1KLUD

Crystal structure of hla-dr1/tpi(23-37) complexed with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
239
structure length
230
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR ALPHA CHAIN
publication title Minor structural changes in a mutated human melanoma antigen correspond to dramatically enhanced stimulation of a CD4+ tumor-infiltrating lymphocyte line.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/toxin
total genus 67
structure length 230
sequence length 239
ec nomenclature
pdb deposition date 2001-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1kluD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1kluD02
1PZJD 4OHJA 1EFID 1QILA 1KLGD 3R8BA 1BCPF 1L0XB 2CHBD 1PZKD 4K6LA 1HXYD 2ICIA 3BVZA 1PZID 1RDPD 2R61A 5D3DA 1FNWA 1EEID 1V1PB 2J4XA 1B44D 1I4HA 1YN4A 1CHPD 1CHQD 5FK9C 4BWGB 1RD9D 4L6TB 1BCPB 4C56C 1I4GA 1GOZA 1JWMD 4RH6A 1D6EC 3R2TA 1EEFD 1TS5A 3V05A 4NZLB 1SXTA 1D5ZC 1DYQA 3EA6A 1SE3A 2IPKD 1CT1D 1F77A 1LT6D 1S5BD 1FGBD 1JWUD 1YN5A 1UUPA 2AQ2B 1LTSD 1LTID 1TS3A 4RGOS 2IJ0A 1I4QA 1TY2A 1ET6A 1BCPD 2XN9C 1LTTD 1TS2A 1RF2D 3TSSA 1XTCD 1AN8A 3BYYB 1YN3A 1G8ZD 2AQ3B 1PTOC 3BVGA 1JQYD 1LT4D 1UNSA 2AQ1B 1I4XA 1DJRD 1M4VA 1LTAD 1PRTC 1JWSD 1LTRD 1HA5A 4Z9CB 3DWPA 3MC0B 4DXGA 1V1OA 4ZYSA 1D5XC 3BZDB 1KTKA 1S5ED 3OWEB 2WV6D 4RHSA 1PTOF 1JR0D 1V1PA 1HTLD 2RDHA 2NTTA 4RGMA 1PRTF 2QILA 1CK1A 3DWAA 3KLSX 4O1NA 2XRQD 2XRSD 1MD2D 1PTOB 1JCKB 1FNUA 1SE2A 4RFBA 1TY0A 1XXGA 1BXTA 2QEJC 1PRTB 1FNVA 1FD7D 4RCOA 1SBBB 1EU4A 1STEA 3CHBD 1EU3A 4RHRA 3O13A 5ELDA 1PTOD 3BYTB 1L0YB 1LT3D 1EWCA 2NTSA 2SEBD 3BVMA 1PRTD 1B1ZA 1KLUD 2XNAC 3DWQA 1LO5D 2TSSA 1LLRD 1RCVD 1S5FD 1TS4A 2G9HD 4L63B 2RDGA 3URYA 1SJED 2O2LD 5I4DA 1D5MC 1S5CD 1CQVA 3EFXD 1ESFA 2Z8LA 1PYWD 1PTOH 5ELEA 4TSSA 1LT5D 5ELFA 3SEBA 1SJHD 1ET9A 1SEBD 1SE4A 4RGNA 3R2IA 1ENFA 1S5DD 3GP7A 3MFGA 1T5XD 1HQRD 1I4RA 5FKAC 1BCPC 1I4PA 1LTBD 3W2DA 4UDUC 5ELBA 1LTGD 5D3IB 4DXFA 5TSSA 5ELCA 4RGTA 1AW7A
chains in the Genus database with same CATH superfamily
2D07B 1TU2B 4HWIB 4HCSA 1HUMA 4GDLA 1EL0A 2NBWB 3PZDA 1BCPF 4GOCA 2HT1A 1II3A 2B3GA 2HDLA 1YJJA 2O2VA 3DQVA 1KDAA 2ICEC 2K33A 1R4MI 4M01A 1K83B 2J4XA 1IUEA 1CFMA 2DHZA 1MI2A 1A15A 4RMFA 4L8JA 3GTGB 4HMJA 3TREA 3UI3A 4C3IB 1BCPB 3I57A 2MQJA 4KKJA 4M0WA 2I46A 3SFEB 4G7ZC 4PZ6A 4NXML 1B8AA 2ZM6L 3LB8C 1SE3A 3Q23A 1F77A 2R7ZG 4A3LG 2Z9HA 5KHQA 3SK5A 4URKA 1V81A 4MM3B 3HP3A 5IY0A 1I4QA 1PH1A 1ET6A 1PV4A 3D32A 4BVUC 3HOZB 4AYBG 4AS1A 2R93B 2IX0A 3TZDA 4A6QA 1WYDA 3TSSA 1Y1VB 3QG1A 3CMAA 2PQAA 1UE1A 1JQYD 1LT4D 3PMFA 2DBYA 3HOVG 3Q69A 1F2YA 1E90A 3S2DB 5C3JB 4QIWB 2QF7A 1FGUA 2QKIC 2IO1B 2Z0DB 5KRUA 3CCUA 2CJNA 5HKHA 1XEEA 1RHPA 4LJPB 1ROEA 5J39A 2RR9A 3CIRB 4GOPA 4MSMB 4GLXA 3DWAA 2KKCA 1TGZB 5A35A 1IKMA 1WZ3A 5JVH3 2KD0A 2WINB 1BUVT 4JK1C 3KBXA 3FVQA 2RD0A 3ZNZB 3PO3G 5M3MG 4QUFA 2PI2E 4NAMA 1N8RC 3RD4A 1WJUA 2GMIC 4E74A 2KJRA 2YU9B 2WU2B 5IOCA 3UDXA 1PVOA 2J0MA 3BK2A 4ZRPA 3HS0C 4DNRB 2AHOB 2X6GA 4F87A 4YWMA 4LUZA 1MSGA 3HKZB 5GAHC 4B3ML 2R92G 2LEKA 3QCAA 5AZGA 2EYFA 1PH9A 4AYBE 3ZTDA 4BY7B 3NHHA 2MNAA 1G6PA 5IO9A 3VFKA 1LO5D 1NSNS 2PZUA 2OTLA 1P0RA 4PS8A 5IP7H 1STGA 2QIEB 1KNEA 3E56A 1UWVA 2CH4A 2IL8A 2RHQB 2L5TA 5IODA 3SVMA 2KXJA 4CDCC 1J7BA 1DOYA 4LF7Q 1ZW7A 1SF0A 5LL6S 3FPUB 4TSSA 5CR3A 4OXPA 2KT7A 4K3BA 2D2QA 2BDOA 1VZ7A 2NB0A 1JICA 3NEMA 4TKOB 4NPSA 3GV6A 3VAWA 1NUCA 1XMOQ 4JE3B 1ZXTA 3FKIB 2W55A 4LJOB 3J81c 2IO3B 2KOLA 1FD6A 4H13C 4HN7A 5AUIA 2L83A 3Q22A 4Y7NH 3IVFA 2K50A 4GN3B 2X6LA 1N36Q 1ENAA 3LNNA 3MP9A 3BS1A 2VZKB 3PSEB 5BMHA 1PDQA 1J19A 3RZFA 2KTFA 5DEHA 2KLCA 2WXQA 5IOIA 4DDID 3BVZA 2W82A 1Y8RC 5LL6X 3U58A 2NYZD 5JJZA 3PIPA 4JI3L 1K83H 4PV1C 3A9KA 4ZRQA 4XE0A 4L1BA 2BE5C 4ME5A 5IAAC 1TKGA 3GTLB 4IFDJ 3TS0A 2Z0EB 3RNEC 4AOFA 3FAHA 4II3B 3DHIC 1D3ZA 5C2TB 5JEAG 2I1JA 3DVGY 2JA9A 1E3PA 3HZXA 2WAQG 1E8XA 3TP5A 2IBIB 3AYHB 4NXMQ 4FA6A 1S3SG 3MC9A 2ZM6Q 3MHBA 1QZHA 4IJHA 2DY8A 4HR7B 4RNAA 1QKZA 1WTRA 3Q8EA 4TUUA 4W9FA 2DNEA 1QT9A 4HRSA 4DAPA 1B2TA 3P63A 4LNIA 4BKSD 1X32A 2K28A 2LHEA 3VYTA 4J6IA 5KEEA 4MH0E 2RCNA 3KUPA 1L1OC 2ALYB 1PTOC 1Y1VH 4C3JB 1C9OA 2CW0D 1K8MA 4KLKA 3SR1A 3C3LA 1EY4A 3ZLZA 2PPHA 2B29A 3NQTA 1TVXA 4JPBW 4MTNA 1HTPA 2LRUA 4ZYNA 2VQEL 3P1HA 2KQ7A 3MC8A 3S2DH 2VH1A 3U8ZA 2M00A 4DK3C 1WCMB 3UE0A 5K36H 3PHXB 2P5ZX 1KL9A 4RHSA 1WTPA 1EYAA 1QOHA 2IW3A 1DGSA 5E1FA 3U4VA 4CJ0B 1BR9A 2ZCBA 3VR5A 4GNXA 4GDKA 2VY3A 3QO2A 3RN5A 2GN5A 3V3XA 4I6LB 4BBSH 5H1SE 2V0GA 1B50A 3K0XA 1V2YA 1VQJA 3FPPA 2ASBA 1HRJA 3NS1A 5DPTA 4A3MG 2DYOA 1FD7D 1LACA 2D3CA 2BPSA 1C4QA 1SBBB 2HHHL 2A73B 2Q2TA 2WXLA 2WAQE 2YU9H 3A4RA 3W9CB 3KYDD 1Y1WG 2E74C 3O13A 3AB9A 4S0RA 4KY7A 2LJIA 2KDIA 3W1SC 4JI8L 3J80L 4HPMB 2ZTDA 2N55A 1DOKA 2RHSB 1EF5A 2PMZE 1S3OA 1EWCA 4B3MQ 2WFWA 4TRDA 4DU9A 1YNTE 3DBRB 2REXA 1YNNC 3AE5B 2NPTB 5L83A 5C5LA 4BY7H 2MHJA 3L10B 1S5FD 3UGBB 3Q3NC 4FLHA 1OXSC 3F1ZA 1GB1A 4WH4A 4WWMA 2BKRB 1MI0A 2BS2B 3CSFA 3QAQA 5I9PA 5M5XH 2Z8LA 2Q2UA 2DAFA 2LD9A 4ME3A 2D2CC 2WU5B 2WXMA 4CQNA 4WRDA 1ENFA 4K7WA 5MPOA 3NVYA 1XJVA 2MFIA 5G5GA 2C5CA 3FKIH 1BQQT 3BWUD 4B0MA 2Y0SE 3STBD 2VXWA 2GRIA 1WX9A 2ZW0A 4OEMB 2KX0A 4DV6L 3BG3A 2HIXA 4N6EB 1RWSA 4YCVA 1VQBA 1P1AA 4UAIA 4LFAL 3PHWB 5JAVA 4HSPA 4BA1I 1VQMA 4QCLA 1C0AA 2D5GA 3E9SA 4KDIC 2NVUI 4MELA 1QILA 1B4OA 1HZCA 2CHBD 3DWMA 3A74A 4QQBX 3AE2B 4A3IG 1UE6A 1AZPA 5L37A 4DR2L 1IZ6A 1NEKB 2MBHA 2K5QA 2ZT9C 1YEZA 3NBHA 1T5EA 4PG3A 4A90A 2J0TD 2JA7H 5C0XG 4JI3Q 1A0IA 4DV3L 1UEBA 4KY6A 2JZ3B 2KC2A 1LM8B 1PA6A 2OCEA 4N9F4 3GTLH 3GTQB 4FHKA 4RMAA 1IKLA 3PREA 1CT1D 4L2YA 2F0WA 4EE2A 3UIPB 4HJGE 3C0RB 4A3GB 4OO1I 1UEAB 5FOBB 2Z4HA 2WX0A 2TMPA 2HD3A 2JA6H 2QA4A 1CSQA 1G8ZD 2MLBA 2ZW1A 3SE0A 4A3FG 4ZLTF 2Y5BB 4ASWC 5DLQE 5BN5A 3Q8FA 3I4MH 3S24A 1A5RA 1LTAD 1Z2MA 5BN3A 3K5NA 5DAUA 2RKSA 2D0OA 3V61A 2VZKD 2VQEQ 3I4NG 2FMMA 1XPRA 2DZIA 4X62L 1OQRA 4II2B 1DM0B 2BYTA 4ANWA 3RZDB 1B9MA 1YMHE 4GGQA 4WAFA 1R9TB 5J3BA 2K0PA 2N9LA 4FDBA 4NAWB 4ID6A 4FYDA 2K5WA 2JE6I 1HPCA 2I5MX 2LSSA 4I7AA 3L2PA 2MJDA 2EKIA 4OVUA 1GUWA 3NHEB 1WX7A 2ZPNA 2E2HB 2EY6A 5J18A 2MWSB 4MM3A 4P6VF 4RAUC 2HHHQ 4IUMB 1QWYA 1QJOA 1EU3A 1XWEA 2E2JB 1J8IA 4M8AA 3NZSA 2Z0SA 3PV0A 1WI0A 2KVRA 4JI8Q 1TXYA 1N34L 2QC8A 4TKNA 2B2TC 2A6EC 3E0EA 1B1ZA 3SK4A 1K50A 3J80i 4IPHA 5HHDG 2GBRA 3ZKJC 2CHXA 4D2KA 4ARIA 4HIMA 1YIJA 5C23A 1TQOA 3PVLA 2F1MA 1JWBD 4TVAB 2JT4B 2KACA 1L5PA 4JI1L 3H09A 1CA6A 1XT9B 3MHSD 4GKKL 3OMGA 1X9NA 2LS01 1D1KA 4RKLA 1EOTA 2C5LC 5ELFA 1F2RC 2KCTA 2G4DB 4KKUA 5CBEE 1C4AA 3OJ3A 3GTOH 4HDQA 4MT5A 2JX5A 5JHAA 4E3CA 1SNDA 4DR7Q 2WS3B 4JYAL 1SIJA 3MAQA 1C79A 3DBLB 2F0OA 1PDXA 3BK1A 3IT6B 4ABNA 4ZKCB 4L5SA 1A70A 4GDLB 5JJKA 4FF4A 3ECIA 4US9A 4ZDVA 5M5YB 5EKKA 1UZXB 1MFWA 4DV6Q 1EOVA 3HK0A 5IWAL 1XPUA 4LFAQ 4YTPB 4IURA 2V4LA 1D7QA 3CU7A 3WANA 5C4XB 3QWNA 4M0WB 3T3NA 3FHWA 2JYEA 4DHJB 3TMPB 1QE6A 1SYEA 2LGXA 3H15A 1ILQA 2M17A 1GJZA 2KHJA 2CVRA 2KENA 1B44D 3S1MB 1YN4A 5H8YE 4DR2Q 3S14B 2F0EA 5CV5A 3GE3C 5BYSA 2GOWA 4FF1A 4OONA 2BDNA 4NJ7A 3PV1A 2V3PA 3PGEA 4DV3Q 4MGZE 3K8AA 1D5ZC 4EZKA 3EA6A 3N6RA 2IPKD 4K2KA 1A6XA 3GTQH 4OVZA 1IL8A 5EKIA 3PO0A 2UXDL 2B8GA 2E2DC 4R4CA 1S1QB 4MGIE 2QDBA 1LUZA 4GLAC 3GTPB 2GB1A 4PS3A 1FXIA 1EWIA 1ILPA 4KGRA 2JP1A 3J9CA 3PZ8A 3GTJB 3NZUA 5CC4A 4JX1C 1IGCA 1R4NB 1K0SA 3GB1A 2PLPA 3NK9A 1VF5C 1FRDA 1NI2A 2IO0B 3KWVA 3QWZB 1M4VA 5HI1A 2KANA 4CJ2C 3GD7A 4NJ6A 1FL0A 1HA5A 3PF4A 4IM2A 4HEA1 2LRWA 3BY4B 4M1UB 4KHVA 1JORA 3AULA 1QVFA 1QOFA 4RM9A 1S5ED 4GXBA 4X62Q 2GA4B 4CDFC 1G291 4FNFA 4POGA 4B3SL 3M85A 2K8BA 3ZJVA 2BE5D 3NELA 4R9WA 1NTGA 2QILA 4C3HB 1JC7A 4JI2L 1VQIA 3M4OB 2OWOA 2MJ3A 3AECB 2IX1A 4RA8A 2NVYH 1VQ7A 1MD2D 1EUJA 3SK8A 2DAJA 2NVQH 3JC66 5C6AA 1FNUA 5DM73 1SE2A 5JEAJ 1VJKA 4DQOC 1VQPA 2BYFA 4TV3A 3GQBA 2CQOA 2N9EB 2G5DA 1FNVA 2WXNA 2JRHA 3PUYA 2KN5A 2CH4W 3M4YA 1VRAB 3UIOB 2E2HH 1EY8A 3VUXA 3I2ZA 1F9PA 1AFPA 1V8CA 1PTOD 3BDLA 4FXGC 2M8SA 1DGJA 1PFMA 3K81C 3NRZA 4A3JG 4IALA 1YNJC 3BVMA 1V8QA 3T16A 4DV0L 2IX3A 1AP0A 3M3JA 4ZRJA 1T3QA 2EXZA 5IP7G 1N34Q 4KTAA 2YTYA 2G9HD 2F0IA 4DK1A 3CCMA 4JVZA 1QOGA 2LVQA 4BBRB 1WJJA 3K9OB 2FUHB 2UXCL 4MHEA 3IAM1 3E3XA 5FLMH 4BY1B 3TP8A 1DZ1A 1HZ9A 4IPDA 1SR3A 4JI1Q 3P4QB 3AXCA 1G51A 5LNK1 3SEBA 4GKKQ 1U9RA 4RF0A 2N1VA 1MKHA 1NBWA 5C3EB 4LF8Q 1WFYA 2X38A 3KK7A 5BYQA 4JYAQ 2BT6A 4U673 1PH2A 2ZPYA 1D8LA 2V3SA 2ATWA 2KA7A 3EROA 5EPKA 1JT8A 5M5YH 1GC6A 2PI2A 2OTJA 1C48A 5CV6A 1IBXB 4OHJA 4KK7A 3DBHI 1HTQA 3ML9A 1IHZA 1TWGB 1IYJB 3I90A 5LXHA 1YNND 3VDZA 2V1YA 2ZJRA 1E10A 5C4XH 3CQZB 3AB5A 4BFRA 3N3KB 3ZDTA 1EY6A 2R6GA 1FFVA 2IHFA 3MTSA 3UF8A 1CHPD 3S1QB 1TWCB 3S1MH 3TP6A 2LXCA 3J80E 1XD3B 3S14H 2MJ8A 2DENB 3P1MA 4LK1C 2A5UA 3QOJA 4QY7A 2N7JA 3RMKC 1NCVA 3ZRCA 1DYQA 2AUJD 4EUTA 4A20A 2OQ0A 3B9JA 1WD0A 3T51B 1OTRB 2YTVA 2MBBB 1V43A 4IUTA 1MJDA 1UUPA 1TY2A 2WXJA 4FN2A 2L11A 4LNKA 3RZWC 2UXDQ 3OIQA 3GTPH 1EIYB 3ZDMC 2IT1A 1NE3A 5LHY1 2AX5A 2F0MA 1AE3A 2JWUA 3OW2A 4XTCS 1P7EA 2EYHA 3GTJH 1G91A 2O6VD 2EY5A 2JA5H 2A6HC 2BBCA 4K14A 2A19A 5ELOA 4X6AH 2D10A 4EKUA 1GM5A 3RNCC 4CHKA 1HFNA 4GDKB 3A0JA 4YTMB 1TT5B 2KOXA 5K36G 3KF8A 2QDLA 4XIGS 4KD3A 5KYLA 1OEYJ 4MGYE 1D4BA 3QK0A 3ULLA 1LTLA 2KHWB 5LMUL 2R2OA 2LASA 2WP8J 1LYLA 2B39A 2RMMA 1R4QB 1E24A 4B3SQ 4LWCA 2XRSD 4BBSG 4JI2Q 1TWFH 1Y69U 2KMAA 3W5UB 3HOXB 2EOTA 1IL2A 1QZEA 1F0ZA 1X3PA 2JZZA 4GN1A 3I7FA 3KDFA 3NJTA 2ENBA 2B2YC 3R66C 2L8JA 4IUVA 4B3RL 2CU3A 3OHXC 2KO3A 2QCZA 1L1OA 4DAYA 3TIXA 5C3XA 3VXWA 4B3TL 3DPDA 2MW5A 4UP9A 3P20A 2ZCCA 2EPBA 2F3VA 3DWQA 4XYCA 5GAGC 4DV0Q 1CKOA 3RR5A 4PMBA 1SGHA 3PO2H 2O2LD 3TJPA 1M1KC 4BBRH 3H7PB 2DLBA 4IW0A 3G6EA 1TKYA 1FIQA 1EUVB 3WAPA 2UXCQ 4BY1H 4PQXA 2B63B 2DJFC 4YT0B 1ET9A 2BTEA 2JYOA 4EVOA 1OXVA 3H9DA 2LGDA 2M0XA 4CKEA 5C3EH 1RIPA 2M56B 4FJZA 2QSDA 5FO9B 2QDFA 3FKIG 1E0ZA 3CCLA 1SNQA 1EFWA 3RUIB 5IE8A 4JBWA 1I4PA 1KAWA 4NW2A 4IM3A 2ZNVB 3HVDA 3ZVVA 4DR1L 3I3TB 4US8A 5IKCM 2QHOA 3NBHB 3QB3A 3NBIA 3HOUB 4ZOHC 1I6HB 4PMWA 2A6ED 1TZ1A 5KNBA 4MNOA 4G57A 1SSOA 4JBMA 4A3BB 3NVZA 2A74C 4E71A 2HJ8A 4OX9L 4KGSA 1L0WA 2EMTA 3CQZH 3L9AX 4GZYC 5IGDA 3AU4A 1BBWA 4FXKC 5I2XA 1BOSA 1RD9D 4L6TB 4ZRZA 2E76C 4R8NA 5EPJA 2JA7G 3S1QH 4A3DH 3EVQA 1PYBA 1TWCH 1LQBA 3KYCD 3CCQA 4OWWB 3RFZB 3UQBA 2KJXA 1BF4A 3QARA 1SXTA 2PNHA 2ZTEA 2WLBA 1E7PB 3T1HL 1CM9A 1KQSA 2D5DA 1ZXIA 3S1NH 1L2NA 4E6IA 4KD4A 2JQRB 4WORA 2LI5A 4F1SA 4RGOS 4YCUA 2WB1G 3WOFA 3RUZA 4DV1L 1L4DB 3AE4B 5DCNA 4REZA 4S3SA 1FRRA 3EQLC 3C2PA 1K8RB 4B6WA 4EQOA 2JA6G 1V49A 2QGQA 3Q6SA 3HHMA 4GMVA 1SE8A 1VQ8A 2B76B 3PRPB 3DUZA 2K05A 3BVGA 1TTNA 2LJ5A 5EE3A 4ANUA 3I4MG 1UNSA 3KLSA 4ILWA 3HOWH 1VQ4A 3TRZA 4HPPA 1Y8NB 4B9WA 2AMCB 1I50B 4A93G 3CKIB 3S15H 3AV8A 1BNZA 2MHVA 4FJVB 3DBRI 2K22A 1XLQA 3Q2AC 4IWQA 3L13A 2LMCB 3KW5B 1SLJA 4KMUC 4B9KA 1UE7A 1W3SA 2BH8A 2K52A 4P71A 5I9OA 2JEBI 1CK1A 5LMUQ 4W9JA 4XWTA 1AARA 3MZ5A 4OWTB 4TQ1A 4NKLA 4LUVA 3DBHB 1XTDA 1O78A 3HOXH 3TBIB 1YJWA 1R7SA 2JWZA 3P75A 4NJCA 4W9HA 2EJMA 3A7AB 3OOCA 2DGYA 3ABVB 4RCOA 4ZHOA 3ZO5B 2K8CA 4HCNB 1UH6A 3V2TA 3JAML 4HAEA 2K03A 5LMNL 1DCZA 3S1RB 3RMHA 1WOCA 4DV2L 1VQKA 1KIXA 4B3RQ 4XQNA 3RZOB 2WB1E 3BDOA 4F8MA 2DYMA 5J2RA 1C4CA 3H8HA 1J9OA 1PMRA 2L12A 4HIDA 4B3TQ 3K59A 3D4DA 1K53A 4PYZA 3I4LA 3TEZA 1BUIC 1JMCA 3KVFB 3VR8B 4A3KH 3TN2A 4QAYA 3E9HA 3NOBA 1FXAA 1E1TA 3W1BA 2LGYA 3R93A 2JSVX 4WWOA 1TZOA 3NTIA 3OYYA 3QHTA 1I3QB 2INCC 2KC1A 3Q14C 1LT5D 3G7LA 5DNFA 2PNRC 4NY0A 1B3QA 1SE4A 3AFPA 1YI2A 1T0YA 3AU5A 4IM0A 3U4EG 3A5ZB 2ACZB 3F2DA 5EDSA 2NZHA 2UU9L 2VRRB 1OEYA 1C1YB 3I73A 2ZTCA 1K51A 2KMCA 3P7JA 3DHGC 4FO2A 2JEAI 4DFAA 1IBML 1EY5A 2YEPF 5EQ0A 2WXPA 2JUOA 2C9WB 1KF6B 5IGBA 3QC8B 4G4KA 2F03A 2N7EA 5D3IB 4Q5VA 3VH4B 2VUMH 5EE0A 1FXTB 2OEDA 3T1YL 2PIAA 2MP1A 4MZ9A 5GQOA 4DR1Q 3APFA 3I72A 2UWQA 4ACFA 4P2CB 4YCWA 5JOBA 2K6AA 2IWHA 1VR9A 3Q8DA 3T56B 2EMSA 3HOUH 2YEPB 4FHJA 3A8KE 3SK6A 1YNJD 3WWVA 2DWQA 2HCCA 2G9DA 1I6HH 1JJCB 1QVCA 2ON8A 1CTMA 2R61A 2CFMA 4A3BH 1DXMA 4ZQ3A 2RSNA 1L0VB 4FXCA 4C1NI 4OX9Q 4YHHL 4A4IA 1QB5D 5FK9C 4XT1B 5F2DA 1WXMA 2I0QA 1IP9A 3CCVA 2EYMA 4JIOU 1YHBA 3I70A 1EWHA 5IP4D 3IAS1 1GKHA 1WXQA 3EHVA 5D2MB 3A4SC 1A3UA 4JOIC 1Y8PB 2PW5A 4V190 1LT6D 1XNRL 1Q1EA 1WVLA 1F2ZA 2AQ2B 2UYZB 3T1HQ 1L7YA 1NVID 4RF1A 3SHQA 3QOLA 1FCCC 1LTTD 2D9UA 1EIFA 1U5KA 1Z47A 2FJ2A 4DV1Q 2QJLA 4BKTA 1HZBA 2AWTA 1HJPA 2LWPA 2SNMA 2AQ3B 4B0EA 2OXPA 3Q3MC 4F8CB 1FM0D 1F9RA 1MPEA 4JQWC 4G50A 3WIMA 1BBUA 3R7QA 4P1CC 3TZUA 1I4XA 3GTKB 1WH3A 1C4PA 2I38A 1WSPA 3APDA 3NY5A 3DXJC 1IBXA 3OSOA 2KDBA 3GTGH 5FLXE 3H3VH 1HH2P 1I50H 3TP7A 4C3IH 2WDVB 5G55A 1V9JA 3IFWB 1ZOYB 1J6QA 4LLGM 1JQ4A 4HJ8A 2JPHA 1BMLC 2F0FA 3P4PB 3HIZA 2N9PC 4LW1A 5IIFA 1WGGA 1YX5B 2J7QB 1E22A 4PYUA 1ZE3D 2FINB 2B2VC 3N32A 4O1NA 5IT9c 2GVBA 2Z1CA 4PK1A 1YJIA 3HOZH 3S9WA 2R93H 4O2DA 3KUDB 4BXXH 1PXUA 1TY0A 5KNDA 5DPSA 4IUNA 3OJ4B 5CHVC 2LY7A 2F4IA 1V5OA 1HTOA 4DHZE 3Q8BA 1STEA 1P98A 3S2HB 3HVZA 3DBLI 3S17B 1PQSA 4LDTD 3S1RH 2I1KA 5LMNQ 5DPWA 3E0JA 3JAMi 2KCCA 4DV2Q 3LGJA 2A6HD 1GHJA 2PW7A 2HE7A 4XX5A 3ONAB 2SAKA 2MBEA 1Z7TA 3CPWA 5I2YA 3L54A 1TYGB 1ASYA 3G48A 2BS4B 2C7NB 1FVIA 4IOIE 1E2VA 1L2FA 1G6JA 1S5CD 2RQXA 5FLMG 5IYDH 2ZVNA 2XIWA 4HPLB 4QMGA 2XWJB 4OW0A 1SSNA 1WGRA 4JCVE 3CAMA 1Q8KA 5E6PA 4IPGA 2JZPA 4BZAA 1FEHA 5FR3A 4RCNA 3SXHA 4R4IA 1LM0A 1Z5SB 1O80A 5C5MA 1KDBA 2UU9Q 3K5LA 5JXVA 3MWYW 4I6NB 1IBMQ 4UDUC 3B1LX 2H89B 1CA5A 3CC4A 4F7XA 5A2QE 4CGYB 2N78A 2Q8TA 4AYBB 3T1YQ 4IO9A 1PZJD 3J7ZC 4LF9L 3HOYG 4KGTA 3J80c 4M8NA 3ZTCA 1VCIA 4P73A 4HCEA 4X3TA 5C4XG 3Q8AA 1R4NI 3PPAA 1EYGA 4CO7A 3HOVB 1B9NA 3ICEA 3M63B 1V1PB 1FPYA 1NR2A 2HQLA 4ZUIA 1U4LA 1HE8A 4XDDA 2DUDA 2SDFA 4JLCA 4YHHQ 1I4GA 3AEEB 1GOZA 3QQ8B 3H7PA 5AZFA 1F9JA 3L7ZC 4UHVA 1JRPA 1OFFA 4HROA 5D7GA 1M8AA 1DOXA 1N9WA 3D8GA 2UXBL 5IP9H 2GBKA 2NN6I 4K81A 2ID0A 4ZK9B 2VL6A 1A8VA 3GTMB 4ANXA 1LTSD 3IAYA 1XNRQ 1U0LA 4MIUA 3CRKC 3PRZA 2XN9C 3W1YA 3B2GA 3VTUA 1X3EA 3K7AB 3PO3B 1WR6E 1X56A 5IYCH 2FIDA 3AFQA 3F8TA 3KF8B 1BBXC 2RDFA 4CHTB 3FEWX 3PS6A 3U7ZA 2JA5G 3RN2A 1ZKHA 2BH2A 4NDXA 4HIKA 1TWAB 1XLPA 1B53A 1JWSD 2LFNA 1Q81C 2KK8A 2R92B 1T0RC 4QGUA 4Z9CB 5E6JA 5LLIA 3OW7A 4KKIA 1V9PA 4JI0L 3OWEB 2C35B 1PTOF 4UP8A 1X3GA 1JR0D 3SFDB 1SNPA 3KDFB 4A76A 3AE7B 3LYYA 3CCEA 4JG2A 2KQ3A 1N61A 1HNZL 3HGBA 4BKSA 3GOEA 1F2RI 3GZNI 1XYIA 1L1OB 4DAYB 1PTOB 4LF5L 2IGHA 2N4FA 4N59A 4K0KL 4DBGA 2MUYA 2QEJC 5M3FG 3LX0A 1LXDA 2BA0A 1ZPSA 4JI4L 2JRIB 4C3JH 5E6OA 1HR0L 1WGHA 3ZGZA 1QOAA 3KQ4A 4HJKA 4BOSC 1WM3A 2N7DA 5ELDA 3S2HH 2OJWA 2UUAL 5FJ8H 3DDCB 1CJEA 1EQTA 2CS4A 2GVAA 1LT3D 3KH0A 4KIKB 2J42A 1S4ZA 1WCMH 1SB3C 4TMAB 5BMGA 3H0GG 2F52A 1SDFA 2XVSA 3NSWA 4H7BA 1KXLA 2KFJA 3QX1A 4J1MA 1U4PA 2FXQA 1Q7YC 3RNAC 3PO2G 4WWPA 1NI3A 4BBRG 1F9QA 3A7LA 4J6HA 4A75A 3A1QA 4USAA 3M9BA 1H8CA 3EFXD 4OO1G 4KX6B 4BY1G 4YTNB 1F2MA 2L7RA 1H9KA 2K5HA 2LMCA 2LFIA 1TR5A 2F0HA 4G0NB 3H91A 3CF5A 4LTUA 2XK5B 4ZKBB 3PCOB 3HRDD 4C4VA 4NNJB 4AQYL 3GP7A 3MFGA 5E3FA 1KRTA 1WTQA 2DNFA 2LUEA 4GOPC 1O7ZA 3C1EA 4C7ZA 1PFBA 3DHQA 2KZRA 2B2YA 2WAQB 1ZP0B 1RLFA 4BBNC 3VQIA 3W2DA 3IL8A 1CKNB 1VQ5A 1VQNA 4WWNA 4FXDA 2CWPA 3KF6B 4F88A 2PMZB 3BZCA 1GO3E 2KFKA 4LFBL 2BGFA 1EFID 3VUWA 1C3TA 3R8BA 1HCZA 3K0YA 4N58A 2KCMA 4LF9Q 3N52A 2V4IB 2B2WC 3RLOA 1N63A 3RNBC 1VCBA 3JAME 3AEFB 2OOBB 5DPRA 3HOVH 2K5VA 1IGDA 1JE4A 2L0CA 1GUNA 1MBYA 1M90C 4A3DG 2LGSA 3TBLD 3EFUA 2F0KA 2JQOA 1YOVB 3EGRA 1VLBA 1XLNA 3PRMB 2L4NA 4NP5A 3V05A 1VQ6A 4K1RB 1NDDA 3CC7A 4EQ5A 5IGFA 2O6VB 1FGBD 2Y0SB 2MA9B 1YN5A 2UXBQ 3CF6E 3KUCB 1I6VC 2IJ0A 1ICWA 1WJ6A 2F3WA 1RL2A 2G4SA 2PW9A 1Q1BA 4A3MB 3AM9A 5D6JB 4G7OC 1U4RA 1FJGL 3HOWG 3B08A 3F2CA 3LWEA 4KZ0A 3VTWA 1XCQL 1PRTC 5G3LD 1Y1WB 4DWFA 1TWAH 2BS3B 3DWPA 1ISNA 4DXGA 1KHIA 2BYEA 3W5OA 2HDEA 1W6JA 4XQQA 2QW7A 4CJ1B 4A3CH 3EFCA 3NTHA 4JI0Q 1JWAD 4JWUC 3J7AF 1NJIC 3NWSA 2H5XA 2K5DA 1E7UA 1KH0A 2MJEA 2PO4A 2E5LL 2BF8B 3CXCA 2JXMB 3ZIMA 3NZ3A 3ENEA 3Q3OC 4A3GH 1HNZQ 2WXRA 3RYTA 4N8FA 3EBEA 3HOXG 3EECA 4LF5Q 2IY5B 1NBFC 4DV7L 4K0KQ 1I35A 5IA7A 2N8NA 4K8JA 4L23A 1HUNA 2RDBC 2LXJA 4KV6A 3KLWA 4JI4Q 4JW0A 1YJ1A 1HR0Q 3LJ3A 1UD7A 4CKBA 1L0YB 2JK8A 1MJCA 2UUAQ 4CDDC 1PH6A 4X57B 1K52A 2TSSA 3RZDH 1RCVD 2A69C 1TS4A 3J81E 3C1FA 4A3KG 3TDQA 4XT3B 2IGGA 4R4OA 1S40A 2YVCA 1MHWC 5M5WB 1R9TH 2VH2A 3ZNHB 2KDMA 4IOCA 1WI5A 4A3EB 2K7VA 2OT2A 2W9NA 3AN1A 1PH4A 5JJIA 3I5JC 3ULPA 2L0FA 2FCQA 2RVLA 5HY6A 1STHA 4W9EA 4RGNA 2VB2X 3TL5A 4OL7A 4POFA 1EO6A 4QB4A 1K8AC 1YX6B 3D0FA 3FP9A 5EJWA 5CHWA 3W1GA 4AQYQ 1GPXA 4R3DA 2FIFA 4LNQA 2E2JH 2EZVA 2NS5A 4LK0M 3RPFC 2KCNA 1LTGD 4HJAA 2VUMG 4AH6A 2DZMA 1YBYA 1STYA 4A55A 2I5HA 2KQSA 2RSOA 4WJQA 2AWNA 3HOUG 4FVMA 2ES2A 2LVOA 1PGBA 1DOIA 2L3ZA 3AEVA 2L52A 4LFBQ 4MJSA 1H9SA 1L0XB 1HHVA 3CMMB 1IYVA 3GZNB 4LUOA 3M4QA 4GLSC 4W9GA 4BOZB 3AU7A 4A3BG 1CUKA 4ZCKA 2W3RA 1ZYRC 2IZVB 1G6ZA 2CKZB 4KHZA 2O5IC 2CR5A 1VD2A 2FHTA 1EZ6A 3H3VI 4JI5L 4BWGB 2G1EA 2MX2A 3DBSA 3FKYA 2OF1A 3I4NB 2PVOD 2A5HA 1JWMD 4HJ7A 4RH6A 2HTHA 4B9XA 1NAPA 4ZUJA 2VW9A 1Q5WB 3GE8C 1WRIA 1BKBA 3V96A 5FLXL 4AIMA 3ZJUA 1SYFA 3KYHC 1TS3A 4IFDI 3I9V1 1AYFA 4XWWA 3SGIA 2PJHA 4HVBA 2F0QA 4JV5L 4P1BC 1LGRA 3BYYB 1F52A 3A9JB 2HDMA 5IWAQ 3SD5A 1E9MA 4K5XA 4A9AA 3T4AC 3U52E 1MHXA 4GB9A 4IWPA 2KDFB 2K8HA 1QNUA 1DJRD 3SDZA 1J5EL 1X1MA 5J22A 3CCJA 2JXTA 4XXEA 1MG4A 2PPBC 1YNXA 2M4NA 1Y1WH 3JW0X 3CPFA 4WAAA 3QA8A 3BJUA 2EY2A 1F9SA 1V1OA 4C3IG 1VZ8A 2KMMA 1DONA 1YQ4B 2WV6D 3P4SB 4HXDA 2WYQA 1TBEA 5J17A 4JPSA 1V1PA 2KN4A 1PGAA 1WGYA 4MACA 4RGMA 3Q8CA 2JVCA 4JL9A 5BMIA 3ETRA 3KLSX 3TQYA 1I94L 4JOIA 2E5LQ 1VQDA 4PMCA 3S16B 3HOZG 3CD6A 2R93G 2A1AA 4ODGA 4BXXG 2EY1A 1C78A 1M94A 1W6KA 1XO3A 2L32A 4EFOA 3HM6X 1BXTA 1Y1VG 3PQIA 1EIGA 1ENCA 1V80A 2KWVB 4BAXA 4DV7Q 5C44B 1MG8A 3MXUA 3APCA 1SROA 2K1BA 2YV5A 1U4MA 3CHBD 4WIPA 4RHRA 3VR6A 1FMAD 1GUAB 1MSHA 3H94A 2EJFC 4XYQA 2NTSA 2L55A 2SEBD 4UY8C 4QF4A 2DNCA 1LLRD 2F0SA 1WTOA 4BA2I 3URYA 1KNAA 3X3MA 2NN6H 1BT0A 5IGGA 3WOEA 3VA5A 2AWOA 1Z9FA 1NNXA 4C3HH 1XCTL 5IYDG 5A2QL 5H92C 5C0XJ 5T8IA 4QJFA 4C1NK 4A3EH 3M4OH 3A55A 4IC7B 4GS3A 1UELA 1PYWD 3NG0A 2B2VA 5CTRC 1YZ6A 2RBMA 1KM7A 4RM8A 3A8IE 1GAQB 1E2WA 2KECA 4K2LA 1L6VA 5C3WA 1E8ZA 1BCPC 2GBNA 3HKZG 1LTBD 1LV9A 1ZUD2 1HA6A 3I8ZA 4DR4L 1WJNA 1WM2A 2O4XA 1YQBA 3OTOL 4BY7G 3U50C 3NVVA 3U30A 1OXTA 4XDXA 4HK2A 1K9MC 1H9MA 3RNUA 2EYLA 3MJ5A 3KBGA 3KJPA 4DNTB 4LNOA 1IXRA 4GN4B 2VQFL 4KIKA 1RFAA 3WCQA 4MH8A 4DPGA 4QIWE 4Q0FA 4K3CA 4X64L 3UE1A 3BDCA 2ASQA 1HNWL 4PZ8A 3OIPA 2F0TA 2WNMA 4W9CA 4J3OD 4BBNF 3AE6B 1O7YA 3VYSA 3AE1B 3VYRA 1SNOA 1ICFB 3D4WA 3L08A 4ZRIA 3VRBB 5IP9G 2PZTA 3J7AV 2IYDB 3HRZC 3CRLC 5COYA 4DUZL 4APVA 4MSQB 2CU1A 2XK5A 2VS1A 4OIJA 2L00B 3R3MA 2R7DA 4FF2A 1LTID 3W1SA 2G3QB 3VHTC 2ZJDA 5C4JB 3MJWA 1YN3A 1FYCA 2F0LA 2W54A 4JV5Q 2PEAA 1CKNA 1SAPA 1TWGH 2B3AA 3DCGA 1JW9D 5AEKB 3QR8A 1YVCA 3MEHA 3SU8X 2YTXA 2FUG1 2M1MA 1P3QU 3KF6A 5EAYA 1XLOA 1CSPA 1WTHA 3W3AA 2DJGC 1J5EQ 4A3JB 4ZYSA 4AQ7A 1D5XC 2F0NA 5IGCA 2AYOB 3MXGA 3PT2B 2NVTB 1XNQL 3AE9B 4IDIA 2NTTA 1VMCA 4QUCA 2X69A 2ZXOA 3PUXA 1N33L 1WX8A 4IQZA 3NVWA 4YSZB 2PZWA 4LDTB 4I7ZC 1NENB 5G2NA 3D6CA 1I94Q 3C46A 1JCKB 4EGVA 4AJWA 4C00A 1R4PB 4EOYA 1XXGA 4DV5L 2NBFA 1C8CA 4JBJA 3X3NA 2O6VA 4JGHB 4C3JG 2LGIA 1RODA 1YHAA 2I07B 1C7YA 3NE5B 2V1CC 1GNUA 2AKWB 1TWHB 5C44H 1TJEA 2D3BA 4HCPB 4YL8A 4DAMA 1YQ3B 3EIVA 1GB4A 4KJOA 2WXIA 1WE7A 3A1QB 4EZLA 4J8QA 4YWGG 3RCZA 1MJEA 1RM6C 1WCMG 2KHSA 2KNBA 3H6NA 4HKZE 1KAAA 1PRTD 5EE9A 1KLUD 4HKQA 4W9IA 2EVBA 1CKMA 2V4DA 3DVNV 4BS9A 1UWMA 1QVGA 2HD5B 2CWAA 1GJXA 3N1XC 4C4VB 1KDCA 1ML0D 4MDKE 1UGJA 5HG2A 4AJYB 3HG9A 2KEDA 3M7NA 1WTWA 4IPCA 1Z6HA 5JJLA 2NBUA 3OG5A 1FCLA 3VH3B 2ZZPB 4C7YA 4J15A 1VS0A 1SJHD 1YHQA 1WGKA 3F2BA 1IYFA 1V6EA 2Z6KC 2WXOA 3NENA 1XF5L 3RT3B 3UQAA 1VMPA 1Q0WB 1GUOA 5EBDA 1VQFA 2FE8A 2KFKB 1T5XD 3K5MA 4NMZA 4HJ5A 2NWGA 4XQJA 1ZDXA 3FILA 4HDOA 2F0PA 5D14A 3VR2A 3JVZX 2A68C 3ALBA 4OVVA 1IW7C 1X54A 3JAMc 4DR4Q 5BYRA 2BA1A 4RGTA 3OTOQ 1AZQA 4LFCL 3UDFA 5DM63 1GVPA 1JROA 4P7IA 2BOSA 1NYRA 4K6LA 4JC0A 5D3DA 2KWUB 2A69D 1RDPD 3MXNB 1TKEA 3CC2A 1HR0W 2VQFQ 1IPGA 2B63H 3CSTA 3RN9C 3PUZA 2UUCL 2LUMA 3KFUA 2J52A 3OAWA 4KZCA 1N60A 5CV8A 4X64Q 1HNWQ 1D6EC 4P74A 4KJNA 4DR3L 2N9XA 5G5HA 2YLMA 1H9JA 2B2UC 2E2IB 4UPAA 3BZKA 5GXGB 1SFOB 5TR5A 5CX3A 3K57A 4DUZQ 5LXIB 1GD7A 1V5TA 3VRAB 1MGSA 4G3XB 2K75A 1Y14B 4BBSB 1IBKL 3AMZA 1RAXA 2B2TA 3OPOA 2K4KA 1ACCA 2X8XX 5C4JH 2ZVOA 1J8CA 4O0AA 4GIVA 4AWJA 4FBJB 4IOAA 4XGAB 1AH9A 1H95A 5NUCA 2L9HA 2IY1B 4OELB 1KLVA 2JA8B 2H4OA 1UWXA 2EYJA 1PHJA 2B2WA 2WXHA 1EQVA 2BQQA 3GS2A 2KWDA 4P75A 5J1ZA 1VF7A 1TT2A 1ZYRD 4B95A 1JRUA 4A3CG 4A3JH 2N49A 3PF5A 5C4ZA 3Q0AA 2C60A 4L5TA 2FBWB 1WD1A 5HFYA 4OZBA 3G6JB 1PH3A 2Q2HA 2RDHA 2NVTH 2FAZA 1XNQQ 2KDEB 2J53A 1B3AA 5JVG3 1XPOA 2NCNA 4DXAB 3B2FA 1NMFA 3J81L 1VQLA 5M5XB 1CQFA 1N33Q 4A3GG 2KYWA 2WDRB 4WJ4A 4ZRKA 1HFGA 3FRPB 3PGZA 2CKHB 2KVMA 4N9PA 1SYDA 4V0BA 4HSVA 5I6WA 1RRBA 1P16A 2F4VL 2LHDA 1UF0A 4ICUA 4DV5Q 3RLFA 3K9PB 3SHLA 2VZAA 5E7NA 2GBJA 3HKSA 4HJ9A 1K8GA 3DVNU 1QUQB 2MO1A 1PH5A 1E8YA 1TWHH 5JHBA 1O7IA 4M8MA 2MSED 3A9JA 2FCSA 3AQQA 3ZNGC 1WMHB 4H2AA 4HMIA 1EZ8A 4GU2A 1PH7A 2XNAC 3ZXRA 5M9OA 2N1WA 5E4WC 1A62A 2A8VA 1EIHA 3MTNB 1X3QA 3HFZB 1PFDA 1WTXA 2FCMA 4IFDH 5IYBH 2GI9A 3RNGC 2F0GA 3DLLA 2KTRB 2K9XA 2JA7B 3E6ZX 5L95C 2Z59B 2KX3A 2XTIA 3P2BA 3DEOA 2KQ4X 3VTVA 2J0JA 1KRSA 5IT9L 3SDLC 2WHIA 1HQRD 4R4QA 1RFKA 5CV7A 2HCIA 3B6YA 3EN2A 4ULLA 2NVXB 5BR8L 4MJSB 1H9SB 3RZOH 5ELBA 2EIFA 3ZXVA 2L1AA 2WB1B 3D4RA 3IFTA 5ELCA 3ER0A 4DNIA 3L0WB 3U2SC 5AJ3L 1G2TA 3QJZA 2GLSA 1SMYC 2RSUA 1SN8A 4DKAC 2JJQA 2JA6B 3IG3A 2D3GA 2MP2B 4ANVA 1D1IA 3K58A 4LFCQ 4WJNA 3ND8A 3J7A5 3I4MB 2DN8A 4FJYA 4KN4C 1WWTA 2J7ZA 1EY7A 1FNWA 2NUCA 1CZGA 3I55A 2WDQB 3TMEA 1I3QH 4MN3A 3VR3A 4P16A 4A93B 4IZ8A 2NZOA 5K5PA 3J7YW 4NB3A 4FULA 5G3LF 2JYTA 2UUCQ 3X0WA 2ZJQA 4YXDB 1X65A 2OJRA 3R2TA 1QF6A 1TS5A 2XWBB 2O5JC 1C77A 4NZLB 4DR3Q 4DK6C 2R7ZB 1N32L 3ZJYC 4DR5L 1S5BD 4N8X1 2IO2B 2E2IH 1VZ6A 2PTLA 5HGTA 3L0OA 2Y0SG 3CMEA 1SFOH 1KD1C 3JSVB 2K25A 3L4PA 2QMTA 1LFDA 4HLEA 1BCPD 3ZRFA 1SYBA 4YY3L 2CHWA 4AP4C 1KABA 3U4ZA 1TS2A 2BCOA 4OWXB 2L0TA 1IBKQ 4OIKA 1AN8A 4CBVA 4RG1A 4CDEC 3QIAA 5CBAE 4GKJL 3UDIA 2UU7A 3ZQ4A 2KBNA 1WZ0A 1ZGUB 1A3VA 2J0KA 1R4MB 3ULJA 3IRBA 1EY9A 2K32A 1JJ2A 3PLVA 2EKEC 2HUGA 2RPVA 3MC0B 2JA8H 4PS7A 1GXDC 1K8OA 1JJGA 3BZDB 4MTKA 1P9DU 1KTKA 1UBIA 4DDGD 2XGTA 3E9IA 2WXKA 2NMQA 1JE5A 1OXUA 5GAEC 1WRDB 2E6XA 3T3OA 3KJOA 4IG7B 5T1IA 4B08A 1QG7A 1QOBA 3VYUA 2PMVA 1WIAA 1FO4A 1AEXA 2XEWA 1QQRA 5JH5C 5EKLA 2Y3AA 3N1YC 3DVGX 5M3MB 1STAA 4X65L 3V6CB 3GTOB 2Z6BA 5E6NA 3J81i 4DR7L 2PE9A 3VA7A 2GBMA 4DUYL 1AE2A 1WGDA 5C0XI 2F4VQ 4ITKA 4FP5D 1SE9A 3GTKH 3CP0A 2BWES 4DK0A 2PVGC 3A54A 4H02A 2CJOA 2PQEA 3AMUA 2D11A 4ICVA 1Q86C 1G2SA 1KOTA 3EJIA 2PE6B 3OLMD 1CMXB 4IWOA 3P42A 1HEZE 2F0JA 4FF3A 2NN6G 3IFDA 4L5QA 1SJED 2MQHA 1T9HA 2M9VA 2KHIA 3A56A 3I4OA 4C3HG 2IY0B 1CQVA 3RI7C 2WQYB 3TCAA 1CZPA 4A3EG 2ONQA 2EXDA 4XZ4A 4DV4L 5ELEA 3TEYA 5T1GA 2DZKA 2AL3A 3Q3JA 4ZAIA 1MVKA 4CKCA 1S5DD 3MEFA 3BU2A 1GG3A 2MO0A 1IBLL 2WKDA 2MBOA 1JOOA 4DHZB 3S17H 2NVXH 4G7HC 2DX5B 2XBBC 5BR8Q 3GDEA 2KJ6A 1D2BA 5TSSA 1O7LA 4LF6L 1YITA 4K5VA 1ZXHA 3D31A 3K6OA 1N62A 2C9OA 4NQKE 2XSCA 1AW7A 1FFUA 3UDGA 4JWSC 4U68A 5FO8B 5AJ3Q 2CQAA 1KLGD 2CCZA 4WFN3 2BWFA 4IN3A 2ICIA 1PZID 4LAAA 2PKOA 1UGMA 2AL6A 3DMUA 1JALA 3A33B 3QIJA 3TUOA 1CHQD 1RTOA 3NQIA 4L5RC 3K7UC 4WJWA 5C3EG 1J7AA 1XMQL 2K5PA 4C56C 2WX1A 3MXPA 1QNKA 4H0LC 4A93H 4A3OA 2M19A 2BW2A 4C80A 4KI0A 2K01A 4NPNA 1EEFD 1TKWB 1UBQA 4HTHA 3DOWA 4KDLB 4MEMA 3S2AA 2WXGA 1SRUA 3VR9B 2R7ZH 4A3LH 2F3IA 4X66L 4OZCA 4F7ZA 2OQKA 2Z4IA 3NTKA 2NVYB 5GADC 4DR5Q 1N32Q 1EM7A 4KSKC 1T6BX 2NVQB 3JYUA 4EQPA 1KRHA 3MA2B 4DK5A 3NP8A 4JBKA 1RF2D 1Y8OB 2G45B 4YY3Q 2A68D 3P4RB 1RYJA 1IW7D 4GKJQ 2K04A 1Q1OA 2I2YA 2JN4A 1U4AA 4M02A 3PIOA 1VDZA 5C4HA 2ZEQA 2WACA 4A3PA 4W9DA 1LTRD 2Q8RE 1LABA 1C76A 3LDZE 5CGKA 2Y5CA 1E1OA 1FR3A 1ZKOA 2K6DB 1NR4A 5BN4A 1GHKA 5CMDA 3MXNA 1NY4A 1CZWA 2E3TA 5I6YA 2JU6X 1HTLD 5EBCA 1X3FA 1F1HA 4EEWA 1SYCA 2LXAA 3GTMH 2MCNB 2XRQD 4LMQD 1SNMA 5CORA 1QLBB 1DOLA 2OHFA 1KC8C 1DOMA 1AWDA 4YIJA 4LF8L 4RFBA 3PIP3 3K7AH 1Q82C 5M3MH 3PO3H 3ONSA 1B7YB 2DY7A 4X65Q 2KLGA 1WXVA 1OTCA 3RLNA 4M00A 5E4XA 2EQSA 2HTME 4DA2A 1N5WA 3C19A 4DUYQ 3ZW3A 5C44G 2EYPA 5KNCA 5D65A 2W3SA 1E7ZA 4O42A 1ASZA 2R92H 4NXNL 1DD2A 2O2VB 1VQAA 1K3BC 4WJOA 2RF4A 2WKCA 2YYZA 3PSIA 2N9KA 3L16A 3M62B 2NZ1D 3A5UA 5AFWA 1XQQA 3I63C 5IGEA 5ISRA 1Q90A 4UP7A 2ZXPA 4GN5A 3ITPA 3HOYB 2EDGA 3H1UA 5JPNC 3N9YC 2K5NA 3U9SA 1KFYB 5KHOA 1WXAA 5I4DA 1WR1A 2KEEA 2BKFA 3ZYYX 2Y5PA 1B70B 1WE6A 1PTOH 1BDOA 3T9LA 1WXSA 1E7VA 3KLRA 3FILB 4KV2A 4DV4Q 4OGQC 2L1BA 4LF4L 2BB5A 5GMVA 1MHHE 2OEOA 4HEDA 3RNFC 3CW2C 3LWUA 4RWSC 4YSYB 2RCFA 3MVVA 4YWLA 1PGXA 5FKAC 3WA0A 3AEGB 1T0QC 1V86A 2K14A 1IBLQ 4W9KA 2PQAB 3ZJTA 1H4RA 3UI2A 1I42A 1V97A 3C8YA 4LF6Q 1RKNA 2KJHB 1EYCA 1QUQA 4C2MB 1PZKD 2ZJPA 3G71A 4A3IB 1UE5A 2Q2IA 3M7GA 4KKSA 5HURA 2JA5B 2DYBA 1WMHA 3AE3B 3MHZA 1HNXL 2F0UA 4IUPA 1J7CA 1MIUA 1EEID 2KUMA 2MBQA 2B63G 3K80C 3RD2A 3TS2A 1WF9A 1NMGA 3PUWA 4GOPB 2EELA 3Q3FA 3CCRA 3M4PA 1RJTA 1VQHA 2EYOA 1E2ZA 4GNXC 5EGTA 1XMQQ 3Q6BA 4OZAA 3KOJA 2IHEA 5EE1A 4MGKE 2Z6KA 5JEAH 2KTRA 5IN7A 2BVCA 4R8IA 2C7MB 4TQUS 4R1JA 2FFKB 2RPQA 1RTNA 3IHPC 3T8MA 1JWUD 5AZHA 1P7FA 3DEPA 1TWFB 2MH7A 3DHHC 4X66Q 4HIOA 1BVSA 2VNUD 3U7DA 1SIFA 2H1EA 2K6QA 2QEXA 2INDC 2KAJA 1XTCD 3EC8A 3KWLA 2HIVA 4LJZC 5M3FB 1A63A 3N1ZC 4WURA 4A3FB 2NR2A 1K0RA 3OMCA 1NYQA 3PLUA 1PYSB 1SMYD 2LZ6A 4GSWA 3UINB 5IT9E 5LMNW 5GROA 2UUBL 1Q3LA 2AUKA 1Y56A 1VQOA 2MP2A 4EQNA 4YSXB 4WQOB 3AEAB 3U9OA 1GUGA 1ONLA 3HM3A 2KVZA 3NS8A 2NBVB 3H0GB 1PFNA 3OWFA 1OGWA 3IBEA 1P8LA 3LXFA 3ZNID 4Y52H 3PO2B 4IJLA 2MPMA 5JPMC 1PRTF 3NWTA 4I65A 1STBA 1EY0A 1F2LA 2B2UA 2LKVA 2K1FA 3TEXA 2FCNA 5FO7B 4DGZA 1E6EB 1QZGA 4X3KA 1N5XA 5FLXc 4K5WA 3PUVA 1XX8A 1PRTB 4GLVB 4K6DA 2IGDA 4K7UA 1A3TA 4A3MH 2D62A 1Q10A 1WY8A 3JSVA 4LNNA 3QJYA 1HZ6A 1X55A 3VUYA 5CV4A 1FJGQ 3ZUNA 4DAVA 1N6ZA 3TEWA 1EQRA 4FADA 3F2UA 2SNSA 3BYTB 4JI7L 4WJ3M 2M0AA 5AUKA 1VQEA 3DM3A 3M3YB 3B0AA 4XYOA 3VR4A 1JOKA 4IUUA 5KIXA 4NXNQ 3TEHB 3I56A 1TIFA 2ZNVC 2C7HA 1ZEQX 3WALA 2ZXRA 1S72A 3A9KB 2MRPA 1OO9B 4CYEA 4JI6L 3HOYH 1YD8U 2RA4A 4IFDG 5IYBG 1EQQA 2MEKA 3J81j 1ESFA 3WAMA 2HJ1A 3ML8A 2H88B 3Q24A 1HZAA 2NPTA 1GUTA 1GC7A 4A3DB 3AEDB 4X3SA 4XC2A 3R2IA 1YJ9A 1Q8IA 4LF4Q 1C9FA 2INNE 3BINA 1SNCA 3WAOA 3ERQA 3EUB2 1A2TA 3S1NB 1VQ9A 1PLFA 4DR6L 3HEJA 2L05A 3W5VB 1WYGA 3AI5A 3I91A 5KGUA 1K73C 4KHPL 1B9RA 1SYGA 1WFQA 1CI3M 2CHZA 3NXWA 3VDYA 2CW0C 4KKTA 2LVPA 2INPE 4EZJA 4H44C 4DN4M 3DM1A 1A2UA 5M5WH 4KY5A 5JZEB 2N0SB 2WIIB 1E5WA 1JMLA 1HXYD 1EYDA 2R3ZA 4C2MH 3HOWB 1TIID 4A3IH 3KUZA 3PIO3 2K3UA 4K8IA 3AH7A 3G4SA 3HUIA 3V60A 4XDCA 2BB6A 1I4HA 2JY6A 1WTVA 3AE8B 2E75C 1HNXQ 1WJ4A 4GNXB 3V62A 3S15B 2LXKA 1PH8A 2D0PA 1I5FA 1VDVA 3L3OC 2QCPX 3V6EB 5C0XH 5EPLA 5BO4B 3RULA 3H3VC 3FC4A 1YJNA 3N20C 4DHJD 1H9RA 1BO0A 4X3UA 4N9TA 3H6MA 2BYVE 4KSLC 2JF5A 2SOBA 3IT4B 1JB3A 2L15A 1EWYC 2PYKA 1OQQA 2M2LA 3D6WA 3GV3A 4QL5A 2WWZA 3IKJA 2JXXA 3DWGC 5M3FH 1YIWA 4A3FH 3WDNA 4A8XC 2AQ1B 1E0BA 5HGQA 3SR6A 2VB3X 2JA8G 4WQMA 2F0VA 4PZ7A 5FR6A 3PTFC 2UUBQ 1HQMC 3K5OA 4JI5Q 4I6PA 3I4NH 1SMXA 4YWKA 1E8WA 4RKBA 4A3KB 3H0GH 1UAPA 4LCDE 2PCFB 4EX5A 1STNA 2I5LX 4PT5A 4NQLB 4WJPA 4ZHPA 4IUQA 2Q5WD 3N30A 1X6OA 3ND9A 4OO1H 3FDTA 1KJTA 5IYCG 1ZDVA 1IYUA 2V9HA 3STBC 2AEHA 2WXFA 4G11A 2R2QA 3VVWB 2EJGC 3R3OA 4KN7C 4K7SA 4AUQC 2IDYA 4NAWA 3HKZE 1JB7A 3PZ7A 4LNFA 1EU4A 1OQYA 5CHFA 1GUSA 1L6UA 2N3SA 2WGSA 2R7FA 1OXXK 2VUMB 1QCBD 3L17A 2RGFA 2MGSA 3E5SA 1W2BA 3ERSX 5CYUA 1VQCA 4DF7A 1K3RA 4JI7Q 3M3YH 3R7RA 1VQGA 4TQ0A 2F0DA 1PUTA 2N88A 2FNJB 4L63B 3A8JE 2RDGA 2KWCA 3IXSA 3D3RA 3NUHB 5D94A 2D3AA 2WDTB 4LF7L 1D5MC 1V1QA 1PFSA 1K28A 3H7SA 2K39A 4JI6Q 3T53B 2Q8IB 3S16H 1XMOL 4P72A 2JSOA 1I7HA 1SEBD 3I3CA 4PNYA 1WYWB 2WP9B 4ALPA 3T13A 1HZ5A 3M95A 2DZJA 2FMCA 2V3NA 4S17A 2B8FA 3NUCA 5CV9A 1T0SC 1I4RA 4Y7NB 2L76A 5C1ZA 3CWIA 5FJ8G 5ELNA 2A4ZA 2EE1A 4IKGA 4R4TA 1JOQA 1L4ZB 5KYIA 1N36L 4Q2JA 3CCSA 3X23A 4BKGA 3MFYA 4DXFA 3GO5A 1ESRA 4ARCA 4W9LA 4DR6Q 4KVGB 3O65B 1Q12A 2HQEA 1Q46A 3NPPA 4KHPQ 1EF1A 2E8GA 3BIID 3FMCA 1J0GA 3AEBB
chains in the Genus database with same CATH topology
1TU2B 4HCSA 1HUMA 1EL0A 1BCPF 1II3A 2HDLA 1YJJA 1KDAA 2ICEC 2K33A 1K83B 2J4XA 1IUEA 1CFMA 1MI2A 1A15A 3GTGB 4L8JA 3UI3A 4HMJA 4C3IB 1BCPB 3I57A 4KKJA 4M0WA 2I46A 3SFEB 4G7ZC 3LB8C 1SE3A 3Q23A 1F77A 3SK5A 4MM3B 3HP3A 1I4QA 1ET6A 3HOZB 4AS1A 2R93B 2IX0A 3TZDA 4A6QA 3TSSA 1Y1VB 3QG1A 1JQYD 1LT4D 3PMFA 2DBYA 3Q69A 1F2YA 3S2DB 5C3JB 4QIWB 2QF7A 2QKIC 5KRUA 2CJNA 1XEEA 1RHPA 1ROEA 5J39A 3CIRB 3DWAA 5A35A 1IKMA 5JVH3 2WINB 1BUVT 4JK1C 3KBXA 3FVQA 4QUFA 4NAMA 3RD4A 2YU9B 2WU2B 5IOCA 4ZRPA 3BK2A 3HS0C 4DNRB 2X6GA 4F87A 1MSGA 3HKZB 2LEKA 2EYFA 4BY7B 3NHHA 1LO5D 1NSNS 2PZUA 1STGA 2QIEB 1KNEA 3E56A 5IODA 3SVMA 2IL8A 2L5TA 1J7BA 1DOYA 1SF0A 5LL6S 3FPUB 4TSSA 5CR3A 2BDOA 1VZ7A 2NB0A 1JICA 4TKOB 3GV6A 1NUCA 4JE3B 1ZXTA 3FKIB 2W55A 2KOLA 1FD6A 4H13C 4HN7A 5AUIA 2L83A 3Q22A 2X6LA 1ENAA 3LNNA 3MP9A 3BS1A 2VZKB 5BMHA 1PDQA 5DEHA 2WXQA 3BVZA 2W82A 5LL6X 2NYZD 5JJZA 4PV1C 4ZRQA 4XE0A 4L1BA 2BE5C 4ME5A 1TKGA 3GTLB 4IFDJ 3FAHA 5C2TB 5JEAG 3HZXA 3TP5A 3MHBA 2DY8A 4HR7B 4RNAA 1QKZA 1WTRA 3Q8EA 2DNEA 1QT9A 4HRSA 4DAPA 1B2TA 3P63A 1X32A 2K28A 2LHEA 3VYTA 5KEEA 3KUPA 1PTOC 4C3JB 2CW0D 1K8MA 3SR1A 3C3LA 1EY4A 3NQTA 1TVXA 1HTPA 3P1HA 2M00A 1WCMB 5K36H 4RHSA 1WTPA 1EYAA 1QOHA 2IW3A 5E1FA 4CJ0B 1BR9A 3VR5A 3FMCA 3QO2A 3V3XA 2V0GA 1B50A 3FPPA 1HRJA 3NS1A 2DYOA 1FD7D 1LACA 1C4QA 1SBBB 2A73B 2WXLA 3W9CB 2E74C 3O13A 3AB9A 4KY7A 2LJIA 3J80L 2N55A 1DOKA 1YNTE 1EWCA 4IDIA 4TRDA 4DU9A 3AE5B 1YNNC 5C5LA 1S5FD 1OXSC 1GB1A 4WH4A 4WWMA 2BS2B 1MI0A 5I9PA 2Z8LA 2D2CC 2WU5B 2WXMA 4CQNA 4WRDA 1ENFA 5MPOA 3NVYA 5G5GA 2C5CA 3BWUD 1BQQT 4B0MA 2VXWA 2GRIA 2ZW0A 3BG3A 4N6EB 1RWSA 4UAIA 5JAVA 4HSPA 4BA1I 4QCLA 3E9SA 2D5GA 1QILA 1B4OA 2CHBD 3DWMA 3AE2B 1AZPA 1NEKB 2K5QA 2ZT9C 3NBHA 1T5EA 4A90A 2J0TD 5C0XG 4KY6A 3GTQB 1IKLA 4L2YA 1CT1D 2F0WA 4EE2A 4HJGE 4A3GB 4OO1I 1UEAB 5FOBB 2Z4HA 2TMPA 1G8ZD 2ZW1A 3SE0A 4ZLTF 5BN5A 3Q8FA 1LTAD 5BN3A 3K5NA 5DAUA 2RKSA 2VZKD 2FMMA 1OQRA 2BYTA 1DM0B 3RZDB 1B9MA 1YMHE 4WAFA 1R9TB 2K0PA 2N9LA 4NAWB 4ID6A 4FYDA 2K5WA 2JE6I 1HPCA 2MJDA 2EKIA 1GUWA 2E2HB 2EY6A 4P6VF 4RAUC 1QWYA 1QJOA 1EU3A 1XWEA 2E2JB 1J8IA 4M8AA 3PV0A 2B2TC 2A6EC 5HHDG 1B1ZA 3SK4A 1K50A 4D2KA 4ARIA 1TQOA 2F1MA 1JWBD 2KACA 1L5PA 1CA6A 3H09A 3OMGA 2LS01 1D1KA 4RKLA 1EOTA 5ELFA 1F2RC 4KKUA 5CBEE 1C4AA 4MT5A 2JX5A 1SNDA 2WS3B 1SIJA 3MAQA 1C79A 2F0OA 1PDXA 3BK1A 3IT6B 4ABNA 4ZKCB 1A70A 4GDLB 4FF4A 4US9A 5M5YB 5EKKA 4YTPB 4IURA 3CU7A 5C4XB 3QWNA 3T3NA 2JYEA 1QE6A 1SYEA 1ILQA 2CVRA 5H8YE 1B44D 3S1MB 1YN4A 3S14B 2F0EA 5CV5A 5BYSA 4FF1A 2BDNA 2V3PA 1D5ZC 3EA6A 3N6RA 2IPKD 4K2KA 1A6XA 4OVZA 1IL8A 5EKIA 3PO0A 2B8GA 2E2DC 2QDBA 3GTPB 2GB1A 1FXIA 1ILPA 4KGRA 2JP1A 3J9CA 3PZ8A 3GTJB 4JX1C 5CC4A 1IGCA 3GB1A 2PLPA 3NK9A 1VF5C 1FRDA 3KWVA 1M4VA 5HI1A 4CJ2C 3GD7A 1HA5A 4HEA1 4M1UB 4KHVA 1JORA 1QOFA 1S5ED 2GA4B 1G291 4FNFA 3M85A 3ZJVA 2BE5D 4C3HB 4R9WA 2QILA 1JC7A 3M4OB 2MJ3A 3AECB 2IX1A 4RA8A 1MD2D 3SK8A 5C6AA 1FNUA 5DM73 1SE2A 5JEAJ 1VJKA 4DQOC 3GQBA 2WXNA 1FNVA 3PUYA 3M4YA 1VRAB 1EY8A 1F9PA 1AFPA 1V8CA 1PTOD 3BDLA 4FXGC 1DGJA 1PFMA 3NRZA 4IALA 1YNJC 3BVMA 1V8QA 3T16A 1AP0A 2IX3A 1T3QA 2EXZA 4KTAA 2G9HD 2F0IA 4DK1A 1QOGA 4BBRB 4MHEA 3IAM1 4BY1B 3TP8A 1DZ1A 3P4QB 5LNK1 3SEBA 1U9RA 4RF0A 5C3EB 2X38A 3KK7A 5BYQA 2BT6A 4U673 2KA7A 3EROA 5EPKA 1C48A 5CV6A 1IBXB 4OHJA 4KK7A 1IHZA 1TWGB 3I90A 1YNND 1E10A 3CQZB 3AB5A 1EY6A 2R6GA 1FFVA 3MTSA 1CHPD 3S1QB 1TWCB 3TP6A 3J80E 2MJ8A 3P1MA 4LK1C 3QOJA 2N7JA 1NCVA 1DYQA 2AUJD 3B9JA 1WD0A 3T51B 1V43A 4IUTA 1UUPA 1TY2A 2WXJA 2L11A 3OIQA 2IT1A 5LHY1 2AX5A 2F0MA 2JWUA 4XTCS 1P7EA 2EYHA 1G91A 2EY5A 2A6HC 2BBCA 4K14A 1HFNA 4GDKB 4YTMB 5K36G 3KF8A 4XIGS 4KD3A 5KYLA 1D4BA 2WP8J 2B39A 2RMMA 1R4QB 2XRSD 1Y69U 3W5UB 3HOXB 2EOTA 1F0ZA 1X3PA 2ENBA 2B2YC 4IUVA 2CU3A 3OHXC 4DAYA 5C3XA 3P20A 2EPBA 2F3VA 3DWQA 4PMBA 2O2LD 2DLBA 1TKYA 1FIQA 4PQXA 2B63B 4YT0B 1ET9A 2BTEA 2JYOA 4EVOA 1OXVA 4CKEA 2M56B 2QSDA 5FO9B 1E0ZA 1SNQA 4JBWA 1I4PA 4NW2A 3HVDA 4US8A 3QB3A 3NBIA 3HOUB 4ZOHC 1I6HB 4PMWA 2A6ED 5KNBA 4G57A 1SSOA 4A3BB 3NVZA 2A74C 4KGSA 3L9AX 4GZYC 5IGDA 4FXKC 5I2XA 1BOSA 1RD9D 4L6TB 4ZRZA 2E76C 4R8NA 5EPJA 3EVQA 3RFZB 2KJXA 1BF4A 1SXTA 2WLBA 1E7PB 1CM9A 2D5DA 1ZXIA 4E6IA 4KD4A 2JQRB 4WORA 4RGOS 3WOFA 1L4DB 3RUZA 3AE4B 4REZA 4S3SA 1FRRA 3EQLC 3C2PA 4EQOA 3Q6SA 2B76B 5EE3A 3DUZA 2K05A 3BVGA 1UNSA 3KLSA 4ILWA 1Y8NB 4B9WA 1I50B 3CKIB 3AV8A 1BNZA 2MHVA 2K22A 1XLQA 2LMCB 4KMUC 5I9OA 2JEBI 1CK1A 4XWTA 3MZ5A 4TQ1A 4NKLA 1R7SA 1O78A 3TBIB 4NJCA 3P75A 2EJMA 3A7AB 3OOCA 3ABVB 4ZHOA 4RCOA 3V2TA 3JAML 4HAEA 2K03A 1DCZA 3S1RB 3RMHA 4XQNA 3RZOB 3BDOA 4F8MA 2DYMA 1C4CA 3H8HA 1J9OA 1PMRA 2L12A 3K59A 3D4DA 1K53A 3I4LA 3TEZA 1BUIC 3VR8B 3TN2A 1FXAA 3R93A 2JSVX 1TZOA 3NTIA 1I3QB 1LT5D 3G7LA 5DNFA 2PNRC 1SE4A 3U4EG 2ACZB 3I73A 1K51A 3P7JA 4FO2A 2JEAI 4DFAA 1EY5A 2YEPF 5EQ0A 2WXPA 1KF6B 5IGBA 4G4KA 2F03A 5D3IB 4Q5VA 5EE0A 2OEDA 2PIAA 2MP1A 3I72A 4P2CB 1GB4A 5JOBA 2K6AA 2IWHA 1VR9A 3T56B 2YEPB 3A8KE 3SK6A 1YNJD 2DWQA 2HCCA 2G9DA 2ON8A 1CTMA 2R61A 1DXMA 4ZQ3A 2RSNA 1L0VB 4FXCA 4C1NI 1QB5D 5FK9C 4XT1B 5F2DA 2EYMA 3I70A 1EWHA 3IAS1 1WXQA 1A3UA 1Y8PB 2PW5A 4V190 1LT6D 1Q1EA 1WVLA 1F2ZA 2AQ2B 1NVID 4RF1A 3QOLA 1FCCC 1LTTD 2D9UA 1Z47A 2FJ2A 2QJLA 2AQ3B 2SNMA 4B0EA 2OXPA 1FM0D 1F9RA 1MPEA 3TZUA 1I4XA 3GTKB 1C4PA 2I38A 1WSPA 1IBXA 3DXJC 3OSOA 5FLXE 3TP7A 2WDVB 1ZOYB 4LLGM 1JQ4A 1BMLC 2F0FA 3P4PB 5IIFA 1ZE3D 2FINB 2B2VC 4O1NA 2Z1CA 1YJIA 3S9WA 1PXUA 1TY0A 5KNDA 4IUNA 2LY7A 2F4IA 3Q8BA 1STEA 3HVZA 3S2HB 3S17B 3E0JA 2KCCA 2A6HD 1GHJA 2PW7A 3ONAB 2SAKA 1Z7TA 5I2YA 1TYGB 2BS4B 4IOIE 1E2VA 1S5CD 2RQXA 2XIWA 4QMGA 2XWJB 4OW0A 1SSNA 2JZPA 5FR3A 1FEHA 4RCNA 3SXHA 1O80A 5C5MA 1KDBA 5JXVA 3K5LA 3MWYW 4UDUC 2H89B 1CA5A 4F7XA 5A2QE 4CGYB 2Q8TA 4AYBB 1PZJD 4KGTA 1VCIA 4HCEA 4X3TA 3Q8AA 3HOVB 1B9NA 1V1PB 1NR2A 4ZUIA 1U4LA 4XDDA 2SDFA 1I4GA 3AEEB 1GOZA 3L7ZC 1JRPA 4HROA 1OFFA 5D7GA 1M8AA 1DOXA 3D8GA 2NN6I 2ID0A 4ZK9B 3GTMB 1LTSD 3IAYA 4MIUA 3CRKC 2XN9C 3B2GA 3K7AB 3PO3B 1BBXC 2RDFA 4CHTB 3FEWX 3U7ZA 4NDXA 1TWAB 1XLPA 1B53A 1JWSD 2LFNA 5E6JA 2R92B 4Z9CB 3OW7A 4KKIA 3OWEB 1PTOF 1JR0D 3SFDB 1SNPA 3AE7B 3LYYA 1N61A 2KQ3A 3HGBA 1F2RI 1XYIA 2IGHA 1PTOB 4N59A 2MUYA 2QEJC 3LX0A 2BA0A 1ZPSA 3ZGZA 1QOAA 3KQ4A 5ELDA 1CJEA 1EQTA 1LT3D 2J42A 1S4ZA 4TMAB 1SB3C 5BMGA 4H7BA 1SDFA 2XVSA 3NSWA 4J1MA 1U4PA 1NI3A 1F9QA 3A7LA 4J6HA 4USAA 3EFXD 4OO1G 4KX6B 4YTNB 1F2MA 1H9KA 2LMCA 2LFIA 1TR5A 2F0HA 3H91A 4LTUA 4ZKBB 3HRDD 3GP7A 3MFGA 5E3FA 1WTQA 1O7ZA 3C1EA 4C7ZA 1PFBA 3DHQA 2B2YA 2WAQB 1ZP0B 3VQIA 3W2DA 3IL8A 4FXDA 2PMZB 1EFID 3R8BA 1HCZA 3K0YA 4N58A 3N52A 2V4IB 2B2WC 1N63A 3JAME 3AEFB 1IGDA 1JE4A 2L0CA 1GUNA 1MBYA 2F0KA 3EGRA 1VLBA 1XLNA 2L4NA 4NP5A 3V05A 5IGFA 1FGBD 2Y0SB 1YN5A 1I6VC 2IJ0A 1ICWA 2F3WA 2PW9A 1Q1BA 4A3MB 3AM9A 4G7OC 1U4RA 3LWEA 1XCQL 1PRTC 5G3LD 1Y1WB 2BS3B 3DWPA 4DXGA 2HDEA 1W6JA 4XQQA 4CJ1B 3NTHA 4JWUC 1JWAD 3J7AF 3NWSA 2K5DA 1KH0A 2MJEA 2PO4A 2JXMB 3NZ3A 2WXRA 4L23A 4K8JA 1HUNA 4KV6A 4CKBA 1L0YB 1K52A 2TSSA 1RCVD 2A69C 1TS4A 3J81E 3C1FA 3TDQA 4XT3B 2IGGA 5M5WB 2KDMA 4A3EB 2K7VA 2OT2A 3AN1A 2RVLA 1STHA 4RGNA 2VB2X 4OL7A 4QB4A 5EJWA 1GPXA 4R3DA 2EZVA 4LK0M 3RPFC 2KCNA 1LTGD 1STYA 4A55A 2RSOA 2AWNA 4FVMA 1PGBA 1DOIA 2L52A 1H9SA 1L0XB 1HHVA 1IYVA 4GLSC 3AU7A 1ZYRC 1G6ZA 4KHZA 2O5IC 2FHTA 1EZ6A 4BWGB 2G1EA 2OF1A 3I4NB 2PVOD 2A5HA 1JWMD 4RH6A 4B9XA 1NAPA 4ZUJA 1WRIA 3V96A 5FLXL 3ZJUA 1SYFA 4IFDI 1TS3A 3I9V1 4XWWA 1AYFA 2F0QA 3BYYB 2HDMA 1E9MA 4K5XA 4A9AA 3T4AC 3U52E 1MHXA 1QNUA 1DJRD 3SDZA 2W3RA 5J22A 2JXTA 4XXEA 2PPBC 2EY2A 1F9SA 1V1OA 4C3IG 1VZ8A 2KMMA 1DONA 1YQ4B 2WV6D 3P4SB 4JPSA 1V1PA 2KN4A 1PGAA 4MACA 4RGMA 3Q8CA 5BMIA 3ETRA 3KLSX 4PMCA 3S16B 1C78A 1XO3A 4ODGA 2EY1A 2L32A 1W6KA 1BXTA 1EIGA 1ENCA 5C44B 3MXUA 2K1BA 4WIPA 1U4MA 3CHBD 4RHRA 3VR6A 1FMAD 1MSHA 3H94A 2EJFC 4XYQA 2NTSA 2L55A 2SEBD 4QF4A 2DNCA 1LLRD 2F0SA 1WTOA 4BA2I 3URYA 1KNAA 3X3MA 2NN6H 5IGGA 3WOEA 3VA5A 2AWOA 1XCTL 5A2QL 5H92C 5C0XJ 5T8IA 4C1NK 3A55A 1PYWD 2B2VA 2RBMA 3A8IE 1GAQB 1E2WA 2KECA 4K2LA 1L6VA 5C3WA 1BCPC 1LTBD 1LV9A 1ZUD2 1HA6A 3I8ZA 2O4XA 3NVVA 1OXTA 4XDXA 1H9MA 2EYLA 3MJ5A 3KBGA 4DNTB 3WCQA 4MH8A 4Q0FA 3BDCA 2WNMA 3OIPA 2F0TA 4J3OD 3AE6B 1O7YA 3VYSA 3AE1B 3VYRA 1SNOA 3D4WA 3VRBB 2PZTA 3J7AV 3HRZC 5COYA 3CRLC 4OIJA 4FF2A 1LTID 3W1SA 5C4JB 1YN3A 1FYCA 2F0LA 2W54A 1SAPA 1JW9D 3MEHA 2FUG1 1XLOA 3W3AA 4A3JB 4ZYSA 4AQ7A 1D5XC 2F0NA 5IGCA 3MXGA 2NVTB 3AE9B 2NTTA 1VMCA 4QUCA 2X69A 2ZXOA 3PUXA 4IQZA 3NVWA 4YSZB 2PZWA 4I7ZC 1NENB 3D6CA 3C46A 1JCKB 4EGVA 1R4PB 1XXGA 2NBFA 1C8CA 3X3NA 4C3JG 2LGIA 1RODA 2I07B 3NE5B 1TJEA 1TWHB 1YQ3B 4KJOA 2WXIA 4J8QA 4YWGG 1RM6C 2KHSA 5EE9A 4HKQA 4HKZE 1KAAA 1PRTD 1KLUD 2EVBA 2V4DA 4BS9A 1UWMA 1GJXA 1KDCA 1ML0D 1UGJA 5HG2A 3HG9A 2KEDA 3M7NA 1WTWA 1Z6HA 1FCLA 4C7YA 1SJHD 1WGKA 2WXOA 1XF5L 1VMPA 1GUOA 5EBDA 2FE8A 1T5XD 3K5MA 4NMZA 2NWGA 4XQJA 1ZDXA 3FILA 2F0PA 5D14A 3VR2A 2A68C 1IW7C 5BYRA 2BA1A 4RGTA 1AZQA 5DM63 1JROA 2BOSA 1NYRA 4K6LA 5D3DA 2A69D 1RDPD 1TKEA 3PUZA 2LUMA 2J52A 1N60A 5CV8A 1D6EC 4KJNA 5G5HA 1H9JA 2B2UC 2E2IB 5GXGB 1SFOB 3K57A 3VRAB 1MGSA 4BBSB 3AMZA 2B2TA 3OPOA 1ACCA 5NUCA 2L9HA 2JA8B 2H4OA 1UWXA 2EYJA 2B2WA 2WXHA 1EQVA 3GS2A 2KWDA 5J1ZA 1VF7A 1TT2A 1ZYRD 5C4ZA 3Q0AA 2FBWB 1WD1A 5HFYA 4OZBA 3G6JB 2RDHA 2J53A 1B3AA 5JVG3 3B2FA 3J81L 5M5XB 1CQFA 2WDRB 1HFGA 3FRPB 2KVMA 4N9PA 5I6WA 1SYDA 4HSVA 4V0BA 2LHDA 3RLFA 3SHLA 4H2AA 4HMIA 1EZ8A 2XNAC 5M9OA 5E4WC 1EIHA 1X3QA 1PFDA 1WTXA 4IFDH 2GI9A 2F0GA 2K9XA 2JA7B 3E6ZX 3DEOA 2KQ4X 5IT9L 1HQRD 1RFKA 5CV7A 2HCIA 4ULLA 2NVXB 1H9SB 5ELBA 2L1AA 2WB1B 3D4RA 3IFTA 5ELCA 1G2TA 1SMYC 2JA6B 1D1IA 3K58A 3ND8A 3I4MB 2DN8A 4KN4C 1WWTA 2J7ZA 1EY7A 1FNWA 2NUCA 1CZGA 2WDQB 3TMEA 4MN3A 3VR3A 4P16A 4A93B 4IZ8A 5K5PA 3J7YW 5G3LF 2JYTA 4YXDB 3R2TA 1QF6A 1TS5A 2XWBB 2O5JC 1C77A 4NZLB 2R7ZB 2PTLA 1S5BD 1VZ6A 5HGTA 3L4PA 2QMTA 1BCPD 1SYBA 1KABA 1TS2A 2BCOA 4OIKA 1AN8A 4CBVA 5CBAE 3QIAA 3ZQ4A 1A3VA 1EY9A 2K32A 2HUGA 2RPVA 3MC0B 1GXDC 1K8OA 3BZDB 1KTKA 2WXKA 2NMQA 2E6XA 1OXUA 3T3OA 5T1IA 4B08A 1QG7A 1QOBA 3VYUA 2PMVA 1FO4A 1AEXA 1QQRA 5EKLA 2Y3AA 5M3MB 1STAA 3GTOB 3VA7A 5C0XI 4ITKA 4FP5D 2PVGC 4DK0A 3A54A 2CJOA 2PQEA 3AMUA 1G2SA 3EJIA 3P42A 1HEZE 2F0JA 4FF3A 2NN6G 3IFDA 1SJED 3A56A 2M9VA 4C3HG 1CQVA 2WQYB 1CZPA 2ONQA 5ELEA 3TEYA 5T1GA 4ZAIA 1MVKA 4CKCA 1S5DD 2WKDA 1JOOA 4G7HC 1D2BA 5TSSA 1O7LA 4K5VA 1ZXHA 3D31A 3K6OA 1N62A 2C9OA 2XSCA 1AW7A 1FFUA 4JWSC 4U68A 5FO8B 2CQAA 1KLGD 4WFN3 4IN3A 2ICIA 1PZID 4LAAA 2PKOA 3DMUA 1JALA 3TUOA 1CHQD 1RTOA 3NQIA 1J7AA 2K5PA 4WJWA 3U2SC 4C56C 3MXPA 1QNKA 4H0LC 2M19A 2BW2A 4C80A 4KI0A 2K01A 1EEFD 1TKWB 4HTHA 2WXGA 3VR9B 4OZCA 2Z4IA 3NTKA 2NVYB 1EM7A 1T6BX 2NVQB 4EQPA 1KRHA 3MA2B 3NP8A 1RF2D 1Y8OB 2A68D 3P4RB 1RYJA 1IW7D 2I2YA 2K04A 1VDZA 5C4HA 2WACA 1LTRD 2Q8RE 1LABA 1C76A 5CGKA 2Y5CA 1FR3A 1ZKOA 1NR4A 5BN4A 1GHKA 5CMDA 3MXNA 1CZWA 2E3TA 5I6YA 2JU6X 1HTLD 5EBCA 1SYCA 2XRQD 4LMQD 1SNMA 5CORA 1QLBB 1DOLA 2OHFA 1DOMA 1AWDA 4YIJA 4RFBA 3PIP3 2DY7A 5E4XA 2HTME 4DA2A 1N5WA 2EYPA 5KNCA 5D65A 2W3SA 4O42A 1DD2A 2WKCA 2YYZA 2N9KA 2NZ1D 5AFWA 5IGEA 5ISRA 1Q90A 2ZXPA 3N9YC 3ITPA 3HOYB 2EDGA 5JPNC 3U9SA 1KFYB 5I4DA 2KEEA 3ZYYX 2Y5PA 1PTOH 1BDOA 3FILB 3KLRA 4OGQC 2L1BA 2BB5A 1MHHE 2OEOA 4HEDA 3LWUA 4RWSC 4YSYB 3MVVA 1PGXA 5FKAC 3AEGB 3ZJTA 3UI2A 1V97A 3C8YA 1RKNA 1EYCA 4C2MB 1PZKD 4A3IB 3M7GA 4KKSA 2JA5B 5HURA 3MHZA 3AE3B 1J7CA 2F0UA 4IUPA 1EEID 2KUMA 3PUWA 2EELA 1RJTA 2EYOA 1E2ZA 4OZAA 5EGTA 5EE1A 5JEAH 4R8IA 4TQUS 2FFKB 1RTNA 1JWUD 1P7FA 3DEPA 1TWFB 2MH7A 2VNUD 2H1EA 2KAJA 1XTCD 3KWLA 4LJZC 5M3FB 4WURA 4A3FB 3OMCA 1NYQA 1SMYD 5IT9E 1Q3LA 2AUKA 1Y56A 4EQNA 4YSXB 3AEAB 3U9OA 1GUGA 1ONLA 3H0GB 1PFNA 3OWFA 3LXFA 3PO2B 5JPMC 2MPMA 1PRTF 3NWTA 4I65A 1STBA 1EY0A 1F2LA 2B2UA 2LKVA 3TEXA 5FO7B 4DGZA 1E6EB 4X3KA 1N5XA 4K5WA 3PUVA 1XX8A 1PRTB 4K6DA 2IGDA 1A3TA 2D62A 1Q10A 3QJYA 1HZ6A 5CV4A 4DAVA 3TEWA 3F2UA 2SNSA 3BYTB 2M0AA 5AUKA 3M3YB 4XYOA 3VR4A 1JOKA 4IUUA 5KIXA 1ZEQX 2ZXRA 1OO9B 2RA4A 4IFDG 2MEKA 1ESFA 2H88B 3Q24A 1GUTA 4A3DB 3AEDB 4X3SA 3R2IA 1Q8IA 1C9FA 2INNE 1SNCA 3ERQA 3EUB2 1A2TA 3S1NB 1PLFA 3W5VB 3HEJA 1WYGA 3I91A 5KGUA 1B9RA 1SYGA 1CI3M 3NXWA 2CW0C 4KKTA 2INPE 4H44C 4DN4M 3DM1A 1A2UA 4KY5A 2N0SB 2WIIB 1JMLA 1HXYD 1EYDA 2R3ZA 3HOWB 1TIID 3PIO3 2K3UA 4K8IA 3AH7A 3HUIA 4XDCA 2BB6A 1I4HA 1WTVA 3AE8B 2E75C 3S15B 1VDVA 3L3OC 2QCPX 5C0XH 5EPLA 3H3VC 3FC4A 1H9RA 1BO0A 4X3UA 4N9TA 3H6MA 2SOBA 3IT4B 1JB3A 1EWYC 2PYKA 1OQQA 2M2LA 3D6WA 3GV3A 3IKJA 3DWGC 3WDNA 4A8XC 2AQ1B 1E0BA 3SR6A 2VB3X 4WQMA 2F0VA 1HQMC 3K5OA 4RKBA 4A3KB 1UAPA 2PCFB 1STNA 4PT5A 4ZHPA 4IUQ<