKZE 5CC4A 1N60A 3CMMB 4US9A 1SB3C 3WCQA 1BVSA 4P74A 3PQIA 4K1RB 4ANWA 2GB1A 3WAMA 4P16A 4TVAB 2ZW0A 2DY8A 1A5RA 1IHZA 1QKZA 4ZRKA 2UXBQ 4M00A 2KLGA 3B2GA 5EBDA 4A20A 1CSPA 1GUOA 2WXQA 3VR8B 4O1NA 3GD7A 2QJLA 3UDFA 1EOTA 5FLXE 2DJFC 1QOHA 3NS8A 3HOZH 1EY4A 1JALA 2Z59B 3LX0A 4J8QA 4ZAIA 4NAWB 4OVUA 2GBKA 2WV6D 3V62A 2M19A 1NDDA 2MFIA 1KOTA 1BUIC 1V9PA 3GE8C 4HEDA 2ZJDA 5IWAL 5FJ8H 4WWMA 5DNFA 3CMEA 2K9XA 2Y5CA 1A3UA 1STEA 4JI1Q 4B3SL 3GTLH 3I57A 2VZAA 4O2DA 1STBA 5BN5A 4QL5A 1N33L 1EZ8A 1AFPA 4R3DA 4APVA 1ML0D 1HA6A 1XEEA 4PK1A 1V1PB 3I3CA 3BDCA 3OWFA 5I9OA 1ASZA 1SYGA 3IG3A 1N5WA 4NAWA 1ENCA 2GA4B 5EKKA 4B0MA 3KLWA 1U4MA 1PLFA 2WXIA 4FJVB 1E0BA 5L37A 2BKRB 1YNNC 3B08A 3L10B 2I0QA 4A76A 2AUKA 3TZDA 3RZDH 4OHJA 1LTSD 3M4PA 3LGJA 3OIQA 1I6VC 3V60A 4N9TA 4PG3A 1GG3A 5C6AA 5ELDA 1WD1A 4R8IA 4DR7L 2L12A 3KUCB 5E7NA 5C44H 2CWPA 3Q24A 2WXLA 2AQ2B 1NTGA 4HWIB 1Y8PB 3X0WA 1V2YA 4HJ7A 4HROA 2F0FA 4F88A 2D3GA 2WXFA 1LYLA 1P98A 2DX5B 3CQZB 2JRIB 5EE3A 4PQXA 4ME5A 4IFDJ 1X3GA 3AE5B 2WAQB 4C7ZA 2PCFB 2WACA 4RHSA 1CA5A 4PT5A 4DAYA 1MBYA 2YTVA 3AE1B 4XDCA 1QILA 1WR6E 4HIMA 1I4PA 4XQQA 4LF9L 3Q3OC 4JW0A 1P9DU 4YCVA 1PFMA 5DAUA 5EBCA 3DHHC 2FFKB 2N9EB 2NBWB 5L83A 1HR0W 2YEPB 2IO2B 5IGEA 3IAS1 4DUYQ 2LD9A 2RDBC 5BO4B 2SNSA 2R2OA 1E90A 2JWZA 3PO0A 2AKWB 2D62A 3KWVA 4QIWB 2LGXA 3S15H 1A3VA 5C3EH 2R93G 4HKQA 3T4AC 3IFTA 2EJFC 1Q3LA 4J1MA 3GTMH 2D5DA 3QR8A 3RMKC 3MHSD 4JPSA 3B2FA 1EWCA 2A74C 1ASYA 4BY1H 2I38A 5IGGA 4EX5A 1ET6A 1D1KA 3F8TA 3DM3A 2ZTCA 1F2YA 1TWGH 1U9RA 1Y8NB 5I2YA 1OTRB 2D5GA 4ALPA 4YL8A 3LYYA 1KNAA 3SK8A 5JJIA 4WWNA 2FMMA 4A3IG 3RNBC 4LK0M 1E6EB 2OOBB 4NQLB 1RWSA 2OEOA 1MI0A 3DVNU 3WAOA 3CD6A 2LZ6A 1N36L 1U4PA 4LDTB 1QVFA 1WSPA 3X3MA 3TREA 1WJNA 3Q2AC 5DPTA 2Q2TA 3V61A 5CX3A 3KW5B 4A3JH 4H02A 2EYPA 1SLJA 2E2IH 1E24A 3DLLA 1H9SA 3H94A 5IP7H 5FR3A 5JEAJ 1K3RA 4JBWA 4NJCA 1F9SA 2GI9A 3KUDB 2B2WA 2J0MA 1LT4D 5HFYA 4CDEC 3Q8BA 3PUXA 2XVSA 2JT4B 4IFDI 4R4CA 3UINB 4A3OA 2IL8A 5IOCA 2INNE 2TMPA 2PMZB 1XLNA 2LVPA 4NJ6A 3UI3A 4HEA1 1K52A 1B44D 1E2WA 3BS1A 1K9MC 3U52E 4GKJL 2L15A 1LQBA 1HFNA 3R93A 5D2MB 1KQSA 1XPRA 2KVRA 1JOKA 2NMQA 5EKIA 2L76A 2L1BA 2LKVA 3RUZA 1WWTA 2FCQA 4AQYQ 3GB1A 3UIOB 3FRPB 2J53A 2KBNA 3F2CA 3I4OA 4YXDB 3NJTA 3LWEA 5J2RA 3SXHA 2ZW1A 1CKOA 2KC1A 2A69D 5BYSA 1G91A 2LFNA 3BK2A 2RA4A 1T0YA 3H1UA 1B53A 1MHWC 5G5HA 4AP4C 1WYGA 3AEVA 2CHWA 1VQFA 4KJOA 3S15B 2L0FA 5C4JB 2E5LQ 3DEPA 2EKIA 1EYDA 4DR6L 2JRHA 2OXPA 2NZ1D 3A5ZB 2K5DA 3H3VI 2CJOA 1Y8RC 2WKCA 4JI1L 3MC8A 1YVCA 3TZUA 5I2XA 2CS4A 4LTUA 5E6NA 3RFZB 4BBSG 5DPRA 2CQOA 1P8LA 3ZTDA 2PI2A 4AQYL 1KAWA 2ZPNA 3HM3A 1PRTB 3RUIB 4NXML 5KGUA 3J7YW 4A3JB 4KHZA 3J7AF 1G2TA 4US8A 2NVTH 4WJQA 4N8X1 3ERQA 1DM0B 5EPKA 1TQOA 1IZ6A 1FM0D 3CRKC 5C0XJ 3A9KA 3DWAA 3S17B 1MJCA 2VZKB 1D7QA 1JJCB 2R61A 1DOKA 1C9FA 4F87A 1EIHA 2C35B 2KECA 5C0XG 3S17H 1KDAA 4DKAC 3S24A 2XWBB 2K33A 2FAZA 1VQJA 2C9WB 1TY0A 3R7RA 3RZDB 1PTOH 4CKBA 1TWHH 1X54A 3NHHA 3PZ8A 4EE2A 4DR3Q 3MFYA 4L5QA 3CC4A 3PO2B 1E2ZA 1L0YB 2EY2A 4E6IA 1ZP0B 3T9LA 3P4SB 4KY6A 2BS2B 2EY5A 1EY9A 2WAQG 3VA7A 2IX1A 1S3OA 5FLXL 2IX0A 4A3FB 4FHKA 4A3JG 5AUKA 4BKGA 2HDEA 5K5PA 2C7MB 2KDEB 2QC8A 2O6VB 4V0BA 4A9AA 1W2BA 4B3TL 2Z6KC 4HJAA 1DYQA 2B76B 3TSSA 2NN6H 4GNXB 3DBRB 4IW0A 4DR3L 4NW2A 3ZDTA 1J19A 3SD5A 3QJYA 4YY3L 4KK7A 3ERSX 4LJPB 4JI6L 4C80A 1B50A 2PNHA 2Z0EB 4BY7H 5C3WA 3O13A 4G7HC 2W3RA 3PCOB 4EZJA 2EVBA 3W1GA 3AE9B 2BT6A 3S14B 4IPDA 2DYOA 5AJ3Q 4WJNA 5IT9E 1ZOYB 1L4ZB 3CCJA 4E71A 4MGZE 2F52A 1WI5A 3MZ5A 2X6LA 1SBBB 4RGTA 1BBWA 4LFCQ 2WXRA 1UE6A 4MT5A 2HHHQ 3ZXRA 1PH4A 5BMGA 4A3EB 4LWCA 3CAMA 1WJ6A
chains in the Genus database with same CATH topology
4DQOC 2RSOA 3AEEB 4XYOA 1JRPA 2PW9A 2O5IC 5CMDA 3M4OB 1XLQA 2G9HD 2VB3X 1YQ4B 1JR0D 1B9RA 2A69C 1F0ZA 1O7LA 3IT4B 5FOBB 3AECB 3Q22A 3D31A 4FF3A 2BOSA 4X3TA 1CZWA 5C4XB 2MPMA 4LLGM 2KQ3A 1C77A 2F3VA 1A2UA 2BBCA 4RF0A 1A3TA 1STNA 3HS0C 3VYUA 2O4XA 1Q1BA 4OIKA 4XWWA 1HFGA 1CZGA 1IGDA 3T56B 1EY5A 3MTSA 3BDOA 3A56A 4TRDA 1J7AA 1HUNA 2F1MA 2DBYA 3C1EA 3E56A 2WXGA 1PZID 2RVLA 1Y1WB 5T1IA 2F0KA 2AWNA 3I9V1 2F0PA 3MXUA 4FVMA 2N9LA 3R3OA 1K8OA 3W9CB 2V3NA 2R3ZA 4C3IB 2LJIA 5AUIA 1T3QA 2A6HC 2HDMA 2BDNA 1EIGA 4KGTA 1GOZA 2E2DC 1FD6A 2PZUA 2BA0A 5G3LF 2LMCB 4KTAA 3RLFA 1JROA 3E9SA 3P4RB 1YNTE 4IDIA 1DOMA 3CWIA 3KLSA 3Q69A 3K0YA 1C8CA 1VF5C 1XCTL 3TEYA 5TSSA 1ZXHA 4H2AA 3SVMA 2Q5WD 3Q8CA 4IUNA 3IXSA 3K5NA 1BNZA 1J9OA 3TP7A 1JE4A 2F0MA 1I4HA 3MP9A 2PQEA 1N5XA 5ELCA 4KN4C 2K04A 4XE0A 3TP6A 2AUJD 3X3NA 3M85A 2RBMA 3NZ3A 5D3DA 1J7BA 2L11A 2NUCA 3VYTA 1Q90A 1FXIA 2JU6X 4NAMA 1EEID 1GHKA 3FILB 4ZOHC 2IGHA 5I9PA 4CBVA 3R2TA 1WTWA 2PKOA 1H9RA 4BBRB 3S1QB 2E76C 1B9NA 3VQIA 2PVOD 1JICA 1EYCA 4LAAA 3UI2A 3J81L 1L0VB 5ELBA 3BDLA 1XLOA 2FMCA 3CIRB 1ET9A 5C2TB 5KNBA 4L23A 1ZE3D 4EQPA 4R8NA 2B2WC 4C1NI 1PRTC 2BE5D 2ICIA 3H91A 5C4ZA 4C3JB 2JA5B 4C2MB 4CGYB 1Q12A 2K0PA 1OFFA 4L63B 2QILA 4K2LA 1SFOB 1TJEA 3I70A 1K8MA 1DOXA 2D2CC 4RCOA 4P6VF 1Z47A 1PDXA 4CJ0B 4HTHA 2CU3A 1IW7C 4TKOB 3EFXD 5BN4A 4KGSA 3Q8EA 1AZQA 2EYOA 3BYTB 4RKBA 1FCCC 3NE5B 2YU9B 3D8GA 3ND9A 2JA6B 3I4MB 3GTMB 4OO1G 1LTTD 5HHDG 4RFBA 3P20A 4IUTA 2SOBA 1CA6A 4WIPA 1QJOA 3NTHA 1KLGD 2B2YA 2FHTA 2LHDA 4AS1A 1SYFA 1ENAA 2H4OA 2A73B 2B2TC 3LXFA 4A93B 3TMEA 4IQZA 5D3IB 1FFUA 3G7LA 1EY7A 1VZ8A 4DA2A 1HRJA 2F0VA 1W6KA 3GTLB 2M2LA 4CQNA 4BA1I 2KUMA 2JYTA 1ZXTA 2FINB 2MGSA 5KIXA 1TKEA 3NS1A 2JQRB 2F0GA 2B2UA 2PVGC 4KX6B 2NN6G 2EZVA 1B1ZA 1KABA 3FILA 1QB5D 1GAQB 3BWUD 1LT5D 4ZRZA 1K51A 2E3TA 4V190 4K6LA 2O5JC 1KH0A 5KYIA 1JC7A 5K36H 1AWDA 1LTID 4RGMA 5CV9A 3S16B 2EYFA 2PO4A 1XO3A 5E6JA 1VLBA 4ARCA 4A3BB 1NEKB 1OXTA 1P7EA 1M4VA 3KUPA 2F3WA 3A8JE 1NUCA 1SNOA 4ZKBB 2JEBI 4Y7NB 4GLSC 1U4LA 3HG9A 4RCNA 4KKIA 2A5HA 5JEAG 4JX1C 2M0AA 4DNRB 2NTSA 4YTPB 1RODA 1SYBA 3W1SA 2BDOA 3NUCA 3K5MA 3NQIA 2J42A 1HUMA 3U7ZA 4NZLB 1SXTA 4KY5A 1JQ4A 5BMIA 1FYCA 1W6JA 2PIAA 1D5XC 3PUWA 4OZBA 4GDLB 4L2YA 4YTMB 5CGKA 3MAQA 2B8GA 3PO3B 1YNJC 4HRSA 4KI0A 4C3IG 1L5PA 4PNYA 5C5MA 4N59A 3P7JA 1SSOA 3NBIA 1HPCA 2MJ3A 2NWGA 2I07B 3MXPA 1C76A 2A68D 1T5XD 1TKGA 4KJNA 2G1EA 3LNNA 3VA5A 2WP8J 5H8YE 2KAJA 3HZXA 3TBIB 2EY6A 3Q0AA 3FPPA 1PXUA 2WU2B 4K2KA 1CHQD 1JW9D 3T3NA 1A15A 3GTGB 4A55A 2I2YA 4YIJA 3P42A 4ZRPA 2V3PA 2W54A 2EXZA 3SK5A 2K03A 1FMAD 3J9CA 1IBXB 1ACCA 2VZKD 2HDLA 1P7FA 3HUIA 1O7YA 2RQXA 1D5MC 2L55A 4BS9A 1TWCB 1DD2A 4XXEA 3F2UA 2AX5A 1G8ZD 4CHTB 1M8AA 1BMLC 2HTME 3AEDB 1F2MA 3NVYA 3W5UB 1G291 1XX8A 1S5DD 4HMJA 4AYBB 1R4PB 3HEJA 3LB8C 3T53B 2B2YC 5EGTA 3T13A 1VMCA 2BYTA 1ESFA 3EROA 2CHBD 2KWDA 1F9PA 4KN7C 3DEOA 2OF1A 4Z9CB 3S1RB 1OQQA 3GTKB 2VXWA 3NRZA 2N7JA 5AFWA 2F0HA 3T51B 2QMTA 4ZYSA 1JORA 5C0XH 4IUVA 1QE6A 5G3LD 2E6XA 3FMCA 3W2DA 4CJ1B 1U4RA 1EU4A 3CHBD 3DUZA 3HVDA 1HEZE 4C7YA 1VDZA 1QLBB 1WCMB 4I65A 4WAFA 1DXMA 3A55A 3PMFA 4XDDA 1EQTA 4XYQA 3OIPA 2F0TA 2KACA 2KMMA 1Q10A 4C3JG 1LTAD 3T3OA 3KWLA 1JWSD 1RJTA 3J7AV 4RKLA 3SHLA 3PUZA 5M5XB 4DNTB 3VRAB 2WXNA 2LFIA 3BIID 2K05A 1PGAA 1YJIA 1SJED 2Z4HA 3BYYB 1GJXA 4HN7A 3EA6A 3BG3A 2KHSA 1V8QA 1VZ6A 3SEBA 3BVZA 1JWMD 1EU3A 3AE3B 1V1PA 2KCNA 1K50A 2K22A 1SNQA 5A35A 4RH6A 2CJNA 4B0EA 4FXDA 5ELEA 5JVG3 2FUG1 4Q0FA 1VCIA 1SEBD 2K6AA 1S5FD 4WFN3 4X3UA 1OO9B 1VRAB 2KJXA 4ARIA 1SJHD 1EY0A 4DGZA 3MHBA 1RFKA 3AE8B 4TMAB 2Q8RE 5COYA 1DOYA 3KBGA 1ILPA 1JOOA 3D4DA 2PLPA 3NQTA 1Z7TA 1RHPA 2CQAA 2AQ1B 4FO2A 3PUVA 3J80L 1MPEA 4A90A 1EWHA 3DXJC 1AP0A 1STHA 3AE4B 1EY8A 1RM6C 4DAVA 3PIO3 1UGJA 2DLBA 2A6ED 1TKWB 2A68C 2K1BA 2K7VA 2KN4A 1NSNS 4XIGS 2QCPX 2F0JA 3GTPB 3NPPA 3ZYYX 1Y8OB 1ONLA 5IGCA 1CT1D 1IL8A 1AW7A 5C3JB 1ILQA 4OO1I 4A3DB 3P1MA 1MGSA 2WINB 5JAVA 1DJRD 1GXDC 3PV0A 3K57A 2XSCA 1EYAA 2BE5C 4MM3B 4AQ7A 4M8AA 1V97A 1HQMC 3TP8A 3KK7A 1LLRD 5LL6X 1RYJA 4J3OD 3GTJB 4HSPA 1VJKA 1GUSA 2WDVB 1WTXA 2J52A 1FNVA 5EKLA 3PZ7A 4TQUS 2QEJC 1OQRA 3AMUA 2B63B 5DM63 1ZDXA 4HMIA 4CKEA 1HHVA 4R9WA 4USAA 2PYKA 4M1UB 4X3KA 1STYA 5CV6A 4IKGA 2LHEA 2B2UC 1FR3A 1GB1A 2F0QA 1H9MA 3AN1A 2AWOA 2NN6I 1EL0A 1I3QB 1X3QA 2KEEA 2MUYA 4PV1C 1PGBA 1SNPA 4L1BA 1K83B 2F0SA 3KF8A 3VR6A 2DNCA 2RDGA 1LV9A 1FEHA 3SFEB 3ITPA 3GQBA 3QIAA 4DK1A 2DN8A 1NR2A 2FE8A 2EDGA 3S1MB 2WKDA 2XNAC 2JWUA 3K5LA 4JE3B 5FKAC 2WLBA 1F2RC 4H13C 3EVQA 3AEAB 5KNCA 2GRIA 2CVRA 5EE0A 3NTIA 2EJMA 1YQ3B 4DK0A 3V3XA 1JWUD 4EE2A 4L6TB 1RCVD 2Q8TA 2IW3A 3VR4A 3PUYA 5CORA 3C2PA 3ZJUA 3HP3A 1TR5A 1VDVA 4LK1C 5F2DA 5IGBA 3I8ZA 1X32A 5IIFA 4H0LC 1HTLD 2QSDA 3A8IE 4XQNA 3H8HA 2WIIB 3KLSX 3GP7A 1RTNA 1FNUA 2F0EA 4N9PA 5A2QE 3AEFB 2H89B 4FF2A 5T8IA 3VR5A 5I6WA 4IUPA 3BK1A 1N63A 4IZ8A 1SMYD 2PTLA 4LJZC 2YYZA 3M7NA 3E5SA 2PZTA 3AE6B 3VR2A 1TS3A 1IUEA 2J4XA 1MSGA 1NR4A 5A2QL 5T1GA 1K53A 2HCCA 1SIJA 1ENFA 3W5VB 5J39A 1PZJD 4IFDH 3DWQA 1EEFD 5EE1A 4C56C 4BA2I 3FKIB 1IBXA 4L8JA 4B9WA 1JWAD 4ZUJA 4BY1B 1L4DB 1SAPA 2AQ3B 5MPOA 2E74C 5JPNC 1PZKD 3ZJVA 4KKJA 3U9OA 2JP1A 1STAA 1CZPA 2XWJB 3K5OA 2NVTB 4FF4A 1TS4A 2Y5PA 4FXGC 5BYQA 1QCBD 3I4LA 5K36G 1PDQA 1WVLA 2EYMA 4ZQ3A 4KV6A 5NUCA 1VMPA 3FVQA 2BB5A 1RTOA 2SEBD 3V05A 3NVWA 3DMUA 4NDXA 5JOBA 3NWSA 2O2LD 4OO1H 1MHXA 1YMHE 5EPJA 4RAUC 1D4BA 1N61A 4F8MA 3AU7A 3K58A 4MHEA 3HKZB 1WTRA 1QG7A 4CKCA 3HGBA 3OSOA 2PZWA 3EQLC 2JA7B 1BF4A 3IAM1 1T5EA 2D9UA 1OXVA 3Q8AA 1GHJA 2HUGA 3WOFA 1ESRA 1J7CA 1TIID 1XLPA 4IUUA 4HCEA 1PFNA 2L5TA 3NK9A 3H6MA 2LY7A 4J6HA 2MJEA 2RKSA 4JWUC 2JZPA 4IURA 1KLUD 3P63A 2MEKA 2N0SB 4FNFA 4ODGA 5E4WC 1EQVA 4K5XA 3TUOA 4U68A 3A7LA 3MC0B 3K6OA 4NKLA 5BN3A 1E10A 2W82A 4H7BA 1BBXC 2F0IA 3C3LA 1F2LA 3GV3A 4FXKC 2R92B 4UDUC 3MEHA 3NBHA 2JSVX 1PTOD 1LT3D 1D5ZC 2M00A 1O7ZA 3A54A 4RGNA 4QMGA 5EPLA 4M0WA 1WGKA 2RMMA 5JJZA 3U9SA 4KMUC 1SNDA 1UWXA 4FP5D 4IUQA 1CFMA 5IGDA 2NBFA 2V4DA 3QG1A 3M3YB 4EVOA 4HR7B 1CTMA 3OMGA 2NVXB 3JAME 2WB1B 4A3GB 1B9MA 2Z1CA 1WTOA 3NSWA 4XTCS 3CKIB 3ND8A 4P2CB 1DCZA 5D65A 2I46A 1I7HA 1RF2D 1YN5A 5LL6S 2NB0A 2KQ4X 1NENB 1ZYRD 2A6HD 1IW7D 2MP1A 1H9JA 3QOLA 2JEAI 4C3HG 5JVH3 3HOYB 5DEHA 1ZYRC 4ILWA 3R8BA 2MJ8A 1CK1A 3AH7A 1L6VA 1SYDA 3VRBB 1YJJA 1CM9A 2WXMA 2W55A 4N6EB 2L4NA 4FXCA 3SR1A 4YTNB 5M3MB 1I6HB 1C4AA 3N9YC 2H1EA 2KVMA 3S9WA 2ACZB 1ZKOA 4BWGB 1E2VA 1QNUA 3U4EG 1WXQA 3VR9B 2JE6I 3I73A 2Y0SB 4KY7A 3ONAB 5HG2A 2KEDA 3H0GB 1JQYD 1PRTD 2SAKA 1R4QB 3P4QB 2K01A 4FYDA 2B2TA 4IN3A 4MACA 1DGJA 4DXGA 1TS5A 1LT6D 2PW7A 3AEGB 4KD3A 2J7ZA 3ETRA 1TWAB 2EE1A 3V96A 5JEAH 1LABA 1L0XB 4K5WA 3ABVB 1TWGB 1MVKA 4TSSA 3SR6A 3M7GA 3NXWA 2EJGC 3P1HA 4KKSA 1II3A 2JYOA 2SDFA 3FAHA 1SMYC 3AE7B 4TQ0A 2B2VC 2RSNA 1TVXA 3E0JA 4OIJA 1QOBA 2L9HA 5KRUA 2IT1A 4HSVA 1D6EC 4YT0B 4OL7A 1ROEA 3NWTA 5HGTA 1TYGB 1KF6B 2XRSD 4RGOS 1YNND 5J1ZA 1JWBD 3AEBB 1JOQA 2BCOA 2LUMA 2ZXOA 3RMHA 1MD2D 2DY7A 5LNK1 4KGRA 3IFDA 2HQEA 3ZQ4A 1BDOA 2LS01 3H09A 1WTVA 2XIWA 1WTQA 4WORA 2WDRB 1OXUA 3ZJTA 4NP5A 4IOIE 5FO7B 1S5CD 3FEWX 5IGFA 4QB4A 1TY2A 5JPMC 1PUTA 3BVMA 2LMCA 1AEXA 4ZUIA 1RDPD 4G7OC 4CJ2C 5H92C 1XWEA 2OEDA 1JMLA 2VB2X 5FK9C 1SF0A 2EY1A 1KDCA 3C1FA 1PYWD 3QWNA 2F0DA 4XT3B 2F0LA 3E6ZX 3TP5A 3CRLC 3VR3A 4RA8A 1XXGA 2EPBA 3D3RA 4ZK9B 1N62A 1EZ6A 3L4PA 2WDQB 3OMCA 1I4XA 1JB3A 3TDQA 1PRTF 2C5CA 4XT1B 3H3VC 3HOVB 2F0UA 3MA2B 4TQ1A 5ISRA 2KA7A 4A8XC 1DOLA 3GTQB 3HRZC 1J8IA 3W3AA 1D2BA 2E75C 4DN4M 3QOJA 4HJGE 2TSSA 1V43A 4PMCA 1EM7A 4QUFA 1Q1EA 5E3FA 4K5VA 1XYIA 2PW5A 2QDBA 1UEAB 5D14A 3V2TA 3IT6B 4G57A 2L52A 1XF5L 4S3SA 4OW0A 3KBXA 1ZPSA 1BCPF 1GPXA 3BVGA 4O42A 3TEZA 2ZXPA 1ZEQX 2IGGA 4K14A 1ZXIA 3MVVA 3TEWA 2NYZD 1F2RI 4H44C 3AB5A 5EJWA 1UNSA 5CBAE 5G5GA 4A3IB 1YNJD 4DAPA 1WTPA 1RD9D 2M9VA 1CJEA 1PTOC 2WXKA 4WURA 2KOLA 3SK4A 1VR9A 5CV5A 3D6WA 2QKIC 1KDBA 1BCPC 2XN9C 4C3HB 2JXMB 4IALA 4LMQD 2NVQB 4ULLA 5HI1A 1LTBD 3GO5A 4DFAA 3HOUB 2Q8IB 5CV8A 1O78A 3VYRA 1AZPA 2FBWB 5CBEE 2OT2A 3SE0A 3OW7A 1LACA 4ZLTF 3OHXC 2CW0C 4JK1C 2BW2A 1O80A 2LGIA 2R6GA 3OOCA 4UAIA 2LEKA 1GB4A 1EY6A 2K5QA 2IX3A 2JYEA 4QUCA 2XRQD 3OPOA 1R9TB 5CV7A 1Y56A 4HAEA 2EOTA 2F0OA 2N55A 5KYLA 1F2ZA 5IT9L 2EYLA 2W3SA 4RNAA 1G2SA 3FPUB 1SNCA 5I6YA 5BYRA 5FO8B 3S2DB 2WP9B 3A7AB 2NTTA 2ZT9C 2H88B 1BUVT 3P75A 5E1FA 3MWYW 3I90A 1IYVA 3C46A 3IKJA 2JX5A 1BOSA 4ITKA 1KRHA 3MXNA 4ZRQA 1HZ6A 1DONA 4G7ZC 1FFVA 1SE2A 1GUWA 1NCVA 1AYFA 1SSNA 3ZGZA 1V8CA 1PMRA 5CYUA 3IAYA 5C3EB 3QB3A 1F9RA 3HOWB 2ENBA 2IPKD 4Q2JA 3I72A 2JSOA 5M5YB 4FF1A 2BS3B 1H9SB 2F03A 1HA5A 3SDZA 1CHPD 3D4RA 2A6EC 5GXGB 5CV4A 1BO0A 3FDTA 4WRDA 1XCQL 1I50B 3RPFC 2WU5B 1UAPA 2HCIA 1R7SA 2L1AA 2ZXRA 3R2IA 3SFDB 4ZKCB 4KKTA 2EELA 5IODA 2VUMB 4F7XA 1B2TA 4KD4A 2B39A 1HZ5A 3C8YA 5C44B 3EUB2 1B3AA 5EE9A 1X3PA 1EWYC 4RWSC 1IGCA 3AV8A 1SYCA 2R7ZB 4MN3A 1OXXK 1HTPA 1E0ZA 4G4KA 4X3SA 4XDXA 1UUPA 5M9OA 2K32A 1BCPD 1Y69U 4REZA 2Z8LA 3CU7A 2DWQA 2DYMA 2J0TD 3PIP3 4Q5VA 2WQYB 4OVZA 3VYSA 1FCLA 1FXAA 2WNMA 1UWMA 2ID0A 3AMZA 1QF6A 5M3FB 4I7ZC 1DZ1A 4C1NK 5BMHA 1I4RA 1CQVA 2WXOA 1B4OA 3MFGA 3JAML 1NI3A 4XWTA 4DXFA 2K5PA 2X69A 2KCCA 5DM73 2F4IA 1I4GA 3GV6A 3HOZB 1VF7A 2WS3B 1LTRD 5C3XA 2E2HB 1LTGD 3WDNA 3N52A 2V4IB 1QQRA 4RF1A 1NYQA 3RD4A 5C5LA 1SYEA 4D2KA 1TZOA 1KAAA 2L0CA 1BR9A 3LWUA 1C4CA 3QO2A 1PTOB 1FGBD 3L9AX 1QOFA 4N58A 1E9MA 1S4ZA 3DM1A 1ZDVA 3SK6A 3L3OC 3A8KE 1BCPB 1IYUA 2RDFA 2KDMA 1C48A 1E7PB 1SDFA 1JCKB 3DWPA 2ICEC 4QCLA 2BTEA 3Q6SA 1ICWA 2WXJA 1LO5D 1RKNA 3HRDD 4BBSB 2C9OA 3OWEB 3DHQA 1A2TA 1OXSC 2WXHA 3I4NB 4WH4A 4IFDG 1QT9A 4WQMA 3B9JA 4EGVA 1H9KA 3K7AB 2IWHA 2DNEA 2ON8A 1FRRA 3U2SC 2EYJA 2BB6A 4B08A 1NYRA 1F77A 2RPVA 2F0WA 1WRIA 4DF7A 2IJ0A 1GUGA 1SE4A 3EJIA 1MSHA 1VZ7A 4K8IA 5KEEA 1F9QA 2G9DA 3DWGC 1TWHB 3DWMA 1TWFB 3AE2B 4EQNA 2NVYB 2JA8B 1KNEA 1S5ED 5E4XA 3NUHB 1C4QA 4KKUA 2JXTA 4OGQC 1Z6HA 5ELFA 1TS2A 1CI3M 1QNKA 3GTOB 1FRDA 1PFDA 1G6ZA 5I4DA 3HVZA 2MHVA 2BA1A 3I91A 2E2IB 1WD0A 1DOIA 2EYHA 1HQRD 4PMWA 1HXYD 3GS2A 4DU9A 4XQJA 3RZOB 5C0XI 1TT2A 1C78A 2N88A 2VNUD 3MHZA 2IGDA 1Y1VB 2FJ2A 3D6CA 2PPBC 4YSZB 2R93B 4WJWA 3AB9A 1BXTA 4RHRA 1L6UA 2V0GA 2INPE 4ZHPA 1SE3A 2QF7A 1NAPA 2PMVA 3BZDB 4YWGG 4NMZA 1D1IA 3TEXA 1HCZA 2K3UA 2L83A 4HCSA 2RDHA 3L7ZC 2M56B 1Q8IA 4MIUA 1S5BD 3NVZA 4B9XA 4ZHOA 1A70A 1YN3A 3J80E 4YSYB 3MXGA 2PNRC 1I4QA 4PMBA 1FD7D 4ABNA 5J22A 3KQ4A 4QF4A 1KFYB 3HOXB 5JXVA 4YSXB 1GUNA 2B2VA 3Q23A 2OHFA 4OZCA 5CR3A 4OZAA 3TN2A 5C4HA 1V1OA 2K28A 2BS4B 1AN8A 2CW0D 3NTKA 2IDYA 2MJDA 1KTKA 3M4YA 3IL8A 1TKYA 3Q8FA 1FNWA 3K59A 4A3MB 2YEPF 2ONQA 3N6RA 1PFBA 1SNMA 2L32A 3P4PB 1PTOF 2Y3AA 3FC4A 2MH7A 1QOGA 3NP8A 2F0NA 4ID6A 3G6JB 1TU2B 2WXPA 4KHVA 2X6GA 2QIEB 4JWSC 3EGRA 4MH8A 2K5WA 1MI2A 2X38A 5D7GA 4GDKB 5M5WB 4U673 4A3KB 3NVVA 1C4PA 4K8JA 5LHY1 1ZUD2 2N9KA 1T6BX 1C79A 1FO4A 2Z4IA 1XTCD 1A6XA 1YN4A 3AM9A 3MJ5A 2E2JB 3KLRA 1STGA 4K6DA 5EQ0A 1GUTA 2SNMA 1FIQA 3T16A 1IKMA 1NVID 1IKLA 3J81E 1MHHE 4BY7B 1BQQT 3URYA 1PGXA 4EQOA 3S1NB 3S2HB 4A6QA 5KNDA 3WOEA 5FO9B 2B8FA 3D4WA 5HURA 4GZYC 1EFID 1CQFA 1QWYA 4HKZE 5CC4A 1N60A 4US9A 1SB3C 3WCQA 2GB1A 4P16A 2ZW0A 2DY8A 1IHZA 1QKZA 3B2GA 5EBDA 1GUOA 2WXQA 3VR8B 4O1NA 3GD7A 2QJLA 1EOTA 5FLXE 1QOHA 1EY4A 1JALA 3LX0A 4J8QA 4ZAIA 4NAWB 2WV6D 2M19A 1BUIC 4HEDA 4WWMA 5DNFA 2K9XA 2Y5CA 1A3UA 1STEA 3I57A 1STBA 5BN5A 1EZ8A 1AFPA 4R3DA 1ML0D 1HA6A 1XEEA 1V1PB 3I3CA 3BDCA 3OWFA 5I9OA 1SYGA 1N5WA 1ENCA 2GA4B 5EKKA 4B0MA 1U4MA 1PLFA 2WXIA 1E0BA 1YNNC 2AUKA 3TZDA 4OHJA 1LTSD 3OIQA 1I6VC 4N9TA 5C6AA 5ELDA 1WD1A 4R8IA 2L12A 3Q24A 2WXLA 2AQ2B 1Y8PB 4HROA 2F0FA 4F88A 2WXFA 3CQZB 5EE3A 4PQXA 4ME5A 4IFDJ 3AE5B 2WAQB 4C7ZA 2PCFB 2WACA 4RHSA 1CA5A 4PT5A 4DAYA 1MBYA 4XDCA 3AE1B 1QILA 1I4PA 4XQQA 1PFMA 5DAUA 5EBCA 2FFKB 2YEPB 5IGEA 3IAS1 2SNSA 3PO0A 2D62A 3KWVA 4QIWB 1A3VA 4HKQA 3T4AC 3IFTA 2EJFC 1Q3LA 4J1MA 2D5DA 4JPSA 3B2FA 1EWCA 2A74C 2I38A 5IGGA 1ET6A 1D1KA 2D5GA 1F2YA 1U9RA 1Y8NB 5I2YA 3LYYA 1KNAA 3SK8A 2FMMA 4LK0M 1E6EB 1RWSA 2OEOA 1MI0A 1U4PA 1WSPA 3X3MA 2EYPA 1H9SA 3H94A 5FR3A 5JEAJ 4JBWA 4NJCA 1F9SA 2GI9A 5HFYA 2B2WA 1LT4D 3Q8BA 3PUXA 2XVSA 4IFDI 2IL8A 5IOCA 2INNE 2TMPA 2PMZB 1XLNA 3UI3A 4HEA1 1K52A 1B44D 1E2WA 3BS1A 3U52E 1HFNA 3R93A 1JOKA 2NMQA 5EKIA 2L1BA 2LKVA 3RUZA 1WWTA 3GB1A 3FRPB 2J53A 4YXDB 3LWEA 3SXHA 2ZW1A 2A69D 5BYSA 1G91A 2LFNA 3BK2A 2RA4A 1B53A 5G5HA 1WYGA 4KJOA 3S15B 5C4JB 3DEPA 2EKIA 1EYDA 2OXPA 2NZ1D 2CJOA 2K5DA 2WKCA 3TZUA 5I2XA 4LTUA 3RFZB 1PRTB 5KGUA 3J7YW 4A3JB 4KHZA 3J7AF 1G2TA 4US8A 3ERQA 1DM0B 5EPKA 1TQOA 1FM0D 3CRKC 5C0XJ 3DWAA 3S17B 2VZKB