1KLUD

Crystal structure of hla-dr1/tpi(23-37) complexed with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
239
structure length
230
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Minor structural changes in a mutated human melanoma antigen correspond to dramatically enhanced stimulation of a CD4+ tumor-infiltrating lymphocyte line.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/toxin
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR ALPHA CHAIN
total genus 67
structure length 230
sequence length 239
ec nomenclature
pdb deposition date 2001-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1kluD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1kluD02
2WV6D 1YN4A 1I4QA 5D3DA 1SEBD 1DYQA 1RD9D 1TS3A 1DJRD 1SE4A 4L6TB 2ICIA 3TSSA 1ET9A 3MFGA 4C56C 3O13A 4BWGB 3BVGA 2XNAC 3CHBD 1YN5A 1PZKD 1CT1D 1PRTD 1LTGD 1LTTD 2CHBD 1AW7A 2XRSD 2IJ0A 1KLUD 1JWUD 2O2LD 1EU4A 1FD7D 2AQ1B 3BYYB 4O1NA 1LT4D 1B1ZA 3DWQA 1M4VA 3R2TA 1JR0D 1MD2D 1LO5D 1I4RA 1LT5D 1AN8A 1T5XD 1V1OA 1EU3A 1D5ZC 1BCPB 1PZJD 5D3IB 1SE2A 1TY2A 1I4PA 1PRTC 5ELDA 2RDGA 2R61A 1PRTF 2RDHA 1KTKA 1LLRD 5ELFA 1S5CD 4RCOA 4TSSA 2NTTA 1LTSD 1D6EC 5ELBA 4L63B 1RDPD 2TSSA 3OWEB 3EA6A 1RCVD 1S5FD 1SXTA 1SBBB 1D5XC 1EWCA 1PTOH 1V1PB 1TS4A 2AQ2B 1ESFA 1BCPC 3R2IA 4RGNA 4RGOS 2NTSA 5ELCA 2AQ3B 1KLGD 1FNWA 2SEBD 1PTOF 1G8ZD 1LTBD 4Z9CB 5ELEA 1RF2D 1SJED 1UUPA 2J4XA 1XTCD 4K6LA 1FGBD 1D5MC 1S5ED 1CHPD 3BYTB 3MC0B 3V05A 1S5DD 1L0YB 1LT6D 1CK1A 2XRQD 3DWPA 1JCKB 3URYA 1LT3D 1CHQD 1PZID 1SJHD 1BCPD 1SE3A 5FKAC 4DXFA 1HA5A 1HTLD 3R8BA 4NZLB 4ZYSA 1TY0A 1EFID 3SEBA 2G9HD 5I4DA 1CQVA 1FNUA 4RFBA 1PYWD 1ENFA 1HXYD 1S5BD 1TS2A 1UNSA 2Z8LA 1I4GA 1LTRD 4RHRA 4UDUC 5FK9C 4RH6A 5TSSA 1BCPF 4RGMA 1XXGA 3BZDB 1LTID 3BVZA 1B44D 1GOZA 1PTOC 1L0XB 1JWSD 1I4HA 1EEID 4RHSA 1YN3A 3BVMA 2QILA 4DXGA 1JQYD 1PTOB 3KLSX 1TS5A 1FNVA 1ET6A 3GP7A 1F77A 1QILA 1JWMD 1EEFD 1BXTA 2QEJC 2IPKD 3W2DA 1HQRD 1PRTB 1V1PA 1PTOD 1STEA 3DWAA 3EFXD 4OHJA 1LTAD 1I4XA 4RGTA 2XN9C
chains in the Genus database with same CATH superfamily
1Z2MA 3UQBA 1WRDB 3RD2A 2O6VB 4JI6Q 1O78A 4ALPA 2VUMB 4NJ6A 3IL8A 2F0PA 1GUOA 1SMXA 2IO0B 2D2QA 1HH2P 2B2TC 1IBXA 5JOBA 2K6AA 1F2YA 2YV5A 1OEYJ 2JA5B 2VQFL 2J42A 4HK2A 1UELA 2NVTH 4A3FG 1P7FA 4FXCA 1QWYA 2IJ0A 2O2LD 5BN4A 1CKOA 1A2UA 4GS3A 2LFNA 4GLAC 1TU2B 3BZCA 5GXGB 2M0XA 4POFA 1PFBA 5CV8A 3I4MH 2MRPA 3P63A 2K5HA 1VQ8A 1HR0L 2EXDA 4A3KH 3NPPA 3H15A 4MZ9A 2UXCL 1U4LA 3ERQA 1ILPA 1LT5D 2AL3A 1EU3A 4A3DB 3JSVA 5FO8B 4IPDA 5HURA 1P16A 1STAA 4YL8A 1CA5A 3EECA 1LFDA 2KTRB 2C60A 1EY9A 1TWGH 4AYBB 1C48A 4C3IB 2ZJDA 3E5SA 2B8GA 1D1KA 1RDPD 3QIJA 2K25A 4IC7B 2DENB 1E10A 4UP9A 4B3TQ 4KGSA 4L2YA 1PTOH 3PHWB 2NYZD 2QF7A 3DUZA 1IBXB 3IFDA 5KIXA 4YY3L 3KDFB 3NS1A 3S2HH 3VUXA 3PIPA 2LGIA 1SNOA 1I35A 4LDTD 3AYHB 1KNAA 1KLGD 4XX5A 2D2CC 3VTUA 1MG8A 2E2JH 1JT8A 2DX5B 3W5UB 2LKVA 4OXPA 4R1JA 5GAHC 4BZAA 4PZ7A 4MHEA 5EPLA 1FFUA 1WJUA 2DZKA 2WDRB 2L00B 2RPVA 3SU8X 4ABNA 4BY1G 1SE8A 2E74C 1EQVA 1V8CA 1O7YA 1X3EA 3K7UC 4JE3B 1RTOA 3UINB 3H09A 1CK1A 2DJFC 4KDIC 3M4OH 1QOHA 3FAHA 3Q8CA 5C3EH 2KX3A 1BDOA 4FBJB 1FVIA 4J1MA 5LMNW 1HA5A 1X32A 1WCMH 1FMAD 5DM73 2V1CC 2HD5B 2N9EB 2PMZB 2VW9A 4AQYL 1F2RI 3NZ3A 1TS2A 4RMAA 2GB1A 1UNSA 3VYRA 2JY6A 1LTRD 2QEXA 1G291 2WAQB 4P75A 5IT9L 4C3IG 3BINA 1J6QA 5AJ3L 5TSSA 2OTJA 1OQYA 2CHZA 1ZYRD 4C3IH 3DHHC 2A69C 1HJPA 3KJPA 1EY6A 3HOYG 1HZ5A 2K22A 3NHEB 3CMEA 2MBOA 3NQTA 4A3FH 3HUIA 4LF6Q 3WIMA 3PUXA 2HQLA 4OONA 1I6VC 5AEKB 3SFEB 1A6XA 2L5TA 1TS5A 1O7ZA 3M4QA 1BUVT 3JAMc 3H7PA 1P3QU 1BO0A 4CHTB 1VLBA 2IO1B 4ILWA 3PGEA 5GROA 3U8ZA 2H4OA 5E6OA 4KSLC 2LSSA 3DBRI 3C19A 1CZPA 3HVDA 3L17A 3W2DA 5LXIB 1T0QC 3J81j 1AZPA 1PTOD 1A3VA 1ONLA 2ZJQA 3TIXA 3VRBB 1L1OA 4CDFC 1TKGA 1YN4A 2HE7A 4GOPA 3FP9A 5LL6X 4HJGE 2V4LA 4GLXA 1CZWA 3H0GG 2JZPA 3R3OA 1H4RA 2NVTB 3OAWA 1SE4A 3DVGY 1SRUA 1XD3B 4A75A 2Z6KA 2J7QB 4FADA 2IT1A 5IP9G 3G71A 2K6QA 3CCLA 2VZAA 2BVCA 4J6IA 4FF4A 1TWAH 4AOFA 1PMRA 4P1CC 2KX0A 1D8LA 2XNAC 2HTME 4JI8L 4XYCA 4GDKA 3W1BA 3PUVA 2CHBD 4YHHQ 2HDLA 4IUQA 3D6WA 4M02A 3OTOQ 5C0XG 4KD3A 3I4NH 1E8XA 2QJLA 2VXWA 3ZRFA 2KJ6A 2KZRA 4KKUA 3CC4A 2HTHA 3H6MA 2OJRA 3D32A 2MA9B 4S0RA 3W9CB 1B1ZA 1NNXA 4GZYC 1UE1A 4B3MQ 3AEEB 1IXRA 2FFKB 3K6OA 3TBLD 3N9YC 1Y56A 3H0GB 1WXVA 4AWJA 4LK0M 3O65B 2R93H 2K1FA 5KNBA 4IUVA 4ANUA 3S1RB 1Z47A 1CSPA 3S1NB 1RL2A 2NTTA 1Y8OB 4IJHA 1YIJA 5E6PA 2B2WA 1DOMA 3U9OA 3N6RA 4LF7L 2BPSA 1HZAA 1DZ1A 3RUIB 3BDCA 1QZGA 3S1RH 1T5EA 1F2LA 1O7IA 5JEAH 3K57A 3T1YL 3GTOH 1C78A 3H6NA 3PSEB 1RAXA 3UIOB 1U4AA 1E2WA 4N8FA 4QGUA 3P2BA 3VR9B 1MVKA 1J8CA 2L32A 5HI1A 3V96A 3LWEA 2A5HA 3PIP3 4EZLA 4PMWA 1WX7A 4LF7Q 2W55A 2LRUA 2RSUA 3TP8A 4YSXB 4R9WA 1B50A 4BBNF 2KEDA 1SLJA 2OQKA 4G7HC 1EF1A 2K5QA 2MNAA 1E8ZA 1GG3A 1S5ED 4O42A 3VA5A 1WXAA 3BYTB 3U4EG 2V0GA 1V9JA 2AX5A 4TQ1A 5LMUQ 2CW0D 4IDIA 3MHSD 4YCUA 1YHAA 2B2VA 3QCAA 3I90A 3AE2B 5AUIA 1STHA 1PZID 1VD2A 2A8VA 3PRZA 5BYQA 2B2UC 1DOXA 1Q90A 4RKBA 2BE5C 5BYSA 3V61A 1HA6A 3BK1A 3HVZA 4UDUC 2CWAA 2IL8A 2UXDL 4N9F4 1QJOA 4UAIA 1V6EA 2IY5B 3Q3FA 2W3RA 1X3FA 3K0YA 5M3FG 1ASZA 3J80L 1KAAA 4CKEA 4NKLA 1E0BA 5JJLA 1YNNC 1SYEA 1EY7A 1TKWB 2HDMA 1WGRA 4HPPA 4IQZA 1A0IA 2A68D 3QWNA 4DXGA 1VZ7A 1PH7A 2KAJA 1SYDA 3UE1A 2PPBC 2Y5PA 1IPGA 3QX1A 4FHJA 2BTEA 2ONQA 3J80E 1KRTA 3KVFB 2KWVB 1QILA 2K50A 3EIVA 4LNQA 3APCA 3AB9A 4GN3B 2QEJC 4K8IA 2Q2UA 3ZUNA 4HIDA 1GAQB 1WGDA 2NPTA 1OEYA 4JK1C 2FCSA 2WXPA 4A4IA 2KQ4X 4KVGB 3NOBA 1SNMA 5C3WA 1I4QA 2LGYA 2NZHA 4GLVB 2FIDA 4W9GA 3AE5B 4LF6L 4L6TB 3PO3H 2F0WA 3QA8A 3FILA 2Q8RE 1L2FA 3AE8B 2ZW1A 3UF8A 3ECIA 4MACA 2FNJB 4WJOA 3I70A 3K80C 1LTTD 3VYUA 4K7SA 5IYBG 4TVAB 1AW7A 5AJ3Q 2KDBA 1ROEA 5AFWA 3KYCD 1B9MA 2I07B 4E6IA 2MWSB 3DWMA 2EOTA 2V3PA 3BYYB 1BBUA 4P16A 3SVMA 1EL0A 1PFSA 4V190 1M4VA 1VS0A 2RDFA 3SHLA 1D2BA 1MD2D 4M8NA 3ZLZA 3OWFA 4EZJA 2ON8A 1Q86C 2VUMG 1BMLC 3EN2A 1C9OA 1XX8A 1K53A 5ELDA 1I50H 4IALA 2FUG1 2F0KA 1PH3A 2B63B 1AFPA 2MH7A 2HCIA 4FDBA 2KC1A 1F0ZA 3L54A 2EYLA 2WAQG 3TP6A 4URKA 3PZ7A 1S72A 1SYBA 4GNXC 2KUMA 2KDMA 4II2B 4A55A 1Y14B 3N1YC 1TT5B 3VQIA 1XO3A 3DEPA 2IX1A 3HOYH 3VDZA 5C44H 2H88B 3W3AA 3E9HA 4JBWA 2RHQB 1SIJA 4EE2A 4KKTA 4PZ8A 3NBHA 2BA0A 3PHXB 2BH8A 2RSOA 2JA8G 2R7ZG 2M9VA 2R7ZB 2KDFB 4FJZA 2QHOA 4M01A 3KUPA 3E0EA 2PTLA 4YT0B 5CYUA 1TTNA 1F1HA 1Y8PB 3L9AX 4JV5L 3T56B 1G6JA 1KLVA 2N1VA 4UP8A 2LGDA 5EDSA 5I6WA 2ZXOA 4RG1A 1X3PA 5C4XB 3T13A 2NVQB 1B2TA 2DLBA 3V60A 3QK0A 3NENA 4NZLB 1HR0Q 2UXCQ 3H1UA 2HDEA 5D94A 1XMQL 4DNRB 2FCNA 2G9HD 2JP1A 1FNUA 1P9DU 1YMHE 4ASWC 4RFBA 1N34Q 1EZ8A 1FCCC 4I7AA 4CO7A 3NTIA 1NDDA 1I4GA 4ZRQA 4PMCA 2MJ8A 1C4QA 4DNTB 4Q0FA 1OXUA 4P2CB 4ME5A 3A54A 1MJDA 2UYZB 4IUTA 3K9PB 3S14H 3K9OB 5TR5A 2RCFA 1J5EL 3C2PA 1HPCA 1SYCA 1A2TA 3U52E 1YN3A 1NI3A 3CCQA 2CVRA 3HG9A 2W9NA 3PTFC 4LNNA 1FNVA 1ZP0B 5C4HA 3A4SC 2N78A 1K9MC 2R7DA 2UUCQ 1AE2A 3CWIA 2VH2A 3T51B 2PZTA 1TGZB 4W9IA 3UGBB 3AQQA 2DY8A 4NQKE 1BBWA 4NDXA 2Y3AA 2H89B 5E4WC 4QIWB 4L5TA 5D3DA 1SYGA 2AYOB 2MBQA 3AMZA 4FN2A 4WWMA 2OEDA 5C3JB 4PYUA 1GUTA 2J52A 1TR5A 5D6JB 4B6WA 1HE8A 1PH4A 1FGUA 3T8MA 1XEEA 1RWSA 2KLCA 2E76C 1QVCA 1H9MA 2NVQH 3VRAB 1HNWQ 4EX5A 2PMVA 2VRRB 2ZPNA 5EAYA 4K2LA 1AH9A 3IVFA 5KHQA 3E0JA 4D2KA 4R8IA 2WXJA 2LXJA 3ZIMA 5FLMH 2WXGA 3CMMB 3GE3C 1N32L 2EQSA 4XXEA 2ZM6Q 5IODA 1VQNA 2ALYB 4X3SA 1CA6A 3KF8B 4H0LC 1D5ZC 1PZJD 3NSWA 3NP8A 4UPAA 4DN4M 1K8OA 2V3NA 3Q8AA 4IWQA 1GM5A 4KV2A 1MI0A 4I6NB 1UWXA 2R61A 1R9TH 4JI4Q 2FBWB 3VYTA 1KTKA 4I6LB 4HLEA 1D6EC 2N9LA 2AMCB 1QOFA 3KJOA 2X8XX 1WJNA 2F0QA 1AE3A 3G6JB 3KBXA 3A33B 1IYUA 4EQPA 2Z1CA 2Z4HA 1EY5A 1N33L 1CUKA 1IW7C 1EOTA 2EJFC 3B0AA 4DV4L 5ELCA 3A1QA 5EPJA 4JI7Q 1K0SA 5JJZA 2INCC 1ILQA 5EBCA 2BYFA 5ELEA 2B2UA 3P7JA 2HT1A 3H91A 4FNFA 3FDTA 4DWFA 1ICFB 1UE6A 4DKAC 3F2BA 2MP2B 1Z5SB 4FF1A 3ONSA 4NJCA 5BYRA 1XLPA 1HCZA 3T1HQ 3Q23A 1YHBA 2YEPB 4KMUC 3AULA 4DFAA 3A56A 2IGDA 2EPBA 3G7LA 1S3SG 2WXMA 4GXBA 2GVBA 1WYDA 4DR3Q 4EGVA 4KY7A 3MJWA 1K51A 5DCNA 1SNQA 3N30A 3TCAA 2JUOA 4XC2A 2NN6H 3I7FA 2GN5A 2L52A 4AUQC 4W9CA 5M5YH 2RCNA 1VQBA 4XQJA 2A68C 2K14A 4R8NA 4DNIA 5L83A 3ICEA 3BDOA 5JVG3 3ZXRA 1TQOA 4KI0A 2FJ2A 1OFFA 1N8RC 3AH7A 5JPNC 1I3QH 2B2WC 4MDKE 2L55A 4LW1A 2DZJA 4RHSA 5H92C 2O5IC 2QILA 3SK8A 3CCEA 5KNDA 4IUNA 1TWFH 1LYLA 2BW2A 2R3ZA 2K6DB 3QAQA 4A3BH 4JBMA 1JROA 1BR9A 2LHEA 3AE6B 3UDGA 3HM3A 1E2VA 4A93B 3VA7A 2GBNA 2B63G 3M95A 4AJYB 2PVOD 1NYQA 2K4KA 1JRPA 4ID6A 1ENCA 1TIID 4MGKE 4L23A 1J5EQ 2NUCA 1I94L 2PPHA 3NG0A 4ME3A 4M0WA 2EIFA 5I9PA 2L4NA 1KL9A 4NQLB 4LDTB 4AP4C 1RYJA 3MFGA 2KACA 4HJAA 1ZXIA 1E0ZA 3PZ8A 2C9WB 3SR6A 4H13C 4ZK9B 1PH8A 4LK1C 1E8YA 1WM2A 2VB3X 1ZXHA 2GBKA 3EC8A 4EUTA 5M9OA 4W9DA 3WAMA 1ASYA 4BS9A 1PH1A 4BKGA 3DEOA 3UDIA 4A3IG 1VQ6A 4CYEA 2EYMA 1XLQA 2QKIC 1AARA 3RI7C 3QWZB 1PFNA 4DAYA 1F9PA 3MFYA 5H8YE 1HFGA 1OXTA 2PNHA 1NEKB 2DZIA 1I4RA 1T5XD 2KHWB 4QIWE 1A70A 4FULA 4HVBA 4F88A 2D3AA 1PRTC 3TZDA 3J81E 1WJJA 3HOZH 3IT4B 1ZKOA 3BWUD 3MHZA 3MXGA 3CF5A 2BGFA 2RA4A 2VZKB 3Q0AA 4NAWB 3F2CA 1ACCA 1EYAA 4DR6Q 3EGRA 3S2DB 2I46A 4IJLA 4XE0A 3OWEB 1Q46A 3CAMA 4RAUC 1HFNA 3C1EA 4ZAIA 1IBML 3VH4B 1UE7A 2FHTA 5EBDA 3IAYA 1G91A 4DV4Q 3H7SA 2F0TA 2PQEA 1FO4A 2VL6A 4OEMB 2N9PC 2F0EA 3HOWG 1E1TA 2XIWA 1L2NA 2AQ2B 3KWVA 1IL2A 2DYOA 4LAAA 3U30A 4BA2I 4Y52H 1YJ1A 2QCPX 1Q8KA 4JVZA 4A3JH 2JN4A 4ZUIA 3AM9A 3P4SB 2JA6B 2N88A 1G8ZD 3M4YA 1WXSA 2VB2X 3C8YA 4PT5A 1H9SB 4H44C 1RF2D 4YWMA 1K0RA 5M3FB 4B3RL 1RM6C 3VR8B 3RZDH 3HKZG 2NB0A 3ZDMC 4K6LA 1SAPA 2PIAA 4DUYL 3RULA 2AUKA 1S5DD 5G5HA 3EFUA 4HAEA 3IKJA 4FXGC 4JI0Q 5GADC 4JGHB 4ACFA 2WAQE 5IA7A 1ICWA 1LT3D 5J1ZA 5I9OA 1CHQD 4U68A 4IFDI 3CSFA 3I63C 2V1YA 1VQOA 2ENBA 2LZ6A 3WDNA 1V1QA 1R4MB 1PH2A 5J17A 1HZ9A 2G1EA 3E56A 2JK8A 2G3QB 5J22A 2O5JC 2IO3B 3WAOA 1Q81C 1Q7YC 4M8MA 4L8JA 3PVLA 2PZWA 4BBNC 1SN8A 4DR1L 2OHFA 3I56A 1YITA 1LV9A 2F0SA 3E6ZX 3F1ZA 1WTQA 1EIYB 2IZVB 3ZW3A 3A9JB 1FM0D 2FMCA 1QZEA 5EGTA 2QA4A 4A20A 1GUNA 3PLVA 1N63A 2AKWB 5IT9E 3DBSA 1L6UA 1HEZE 3D4RA 4ZDVA 1Q3LA 3TQYA 3HKZE 1PGBA 4A3GB 2D0PA 4NXMQ 4DR1Q 2KENA 4XYQA 3PPAA 4MGIE 1LABA 1F77A 3HRZC 3NXWA 1VDZA 4NAWA 4WWOA 1QE6A 1NCVA 3QIAA 3QQ8B 3QOJA 2V4DA 2PKOA 1XCQL 4Q2JA 1EO6A 1CKMA 3ZO5B 4DV3L 2Z9HA 4IZ8A 3VTVA 3Q8DA 4N58A 4N9PA 5FLXL 4HMJA 2L0FA 5EKKA 4J15A 3TSSA 4AYBE 4KHPL 2D3BA 3HOVH 2PLPA 1ZUD2 5BO4B 4K2KA 3F8TA 3NHHA 4NP5A 3O13A 1HNXL 2ATWA 3H3VH 4BBSH 1QOAA 2WX1A 3L16A 4RM9A 4ANVA 4F7ZA 2Y5CA 2EYJA 4LUOA 2RMMA 4OZCA 1JB3A 2DNCA 1YX5B 4JYAL 4LTUA 3S2AA 3U58A 2W54A 4P71A 4I6PA 3CP0A 1KLUD 1V81A 3CCUA 4OIJA 3M4OB 3MEFA 2WINB 2AQ1B 2BDOA 3FEWX 1J7BA 2MJDA 1MJEA 3PREA 4TQUS 1V8QA 2KTRA 3Q3JA 3NVVA 3GTKB 5JJIA 4A3MG 2J0TD 3J7ZC 1ZKHA 3NBHB 1XPUA 5BN3A 2QW7A 1KC8C 3LGJA 2E2JB 1GHJA 1I4PA 1G2TA 2RDGA 3NUHB 3MVVA 3CPFA 1J7AA 3GQBA 4W9LA 2KXJA 2BWES 3M7NA 2XVSA 1YJNA 1LTSD 2K5NA 3MWYW 3M63B 4BOSC 4C7YA 3NUCA 2GLSA 2NWGA 3KW5B 3EA6A 1B9RA 3BJUA 1S5FD 2RDBC 1HNXQ 1VZ6A 1CKNB 2RVLA 3FVQA 3WOEA 3UI3A 1IYVA 3OYYA 2ZZPB 2KCMA 5JEAG 2BE5D 3AE3B 1QLBB 3W5VB 5IP9H 3G48A 3MXUA 4FVMA 2MFIA 3CRLC 2XGTA 5M3MH 5E1FA 3CMAA 1L4ZB 3Q69A 4DAMA 1E2ZA 5HY6A 2UU7A 3A9KB 4IWPA 3MHBA 4HWIB 2KJRA 2KOLA 2K28A 2MHVA 2ES2A 1G2SA 1TWHH 2QMTA 3AI5A 3K81C 3SDZA 5AZFA 4QB4A 1HRJA 4DQOC 3S1QB 2BKRB 4UP7A 2LVOA 3MC9A 1F9QA 1SR3A 4G50A 3TEHB 3URYA 4X64Q 3ZNHB 1WX8A 3HRDD 5KGUA 2F3WA 5A2QL 4J6HA 3R8BA 2K5WA 4LUZA 1EFID 4O2DA 4QJFA 2FINB 4LNIA 1FCLA 1CQVA 3RN2A 5IGGA 1ENFA 1WJ6A 4YWKA 2Q5WD 3H3VC 2WP9B 4JI8Q 2FAZA 2L76A 4K5XA 1JWBD 1S1QB 2F4IA 3CCJA 1DOLA 1PH6A 3MA2B 4W9JA 4MEMA 3U9SA 1B44D 1WMHB 5AZHA 3FILB 1GOZA 3RNBC 2JF5A 1M8AA 1DM0B 1H9KA 2KQ7A 4DK0A 3AN1A 3STBD 4NXNQ 2MQJA 3ZNZB 3A5UA 1VQGA 5IP7G 1WGGA 2LXCA 3BVMA 3DQVA 2KCTA 4OVVA 2EDGA 5IN7A 4NNJB 4W9HA 1LUZA 3RLFA 1VRAB 1PGAA 2INPE 3AE4B 2EYFA 3JAMi 2LUEA 2PE6B 4DHZE 1JWMD 3T1HL 5J39A 3RZWC 3STBC 2O2VA 4HPMB 3GZNI 5IY0A 1EF5A 3WCQA 4L5QA 1K8AC 2QDLA 4RGTA 1AP0A 2L11A 3I4OA 1SEBD 3GDEA 4Y7NB 4ANXA 3N52A 1C8CA 1F2RC 4DDID 1Y1WG 3AU7A 2JZ3B 4W9KA 4XZ4A 2E2IH 1U4RA 2VS1A 3N32A 4XT3B 1VQEA 2HUGA 2D10A 2XRSD 3E9SA 4LF8L 4YWLA 1C1YB 2F4VQ 3GTJB 3U50C 3S16B 3NS8A 1JOQA 2PW7A 1XJVA 2EE1A 3DWQA 3OMCA 4ZYNA 1VQLA 3JC66 1AN8A 1I6HH 1KDBA 2VH1A 4IKGA 5G5GA 1Q82C 2E6XA 3EUB2 2B29A 1IUEA 2YTVA 3DVNU 1LQBA 5EE0A 2N1WA 4A3PA 2K5PA 3OSOA 3J81c 1B8AA 1LTLA 2V9HA 4JYAQ 1FD6A 2UXDQ 4RM8A 1WWTA 1W2BA 4B9WA 3IFTA 3PLUA 3PF4A 1CI3M 2B3GA 1WGHA 3PQIA 1T9HA 2JXXA 4DV6L 2HJ1A 5E4XA 1C3TA 2WB1E 1KDCA 2MJEA 3NVZA 2J7ZA 2JA8H 5C0XH 5H1SE 5M3FH 4JV5Q 2PEAA 2AQ3B 4DA2A 4BY7B 4G7ZC 4DK1A 2JEAI 4IFDJ 4DV5Q 5JEAJ 4DR6L 5DPWA 4BY1B 4K7UA 4A3CG 2MUYA 1SJED 1UUPA 2BQQA 3M62B 3L0WB 2XEWA 4A8XC 1LACA 3MC8A 5JAVA 5CV9A 1HZBA 4JIOU 2B2YA 1WTWA 3U7ZA 3KH0A 3DBLI 2IY1B 1V43A 2NBWB 3FMCA 3RCZA 2QGQA 4DK5A 4W9FA 2KVZA 4G11A 1N60A 4O0AA 4QUFA 3TS2A 2R7FA 1IP9A 4PV1C 1SJHD 1IW7D 4LMQD 1SNCA 1BOSA 4DXFA 2LVPA 3S1QH 2IHEA 2ZJPA 3SEBA 4DV2L 2F3IA 2DAJA 3P20A 1HTQA 4II3B 4DV1Q 4B3SL 1IYFA 2DNFA 4HROA 1YNXA 2WB1G 2Z8LA 2DUDA 3FHWA 4CKBA 3ZGZA 3K5OA 4DU9A 1UGJA 3AEDB 1FR3A 5G2NA 1S3OA 1SMYC 3K8AA 3PCOB 1HNZL 4G57A 1JJGA 5E3FA 4DV5L 1XQQA 3L4PA 3HOWH 3VFKA 3W1SA 1L0XB 2OJWA 3MTNB 2D62A 3PO3B 1A8VA 2RPQA 2OQ0A 1NBFC 1FJGL 1C4PA 3MAQA 4DR2L 4R4TA 1V49A 3PRMB 3IRBA 2IW3A 3W1YA 3U2SC 2VQEQ 2LS01 1X6OA 1EEFD 3DMUA 1NTGA 2JA5G 2EJGC 3DWAA 5C3EB 2F0FA 4JOIA 4IFDH 1PH9A 2GOWA 3V62A 2AWNA 1TWGB 2DGYA 1Q1OA 2IBIB 4HKQA 3NZUA 2XN9C 1N62A 2A6ED 2JJQA 3DHQA 4JI3L 2WV6D 4E74A 3RFZB 4YWGG 5IYCG 3HZXA 4RNAA 2HJ8A 2K8HA 4FLHA 1E7UA 2UUBL 1NR2A 2ICIA 3A5ZB 4HCNB 1NSNS 2RD0A 2K8BA 4XWWA 1C76A 1GNUA 3QO2A 2DZMA 2KDEB 3DCGA 3TEXA 2QC8A 4DUZL 4M1UB 1WYWB 1K28A 2MCNB 2PCFB 4AIMA 1WFYA 3TEZA 2OWOA 1TZ1A 4L5SA 4BBSB 2JWUA 2NVXB 5C4JB 1V80A 4YSZB 5FLXc 2MBHA 1RTNA 1JR0D 3SK4A 5D14A 1A3UA 4JI0L 5D3IB 5IYBH 3P1MA 2ZT9C 3WANA 1SSOA 4US8A 4ARCA 1R4QB 3FPPA 1ZXTA 1ZGUB 1LLRD 3VDYA 4X66L 5KNCA 2C7HA 1PUTA 4EEWA 2SOBA 3NZSA 3A8IE 2M00A 4OVZA 4ICVA 2L0CA 4N9TA 2YVCA 1GB4A 1VQKA 1SXTA 1XNQL 2ASQA 3OJ4B 1X9NA 4A76A 3GE8C 1D3ZA 1YQ4B 2DYBA 3A8KE 2LHDA 4OWTB 3UIPB 1P0RA 4RGNA 1F9RA 2AEHA 4LNOA 3ND9A 4P1BC 2I5HA 3PO3G 4PNYA 1WF9A 2LVQA 3JVZX 4US9A 1PTOF 3J81i 1L1OB 3LJ3A 1N5WA 2JEBI 5M5XB 1MPEA 1WGYA 2NN6G 3NK9A 1FEHA 2PO4A 3CRKC 4MGYE 1MJCA 1H9JA 1I6HB 1WCMG 2LY7A 3U7DA 4EZKA 3K58A 1XNRL 2JRHA 1CHPD 1K50A 2GVAA 3WWVA 4CDDC 4ZLTF 1XPOA 3OOCA 4PZ6A 2BYEA 4JI2L 2R93B 1CMXB 1UE5A 2WDTB 4JG2A 1EY8A 3TRZA 1N61A 2ZW0A 2ZXPA 1KFYB 1X3QA 5FR3A 2F0UA 2F0MA 4MIUA 4HSPA 4LLGM 2I38A 1S4ZA 2E2IB 1EYGA 4C4VB 3AU4A 3B6YA 5JPMC 3HOXB 2JA7B 5HKHA 4KY6A 1OXVA 5LMUL 1YI2A 5LMNQ 4YCVA 2X69A 1IKLA 2PI2E 3X23A 3A74A 4MSMB 4RHRA 3PMFA 1QUQB 4Y7NH 1HNZQ 4K14A 1S40A 3HKZB 4K5VA 3I3CA 1EUVB 1NUCA 1XXGA 4FHKA 1Y1VB 1PA6A 3A1QB 4IPHA 1PTOC 3ETRA 1JWSD 3BU2A 4LJOB 4YXDB 4GKKL 1HUMA 1EEID 3S1NH 3ERSX 1DCZA 1IKMA 1D1IA 3IT6B 1WTXA 4QCLA 3AE9B 3ULPA 1ZPSA 3Q8BA 2RR9A 3TL5A 5IP7H 4DHJB 4A3JG 2R2OA 2F52A 2DN8A 2N55A 3DM1A 3LYYA 4AQYQ 2KFJA 3RMHA 1STEA 2PE9A 3CIRB 5LMNL 4XWTA 4JI5L 3RUZA 1QUQA 3IXSA 4P73A 5DEHA 3B2GA 3RLNA 1HHVA 3KYDD 1T6BX 2L1BA 3I2ZA 2KMCA 3QR8A 4MN3A 2Q8IB 1RJTA 1EQQA 3C0RB 3HOVG 5CHFA 1QCBD 1YOVB 2K3UA 4BWGB 2B2TA 4OZBA 2VNUD 3HOZG 4NAMA 4JL9A 4E71A 5FJ8H 3HP3A 3GTMB 1SNDA 2HQEA 5EKIA 2WU2B 3TREA 4FO2A 3W5OA 1DONA 4KD4A 3RNFC 2AUJD 4C3HG 1JJCB 3HOZB 4P74A 3S15H 2R92G 4A3IH 1IBKL 3HOYB 2EKEC 5C44B 1YJJA 1KOTA 4K6DA 4PQXA 4MNOA 4GN5A 1ZOYB 2KOXA 5ELFA 4LF8Q 5K36H 5G3LD 2BF8B 2AL6A 5C4ZA 4A93G 4BOZB 1Y8NB 4L63B 2REXA 2WGSA 4IG7B 4R3DA 4IUMB 4QY7A 1TVXA 2PQAB 3HKSA 2B63H 1ZE3D 5GMVA 5CMDA 5C4XG 2D11A 2M19A 3NELA 4HXDA 3RN9C 4DF7A 3VUYA 1K3BC 2PW9A 2NTSA 2D5DA 2TMPA 5HG2A 2EXZA 1ENAA 1YNND 4DV7Q 1UH6A 3ZQ4A 4HDQA 2MSED 5HGQA 1N5XA 2AHOB 4HIMA 4JPBW 3KWLA 3WA0A 5MPOA 1KDAA 4A3MH 2AWTA 4LFBQ 1UEBA 2KFKA 3K7AH 2VQFQ 2JYEA 4C3HH 4A6QA 4BY7G 4QMGA 3H94A 5JJKA 2JSVX 1J9OA 4BBRG 2EMTA 2WYQA 1BUIC 3AEGB 2XRQD 3CW2C 2JA7G 4B9XA 4BXXH 4K3BA 5DPTA 4A3OA 5BN5A 1Z7TA 1WOCA 5FJ8G 2FXQA 4K81A 3NBIA 4IW0A 3CPWA 3S15B 3A7LA 1X1MA 5EPKA 3GZNB 1E7VA 2YTYA 3ZNID 2NZOA 2IWHA 1DOIA 2PI2A 1SDFA 2CFMA 3V6EB 3FKIH 5T1IA 3FPUB 2R92H 4RH6A 1M1KC 2L8JA 3KF8A 1SNPA 2NZ1D 4IUUA 5CBAE 3L08A 2K75A 1Y1WH 1QNUA 3HEJA 1PFDA 4BBRH 3PF5A 3CXCA 1XMQQ 3VR5A 5BR8L 5C44G 1F2ZA 1JMCA 2Q8TA 4LF4Q 4BY7H 2F3VA 1E5WA 1XLOA 3HS0C 2CU3A 3GOEA 4JQWC 1ZYRC 1P7EA 5C5LA 4DR7L 4YCWA 1VZ8A 3AB5A 3J80i 3OG5A 3C3LA 2A74C 4PS7A 2UWQA 1YJ9A 2DJGC 1ZDVA 3GP7A 2DNEA 5E7NA 2DAFA 3DXJC 4DV0L 1BXTA 4A3IB 1II3A 3N1XC 1VQIA 2X6LA 1KJTA 2A19A 4KHVA 3I4MB 2K04A 3N20C 4OELB 3UI2A 3PO2B 2JT4B 1XT9B 2KMMA 1OGWA 3ALBA 5IYDH 2SNMA 1WTHA 3Q3MC 3LNNA 2HIVA 4LFAL 4GU2A 2JQRB 1IBLL 4CDCC 3F2UA 1STGA 4HR7B 2EELA 2ZM6L 3IBEA 4NMZA 3I73A 4JI2Q 2F03A 4GGQA 1NMFA 1PRTD 3H0GH 3PZDA 2QIEB 1K8MA 3J7AF 1TIFA 1CSQA 1RODA 1RRBA 4B3TL 5CV6A 4A90A 2MHJA 1F9SA 2VY3A 5EE9A 1HZ6A 4KGRA 3PSIA 1FD7D 2B39A 1STNA 3R3MA 2FCQA 1H95A 3KK7A 1BNZA 1GUWA 2LMCB 3HOXH 2Z6BA 4JOIC 1KIXA 2K32A 3T16A 3RZDB 3JYUA 1NE3A 4KN4C 3ZKJC 4HCEA 1N33Q 2BS3B 2BB5A 2V4IB 4KX6B 1TWAB 1X56A 1T0RC 2KYWA 1Y1VH 2KHIA 3I4MG 4TSSA 4PYZA 4DHZB 1YJWA 2C7NB 4APVA 2MGSA 2DYMA 2N9KA 3M3JA 4ODGA 4RA8A 3CCRA 4LUVA 4LF5L 3DWGC 5KEEA 1D5XC 4EVOA 4JI4L 3OIPA 1E8WA 3E9IA 3HHMA 1Q1BA 5T1GA 1KM7A 1WRIA 3M9BA 1EWIA 2M2LA 5C0XJ 1WYGA 5D2MB 2RQXA 1BBXC 4KSKC 1B3AA 2OCEA 4Z9CB 5DAUA 4KHZA 3A0JA 1C7YA 4DV3Q 1X54A 2BT6A 2BCOA 1QZHA 4EOYA 4GIVA 4A3EH 4AS1A 1C4AA 3PRPB 5JHAA 4LJZC 4HTHA 1VF7A 4NJ7A 2WXOA 5HFYA 3MC0B 1EWHA 1M94A 5G55A 5BMGA 1C77A 1NR4A 1FPYA 4CJ2C 5IGCA 4FA6A 1GUSA 1WR6E 2E2DC 3Q6BA 2HD3A 2B2YC 1SSNA 3CF6E 2UUAQ 4XQNA 5IT9c 1WIAA 2A5UA 1Q5WB 2C9OA 2GA4B 1MGSA 1VCBA 4JI1Q 2WXLA 3JAME 2WS3B 1EY4A 3A9JA 4J3OD 5I4DA 4MM3B 3TJPA 2D5GA 2IGHA 1T0YA 3RD4A 1CJEA 4G4KA 5CGKA 1CKNA 1HTPA 4KGTA 2KECA 3BDLA 4GDLB 4YHHL 4LF9L 3OIQA 3T9LA 1VDVA 3B1LX 1EUJA 1N9WA 3HOUG 2GMIC 2JXTA 2B8FA 1L0WA 4KDLB 4A93H 1DD2A 2O6VD 4HDOA 3OW2A 1XYIA 1NAPA 2K5VA 2LXKA 1PH5A 3PT2B 1A62A 2WACA 3GD7A 1FFVA 3AU5A 1YIWA 5K5PA 3OW7A 3SE0A 2IGGA 3OPOA 3DBLB 2L12A 2UU9L 3VR3A 3FKIB 2OOBB 3IFWB 4H2AA 1I50B 4F8MA 1I4XA 4AYBG 1VQHA 2PYKA 3BVZA 2CHXA 4YTNB 2RBMA 2P5ZX 4FP5D 4KJOA 4OWXB 2BOSA 1DYQA 2KC2A 4GB9A 2DBYA 1N36L 1VQMA 1TS3A 1DJRD 3E3XA 1FXIA 4A3DG 4DR7Q 3EROA 3GV3A 5BR8Q 1SFOB 5FO9B 3ITPA 2WXHA 4R4IA 1QVFA 4DR5Q 2ACZB 2F0LA 2JWZA 2F1MA 2INDC 1EIGA 2BDNA 5LLIA 1EM7A 2MEKA 1YQ3B 3CHBD 2G5DA 2E5LL 4C3HB 1PZKD 1CT1D 4IOAA 5HHDG 4CJ0B 3LX0A 5A2QE 1GKHA 1I5FA 2FIFA 2CJNA 3OJ3A 3H3VI 4ZHOA 3APDA 3Q14C 5IGBA 1ZW7A 4HPLB 4YSYB 3VTWA 1VF5C 4UY8C 1E7ZA 4A3GG 1UF0A 3HOVB 3AFQA 1MHHE 1B9NA 1UWVA 4GOPB 1LO5D 2PQAA 3GTMH 2NBUA 3GS2A 4LFCQ 3K5NA 3TS0A 3I57A 1TKEA 3GTLB 4TKOB 3AEVA 1B4OA 2L83A 3H9DA 3DLLA 3CD6A 1P8LA 1GUAB 4WJNA 2WB1B 2VUMH 1BVSA 1XMOL 1XMOQ 1YX6B 4KZ0A 3EHVA 3NRZA 4GDLA 5C5MA 2L05A 3GTKH 2LFIA 2RF4A 1MSGA 1YBYA 1E9MA 4K0KQ 1IGCA 4JBJA 4DAPA 2Q2HA 2F0JA 1MHXA 1R4NI 4C80A 5FOBB 1TS4A 1IBLQ 4OO1I 2CHWA 4IWOA 1CZGA 2KWCA 1N32Q 4GMVA 2UUBQ 4PMBA 1JWAD 2EKIA 3AFPA 2WWZA 1E1OA 2NVUI 1IZ6A 1LTBD 4WWNA 2NVYH 2X38A 1KRSA 3AECB 4K1RB 2DY7A 1U4PA 3AEBB 1WZ0A 2YYZA 1E90A 4WJQA 1FGBD 3T4AC 1VJKA 5IO9A 1F9JA 1SROA 4KIKA 3L2PA 2BYVE 4LNKA 2JRIB 2K52A 3HOUH 1C0AA 4A3BG 4EFOA 4X65L 5EKLA 4MSQB 4L1BA 2K33A 2KD0A 3UE0A 1PV4A 3RNAC 5JVH3 1TBEA 1K3RA 2KCNA 1EFWA 4DAYB 4BY1H 3ENEA 4C3JB 5HGTA 2CR5A 1SIFA 4B95A 5I6YA 1TZOA 2R93G 3OMGA 1JORA 1V5TA 4WFN3 1HXYD 1NBWA 1S5BD 4N6EB 4XTCS 3OHXC 2GRIA 3MEHA 2KCCA 5C6AA 2VQEL 3DOWA 4K5WA 4OO1G 3DHGC 2EMSA 3D31A 2C5CA 4FJVB 4WORA 2F0NA 3P1HA 1WD0A 3QJYA 1EIHA 1KABA 3ND8A 4DV2Q 2K7VA 1STYA 4GNXA 1FRDA 1K8RB 4M0WB 4M00A 5ISRA 1MI2A 4N8X1 1WR1A 1JQYD 3ZTCA 1IYJB 4DR4L 3P4PB 2NPTB 3SXHA 4GKJQ 4ZRKA 3GV6A 1Q12A 1KH0A 1SE9A 2D07B 1A15A 5IGEA 1RLFA 3S14B 3QC8B 3M7GA 2UXBQ 4OHJA 2J0KA 1DGJA 4YTMB 1QF6A 3SR1A 2FUHB 4FXDA 4TKNA 1MSHA 4DR4Q 1UBQA 1VQCA 1FJGQ 2RKSA 4NB3A 3Q8FA 1A5RA 4FYDA 1FXAA 2N7EA 1BKBA 1FIQA 3CU7A 3CQZH 4TQ0A 1EYCA 3GTOB 1G6PA 1E6EB 4WAFA 4XQQA 3I9V1 3K5MA 2KWUB 4XIGS 1WX9A 3F2DA 4OZAA 3FKIG 3CCSA 2GBMA 3KQ4A 5IYCH 1LTGD 4GOCA 4A3JB 3LDZE 3OTOL 1KRHA 4ZRIA 1WI0A 1EU4A 1P1AA 1VQJA 4KN7C 2O2VB 2KVMA 1N34L 3DVNV 4DGZA 4IFDG 1WSPA 2ZTEA 1YQBA 2LASA 4PG3A 2MO1A 4W9EA 1XTDA 3BY4B 2H1EA 2YU9B 5CX3A 3BG3A 3RZOB 2R7ZH 1D4BA 3NWSA 1BCPB 1STBA 2NBVB 4I65A 2KANA 1WTRA 1TY2A 2LWPA 1Y1VG 2J53A 3P42A 1TJEA 4WURA 3GTPH 1XF5L 1H8CA 3BK2A 3GTGH 3L0OA 2WLBA 5C3EG 2MBBB 5J18A 3NEMA 1ML0D 1WY8A 1E24A 5DNFA 3U4VA 3IAS1 3CSTA 3L10B 5LNK1 1RCVD 4PS8A 1J19A 4MJSB 4QF4A 2JX5A 1GJZA 3HOXG 2QCZA 2MJ3A 1V1PB 4P7IA 5IP4D 4S17A 2OF1A 3VR6A 1VQ7A 3M4PA 1KXLA 2N9XA 5C4XH 1OO9B 4QL5A 4HEDA 3R2IA 2KO3A 3ULJA 5T8IA 3V3XA 1GD7A 3R66C 3TP5A 3D6CA 2LGSA 1H9RA 1Q10A 3L7ZC 4JI3Q 3ZVVA 1WCMB 3EVQA 2KLGA 3ML8A 1DGSA 2M17A 3RLOA 2ZJRA 1WFQA 2I5LX 1PXUA 1W6KA 2UUCL 1K52A 3VHTC 1HZCA 2B2VC 2K05A 5E6NA 1L7YA 2KTFA 2ZNVB 2NVYB 3A4RA 4OVUA 1L0YB 2KK8A 3PUZA 2OXPA 1LT6D 3DWPA 3J7A5 2LEKA 5CC4A 1YJIA 2Z4IA 3GB1A 1OXSC 2C35B 2PW5A 4IM3A 3AE1B 5FKAC 1JE4A 2IY0B 5IWAL 4HKZE 5EE3A 3KLSA 3M3YB 1NYRA 1TY0A 3TUOA 4C1NI 4NXNL 4A3BB 2I2YA 4BBRB 3CC7A 3AE7B 3AV8A 1PYWD 1C9FA 1KF6B 1SMYD 1I3QB 1NY4A 3ZYYX 1UAPA 1E22A 5D65A 3S2HB 1OXXK 1HNWL 3PV1A 4HIOA 1L6VA 4OL7A 1PFMA 1EWYC 1GHKA 4DK3C 4B3SQ 2WDQB 2A69D 2CH4W 2L9HA 3GTLH 2LI5A 4ITKA 4P6VF 1I42A 2LJ5A 4HJKA 2A6EC 2IDYA 2RHSB 4JI5Q 1XLNA 3IHPC 3VUWA 2IX0A 2XK5A 1PTOB 4ARIA 3HOWB 1CQFA 2WX0A 2BS4B 2XK5B 4BBSG 4LCDE 1WXQA 1JICA 3EQLC 1XWEA 4RWSC 3DBRB 4XDXA 2UXBL 1TYGB 3UDFA 1KHIA 1MFWA 1SF0A 1GO3E 2I0QA 1PRTB 3PO0A 3GO5A 2EYOA 2KHSA 1R9TB 5EQ0A 2MLBA 2KVRA 3DBHB 2SNSA 2ZNVC 3S24A 3PIOA 4F7XA 1WTVA 2KN4A 2WHIA 4NW2A 1RD9D 3D4DA 1BT0A 2DHZA 2M4NA 2Z59B 5LL6S 1G51A 1ET9A 4DBGA 5J3BA 3MZ5A 2K9XA 5CV7A 3PO2G 1NMGA 1KQSA 3P75A 1YN5A 2NR2A 3LXFA 2MPMA 4LF9Q 2CQOA 1MIUA 4DUYQ 2K39A 4LF5Q 3IG3A 1QT9A 4BKSA 4X3UA 4TMAB 3ZRCA 4HRSA 1JWUD 5ELNA 5DPSA 4GOPC 2EY2A 1AEXA 1CM9A 1K8GA 3Q3NC 2WXKA 4TUUA 4LWCA 1X3GA 1Z6HA 1IHZA 4KJNA 2LD9A 2Z0DB 3BZKA 1YZ6A 3TMEA 3GTGB 2BBCA 2A73B 1NJIC 2KJXA 4V0BA 4YY3Q 2JA9A 1R4NB 4KKIA 4K3CA 4HSVA 5AZGA 5KRUA 1PRTF 3GTQB 1QQRA 4GN1A 1QKZA 3KLWA 3I55A 4RCOA 5D7GA 1W3SA 2F0IA 4RMFA 1EQTA 1VMPA 2EY5A 4XT1B 3FKYA 3QOLA 1VQ4A 4A9AA 2CJOA 4X3KA 3KFUA 3WALA 4RF1A 2EZVA 2M8SA 1EQRA 3ZDTA 4R4OA 1PDXA 2M1MA 1GXDC 1X55A 4EQOA 4C2MH 1OQQA 4RGOS 4FJYA 2DWQA 3RN5A 2WXFA 4C00A 5CORA 4JPSA 5C1ZA 4GDKB 3GTJH 4DV6Q 3S16H 1VQ9A 2VZKD 4C7ZA 3I8ZA 1QVGA 3TDQA 1MBYA 1XTCD 2JA8B 1JALA 5EE1A 2D9UA 2E2HB 1J8IA 1UD7A 2L3ZA 1IL8A 2ICEC 2OTLA 2C5LC 3J80c 4KHPQ 2K0PA 3I4NB 1DOKA 2I1KA 4X6AH 5IAAC 3IAM1 1SE3A 5C23A 1HTLD 2WKDA 4ZYSA 1I94Q 5IGFA 3J7YW 4QAYA 4PK1A 4A3CH 4AH6A 2QDFA 4F1SA 1L5PA 2X6GA 3KUCB 4J8QA 2Q2TA 1BQQT 2E5LQ 3R7QA 2CW0C 5KYLA 1QG7A 1N6ZA 5IOCA 1BCPF 2EJMA 2K1BA 3HK0A 1U0LA 3VR2A 2KEEA 1T0SC 1LTID 3NWTA 2XWBB 4CGYB 2MBEA 1WD1A 4ZKBB 5K36G 4L5RC 1R7SA 1F2MA 4H7BA 2N49A 3ER0A 3RPFC 4LFAQ 3H7PB 3KLSX 4M8AA 4AJWA 1NI2A 2EVBA 4IN3A 2FCMA 3B08A 5IIFA 3H8HA 3JW0X 4A3FB 3BS1A 3VAWA 5LHY1 3S17B 2L0TA 2R2QA 4BKTA 1V1PA 1D7QA 4DUZQ 4XDCA 1U5KA 5M5XH 2KDIA 4B3RQ 3PIO3 4FF2A 3SK6A 1Y1WB 1K83H 1FRRA 1VMCA 1B53A 3AEFB 4BA1I 4DDGD 2B3AA 2BYTA 3FRPB 2YTXA 4KIKB 2R6GA 3APFA 1KNEA 5C4JH 3K5LA 2CCZA 2LJIA 1MG4A 2KJHB 1WVLA 4MTKA 1FYCA 3BVGA 1PQSA 3D0FA 5LXHA 2M56B 2LXAA 2N7DA 1Q1EA 3ZNGC 1U9RA 3X3MA 2W3SA 2ZTDA 1BF4A 4OW0A 1EYDA 2XWJB 4WQMA 2IX3A 5BMHA 4ZHPA 1E3PA 5M3MB 2KT7A 4O1NA 2IHFA 2XSCA 2ZTCA 4KY5A 1CFMA 3M3YH 3AXCA 2G4SA 3V6CB 2NMQA 1DXMA 2PJHA 5KHOA 4MJSA 1J7CA 2JU6X 1G6ZA 1B3QA 4NY0A 2QDBA 4PS3A 2EYHA 1SE2A 1RKNA 5CR3A 3OLMD 2BA1A 2A6HC 4B0EA 1V2YA 1LGRA 3ABVB 1V5OA 4F8CB 1S5CD 3T3OA 2KQ3A 5L95C 2H5XA 4ZKCB 5IOIA 4LFBL 5ELBA 1Y69U 5GQOA 2KHJA 2JXMB 1UBIA 3B2FA 3TEYA 4QUCA 1I7HA 3A7AB 1GUGA 4TRDA 1YHQA 2PMZE 3J81L 3D4WA 2ZPYA 2PNRC 1TWHB 1SB3C 1KD1C 2K5DA 5CV4A 4KTAA 1TWCB 1N36Q 1NVID 3D3RA 1WMHA 2WNMA 4YTPB 5DPRA 3DPDA 3T53B 1EY0A 2ID0A 2IO2B 2NS5A 4JBKA 1WGKA 4G7OC 3JSVB 3RNGC 3K7AB 5KYIA 4EKUA 3N3KB 5IYDG 1VQDA 2JYTA 2Y5BB 2F4VL 3HFZB 1SGHA 3B9JA 1TWCH 4JC0A 1A63A 2YLMA 5CBEE 1D5MC 2EY6A 4TV3A 2K03A 1RIPA 3V05A 2RGFA 4K8JA 1ESRA 2N4FA 2WIIB 1VQAA 5L37A 4JI7L 4MH8A 2N8NA 4CBVA 5BMIA 1HUNA 3U4ZA 2F0VA 4NXML 5CV5A 3T3NA 1VQFA 2JA5H 4HEA1 4ZQ3A 2JZZA 2JVCA 5M5WH 1K83B 1XNQQ 4GKKQ 3ZTDA 3UDXA 3TEWA 4BKSD 2WKCA 4WQOB 2EY1A 1Z9FA 2F0HA 2KKCA 1WTPA 1YNJD 3S1MB 2ZCCA 1JB7A 3BZDB 3PUYA 5FLMG 4X57B 5ELOA 2JSOA 4R4QA 3L3OC 1ZEQX 1I4HA 4JWSC 4ZOHC 3MXPA 3A9KA 2E75C 3MXNB 3GTPB 5CTRC 4CHKA 3SD5A 1YNJC 4MT5A 2ZVNA 3I91A 1Y8RC 3SFDB 2D0OA 3PV0A 4POGA 2ZXRA 2WU5B 2A6HD 2IPKD 2KQSA 1J0GA 1WJ4A 3QHTA 4DV1L 1YD8U 3X0WA 3KF6B 3EFXD 4HN7A 1WE6A 3MP9A 3TN2A 5IWAQ 1UZXB 2I5MX 4DXAB 3ZJVA 1WM3A 2G9DA 4HCPB 3S2DH 3S17H 3A55A 1OTRB 4OIKA 4X65Q 3Q8EA 2HCCA 3RYTA 2Y0SG 3Q3OC 4R4CA 1E7PB 4CJ1B 4LNFA 4BVUC 4CQNA 3CCMA 4X64L 4ICUA 5JH5C 4C56C 4B08A 2CU1A 2LUMA 2WDVB 3ZJUA 2Z0SA 2Q2IA 1B70B 2WFWA 2PVGC 4NPNA 1OQRA 5JHBA 2E2HH 1ISNA 1EOVA 2F0GA 4IPCA 5GAGC 3SK5A 3MXNA 1M90C 2BH2A 1WZ3A 3ULLA 3RT3B 4DHJD 1T3QA 5FLXE 2A1AA 3HIZA 3ZJYC 4X62L 1R4MI 1IGDA 4HJ7A 2D3CA 2M0AA 5FO7B 4BAXA 1EIFA 1LT4D 4C3JH 2MO0A 3PUWA 1U4MA 4DR5L 3NY5A 2JE6I 4HJ5A 2GBRA 4WJWA 2BB6A 1QB5D 1V1OA 4YIJA 3FC4A 5JZEB 1O80A 1PGXA 3MJ5A 4GN4B 2BKFA 2N0SB 3KF6A 5I2YA 3ONAB 2EYPA 2WXRA 3VXWA 4WH4A 3VR4A 2ZVOA 2ASBA 4MTNA 1GPXA 1GVPA 2KMAA 2B76B 2G45B 2K01A 3KUZA 3N1ZC 2MQHA 3TP7A 4KZCA 3W1SC 3UQAA 4C3JG 3GTQH 1NENB 3K0XA 5DLQE 1PVOA 4USAA 5CHVC 2RSNA 5EJWA 2YEPF 2LMCA 4IUPA 3NTHA 5IGDA 1QOBA 1UWMA 3QARA 3S1MH 1ESFA 1BCPC 1PYBA 2UUAL 3I4NG 2INNE 1SYFA 3EFCA 4RF0A 1L0VB 4N59A 3TZUA 2JQOA 4B0MA 3X3NA 1PHJA 1FNWA 5A35A 3LB8C 3DDCB 1JE5A 3HOUB 4RKLA 1LM0A 2QSDA 3RNCC 4Q5VA 1IBMQ 4WJPA 4REZA 2J4XA 3SGIA 2MX2A 4CKCA 4ULLA 4C2MB 2A4ZA 4KLKA 1GB1A 5I2XA 3VH3B 4U673 3KDFA 4X66Q 1TXYA 4OWWB 4IOIE 2LRWA 3KBGA 4ZRZA 1JCKB 3QG1A 2K8CA 2WQYB 1HR0W 3Q6SA 3WOFA 2NN6I 3AEAB 4KK7A 5F2DA 3KOJA 3HGBA 1Q0WB 2WP8J 3T1YQ 4LF4L 4B9KA 4E3CA 4EQ5A 3HM6X 2CWPA 5COYA 3ML9A 4A3LH 2E3TA 3C46A 3M85A 3DBHI 4IOCA 4C4VA 4GSWA 3SHQA 3NTKA 5E6JA 3QB3A 1WI5A 5FK9C 1AWDA 1XCTL 4EQNA 4RGMA 2AWOA 4OX9L 4P72A 1YNTE 3DVGX 4OGQC 3RZFA 3J7AV 2XTIA 4NPSA 2J0JA 3P4RB 1TWFB 1EZ6A 3S9WA 5M5WB 1AYFA 4JI6L 1LXDA 1Q8IA 1AZQA 4RCNA 2R92B 4HCSA 5GAEC 4DR3L 4QQBX 2CKHB 2N7JA 3NJTA 2CH4A 3QJZA 2CKZB 3VYSA 2NVXH 4WJ3M 1VR9A 1V97A 4OX9Q 2XBBC 4WWPA 4K0KL 3K59A 3V2TA 3EJIA 3WAPA 3PGZA 4MM3A 1XNRQ 5IE8A 4GLSC 4DV0Q 4ZRPA 1RFKA 4JLCA 1RHPA 2KWDA 2MW5A 4XGAB 4BFRA 4F87A 3NVWA 3R7RA 2W82A 1QOGA 2O4XA 1H9SA 4HJ9A 2ZCBA 3ZJTA 1K73C 2NCNA 2Y0SB 1UGMA 1MHWC 3I5JC 1UEAB 4LFCL 2PZUA 2KFKB 4LJPB 4A3MB 4K7WA 4A3KB 3LWUA 2CS4A 1JRUA 4KKSA 4MELA 1HQMC 4A3LG 1TT2A 2SDFA 4KKJA 2Y0SE 1GC6A 1JOKA 3KUDB 5M3MG 1DOYA 3Q2AC 4X62Q 1SFOH 5DM63 1TKYA 5FR6A 2Z6KC 5G3LF 1XPRA 1VQ5A 2C7MB 3RZOH 4I7ZC 3R93A 4IM2A 3RR5A 3A8JE 4KV6A 4ZRJA 5IKCM 4GNXB 4CDEC 2JYOA 1L1OC 2OEOA 3W1GA 1OTCA 4WRDA 3CCVA 1IBKQ 3R2TA 2SAKA 4IPGA 4JW0A 1VCIA 4WJ4A 2GI9A 1WTOA 1WH3A 3I4LA 5M5YB 1ZDXA 3MTSA 1HTOA 2JPHA 2N3SA 2RDHA 3G6EA 4JWUC 3NE5B 4A3GH 1CTMA 1QNKA 3EBEA 3I72A 2IYDB 3P4QB 3PS6A 4A3DH 1KAWA 4JX1C 1PLFA 2TSSA 4OO1H 5AUKA 3RMKC 5NUCA 2KA7A 3ZXVA 1SBBB 1EWCA 1LM8B 4G0NB 5CHWA 3SDLC 4A3EG 3KLRA 4DAVA 1JMLA 1RFAA 1C4CA 4AQ7A 2SEBD 1YEZA 3Q22A 2MP1A 3AMUA 4UHVA 1F52A 4H02A 5C0XI 1GC7A 3VVWB 4MH0E 4IM0A 1W6JA 5JXVA 1JW9D 2L7RA 3TBIB 3RNUA 4XDDA 1PYSB 3CKIB 4IO9A 1O7LA 3C1FA 2JA7H 4BXXG 4HIKA 2F0OA 1R4PB 3D8GA 4S3SA 2V3SA 2FMMA 2NBFA 4DR2Q 4A3EB 1PDQA 1L4DB 1BCPD 4HMIA 2J0MA 2WXNA 5J2RA 2OT2A 1V86A 2HHHL 1WXMA 3TMPB 2HIXA 1JC7A 4JCVE 2CQAA 4XYOA 2O6VA 1V9PA 1VQPA 4IURA 2I1JA 2L15A 1JQ4A 1A3TA 3NQIA 2KBNA 2YU9H 1P98A 2KNBA 3J9CA 1YVCA 1X65A 3Q24A 1GJXA 2JA6H 1B7YB 2D3GA 3I3TB 4WIPA 2HHHQ 2FE8A 4X3TA 2BWFA 2L1AA 3BIID 2JA6G 1JOOA 2ZEQA 2LGXA 4DV7L 2MP2A 2WXQA 3DHIC 4B3ML 2BS2B 1FL0A 4DK6C 4HJ8A 2WXIA 2Z0EB 4WAAA 1C79A 4ANWA 2E8GA 3KYHC 4MGZE 4FXKC 3RNEC 4ZUJA 4ZCKA 3PO2H 2F0DA 1ET6A 3CC2A 2GBJA 3G4SA 3CQZB 2KN5A 3DM3A 3L13A 1JJ2A 4FF3A 5C2TB 4DPGA 2UU9Q 1FXTB 1HQRD 4G3XB 1LTAD 4JI1L 4C1NK 5C3XA 3JAML 2G4DB 1WE7A 4GKJL 3NVYA 1MKHA 4A3KG
chains in the Genus database with same CATH topology
1O78A 2VUMB 3IL8A 2F0PA 1GUOA 2B2TC 1IBXA 5JOBA 2K6AA 1F2YA 2JA5B 2J42A 1P7FA 4FXCA 1QWYA 2IJ0A 2O2LD 5BN4A 1A2UA 5GXGB 2LFNA 1TU2B 1PFBA 5CV8A 3P63A 2ACZB 3NPPA 1ILPA 1U4LA 3ERQA 1LT5D 1EU3A 4A3DB 5FO8B 5HURA 1STAA 1CA5A 1EY9A 4AYBB 1C48A 4C3IB 3E5SA 2B8GA 1D1KA 1RDPD 1E10A 4KGSA 4L2YA 1PTOH 2NYZD 2QF7A 3DUZA 1IBXB 3IFDA 5KIXA 3NS1A 2LGIA 1SNOA 1KNAA 1KLGD 2D2CC 3W5UB 2LKVA 1FFUA 4MHEA 5EPLA 2WDRB 2RPVA 4ABNA 2E74C 1EQVA 1V8CA 1O7YA 4JE3B 1RTOA 3H09A 1CK1A 1QOHA 3FAHA 3Q8CA 1BDOA 4J1MA 1HA5A 1X32A 1FMAD 5DM73 2PMZB 1F2RI 3NZ3A 1TS2A 2GB1A 1UNSA 3VYRA 1LTRD 1G291 2WAQB 5IT9L 4C3IG 5TSSA 1ZYRD 2A69C 1EY6A 1HZ5A 2K22A 3NQTA 3HUIA 3PUXA 1I6VC 3SFEB 1A6XA 2L5TA 1TS5A 1O7ZA 1BUVT 1BO0A 4CHTB 1VLBA 4ILWA 2H4OA 1CZPA 3HVDA 3W2DA 1AZPA 1PTOD 1A3VA 1ONLA 3VRBB 1TKGA 1YN4A 4HJGE 3TEXA 4A6QA 5LL6X 1CZWA 2JZPA 3R3OA 2NVTB 1SE4A 2IT1A 4FF4A 1PMRA 2XNAC 2HTME 3PUVA 2CHBD 2HDLA 4IUQA 3D6WA 5C0XG 4KD3A 2QJLA 2VXWA 4KKUA 3H6MA 3W9CB 1B1ZA 4GZYC 3AEEB 2FFKB 3K6OA 3N9YC 1Y56A 3H0GB 4LK0M 5KNBA 4IUVA 3S1RB 1Z47A 3S1NB 2NTTA 1Y8OB 2B2WA 1DOMA 3U9OA 3N6RA 1DZ1A 3BDCA 1T5EA 1F2LA 3K57A 5JEAH 1C78A 1E2WA 3VR9B 1MVKA 2L32A 5HI1A 3V96A 3LWEA 2A5HA 3PIP3 4PMWA 2W55A 3TP8A 4YSXB 4R9WA 1B50A 2KEDA 4G7HC 2K5QA 3U4EG 1S5ED 4O42A 3VA5A 3BYTB 2V0GA 2AX5A 4TQ1A 2CW0D 4IDIA 2B2VA 3I90A 3AE2B 5AUIA 1STHA 1PZID 5BYQA 2B2UC 1DOXA 1Q90A 4RKBA 2BE5C 5BYSA 1HA6A 3BK1A 3HVZA 4UDUC 2IL8A 1QJOA 4UAIA 2W3RA 3K0YA 3J80L 1KAAA 4CKEA 4NKLA 1E0BA 1YNNC 1SYEA 1EY7A 1TKWB 2HDMA 3QWNA 2A68D 4IQZA 4DXGA 1VZ7A 2KAJA 1SYDA 2PPBC 2BTEA 2Y5PA 2ONQA 3J80E 1QILA 3AB9A 4K8IA 2QEJC 1GAQB 4JK1C 2WXPA 2KQ4X 1SNMA 5C3WA 1I4QA 3AE5B 4L6TB 2F0WA 3FILA 2Q8RE 3AE8B 2ZW1A 4MACA 3I70A 3VYUA 1LTTD 1AW7A 1ROEA 5AFWA 1B9MA 2I07B 4E6IA 3DWMA 2EOTA 2V3PA 3BYYB 4P16A 3SVMA 1EL0A 4V190 1M4VA 2RDFA 3SHLA 1D2BA 1MD2D 3OWFA 2ON8A 1BMLC 1XX8A 1K53A 5ELDA 4IALA 2FUG1 2F0KA 2B63B 1AFPA 2MH7A 2HCIA 1F0ZA 2EYLA 3TP6A 3PZ7A 1SYBA 2KDMA 2KUMA 4A55A 3VQIA 1XO3A 3DEPA 2IX1A 2H88B 3W3AA 4JBWA 1SIJA 4EE2A 4KKTA 3NBHA 2BA0A 2RSOA 2M9VA 2R7ZB 3KUPA 2PTLA 4YT0B 5CYUA 1Y8PB 3L9AX 3T56B 5I6WA 2ZXOA 5C4XB 1X3PA 3T13A 2NVQB 1B2TA 2DLBA 4NZLB 2HDEA 4DNRB 2G9HD 2JP1A 1FNUA 1YMHE 4RFBA 1FCCC 1EZ8A 3NTIA 1I4GA 4ZRQA 4PMCA 2MJ8A 1C4QA 4DNTB 4Q0FA 1OXUA 4P2CB 4ME5A 3A54A 4IUTA 3C2PA 1HPCA 1SYCA 1A2TA 3U52E 1YN3A 1NI3A 2CVRA 3HG9A 1FNVA 1ZP0B 5C4HA 3CWIA 3T51B 2PZTA 2DY8A 4NDXA 2Y3AA 2H89B 5E4WC 4QIWB 5D3DA 1SYGA 3AMZA 4WWMA 5C3JB 2OEDA 1GUTA 2J52A 1TR5A 1XEEA 1RWSA 2E76C 1H9MA 3VRAB 2PMVA 4K2LA 3E0JA 4D2KA 4R8IA 2WXJA 2WXGA 4XXEA 5IODA 4X3SA 1CA6A 4DN4M 4H0LC 1D5ZC 1PZJD 3NSWA 3NP8A 1K8OA 2V3NA 3Q8AA 1MI0A 1UWXA 2R61A 2FBWB 3VYTA 1KTKA 1D6EC 2N9LA 1QOFA 2F0QA 3G6JB 3KBXA 1IYUA 4EQPA 2Z1CA 2Z4HA 1EY5A 1EOTA 1IW7C 2EJFC 5ELCA 5EPJA 5JJZA 1ILQA 5EBCA 5ELEA 2B2UA 3P7JA 3H91A 4FNFA 3FDTA 4FF1A 4NJCA 5BYRA 1XLPA 1HCZA 3Q23A 2YEPB 4KMUC 4DFAA 3A56A 2IGDA 2EPBA 3G7LA 2WXMA 4EGVA 4KY7A 1K51A 1SNQA 2NN6H 2L52A 4XQJA 2A68C 4R8NA 3BDOA 5JVG3 1TQOA 4KI0A 2FJ2A 1OFFA 3AH7A 5JPNC 2B2WC 2L55A 5H92C 4RHSA 2O5IC 2QILA 3SK8A 5KNDA 4IUNA 2BW2A 2R3ZA 2LHEA 1JROA 1BR9A 3AE6B 1E2VA 4A93B 3VA7A 2PVOD 1NYQA 1JRPA 4ID6A 1ENCA 1TIID 4L23A 2NUCA 4M0WA 5I9PA 2L4NA 1RYJA 3MFGA 2KACA 1ZXIA 1E0ZA 3PZ8A 3SR6A 4H13C 4ZK9B 1ZXHA 4LK1C 2VB3X 5M9OA 4BS9A 3DEOA 2EYMA 1XLQA 2QKIC 1PFNA 4DAYA 1F9PA 3MFYA 5H8YE 1HFGA 1OXTA 1NEKB 1I4RA 1T5XD 1A70A 4F88A 1PRTC 3TZDA 3J81E 3IT4B 1ZKOA 3BWUD 3MHZA 3MXGA 2RA4A 2VZKB 3Q0AA 4NAWB 1ACCA 1EYAA 3EGRA 3S2DB 2I46A 4XE0A 3OWEB 4RAUC 1HFNA 3C1EA 4ZAIA 2FHTA 5EBDA 3IAYA 1G91A 2F0TA 2PQEA 1FO4A 2F0EA 2XIWA 2AQ2B 3KWVA 2DYOA 4LAAA 4BA2I 2QCPX 3AM9A 4ZUIA 3P4SB 2JA6B 2N88A 1G8ZD 3M4YA 3C8YA 2VB2X 4PT5A 1H9SB 4H44C 1RF2D 5M3FB 1RM6C 3VR8B 2NB0A 4K6LA 1SAPA 2PIAA 2AUKA 1S5DD 5G5HA 4HAEA 3IKJA 4FXGC 1ICWA 1LT3D 5J1ZA 5I9OA 1CHQD 4U68A 4IFDI 2ENBA 3WDNA 2G1EA 3E56A 5J22A 2O5JC 4L8JA 2PZWA 2OHFA 1WTQA 1LV9A 2F0SA 3E6ZX 1FM0D 2FMCA 5EGTA 1GUNA 1N63A 5IT9E 1L6UA 1HEZE 3D4RA 1Q3LA 1PGBA 4A3GB 4XYQA 1LABA 1F77A 3HRZC 3NXWA 1VDZA 1QE6A 1NCVA 3QIAA 3QOJA 2V4DA 2PKOA 1XCQL 4Q2JA 4IZ8A 4N58A 4N9PA 5FLXL 4HMJA 5EKKA 3TSSA 2PLPA 1ZUD2 4K2KA 4NP5A 3NHHA 1QOAA 3O13A 2Y5CA 2EYJA 2RMMA 4OZCA 1JB3A 2DNCA 4LTUA 2W54A 1KLUD 4OIJA 3M4OB 2WINB 2AQ1B 2BDOA 3FEWX 1J7BA 2MJDA 4TQUS 1V8QA 3NVVA 3GTKB 2J0TD 5BN3A 1G2TA 2E2JB 1GHJA 1I4PA 2RDGA 3NUHB 3MVVA 1J7AA 3GQBA 3M7NA 2XVSA 1LTSD 3MWYW 4C7YA 3NUCA 2NWGA 1B9RA 3EA6A 1S5FD 1VZ6A 2RVLA 3FVQA 3WOEA 3UI3A 1IYVA 5JEAG 2BE5D 3AE3B 1QLBB 3W5VB 3MXUA 4FVMA 3CRLC 1L4ZB 5E1FA 3Q69A 1E2ZA 3MHBA 2KOLA 2K28A 2MHVA 1G2SA 2QMTA 3SDZA 4QB4A 1HRJA 4DQOC 3S1QB 1F9QA 3URYA 3HRDD 5KGUA 2F3WA 5A2QL 4J6HA 3R8BA 2K5WA 1FCLA 1EFID 2FINB 1CQVA 2Q5WD 5IGGA 1ENFA 2WP9B 3H3VC 4K5XA 1JWBD 2F4IA 1DOLA 5JXVA 3MA2B 3U9SA 1B44D 3FILB 1GOZA 1M8AA 1DM0B 1H9KA 4DK0A 3AN1A 3BVMA 2EDGA 3RLFA 1VRAB 1PGAA 2INPE 3AE4B 2EYFA 1JWMD 5J39A 3WCQA 4RGTA 1AP0A 2L11A 1SEBD 4Y7NB 3N52A 1C8CA 1F2RC 3AU7A 1U4RA 4XT3B 2HUGA 2XRSD 3E9SA 3GTJB 3S16B 1JOQA 2PW7A 2EE1A 3DWQA 3OMCA 1AN8A 1KDBA 4IKGA 5G5GA 2E6XA 3EUB2 1IUEA 5EE0A 2K5PA 3OSOA 1FD6A 1WWTA 4B9WA 3IFTA 1CI3M 5E4XA 1KDCA 2MJEA 3NVZA 2J7ZA 5C0XH 2AQ3B 4DA2A 4BY7B 4G7ZC 4DK1A 2JEAI 4IFDJ 5JEAJ 4BY1B 2MUYA 1SJED 1UUPA 4A8XC 1LACA 5JAVA 5CV9A 2B2YA 1WTWA 3U7ZA 1V43A 3FMCA 1N60A 4QUFA 4PV1C 1SJHD 1IW7D 4LMQD 1SNCA 1BOSA 4DXFA 3SEBA 3P20A 4HROA 2Z8LA 4CKBA 3ZGZA 3K5OA 4DU9A 1UGJA 3AEDB 1FR3A 1SMYC 4G57A 5E3FA 3L4PA 3W1SA 1L0XB 2D62A 3PO3B 1C4PA 3MAQA 2IW3A 3U2SC 2LS01 1EEFD 3DMUA 2EJGC 3DWAA 5C3EB 2F0FA 4IFDH 2AWNA 1TWGB 4HKQA 3RFZB 2XN9C 1N62A 2A6ED 3DHQA 2WV6D 4YWGG 4RNAA 3HZXA 1NR2A 2ICIA 1NSNS 4XWWA 1C76A 3QO2A 4M1UB 2PCFB 3TEZA 4BBSB 2JWUA 2NVXB 5C4JB 4YSZB 1RTNA 1JR0D 3SK4A 5D14A 1A3UA 5D3IB 3P1MA 2ZT9C 1SSOA 4US8A 4ARCA 1R4QB 3FPPA 1ZXTA 1LLRD 5KNCA 1PUTA 2SOBA 3A8IE 2M00A 4OVZA 2L0CA 4N9TA 1GB4A 1SXTA 1YQ4B 3A8KE 2LHDA 4RGNA 1F9RA 3ND9A 4PNYA 4US9A 1PTOF 1N5WA 2JEBI 5M5XB 1MPEA 2NN6G 3NK9A 1FEHA 2PO4A 3CRKC 1I6HB 1H9JA 2LY7A 3K58A 1CHPD 1K50A 4ZLTF 3OOCA 2R93B 2ZW0A 1EY8A 1N61A 2ZXPA 1KFYB 1X3QA 5FR3A 2F0UA 2F0MA 4MIUA 4HSPA 4LLGM 2I38A 1S4ZA 2E2IB 5JPMC 3HOXB 2JA7B 4KY6A 1OXVA 2X69A 1IKLA 4RHRA 3PMFA 4K14A 3HKZB 4K5VA 3I3CA 1NUCA 1XXGA 1Y1VB 1PTOC 3ETRA 1JWSD 4YXDB 1HUMA 1EEID 1DCZA 1IKMA 1D1IA 3IT6B 1WTXA 4QCLA 3AE9B 1ZPSA 3Q8BA 2DN8A 2N55A 3DM1A 3LYYA 3RMHA 1STEA 3CIRB 4XWTA 3RUZA 3IXSA 5DEHA 3B2GA 1HHVA 1T6BX 2L1BA 4MN3A 2Q8IB 1RJTA 1QCBD 2K3UA 4BWGB 2B2TA 4OZBA 2VNUD 4NAMA 3HP3A 3GTMB 1SNDA 2HQEA 5EKIA 2WU2B 4FO2A 1DONA 4KD4A 2AUJD 4C3HG 3HOZB 3HOYB 5C44B 1YJJA 4K6DA 4PQXA 1ZOYB 5ELFA 5K36H 5G3LD 5C4ZA 1Y8NB 4L63B 4R3DA 1TVXA 1ZE3D 5CMDA 2M19A 4DF7A 2PW9A 2NTSA 2D5DA 2TMPA 5HG2A 2EXZA 1ENAA 1YNND 3ZQ4A 1N5XA 3KWLA 5MPOA 1KDAA 2JYEA 4QMGA 3H94A 2JSVX 1J9OA 3AEGB 1BUIC 2XRQD 4B9XA 5BN5A 1Z7TA 3NBIA 3S15B 3A7LA 5EPKA 1DOIA 2IWHA 1SDFA 5T1IA 3FPUB 4RH6A 3KF8A 1SNPA 2NZ1D 4IUUA 5CBAE 1QNUA 3HEJA 1PFDA 3VR5A 1F2ZA 2Q8TA 2F3VA 1XLOA 2CU3A 3HS0C 1ZYRC 1P7EA 5C5LA 1VZ8A 3AB5A 3C3LA 2A74C 1ZDVA 3GP7A 2DNEA 3DXJC 4A3IB 1BXTA 1II3A 2X6LA 4KHVA 3I4MB 2K04A 3UI2A 3PO2B 2KMMA 2SNMA 3LNNA 2JQRB 3F2UA 1STGA 4HR7B 2EELA 4NMZA 3I73A 2F03A 1PRTD 2QIEB 1K8MA 3J7AF 4A90A 1RODA 5CV6A 1F9SA 5EE9A 1HZ6A 4KGRA 1FD7D 2B39A 1STNA 1BNZA 3KK7A 1GUWA 2LMCB 2K32A 3T16A 3RZDB 4KN4C 4HCEA 2BS3B 2BB5A 2V4IB 4KX6B 1TWAB 4TSSA 2MGSA 2DYMA 2N9KA 4ODGA 4RA8A 3DWGC 5KEEA 1D5XC 4EVOA 3OIPA 1Q1BA 5T1GA 1WRIA 5C0XJ 2M2LA 1WYGA 2RQXA 1BBXC 1B3AA 4Z9CB 5DAUA 4KHZA 2BT6A 2BCOA 4AS1A 1C4AA 4LJZC 4HTHA 1VF7A 2WXOA 5HFYA 3MC0B 1EWHA 5BMGA 1C77A 1NR4A 4CJ2C 5IGCA 1GUSA 2E2DC 2B2YC 1SSNA 4XQNA 2C9OA 2GA4B 1MGSA 2WXLA 3JAME 2WS3B 1EY4A 4J3OD 5I4DA 4MM3B 2D5GA 2IGHA 3RD4A 1CJEA 4G4KA 5CGKA 1HTPA 4KGTA 2KECA 3BDLA 4GDLB 3OIQA 1VDVA 2JXTA 2B8FA 1DD2A 1XYIA 1NAPA 2WACA 3GD7A 1FFVA 5K5PA 3OW7A 3SE0A 2IGGA 3OPOA 2L12A 3VR3A 3FKIB 4H2AA 1I50B 4F8MA 1I4XA 2PYKA 3BVZA 4YTNB 2RBMA 4FP5D 4KJOA 2BOSA 1DYQA 2DBYA 1TS3A 1DJRD 1FXIA 3EROA 3GV3A 1SFOB 5FO9B 3ITPA 2WXHA 2F0LA 2F1MA 1EIGA 2BDNA 1EM7A 2MEKA 1YQ3B 3CHBD 4C3HB 1PZKD 1CT1D 5HHDG 4CJ0B 3LX0A 5A2QE 2CJNA 4ZHOA 4YSYB 5IGBA 1VF5C 3HOVB 1MHHE 1B9NA 3GS2A 1LO5D 3K5NA 3I57A 1TKEA 3GTLB 4TKOB 1B4OA 2L83A 2WB1B 3NRZA 5C5MA 2LFIA 1MSGA 1E9MA 1IGCA 4DAPA 4C80A 2F0JA 1MHXA 5FOBB 1TS4A 4OO1I 1CZGA 4PMBA 1JWAD 2EKIA 1LTBD 2X38A 3AECB 2DY7A 1U4PA 3AEBB 2YYZA 1FGBD 3T4AC 1VJKA 5EKLA 4L1BA 2K33A 5JVH3 2KCNA 4C3JB 5HGTA 5I6YA 1TZOA 3OMGA 1JORA 4WFN3 1HXYD 1S5BD 4N6EB 4XTCS 3OHXC 2GRIA 3MEHA 2KCCA 5C6AA 4K5WA 4OO1G 3D31A 2C5CA 1WD0A 4WORA 2F0NA 3P1HA 3QJYA 1EIHA 1KABA 3ND8A 1FRDA 2K7VA 1STYA 1PDXA 5ISRA 1MI2A 1JQYD 3P4PB 3SXHA 3GV6A 1Q12A 1KH0A 1A15A 5IGEA 3S14B 3M7GA 4OHJA 1DGJA 4YTMB 1QF6A 3SR1A 4FXDA 1MSHA 2RKSA 3Q8FA 4FYDA 1FXAA 1FIQA 3CU7A 4TQ0A 1EYCA 3GTOB 1E6EB 4WAFA 4XQQA 3I9V1 3K5MA 4XIGS 4OZAA 3KQ4A 1LTGD 4A3JB 1KRHA 1EU4A 4KN7C 2KVMA 4DGZA 4IFDG 1WSPA 2H1EA 2YU9B 3BG3A 3RZOB 1D4BA 3NWSA 1BCPB 1STBA 4I65A 1WTRA 1TY2A 2J53A 3P42A 1TJEA 4WURA 1XF5L 3BK2A 2WLBA 1ML0D 5DNFA 5LNK1 3IAS1 1RCVD 4QF4A 2JX5A 2MJ3A 1V1PB 2OF1A 3VR6A 1OO9B 4HEDA 3R2IA 5T8IA 3V3XA 3TP5A 3D6CA 1H9RA 1Q10A 3L7ZC 1WCMB 3EVQA 1PXUA 1W6KA 1K52A 3T3NA 2B2VC 2K05A 2NVYB 1L0YB 3PUZA 2OXPA 1LT6D 3DWPA 2LEKA 5CC4A 1YJIA 2Z4IA 3GB1A 1OXSC 2PW5A 3AE1B 5FKAC 1JE4A 4HKZE 5EE3A 3KLSA 3M3YB 1NYRA 1TY0A 3TUOA 4C1NI 4A3BB 2I2YA 4BBRB 3AE7B 3AV8A 1PYWD 1C9FA 1KF6B 1SMYD 1I3QB 3S2HB 3ZYYX 1UAPA 5D65A 1OXXK 1L6VA 4OL7A 1PFMA 1EWYC 1GHKA 2WDQB 2A69D 2L9HA 4ITKA 4P6VF 2A6EC 2IDYA 1XLNA 2IX0A 1PTOB 4ARIA 3HOWB 1CQFA 2BS4B 1WXQA 1JICA 3EQLC 1XWEA 4RWSC 4XDXA 1TYGB 1SF0A 3PO0A 1PRTB 3GO5A 2EYOA 2KHSA 1R9TB 5EQ0A 2SNSA 2KN4A 1WTVA 4F7XA 4NW2A 1RD9D 3D4DA 5LL6S 1ET9A 3MZ5A 2K9XA 5CV7A 3P75A 1YN5A 3LXFA 2MPMA 1QT9A 4X3UA 4TMAB 4HRSA 1JWUD 2EY2A 1AEXA 1CM9A 2WXKA 1Z6HA 1IHZA 4KJNA 3TMEA 3GTGB 2BBCA 2A73B 2KJXA 4V0BA 4KKIA 4HSVA 5KRUA 1PRTF 3GTQB 1QQRA 5D7GA 1QKZA 4RCOA 2F0IA 1EQTA 1VMPA 2EY5A 4XT1B 3QOLA 4A9AA 2CJOA 4X3KA 4RF1A 2EZVA 1GXDC 4EQOA 1OQQA 4RGOS 2DWQA 2WXFA 5CORA 4JPSA 4GDKB 2VZKD 4C7ZA 3I8ZA 3TDQA 1MBYA 1XTCD 2JA8B 1JALA 5EE1A 2D9UA 2E2HB 1J8IA 1IL8A 2ICEC 2K0PA 3I4NB 1DOKA 3IAM1 1SE3A 1HTLD 2WKDA 4ZYSA 5IGFA 3J7YW 1L5PA 2X6GA 4J8QA 1BQQT 2CW0C 5KYLA 1QG7A 5IOCA 1BCPF 2EJMA 2K1BA 3VR2A 2KEEA 1LTID 3NWTA 2XWBB 4CGYB 1WD1A 4ZKBB 5K36G 1R7SA 1F2MA 4H7BA 3RPFC 3KLSX 4M8AA 2EVBA 4IN3A 5IIFA 3H8HA 4A3FB 3BS1A 5LHY1 3S17B 1V1PA 4XDCA 3PIO3 4FF2A 3SK6A 1Y1WB 1FRRA 3AEFB 1VMCA 1B53A 4BA1I 2BYTA 3FRPB 2R6GA 1KNEA 3K5LA 2LJIA 1WVLA 1FYCA 3BVGA 2M56B 1Q1EA 1U9RA 3X3MA 2W3SA 1BF4A 4OW0A 1EYDA 2XWJB 4WQMA 2IX3A 5BMHA 4ZHPA 5M3MB 4O1NA 2XSCA 4KY5A 1CFMA 2NMQA 1DXMA 1J7CA 2JU6X 1G6ZA 2QDBA 2EYHA 1SE2A 1RKNA 5CR3A 2BA1A 2A6HC 4B0EA 3ABVB 1S5CD 3T3OA 2KQ3A 4ZKCB 5ELBA 1Y69U 2JXMB 3TEYA 3B2FA 4QUCA 1I7HA 3A7AB 1GUGA 4TRDA 3J81L 3D4WA 2PNRC 1TWHB 1SB3C 2K5DA 5CV4A 4KTAA 1TWCB 1NVID 3D3RA 2WNMA 4YTPB 3T53B 1EY0A 2ID0A 1WGKA 4G7OC 3K7AB 5KYIA 2JYTA 3B9JA 5CBEE 1D5MC 2EY6A 2K03A 3V05A 4K8JA 1ESRA 2WIIB 4MH8A 4CBVA 5BMIA 1HUNA 2F0VA 5CV5A 4HEA1 4ZQ3A 1K83B 2WKCA 2EY1A 2F0HA 1WTPA 1YNJD 3S1MB 3BZDB 3PUYA 2JSOA 3L3OC 1ZEQX 1I4HA 4JWSC 4ZOHC 3MXPA 2E75C 3GTPB 1YNJC 4MT5A 3I91A 3SFDB 3PV0A 2ZXRA 2WU5B 2A6HD 2IPKD 3EFXD 4HN7A 3MP9A 3TN2A 3ZJVA 2G9DA 3A55A 4OIKA 3Q8EA 2HCCA 1E7PB 4CJ1B 4CQNA 4C56C 4B08A 2LUMA 2WDVB 3ZJUA 2PVGC 1OQRA 2F0GA 3SK5A 3MXNA 1T3QA 5FLXE 1IGDA 2M0AA 5FO7B 1LT4D 3PUWA 1U4MA 2JE6I 4WJWA 2BB6A 1QB5D 1V1OA 4YIJA 3FC4A 1O80A 1PGXA 3MJ5A 2N0SB 5I2YA 3ONAB 2EYPA 2WXRA 4WH4A 3VR4A 1GPXA 2B76B 2K01A 3TP7A 4C3JG 1NENB 4USAA 2RSNA 5EJWA 2YEPF 2LMCA 4IUPA 3NTHA 5IGDA 1QOBA 1UWMA 4RF0A 1ESFA 1BCPC 2INNE 1SYFA 1L0VB 4N59A 3TZUA 4B0MA 3X3NA 1FNWA 5A35A 3LB8C 3HOUB 4RKLA 2QSDA 4Q5VA 4REZA 2J4XA 4CKCA 4ULLA 4C2MB 1GB1A 5I2XA 4U673 4IOIE 3KBGA 4ZRZA 1JCKB 3QG1A 2WQYB 3Q6SA 3WOFA 2NN6I 3AEAB 4KK7A 5F2DA 3HGBA 2WP8J 5COYA 2E3TA 3C46A 3M85A 3NTKA 5E6JA 3QB3A 5FK9C 1AWDA 1XCTL 4EQNA 4RGMA 2AWOA 1YNTE 4OGQC 3J7AV 3P4RB 1TWFB 1EZ6A 3S9WA 5M5WB 1AYFA 1Q8IA 1AZQA 4RCNA 2R92B 4HCSA 2N7JA 3VYSA 1VR9A 1V97A 3K59A 3V2TA 3EJIA 4GLSC 4ZRPA 1RFKA 1RHPA 2KWDA 4F87A 3NVWA 2W82A 1QOGA 2O4XA 1H9SA 3ZJTA 2Y0SB 1UEAB 2PZUA 4A3MB 4A3KB 3LWUA 4KKSA 1HQMC 1TT2A 2SDFA 4KKJA 1JOKA 1DOYA 5DM63 1TKYA 5G3LF 3TEWA 4I7ZC 3R93A 3A8JE 4KV6A 2JYOA 2OEOA 4WRDA 3R2TA 2SAKA 1VCIA 2GI9A 1WTOA 3I4LA 5M5YB 1ZDXA 3MTSA 4JWUC 2RDHA 3NE5B 1CTMA 1QNKA 3I72A 3P4QB 4JX1C 1PLFA 2TSSA 4OO1H