1KLYA

Orotidine monophosphate decarboxylase d70g mutant complexed with 6-azaump
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
212
structure length
212
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIAGFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mapping the active site-ligand interactions of orotidine 5'-monophosphate decarboxylase by crystallography.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
molecule keywords OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
total genus 82
structure length 212
sequence length 212
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2001-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1klyA00
2AQWA 4FNQA 4NJKA 5T26A 4O15A 1HFBA 3PUEA 3S1WA 3W1MA 2ZYFA 3G1HA 2QUUA 3B05A 1AK5A 3QFEA 1KFEA 1I2NA 4L4LA 1HTIA 1EP3A 4LV4A 1ZENA 2A7NA 3PBUA 1OK6A 1UBSA 4LRSA 3O6CA 2CZ5A 5CG7A 3L5AA 5AFDA 1Q6LA 4LVAA 2CZEA 1GG0A 4TR9A 6ALDA 3EWZA 5DBUA 3RMJA 1TPFA 1TSIA 4FF7A 1E51A 3LTYA 3QW3A 2ZFAA 5FEZA 3PBWA 5U4NA 3HF3A 1SZEA 5TIMA 1AMKA 4UTIA 1NVMA 4WD0A 4GE8A 4TMBA 5EL1A 1IF2A 4U4MA 4PC8A 2J9YA 4JDBA 3BGJA 4RXGA 4NX0A 4Z1AA 3DKJA 1J2WA 1ZALA 3KVLA 4CNNA 4LVFA 1KTNA 3SIZA 1H7NA 4O50A 3DHFA 1A5SA 2DZVA 3P5YA 3P81A 4QISA 1MXSA 4O1BA 3GAYA 1OX5A 1ZHAA 1FY6A 2ZZ4A 3M9YA 3WJXA 2OJPA 4GFSA 4I7VA 3R89A 3NQFA 1P4CA 4Y90A 4P61A 1RPXA 3VI2A 3O06A 3O07A 4GUHA 1YTDA 1FXPA 3CEUA 1TRDA 3IVSA 2R14A 4LVBA 4NJIA 1S5TA 2BX7A 5K4XA 2HS8A 1JJKA 3KHJA 3SZ8A 4XQ6A 3HG5A 1ZAJA 4A22A 1A5AA 4PL2A 5K2ZA 4O54A 3W7KA 1VYPX 4HPXA 4QNWA 2YSWA 4R53A 3L0GA 1EB3A 4LVGA 1FBAA 1MZHA 5DCBA 1I2QA 3W2LA 4NXKA 2Q8LA 4MY9A 4MJMA 3U8GA 4EVZA 3M7WA 3C56A 3I65A 4GUIA 2NX1A 1KTBA 1FDJA 3T7VA 5L9FA 3GVGA 2C0AA 3E0IA 3GXTA 1V5XA 2ISWA 1LLWA 5CGQA 3BO9A 4GWEA 3M0ZA 3NO5A 4AHOA 5KZEA 3EX3A 3O8AA 1BEUA 3DENA 1O95A 4JR5A 1R2SA 5K9DA 2CLHA 2X1RA 2ZZ5A 2X1SA 1Z44A 4JTLA 4JD4A 1F5ZA 3P5ZA 2BWGA 1M7OA 4RZ4A 3VKJA 3GDMA 3EX6A 1W0MA 2V5BA 2C15A 4UFJA 2G95A 2Z0IA 4ML9A 1KM0A 2V81A 1XM3A 3W71A 5G1YA 3T78A 3BV4A 3UPBA 3UXAA 1SW0A 2OCZA 2I9EA 4CCEA 3GDLA 1W56A 1XKYA 5K9XA 2QAPA 1K7EA 1PIIA 2VEMA 3ABOA 2A7PA 3KRZA 4NUWA 1KFCA 2GVLA 2NWSA 5FEXA 4LC8A 3TA6A 1VYSX 3M41A 3PR2A 4N9CA 3NQCA 4LW7A 3M6YA 3DAQA 1JQXA 3W3OA 3TE9A 4QQ3A 1TTIA 4JN6A 3W84A 1FCBA 3TIMA 2HTMA 1SFLA 2ZA2A 1DQXA 2YDAA 2O7SA 3TX9A 3NG3A 4K38A 2H3DA 4ADTA 1G7UA 1EUAA 3R2GA 4FXRA 4JNMA 3UNDA 5LKYA 3I7RA 2Y7DA 3W1RA 4TU1A 3ATZA 4O53A 4TX9A 1QPOA 3SGZA 2DZUA 3LBCA 3LI0A 2A6LA 4P2VA 4GXMA 4M19A 3U2OA 1H50A 4UTKA 2C18A 3FJ6A 2B4GA 2Y6ZA 4UMAA 4JGDA 4MIMA 4K36A 4MLJA 3ZR4A 1GWJA 3N9SA 1CI1A 5AHMA 5HNRA 5LHFA 4O4VA 3HGSA 4IMFA 1TQJA 1MEIA 1H7PA 2A0NA 4WY0F 1QWGA 3VE9A 3QQ0A 3LGEA 4NQ1A 3G18A 4WOQA 4WQ6A 1O94A 5FF0A 3LV5A 2X1UA 1EWDA 4LOCA 1NFBA 3TC7A 3C0JA 2QJHA 2TRSA 2X2GA 4FNSA 4I7WA 4HSOA 5L6UA 2BZNA 5FEWA 1TTPA 2DZXA 3IGSA 1G4SA 1PHQA 4K8HA 1YTEA 4DXVA 2VFHA 3GDRA 2CLMA 2CWNA 3V1PA 1ZY9A 3NL5A 3JRKA 3GX9A 4L4MA 3MI6A 4ZQMA 4AHPA 1KFLA 2O7QA 4OWGA 1CW2A 1OF6A 3NL6A 1GVFA 5AYZA 5K7JA 4ZVJA 4XBKA 3C6CA 4NJGA 2FDSA 4N4PA 1LTDA 5LNSA 1GVOA 3WK2A 2D73A 4HIBA 3I68A 3CB8A 2V8ZA 4GJ1A 5CSSA 1O5KA 4DBEA 2QR6A 3GDKA 1OX4A 2J9ZA 1K02A 1LCOA 1VPXA 2B7OA 4DELA 1EA0A 4BI7A 1SO4A 5KITA 1BWKA 3M1ZA 4G1KA 4ADSA 1PHWA 4IJBA 1GTHA 1VS1A 4RKAA 1LBMA 3LCFA 3NQ8A 2R91A 3EB2A 3FFSA 2IQTA 5IM51 4WJEA 4UC5A 3GB6A 1TV7A 3GXPA 2V9DA 1W31A 2RDWA 4FIRA 1K03A 1QDSA 1W8SA 3L9CA 3TJLA 2QJIA 3DU0A 1JCNA 1RQBA 1G7VA 1GT8A 2NUYA 3F1QA 1GYNA 1GPWA 1WA3A 3STEA 4IPJA 3R5EA 1BKSA 4OGZA 2C13A 3JS3A 3P84A 4UFIA 5CZJA 1RV8A 3QF0A 3BG5A 4OV4A 3BGGA 3ABQA 1LRNA 3RU6A 1ALDA 3A9IA 3F4WA 4UTLA 3EKZA 4LS1A 1A50A 1ME8A 4OU1A 3OEXA 2V82A 2QF7A 4MLRA 2JGQA 3LCXA 1Z41A 4WUIA 1UCWA 3EWWA 2DJLA 4JTUA 1D3GA 1TREA 4HNUA 1LDCA 1QO2A 2Y7FA 2NXHA 2PCQA 2ZTJA 3GIYA 4LS2A 2HSAA 4UR7A 3KXQA 4ADUA 4UTMA 3VCRA 1OG0A 1QOQA 3T4CA 2ABAA 3OBKA 4MVAA 2NXIA 3I7QA 5A5WA 5AYXA 1SW7A 4LRTA 3OIXA 1F2JA 1HO1A 1PS9A 4Q33A 1SZGA 5AHNA 3EWBX 3IRDA 4LU0A 3W87A 1I45A 1W3NA 2QKFA 3VNDA 3LLFA 1OYBA 3C2VA 1LOQA 1OF8A 3P62A 3CTLA 2PRMA 3HPZA 1FWRA 1T96A 3T55A 3WJWA 1AG1O 3DI1A 2FB3A 3HGJA 3UYCA 3EX1A 2GPTA 3LTPA 2TPSA 4ALDA 3TDFA 4NNAA 1FQ0A 1YDVA 3LCLA 3LB0A 3N73A 2WSQA 4K6AA 4WXZA 3MI3A 3P67A 3A21A 2ZBTA 3GLCA 2DZSA 4ONVA 3FYOA 2FTPA 3W7HA 5CKSA 1WDWA 1EUNA 1O4UA 2C14A 1OFAA 4HT3A 1TQXA 3PSVA 4ZQCA 4FNRA 3EWYA 4WOZA 1IXQA 2X30A 3W1PA 1GVRA 3HG3A 3LLDA 1VCFA 2E09A 4BF9A 4D2JA 1TPDA 5BMXA 3DBPA 5D04C 5I3GA 5SWUA 3HOJA 3LDVA 1H62A 1P1XA 2A2IA 4HNNA 2CFFA 2WNZA 3G22A 4JYEA 1GTEA 1WQ5A 4Y9AA 4EOUA 2H3BA 4O11A 4UUIA 5EBUA 2AAMA 2ALDA 4N2YA 3S5OA 1GYLA 1W5NA 3KVJA 3SR7A 1GVQA 3M5ZA 3FYPA 1KM4A 1DBTA 3W2NA 3L0KA 2B7NA 2OT0A 5LNRA 3B06A 2WPBA 2VFFA 3W23A 1ZJIA 2YW3A 4H3DA 1IIGA 1S3HA 4O8RA 3O6DA 2A6NA 3QMRA 4JIQA 3LHZA 1H7XA 3KOFA 3GNNA 3BARA 3W7OA 3C52A 2BXVA 3C2EA 3NM3A 4YLWA 3S6DA 4EF9A 3FA5A 4IGHA 3T44A 1KM1A 2E68A 1RR2A 2YZRA 5AC6A 3C2FA 2VFDA 5HJLA 2Y7EA 4C1KA 2JKAA 4GUJA 4CNOA 2R94A 5D33A 2YXGA 3QQ1A 3NQEA 4K39A 3PY2A 3TQVA 3B0VC 5EY5A 4MZ1A 3W7RA 3GNDA 4HPJA 4LTSA 2QCLA 5D09A 1D9EA 4LT9A 3IIPA 3LM7A 4NT0A 5F4XA 1OFQA 4IXXA 2G5WA 4JTFA 3W76A 3LI1A 4AEOA 3UQNA 5K4ZA 3BW3A 5F1UA 4QSHA 1SFJA 3EXSA 5MHBA 3TMQA 1VH7A 1DHPA 5FF7A 4CQAA 4UTUA 3S1UA 3PBYA 2QDGA 4BR1A 3HG2A 2J24A 3M16A 4JY8A 3HQ1A 1ME7A 3SSJA 1XDLA 2OX1A 2LLEA 4PA8A 4R7JA 2RDUA 4ZL1A 1EWEA 3PBVA 1FWSA 3WK3A 4UTTC 3V75A 5CZTA 3W1TA 2GQ8A 4NJJA 5FI8A 5HINA 1W5PA 1FWWA 3VE7A 4J9JA 1R47A 3OA3A 3EEGA 4OHQA 3QRHA 3NZRA 5AHEA 1WBJA 4S2BA 5HULA 1I2PA 1ZFJA 4JTHA 3TFCA 3E12A 4ZQOA 3NEVA 5F2LA 1ZAIA 2QCDB 3QMTA 2A4AA 1QCWA 5F4SA 1TCDA 3WK0A 1TRIA 4M7SA 4KFOA 2DU2A 3BVJA 4NVTA 4XWUA 1V7YA 1VJIA 5AYYA 3W7IA 4RV8A 3N3MA 5CPLA 2QCFA 4NZFA 4CQ8A 3C4UA 3Q94A 4KFNA 3OVQA 1TV5A 1VRDA 3TSMA 3M5YA 1TYGA 4DEFA 1LORA 3KRUA 4JX6A 1LOSA 4UTTA 2P1FA 3NGJA 4FXSA 5F2MA 3C3NA 2TSYA 3TMLA 1KM2A 1KW1A 2CW6A 4Q4KA 3TNOA 1AW5A 3UY8A 4UTJA 1AW1A 3ZWSA 5HWMA 4QIUA 3SJ3A 2A7RA 1I2RA 2GQ9A 5C54A 8TIMA 2RFGA 3MJYA 3BLIA 4EF8A 2GVJA 1JUEA 3HBLA 2P0OA 1GEQA 4UR8A 3G0XA 4OE7A 1QO5A 1SPQA 2NUXA 1NF0A 1TPH1 5HQEA 3CWOX 3U6WA 3W7EA 4BI6A 3DFSA 3W7LA 2H90A 3QSTA 3WFAA 3JR2A 4MZYA 3UWWA 1B4KA 2EHHA 3DFOA 1TPB1 1WX0A 3UD6A 2B7QA 4O0KA 2JK2A 3KAOA 1AL8A 3UY7A 2V2CA 4N02A 1DORA 1WOAA 3GDTA 2A5HA 2NLIA 3QC3A 5FF3A 1GG1A 4N9DA 3KRSA 5AC8A 3FKRA 1GQNA 1WBHA 3LRLA 1HG3A 4FB7A 2NWRA 4K8EA 1UUMA 3PSWA 4IWWA 3SY5A 3O15A 3TC6A 5TBOA 1ZNNA 3EXRA 3NQ7A 3RF9A 1LLZA 1H7WA 1GJPA 4LWWA 1I8JA 5C6MA 4XKYB 4GBUA 3TW7A 4RXFA 1L6YA 3G8EA 4ZQPA 5BNKA 4QJ1A 1VLIA 2GJNA 2ZRWA 1JCLA 1O5XA 1K8ZA 1R46A 3L21A 1G4PA 3LXCA 3MW7A 3S5NA 3WJZA 2J9XA 1FUYA 2V30A 1TTJA 1DVJA 3UWQA 4N4QA 3W7PA 4MZ8A 4QAIA 4O57A 1HL2A 1TMHA 4DO4A 1N55A 1YPFA 5DN1A 1LP6A 1PL9A 4UNKA 5G1TA 3W2KA 1XBZA 2PC4A 1VGAA 3LCHA 3GKFA 2FPTA 1NEYA 5E0KA 3DFQA 1W54A 2ZRZA 3O6YX 3L65A 3L66A 4UTHA 3FS2A 1FDZA 2EF9A 4O17A 3DI0A 2VFIA 3NL2A 3O05A 2ZRVA 2ABBA 4LUIA 5ABTA 1W3TA 1Q6QA 2ZZ7A 2DJXA 3P7YA 4A3UA 5A8GA 5TQLA 1R30A 1RVGA 4LY8A 2WNNA 2OZ0A 2QAFA 3HO8A 4HNTA 3LCGA 1F6PA 2KZHA 4NXSA 1LOLA 1JR1A 1VZWA 1PV8A 4FIQA 3W1LA 4GC4A 1H51A 5AB3A 5HR6A 2YGYA 3MO7A 3A22A 3LV6A 1SSGA 1QR7A 2A21A 2VELA 2YCEA 4NX5A 4A2SA 4JYFA 2QCEA 4I9AA 1TJRA 3M5XA 5HWJA 3TK7A 1XI3A 4RZ5A 4EIVA 1DL3A 1C9DA 3TQKA 3S1VA 1VCGA 5AHIA 4DQWA 3W9ZA 1Y0EA 4NU7A 3B0PA 4S1FA 4AF0B 3A24A 3LRKA 1H1YA 4NNBA 2XN2A 3LBMA 3W75A 3DFNA 4IMCA 1LRQA 1TPEA 2PURA 1B3OA 1KM6A 1OYAA 3B4UA 1OFBA 2B7PA 2H8ZA 4JTIA 2Z6IA 4PL1A 4UFLA 3NQ6A 4O1DA 1VHCA 2CU0A 3GR7A 5HUPA 3THQA 3WJYA 2F84A 1YXYA 2QEZA 3NNTA 1SU5A 2J88A 1ONRA 2JKEA 1JUKA 1YXDA 2Z1BA 2QUVA 4YCPA 2OT1A 1QOPA 3NYZA 1LM1A 3UWYA 4RR4A 2NX9A 4QNEA 3S8HA 3N14A 1G69A 3IVUA 1KV5A 3CC1A 3DZ1A 5CZ0A 4H4IA 1FCQA 4IOTA 2RDTA 5DXYA 4M6PA 2QCHA 1M7PA 3UPWA 2BLEA 1MEHA 3E96A 1VHNA 3B03A 4WX2A 2ZQ0A 1J4EA 1KM3A 4YMZA 2YYTA 3NQVA 1RD5A 4MOZA 3FEMA 5F1VA 5LHEA 5HR7A 1OFRA 3QM3A 4N6EA 3F4NA 2YPIA 4JX4A 1P0KA 3TV8A 1GOXA 2CLKA 1WAUA 1C8VA 3M5VA 1DJQA 3PG9A 1M6JA 1NF7A 1LBLA 3GAKA 1IXNA 2NV2A 2A85A 3OVPA 3LXAA 3O16A 3HG4A 3LCWA 1X6UA 4O10A 1EEPA 4JTJA 1XFBA 3GK0A 2XN0A 1JCYA 1P5BA 1XC4A 2QCMA 1IGSA 3PC0A 4HN4A 3S1XA 3G1DA 4JICA 5DELA 3AJXA 3SECA 3H55A 1JCJA 3DGRA 3OHIA 4K37A 3KVMA 2P10A 2FQIA 4PFMA 2ISVA 3CPRA 2CLIA 1G4EA 1PCWA 4WZHA 4O1AA 3P80A 3LRMA 4Y6GA 5D2VA 1QNVA 1K7XA 2VEPA 4JS3A 1T0OA 4AB4A 4JTKA 5G4EA 3MWAA 4FX6M 4KWVA 1FCVA 4UFKA 2A1YA 5FEPA 1YXCA 3EWUA 3P8IA 1NSJA 1THFD 3C2RA 1W37A 4CQ9A 4ORIA 4R33A 4JEQA 5C2XA 3TAOA 2DZWA 3NPXA 2J27A 1ADOA 3PULA 4FHAA 5LGXA 2ZZ3A 3FOKA 2I14A 4OBTA 3CLMA 4ZQNA 3TROA 1X8FA 5CPNA 1ZCOA 2YR1A 2C1HA 1OX6A 1B4EA 3LX9A 2QCCA 2C6QA 3QYQA 3SW6A 5CSRA 2ZA3A 4ICNA 1O60A 2Y85A 4JX5A 1N8FA 4MUZA 3ZWTA 4XUGA 1WXJA 4I7UA 4Z08A 3RFAA 1ME9A 1H7RA 3G0SA 3NOEA 2C16A 5DBTA 3W7MA 4AWTA 3PUOA 1K8YA 5LSMA 2FFCA 5CPMA 1J5TA 4X9SA 4XZ9A 3MYPA 3L5LA 3EKLA 3GR8A 5DCDA 2Y88A 3IIVA 2F7FA 1EPXA 3DFTA 4JTTA 4JIPA 4IMDA 1OFPA 5G2HA 2FPYA 2VC6A 4YCOA 1DV7A 4FO4A 1XBXA 4OT7A 3TSDA 4OV9A 2E6DA 2Z2UA 4XTDA 3IEBA 3PVFA 3PAJA 5FF2A 4IX0A 1JCXA 1L6WA 4FEZA 2X1TA 3N9RA 3GKAA 1X1OA 1G6CA 1KA9F 4Z1DA 3UZJA 5LNVA 1Z42A 4H6KA 2Q8ZA 4LVDA 1X7FA 3RLUA 1XXXA 3DHDA 3MHUA 4XBSA 2XN1A 3N2MA 5D02A 4UIOA 2E6YA 5D37A 1QPQA 4MPQA 1AL7A 4AWUA 1C29A 3P82A 1XBVA 1T99A 4N9EA 3R8RA 2H6RA 3W7CA 3C61A 2ZRXA 3SFKA 4R34A 4O14A 3S9YA 3CU2A 3W83A 4M6QA 3TU9A 3TR2A 4RK8A 5C5YA 2FJKA 4PODA 4E2DA 4W9TA 4AWSA 4Z1BA 3L5MA 4DO5A 4AF0A 2I1OA 4RCXA 1W5QA 3H54A 1OABA 3C2OA 3BW4A 3T40A 2X16A 3MHFA 3W88A 5D2TA 2VENA 1OFDA 4M5PA 3W1XA 2E1DA 3TH6A 3LERA 4IPIA 3BPWA 4YL2A 4WY0B 4TIMA 1K3UA 3W2JA 2Y62A 3CWNA 7TIMA 4MJZA 3E9AA 4PEKA 5EPDA 1KFBA 4DPQA 5E93A 3QEZA 3PM6A 3STCA 3SGUA 3HMJG 3NQAA 3HPXA 4N6FA 3QPZA 3CQ0A 1ICSA 1B57A 2GJLA 3W7QA 3H53A 3L68A 2ZZ6A 5C55A 1UB3A 1MO0A 3P8JA 4UFMA 1U5JA 1TB3A 1KBIA 5E1QA 3GYEA 3R13A 4X3ZA 3F03K 2HMCA 1HO4A 5DY2A 3G3MA 2Z6JA 5AC7A 3B04A 1A5BA 1XUZA 3NPUA 2ZA1A 4A21A 1I4NA 3USBA 3TFXA 4AAJA 3MP5A 2DP3A 3INPA 4IQLA 5BOOA 3KX6A 4IUOA 1LRTA 4UFHA 1B9BA 5AHFA 3W72A 3NPVA 1IIHA 2QCDA 1KLYA 1OVDA 3Q2DA 1FXQA 1KFKA 1YYAA 2G96A 3B8DA 4MY8A 1JRBA 2BSLA 5CPOA 2WNQA 4KWWA 1F73A 4IX2A 4MYAA 4YWIA 4PTNA 1F6KA 4QM1A 4HHPA 2ZZ1A 3UWZA 3A5VA 4HNVA 3FKKA 3NZ1A 3I7SA 2JGYA 3G1XA 2FPVA 3P61A 5LNUA 4RZ6A 4BK9A 1SSDA 3W22A 4JTSA 4O13A 3W74A 3YPIA 4UMBA 1JUBA 1PE1A 3CT7A 2W0UA 5G4WA 2QUTA 3NR0A 3DKLA 2QJGA 2EGZA 2WSYA 3NQDA 3ATYA 4FNPA 3BG9A 2CLLA 4XTIA 3W6YA 2Y70A 2QCGA 3G3DA 2V0TA 4NJHA 3Q37A 5D32A 5J5DA 4DPPA 3M43A 3BK0A 2GQAA 3ABSA 2PRLA 4Q32A 5LGZA 5F4WA 2YX0A 3W86A 2YYUA 1U83A 2FB2A 1PVNA 4BWLA 2VEIA 1G67A 1F05A 1I2OA 1D3HA 3CIXA 5G5IA 2QDHA 4PH6A 2J6XA 3TJXA 1LYXA 3EX4A 1A5CA 2RH9A 1QAPA 3W1AA 1A53A 4UTWC 4MY1A 1F7BA 1IXOA 1TO3A 2AGKA 4O16A 2CLOA 3UWVA 1LBFA 4RLIA 2VKZG 1K7FA 3A5FA 4GUGA 3CIWA 1RZMA 3W1UA 1JQVA 3RLVA 1ICPA 4LUJA 3R12A 3WK1A 4ORMA 4AH7A 4JYDA 1KFJA 1XL9A 3G1YA 3N34A 3RNDA 2RHGA 3LHYA 4HSNA 5F2GA 3O63A 1FX6A 2W79A 2YFNA 2EKCA 4UXDA 3PWAA 3IVTA 5H2ZA 5K3VA 4TO8A 4BI5A 5EA9A 4AXKA 2BTMA 1OK4A 4JY9A 4RX0A 2E6AA 1F74A 1H60A 2ZRYA 1TTQA 3TSBA 3G1SA 1JCMP 3UWUA 3IIOA 4AHQA 5J5RA 4M7TA 3STGA 1DQWA 1NAL1 4K7VA 4LS0A 2WJZA 4POCA 4CCCA 5I3JA 1XUUA 2E5BA 5KTLA 5I3IA 3S5ZA 4DF2A 3NL3A 4JTEA 1YADA 5EKYA 1WV2A 1TPWA 3MP3A 2WKJA 2YW4A 3HIJA 3WJSA 3KFTA 1DKWA 3UZ5A 4CNPA 4IXHA 5BW6A 4XKYA 5D2XA 3MYOA 4X2RA 1EIXA 1W5MA 2NXGA 3ZFHA 4AVFA 5EYWA 4GRSA 3NQ2A 4NNCA 3FIGA 4JTGA 5KINA 4B5NA 2DZPA 1S5VA 2CLFA 3PG8A 2H8XA 5BMWA 2ZCGA 1MEWA 2QCNA 4O0ZA 4N9BA 2CZDA 1DJNA 3AO0A 5HUOA 3GZ3A 3CM4A 4QITA 4LV9A 4Z0JA 4LNYA 5D30A 2GOUA 1L2UA 3S42A 2NUWA 1RQEA 1UJPA 3MHGA 2WV8A 3LHTA 3BLEA 3G1AA 4FX8A 3RK8A 1TJPA 3B0UX 5G2WA 1QPNA 1EP1A 4IMEA 2Q3RA 1K8XA 1BWLA 3G1FA 4FX7A 1L6SA 3PUDA 4FNUA 3MI2A 3LHVA 1M5WA 1TPVA 1VC4A 1JVNA 3HGRA 1VQTA 4O1CA 3HGOA 4EWND 1X1ZA 2VXNA 5DXXA 3FLUA 2NV1A 2TMDA 4JDYA 5U7SA 1WOBA 5FESA 5KZDA 4DO6A 5KMYA 3TXVA 2ZTKA 3W07A 4UTWA 2CZFA 1OFEA 3E02A 3QZEA 2V2HA 1SR9A 2V2DA 3QJAA 2Y7GA 3NQMA 2V5LA 3NXFA 1YDNA 2NZLA 3MUXA 3TKFA 1WYIA 3W7JA 2XFWA 5G2IA 5DY3A 3QH2A 5HMSA 1SZNA 1LZOA 1Z48A 1FCUA 2VFEA 4E0CA 3G1VA 1KV8A 5LNWA 2YFOA 1PCKA 5DCEA 2VOMA 3N19B 3SI9A 3OVRA 1W1ZA 3W2UA 2C3ZA 5CZSA 4BFAA 1KBJA 2WSRA 3HB9A 5KSWA 3TCEA 1R2TA 1L9WA 1VCVA 1YTKA 3L0NA 1QFEA 2Y63A 2TYSA 1W5OA 3TAKA 4BWLC 1SO3A 2FLIA 3K30A 3W73A 3A23A 3DH7A 4UMCA 2JBMA 4A2RA 5I3KA 1YPIA 1CX9A 2PRHA 4O52A 4O19A 1Q45A 2WOQA 3FJLA 3W7GA 2UV8G 1OX4B 2B0MA 3P60A 1LROA 5FF4A 2C19A 1JULA 5D38A 4ZMGA 3W1QA 3Q58A 3NQGA 3MBDA 3S5YA 3QMSA 4WXYA 4Y8FA 4Y96A 3TQ0A 2DZTA 3O1NA 4O18A 3ZS4A 4E2BA 5AOUA 1DOSA 5D03A 3LTSA 4JXCA 2HS6A 1GZGA 1VLWA 3PB2A 3IGXA 1HUVA 3D0CA 3NA8A 3BW2A 3NAVA 4MFDA 1IXPA 1SO5A 2E6FA 3QSRA 3IIZA 1YLVA 1FWTA 1KTCA 3L2IA 5AHLA 1GVSA 2G97A 4E38A 4M6VA 5I3FA 3LHUA 3ELFA 4WY0A 3MBFA 3LHWA 1H61A 3CEPA 2R8WA 5IBXA 2GVGA 3PF3A 4DF1A 1RQHA 4O4WA 1KM5A 2ATSA 3HJZA 1G4TA 1S5WA 4CLMA 3TW6A 4KKXA 3TXZA 2E5CA 1QMLA 1T8XA 4UNLA 4FNTA 1ICQA 1ZAHA 1Q3NA 2DORA 4Z0SA 1Q6OA 1H5YA 5AN7A 1XCFA 1SQ7A 3LXBA 3OG3A 1SO6A 3EXTA 5F2IA 4S2CA 3C8FA 3ANYA 1OYCA 2CLEA 1TIMA 4O28A 3W7NA 1TV8A 1FWNA 3G24A 2W6RA 3NDOA 2ISSA 1TPC1 4O12A 1TPUA 5IBXC 3EWXA 5LZLA 2WO5A 3PS7A 1OFOA 1KLZA 2WQPA 1EX5A 2FIQA 3ABRA 5BRBA 3CHVA 1XBYA 1H63A 4IMGA 2E77A 5I3HA 3P74A 1R2RA 3QPYA 4U28A 2EAWA 3G8RA 3BLFA 4X22A 1EP2A 4RJEA 1VYRA 2ZRUA 1OHLA 4GUFA 3W85A 5HWNA 4TMCA 3HPSA 1XDMA 1N7KA 1H7OA 4OQVA 5D2YA 4ZZ9A 4KFPA 3TUUA 3M47A 3NM1A 3KVKA 2ATMA 1Q6RA 3IGUA 3W7DA 4GNJA 2RKXA 1F76A 2Y89A 3BG3A 5H91A 1SUXA 2VFGA 3QW4B 5GVJA 4Z1CA 3NVTA 3LCIA 1H1ZA 2EPHA 3IV3A 3W1NA 3UXDA 2Q3OA 2NX3A 4NZJA 5DLCA 4A29A 1OJXA 3DFPA 4K7YA 4LC6A 1VR6A 1QPRA 3NPWA 3EX2A 4MKNA 3THAA 3DXIA 4DF0A 3L67A 2JKPA 4MYXA 3IIXA 4HKPA 3I6RA 1YDOA 3W70A 2VEKA 3G0UA 4ZQRA 3MP4A 1W3IA 3MMTA 1FDYA 5EMUA 2ZZ2A 2GUUA 1SZFA 4PCFA 6TIMA 1BTMA 3S0CA 2Y61A 1SW3A 1AW2A 4CCDA 4UCGA 2OMAA 3E49A 3STFA 1MSSA 4MFEA 4DBDA 2ZDRA 3GXNA 1UUOA 1ML1A 3PB0A 1UASA 4AMAA 3W2MA 5K9CA 1P0NA 4YXGA 5KZMA 3VFLA 5D05A 4C1LA 5D2WA 1JRCA 2E5DA 3LOTA 3M44A 3N2XA 2PE4A
chains in the Genus database with same CATH superfamily
1MW3A 1ITUA 1UQZA 2JEQA 1HFBA 3S1WA 3ZJKA 5LXEA 2ZYFA 2QUUA 4PUWA 5FD0A 5TD4A 2J13A 1V0KA 3N13A 1QHPA 3AOFA 1B3XA 1FHVA 4PSPA 3VIFA 2YCLB 1OB0A 1XWYA 2CZ5A 3KZPA 3L5AA 4WSHA 3THCA 5AFDA 2FJUB 6ALDA 3EWZA 7PTDA 1TPFA 4NRSA 5U4NA 4M8UA 1SZEA 1RALA 4UTIA 1K9DA 3CZLA 4WD0A 2YB1A 1FWGC 5EL1A 4ZB0A 4U4MA 4PC8A 2J9YA 3UJSA 5AZ1A 1VFTA 4C6BA 1ZALA 2J8FA 3SIZA 2RGMA 2VC5A 5FJOA 4ZTXA 5A6LA 3WFZA 4H9YA 4HBKA 3C86A 1IWBA 2JALA 1KCZA 3AICA 3M9YA 1IQ8A 1RA5A 3WJXA 1XH0A 3IK4A 1AQFA 4I7VA 2RJGA 1EZ2A 1WKDA 4GUHA 2PLMA 2GZXA 4LVBA 4NJIA 5TF0A 1JJKA 5A6BA 3KHJA 1ZTVA 4A22A 1A5AA 4MSSA 4R53A 5A3HA 4LVGA 2Q8LA 1M04A 3E0VA 4MY9A 1TWDA 3I65A 4GUIA 2HISA 1ADDA 1KTBA 2Y5SA 5L9FA 3Q45A 4DWSB 3E0IA 1UWTA 1MI3A 1V5XA 4MDPA 5CGQA 1XC6A 2OVLA 4PTWA 2VZTA 4HGXA 1BEUA 2GSEA 4PUDA 1R2SA 3NEHA 1DE6A 2ZZ5A 1Z44A 4JTLA 5C7VA 1F5ZA 3GG0A 1ELSA 1XJBA 1A49A 3H4WA 3GDMA 3H2EA 2V5BA 4UFJA 2Z0IA 5FAJA 1GCYA 3T78A 4KRUA 2QGHA 3UPBA 6REQA 4BKNA 1SW0A 4CCEA 4J40A 3AMLA 3T8QA 1K7EA 4XK2A 4L9YA 2VEMA 1I75A 5LA2A 2A7PA 3KRZA 3OU8A 3PZMA 3VA8A 5FEXA 3MQTA 3WEZA 1VYSX 3VNJA 3M41A 4ZXOA 1XLDA 1JQXA 3KCOA 3W3OA 1AH4A 1TTIA 2PLCA 1HVXA 4GI4A 3W84A 1FCBA 1O1HA 1DQXA 2YDAA 4UB9A 3L7RA 4L65A 4K38A 2H3DA 1LQ2A 2PTXA 2YL9A 3R2GA 1UD8A 1UKQA 4C6NA 4W7WA 3W1RA 4TU1A 4XSLA 4QFUA 3LBCA 2YA2A 4KCUA 1F6YA 1BG4A 5M2FX 4UTKA 3URQA 3GHUA 2B4GA 5JBFA 4UMAA 1C7TA 3D3AA 2OWWA 1S2AA 2HCVA 4Q7NA 3SURA 3ZR4A 5HNRA 3GXFA 1UJQA 1MUWA 3KOYA 3LA4A 3HGSA 1UMYA 1UOZA 1TQJA 1H7PA 3VE9A 2HXUA 1ESWA 3LGEA 4GINA 4R3UA 1IEXA 5FF0A 3LV5A 4DLFA 2X2GA 1KBKA 4LCRA 2PGRA 4HSOA 1XLBA 3KL3A 2J78A 4HD5A 1G4SA 1PHQA 1HP4A 2W63A 4CN4A 5CC3A 2VFHA 1B3YA 1UKOA 4GJJA 4JHOA 1DWGM 4KEMA 3V1PA 2PBGA 4Q8PA 1ZY9A 3NL5A 2WB5A 2NVCA 3D47A 1KFLA 1Q6DA 2D2OA 3QV6A 4GGBA 1GVFA 3MC5A 5K7JA 4ZO7A 4GQBA 4ZVJA 4XBKA 3C6CA 3L2LA 2FDSA 3PTDA 5LNSA 1EJTC 2V8ZA 5I23A 2QR6A 1XINA 4NAFA 3GDKA 2ACQA 2FKPA 2GGHA 3FW6A 1ODZA 2J9ZA 1LCOA 2F61A 3GHRA 3QC0A 4ICCX 2PAJA 5KITA 4G1KA 1PHWA 1J0YA 5D9PA 5FL0A 1OZQA 2IQTA 3UXIA 4X0VA 2V9DA 4JIRA 4UQBA 1B3VA 1ECQA 1QDSA 5BRPA 2QJIA 4H1ZA 2A3AA 3CV2A 2D3NA 3H7UA 5CZKA 1WA3A 1BVZA 4AZ6A 2HPIA 3CB3A 1CECA 4IPJA 2PDMA 2Y8UA 3UR7A 3CL8A 2WCSA 3JS3A 3L4VA 3P84A 2YA0A 4IM4A 4QRNA 3BG5A 2W4XA 3QR3A 3RGTA 3A9IA 4LS1A 1GJUA 1LWIA 1XIIA 3CASA 2QF7A 4MB5A 4MLRA 4WUIA 1PDYA 1VEPA 1W91A 1VFSA 4U3CA 3VYLA 3WKZA 2PCQA 5C9UA 3MUZ1 3VCRA 1QOQA 1N8WA 5AYXA 2DDXA 4LRTA 1TCMA 2G41A 3TEVA 4PRWA 3TLQA 1PKNA 3NZPA 4Q33A 1OGSA 2DUAA 3PPGA 3C2VA 1LOQA 3F7JA 3LZ5A 1OF8A 2F2HA 2BG5A 3ZYZA 4V33A 1TV3A 4BCEA 1T96A 3WJWA 2VRJA 3EX1A 3VNIA 3PFMA 1MNSA 4ALDA 5A8QA 4NNAA 1R86A 1FQ0A 4YJ5A 3R1ZA 3B9EA 1JD9A 1E9YB 3MI3A 3WENA 3P67A 1VENA 4XVDA 2Y8VA 3GLCA 4ONVA 1D7KA 1KBBA 1DJWA 3RO8A 4UBPC 5CKSA 2QYGA 2C14A 1OFAA 1PJ9A 2A3CA 3M0KA 1X98A 4HNOA 4FNRA 5IRPA 2DVUA 4EXBA 2HQAA 1GVRA 3HG3A 5JIWA 3IGHX 4RW5A 2DV0A 4A3YA 4BF9A 3N4EA 1QI4A 3T9PA 3TTEA 3LDVA 3M0YA 2CFFA 4IGNA 3TC3A 4OJYA 4Y9AA 1IZCA 4FXFA 4EOUA 2H3BA 3TNBA 4BJHA 2ALDA 3GTIA 3KVJA 2I5IA 5CBIA 3CNYA 4S3JA 1S38A 3GTHA 5GJMA 3W23A 4KWOA 3VOGA 3WNNA 5TNVA 1RJQA 3O6AA 1SM9A 1S3HA 2OELA 3O6DA 4JIQA 3SCTA 1W1VA 1SR0A 4ZOEA 3C52A 3ZT5A 3VGFA 5JBEA 1E70M 1KM1A 5DANA 2HBXA 2PB1A 5AC6A 5HJLA 3UJRA 2O0TA 3VIHA 1EJWC 4TVCA 2R94A 3DDMA 3VZXA 3SADA 3DUGA 4S3GA 3B0VC 3W7RA 4LTSA 3GNDA 5D09A 2INFA 3LM7A 3WBWA 2FH6A 3LI1A 2BY3A 2PI6A 1KWGA 5K4ZA 5F1UA 4Y9MA 1SFJA 1Q8JA 4GNVA 5MHBA 3TMQA 2VGGA 3IAQA 3S9ZA 1DHPA 3QKEA 4UTUA 1I6NA 4NI8A 1V0MA 4EKJA 3AYVA 4BR1A 3MSDA 4PMJA 3LG3A 3BDKA 3WELA 4K1WA 1X6LA 1E4IA 3ITOA 4UTTC 3RITA 1SFTA 3K2GA 2GQ8A 4NJJA 1GKQA 2WHKA 5IFPA 3OA3A 1D3CA 3QRHA 3NZRA 1C8QA 2ZDSA 1ZFJA 5CEWA 2V3GA 4ZQOA 3WDIA 1ZAIA 3QMTA 7TAAA 1QTWA 4E5TA 2A4AA 1PX8A 1QCWA 4GXWA 5BXSA 2DU2A 4NVTA 1W2VA 3SUTA 2Q8XA 1KGXA 1MZRA 4F4RA 2J79A 4RV8A 2XDFA 3N3MA 5IXEA 5FAGA 2OKTA 3Q94A 1TV5A 1FP9A 2XFFA 1TYGA 1HJVA 1LORA 2DGAA 1LOSA 3F2BA 1YIXA 3AS2A 6TAAA 1KW1A 4Q4KA 3APTA 3UY8A 4AY1A 3ZWSA 1NFGA 1B90A 5DMNA 2DIKA 4LUTA 3SJ3A 2A7RA 4IFRA 3BJTA 3SUUA 3BAYA 2O4QA 1UZHA 2G3IA 2IS7A 1GEQA 4J5NA 4B91A 1VPQA 2I16A 1M41A 1SPQA 5HQEA 1E9ZB 3U6WA 3DFSA 2H90A 4MZYA 1B4KA 3B8IA 2EHHA 4J3SA 1TPB1 4AY7A 1U2YA 1ZQ5A 1WX0A 1JYNA 3KOZA 3BMVA 2V2CA 2P8CA 4N02A 2BXZA 5FF3A 1WOAA 3AS3A 3GDTA 1QBBA 3PK7A 4H01A 3KRSA 3FKRA 3H6OA 1WBHA 1V3LA 4LJ3A 1BVNP 1UR4A 3GFYA 3PSWA 1EBHA 5DMMA 3O15A 5TBOA 3BMWA 3EXRA 5EFFA 4TVDA 1GJPA 2WM0A 5C6MA 4GIRA 3FA4A 3VO0A 1L6YA 4IP4A 3FNDA 1DXFA 3CH0A 4QJ1A 1VLIA 1HP5A 1JCLA 4LGXA 1K8ZA 1R46A 1G4PA 2BNJA 3BZJA 3S5NA 4C6QA 2FHBA 1VPYA 3GXDA 4R85A 2V30A 4A6GA 3EDJA 4PEEA 1TTJA 2Z1XA 5XINA 4N4QA 1HL2A 3H4XA 3GC2A 4DO4A 5DN1A 1GKPA 1U1HA 4DYKA 3VM7A 5G1TA 2WJFA 3W2KA 2PC4A 1VGAA 1TX2A 3LCHA 3GKFA 2FPTA 4Q4OA 3JVAA 3NCOA 2ZRZA 1XD1A 3KBVA 3L65A 2GWNA 3W25A 1XSIA 4O17A 4FA3A 1YRRA 4GABA 1V02E 1E0VA 1KXQA 3P7YA 4GYKA 2WMIB 4LY8A 3HO8A 5H1WA 2CESA 2R1LA 1BAGA 2KZHA 4NXSA 1JR1A 3UG5A 3RYSA 1VZWA 3ZJ8A 2NSXA 4MNMA 3UGRA 4AZCB 4GC4A 1H51A 2YGYA 3CZ8A 3LV6A 3DG3A 2A21A 1RSCA 4NX5A 4CNSA 2ACSA 4I9AA 4QSFA 2VMFA 1TJRA 1V3HA 1EHAA 1C9DA 1VCGA 4H9TA 1G1YA 4NU7A 4S1FA 2WCAA 3W6MA 4A05A 3M0HA 1IZJA 2X40A 3W75A 3DFNA 4IMCA 3AWOA 1OYAA 3B4UA 4A3RA 4PL1A 5D4YA 1POJA 3STPA 1FHLA 3NNTA 2VX5A 1SU5A 3FAWA 3CZKA 1ONRA 1PKLA 1YXDA 5BROA 2PDKA 1LM1A 3QZ6A 1EEXA 3EOSA 3UP8A 2PA6A 3UCDA 3GHTA 5JU6A 3CC1A 3DZ1A 5CZ0A 2OXNA 1ZP4A 1U5VA 5DXYA 3QKZA 1OBAA 3E96A 4GVIA 3ONCA 2R1PA 1J4EA 1UBPC 5ABGA 2PTZA 1J96A 2YYTA 1XHGA 3VKAA 5CLTA 1UD5A 4JQ3A 1VBGA 1DWJM 3IRSA 3FEMA 1GOQA 4PE8A 4CD8A 1OFRA 3QM3A 5HANA 1OCNA 4JX4A 1WAUA 3AYSA 3PG9A 2VDGA 3OVPA 2P3ZA 3WZ0E 3LXAA 1R3QA 4KRZA 4F9JA 1CCWB 2QT3A 3VDBA 4O10A 2X1IA 3HA1A 2G8ZA 1V93A 1JPKA 1EEPA 4JTJA 1JNDA 4DJDD 3S9IA 5HMEA 1P5BA 1JPMA 2BV9A 2NQ9A 3EOOA 1VBHA 2P10A 3T2QA 4PFMA 2ISVA 2W3ZA 3RRAA 1YE4A 3OVGA 4KESA 2VEPA 4MUPA 4H9ZA 3PZGA 3TYDA 4KWVA 5M3WA 1FCVA 2A1YA 3N2CA 3P8IA 3WH5A 1AVAA 1THFD 4PCPA 3SCOA 5A95A 1TA3A 4Y8EA 1W37A 4FLSA 5JQ9A 4E2OA 1FWCC 3AWNA 4R33A 4JFTA 3E0FA 4AU0A 3TAOA 5C2XA 3IJ7A 3ZVHA 3HQNA 3GIPA 3GHSA 3AU2A 3AAMA 3NIYA 4CKQA 3PULA 1XRSA 5LGXA 4RZBA 1J93A 3CLMA 2GDUA 1P0DA 1YQ2A 1OX6A 5C2GA 3AXHA 4FOJA 2PSNA 1BYDA 5DX7A 4AMCA 2Y85A 4OOUA 4IIBA 1JGIA 4GJIA 4MUZA 3CBWA 1TZ9A 4I7UA 4DI8A 5I03A 3WSUA 1J12A 3G0SA 1YNQA 3W29A 1R8LA 2FFCA 5DCDA 3GNXA 1O5QA 2F7FA 3DFTA 4YTUA 1PTDA 5G2HA 3SRDA 2VC6A 1NQKA 5FJRA 4ZE4A 2ONEA 2D0HA 3HM7A 3RAOA 5HQLA 1DJGA 5FF2A 1JCXA 4N42A 3QOKA 1FTXA 1X1OA 1WNOA 4Z1DA 3UZJA 4H6KA 2Q8ZA 4LVDA 1X7FA 4R7WA 1V7AA 4GYPA 3M64A 1XXXA 3DHDA 3S46A 1PBGA 4YTSA 3G6LA 4ZFMA 2E6YA 2E40A 5D37A 4EWJA 3DOPA 3N1AA 2XVGA 4DM2A 1R9XA 1AL7A 4HNLA 1RBOB 2OFJA 4AWUA 3BLKA 1T99A 2Y24A 4B16A 4HK6A 2H6RA 1B31A 4LB3A 4TV5A 3BZGA 3C61A 1TUXA 2AGTA 1NARA 4O14A 4NKCA 1QOXA 3TU9A 2XISA 3TR2A 4WLCA 4AVOA 4IFKB 3M0JA 4E2DA 1ZBCA 3EEZA 2XH4A 2OEKA 3L5MA 4IFKA 1VFFA 1JPHA 3H54A 1G94A 3KHDA 1Q6CA 1OQFA 1DIKA 2EG6A 3MHFA 4I9MA 3DIPA 1ISZA 2VCBA 3S2MA 3W1XA 3TH6A 4XZNX 4I5UA 5BOFA 4MAZA 3IJ9A 4WY0B 1T6MA 4XB3A 2WHLA 3CQIA 3VC6A 4DWDA 1Q4WA 1ZCCA 1M3UA 2QMJA 3QEZA 3PM6A 3SGUA 3NQAA 1VJSA 4N6FA 3WY1A 3R6IA 4MJ4A 3CQ0A 3UR8A 1TELA 4E4PA 4F40A 4WDXA 3W7QA 1F3XA 2REQB 3KZSA 3KL0A 4DZ5A 1KBIA 1YX1A 3GYEA 3R13A 3AMGA 3SJNA 2HMCA 1FFQA 2ZE3A 2Z6JA 1HKJA 3A64A 1A5BA 2ZA1A 3SRKA 2OLAA 1E0TA 1DHKA 2PP1A 3BAWA 1NDYA 3KX6A 4IUOA 3VMOA 4UFHA 3W72A 3ARRA 1IIHA 1KLYA 1KFKA 1YYAA 2EXOA 5CPOA 2E8ZA 1F73A 3RG6A 4IX2A 4PTNA 1QW7A 1F6KA 2VX4A 4QM1A 5D9NA 4CEUC 3M0XA 3WLOA 2JGYA 3G1XA 1A80A 2ZXQA 3KP0A 2FPVA 3W22A 4FLRA 4JTSA 4O13A 2PGEA 1JUBA 4C90A 3CT7A 3LK6A 4XAGA 3BURA 2OG9A 3SM0A 3DKLA 3B9DA 1BYAA 2GVYA 2VJXA 1OT2A 4P8WA 3W6YA 4AX7A 2PD5A 3G3DA 1IEQA 1TX0A 1JFXA 5D32A 5J5DA 2YKKA 1HL9A 4YVVA 3BJFA 3H2FA 4ZB5A 2VX7A 2YX0A 1U5HA 2Q09A 1PVNA 3VKDA 3OODA 2OOFA 4B5TA 2VEIA 3VIGA 1G67A 1V6VA 1P48A 4W5UA 1QI5A 2QDHA 4X63A 4CNTA 1LYXA 3LGDA 2V3FA 1A5CA 2RH9A 4XAZA 4O16A 2AGKA 4ENLA 5B7ZA 1D8CA 3UWVA 3EOLA 2PCEA 4RLIA 1PTGA 2Y2WA 3IJIA 2J7HA 1EOMA 4FR6A 3CIWA 1NDVA 3VZYA 3CT2A 1JQVA 3RLVA 4I5XA 1BVWA 4H2HA 4XD4A 1KFJA 3TYEA 1XL9A 2OB3A 5AVNA 2C1GA 3P0XA 3IVTA 5H2ZA 5J04A 1P6CA 4BI5A 1JZ4A 4AXKA 1GGOA 4ERAA 3AIEA 1XICA 1M7XA 1LF1A 4RX0A 4LF2A 1VKFA 1F74A 2VWSA 2QJMA 3ANVA 5TAOA 3VOCA 3GZAA 3WMBA 3UWUA 3ARZA 4LS0A 4K7VA 3MMDA 3BUVA 4POCA 4CCCA 4C1NA 1XUUA 4B4FA 1J01A 2Z2BA 3L4YA 3S5ZA 4DF2A 1M65A 2DSUA 3WUEA 3WJSA 1ZS2A 1DKWA 1FWFC 2BY2A 3UZ5A 2ANUA 4CNPA 1MVYA 5D2XA 3NFUA 1UWQA 2PWGA 3ZFHA 1W5MA 2NXGA 2FZBA 4AVFA 5EYWA 5G1MA 1YMYA 4YTQA 4LANA 2GYIA 1P7TA 4G8TA 6CGTA 3GS6A 3W02A 1JI2A 1F3TA 3T1GA 2ZCGA 2PDGA 4N9BA 2PWUA 3AO0A 4QDPA 5AC5A 4DWSC 4GI6A 4Z0JA 1GOIA 1MDRA 3GG1A 1EXBA 4GG9A 3S42A 2NUWA 1UJPA 3R11A 1TVNA 2XSAA 2VUYA 3ZXWA 1XLGA 4GVHA 2WV8A 3PNZA 3LHTA 4FX8A 3BLLA 3UR5A 4DM1A 4AW7A 1K70A 4PYSA 3B0UX 1SFSA 1ZL1A 2ALRA 2Q3RA 4FX7A 1L6SA 4QEEA 1LT7A 4FNUA 3LHVA 4JHMA 4LH8A 3NXLA 1VC4A 3PZNA 5A8OA 2E7FA 4KS0A 2SFPA 2VQUA 3QV7A 4GYPC 3TWBA 1WOBA 4LUYA 4U5KA 5KZDA 3LQGA 4M0XA 2JE8A 1MXGA 3M07A 4C6LA 3IK2A 4DY1A 1XG4A 2CZFA 2G3NA 4UTWA 4PMOA 1OFEA 3QZEA 3WNMA 3QJAA 3MO4A 2DEPA 2YBUA 3OBEA 2V5LA 3NXFA 3SQMA 1E3XA 3M6DA 1PIFA 3UG4A 5G2IA 3DX5A 5AYBA 3QH2A 4LSBA 3W0KA 5I78A 1LZOA 3ARWA 1JDCA 3G1VA 1H0GA 4Z42C 4XIAA 5LNWA 1R3YA 4GMEA 1Y65A 2E25A 1W1ZA 4AD0A 3CS2A 4Z2GA 3RILA 2WSRA 5C0QA 1GVYA 2E28A 1FWJC 3U48A 1DTUA 3L0NA 1TG7A 3IARA 3K46A 5T9CE 2FLIA 3K30A 2OPJA 1XV8A 4A2RA 2WJDA 5GJPA 4HK7A 4O19A 4DYJA 2UV8G 4C6PA 3P60A 2X09A 1BG9A 3CV7A 5D38A 4ZMGA 3W1QA 1TWSA 2QDEA 3S5YA 4IIDA 1BLIA 3O0KA 4AEFA 4LYRA 3VOJA 1UR3M 4PGLA 4F0KA 1RCXB 5DQPA 3LPFA 3ZS4A 4LYPA 4QXIA 1AODA 2WK2A 5JXQA 3LTSA 3COTA 2DSVA 3PB2A 1HUVA 4PTVA 3NA8A 3CHFA 3GO2A 3MTWA 4JOMA 3IIZA 2Q02A 1UROA 1KTCA 2VYOA 3DFHA 4LYQA 3VGHA 3N2TA 2G4FA 2R8WA 3CEPA 3OZOA 3CQJA 3PF3A 1C8YA 1HJUA 2QF8A 2ATSA 3HJZA 1S5WA 1TV4A 3TW6A 1V6UA 5FIPA 3GWQA 1E5NA 1W32A 3R7MA 4QE4A 3LNPA 2BVYA 1QMLA 1F8MA 1T8XA 4Q3MA 1ZAHA 3EWCA 2DORA 3B8SA 4GACA 1BXNA 3EYPA 4HJFA 1QNPA 5BRQA 4S2CA 2J77A 2CLEA 1TE1A 1ZSXA 4DNMA 4O28A 3W7NA 1PPIA 3NDOA 3WD1A 4BHYA 1Z32X 1TPUA 1JXJA 3PS7A 1OFOA 1RJRA 1EX5A 1JPIA 3QGVA 3IJ6A 1XBYA 2B31A 4IMGA 3P74A 2CHRA 1R2RA 3CAKA 1OEPA 3QPYA 5KEZA 2UY4A 2EAWA 3KOWA 5M1TA 2FH8A 1NP0A 3DHUA 1EP2A 3VDHA 4RJEA 5MKGB 1CGUA 1H2JA 2W92A 4KIEA 4IMAA 5HWNA 1N7KA 3VOFA 4KFPA 4H04A 3TUUA 1U33A 3NM1A 1US0A 2XIOA 3FXYA 3IGUA 3VM5A 4AISA 3KP1A 4LALA 4G7EB 3GY1A 1M01A 4Z1CA 3NVTA 1H1ZA 3IV3A 2Q3OA 2NX3A 4TTUA 4NZJA 4KGJA 4M81A 4LC6A 3DFPA 3VDGA 3VOIA 1L8PA 3ARQA 3UA4A 3WEMA 4MKNA 5AYIA 3DXIA 2QGYA 2JKPA 3IIXA 1JCTA 5C9RA 3UNTA 2V63A 3T81A 1NWTA 4NG3A 2PUZA 4XISA 2PWHA 3PJUA 2C71A 6TIMA 2PF0A 2V69A 3S0CA 2Y61A 1PZ2A 2WNWA 4H8NA 5I7GA 2YXXA 4OZOA 1ZU8A 2WMJA 5HPCA 3STFA 1MSSA 1OCJA 3KBSA 4DBDA 3GXNA 1A47A 1UUOA 4O8AA 4M24A 1Q2SA 4DXKA 2IPWA 1KRBC 1R0MA 3VIPA 3PJTA 4IGMA 1UASA 1FP8A 4YXGA 5KZMA 1HJXA 3VFLA 5D05A 6XIMA 3K1GA 1B3ZA 1JRCA 2E5DA 4JQ2A 3LOTA 4YU1A 5BWFA 5HDRA 5GJNA 1EPVA 3NUKA 4FNQA 4NJKA 4O15A 3KS6A 4MF4A 4XAPA 2IKHA 1CXIA 3B05A 3SDOA 3FEQA 1V6TA 1AK5A 3QFEA 1KFEA 1R3VA 1I2NA 1HTIA 4XZHA 4LV4A 1ZENA 1OK6A 4CNUA 1XGDA 3CZGA 3DG7A 3O6CA 4ZENA 1EJXC 2FDMA 1I1XA 5CG7A 5XIMA 1Q6LA 1UOKA 1KCXA 1E6PA 2CZEA 2NQ5A 4TR9A 3BOFA 1CXEA 1TSIA 2CYGA 3CXOA 3WMCA 4GY1A 2W9MA 1TR9A 3P0WA 2PLKA 3TW9A 3I4EA 2ICSA 3WO8A 3PPCA 4Z1AA 3DKJA 1J2WA 3KVLA 4LVFA 3DHFA 3EPNA 2AQOA 3WQOA 6A3HA 3P81A 4P8UA 4WKFA 4GISA 1MXSA 3W27A 3GAYA 3S47A 4MNLA 3C3UA 2WMKA 5M5DA 1KQZA 4TX6A 3O06A 3O07A 4JCLA 3OP2A 3LZ3A 3IVSA 1FKXA 1S5TA 2BX7A 3VFCA 5K4XA 2HS8A 3SZ8A 1P6WA 3AMKA 1B5TA 3HG5A 1X97A 4Q4SA 5FSDC 3H7RA 4QJ4B 4YVXA 1VYPX 4QNWA 1F8IA 2YSWA 3L0GA 3TTYA 4M3PA 3LN3A 4XV0A 2QIWA 1FBAA 5DCBA 1S2UA 2X05A 3M7WA 4ZODA 4S3AA 3BOXA 4M80A 4LAMA 2YB4A 1ECEA 2ISWA 1LLWA 4Q4QA 3BO9A 1JYVA 2ZADA 3EX3A 2QXWA 1CWYA 3U7VA 4XSMA 2OODA 4UWMA 1QASA 4B5WA 4US5A 4AUBA 1QATA 3THDA 3WBEA 1MQRA 1M7OA 1ZUAX 4K2SA 3VKJA 2G95A 3ZJ7A 1KM0A 5G1YA 3BV4A 2V6AA 2GGGA 3UXAA 2OCZA 4LAZA 3MCOA 4MMWA 1FVPA 5CPQA 2QAPA 1PIGA 1Z9AA 4H9XA 1DJYA 2PWEA 2DSZA 4J2MA 3U0HA 1S3TC 3PR2A 4ZBCA 3NQCA 3M6YA 1WUEA 3U4FA 4JN6A 1JYXA 4WSJA 4TV6A 4IGSA 1GKRA 4TX8A 3MZNA 2VT0A 3C8NA 4ERIA 2TODA 8RUCA 4AVNA 4LF1A 5LKYA 3UEQA 2Y7DA 4JNZA 1JYWA 1HGWA 3TTQA 4TX9A 1TE6A 1QPOA 3AISA 1ITCA 3MSGA 1KRMA 2VUNA 1WE5A 2A6LA 4XKMA 3U2OA 3HV8A 2JF7A 2PTWA 1WP6A 3AXKA 1T5AA 1HKKA 2PU1A 4K36A 2PDQA 3NSNA 5AHMA 1CI1A 3NSXA 3OYZA 3SRFA 4IMFA 2POTA 1MEIA 1AZ2A 1QWGA 3G18A 3ES8A 3ITVA 4REQB 2NVDA 3ZZ1A 4IG2B 2ZWYA 1CXKA 4I9JA 2BHZA 4J4KA 3C0JA 3OLIA 3LQLA 2E9LA 4BS0A 5FEWA 1EDGA 4D6IA 1TTPA 4F66A 1ZPTA 4A8LA 1IZKA 2CLMA 4QS6A 1Z6KA 3GX9A 3MI6A 3GBEA 4P7RA 2WMIA 1CW2A 3E1F1 3F5LA 2XIQA 3VD7A 5AYZA 1US3A 3VNYA 3FVDA 3MU7A 3TCSA 3WK2A 3ZJ6A 2IUZA 4EAYA 2PBOA 1WAWA 4GJ1A 1TKKA 5CSSA 1Q13A 4U5IA 1K4HA 2EEXA 1RAKA 3I10A 2PGWA 1SO4A 1GTHA 4RKAA 3VUSA 3WCZA 3C0SA 2R91A 2CWXA 3KBMA 5IM51 4UC5A 3GB6A 2RDWA 3A6OA 4CU7A 1W8SA 4AZGA 5ENLA 1G7VA 3OLEA 8CGTA 4GVFA 1BPLB 1GT8A 3BV7A 2NUYA 3STEA 1BKHA 4HPHA 5RUBA 1UA3A 4OGZA 5CZJA 3O2LA 3W38A 4GIEA 4OV4A 3BGGA 3ABQA 1LRNA 3V5CA 5LIXX 4J3XA 3KTSA 3ITGA 3GH5A 1Z41A 3BAJA 3CZEA 2XWDA 2DJLA 1D3GA 1QO2A 2R1MA 2NXHA 3N6HA 3GIYA 4LS2A 4ADUA 4UTMA 4RPPA 4Q8TA 1OG0A 3ES7A 1RLDA 3OBKA 5JUVA 3WBAA 4RDYA 1WDPA 2NQJA 1F2JA 4XD6A 1ONXA 1SZGA 3EDDA 1O5RA 4LU0A 1W3NA 2BVTA 2XPKA 1O6IA 5LIYX 3GG8A 1FWRA 5I09A 1ADSA 3R58A 3UYCA 4IQJA 5CC6A 2TPSA 3PZQA 4X61A 3VXGA 4DJDA 5H8PA 2V5DA 4C6MA 4CCZA 4WXZA 3A21A 3WUFA 1JL8A 3FY1A 3B8TA 4F48A 4MKSA 2DZSA 1JD7A 4ATDA 5LIUX 2W66A 3T09A 3W7HA 1O4UA 3SBFA 3BLDA 1AA1B 3ME3A 2QDDA 1JFHA 3EWYA 2PWFA 3VCNA 1KWKA 5FJPA 5CC7A 3H4GA 3W1PA 1AD4A 1P0EA 3LLDA 1AQHA 2PF8A 4GO8A 1MDLA 1XIBA 3DBPA 1OIFA 5D04C 3WF0A 1FKWA 1U1JA 3RLGA 1H62A 2DZBA 1X38A 4JIEA 4LFYA 1X1NA 3KL5A 1TWWA 1J6PA 2WSKA 4K3ZA 2O4MA 4LEQA 4J1OA 5AKQA 2ON3A 4UUIA 2AAMA 1U30A 3FYPA 1KM4A 3W2NA 3G77A 4KIRA 3CYJA 5HK4A 1KR1A 3AIVA 4HVXA 3OPSA 3VGGA 2VFFA 3CL6A 1PAMA 1J10A 3PP7A 2J25A 1IIGA 4D6EA 1EGZA 2Z29A 3QMRA 1DQUA 3LHZA 1H7XA 4H9MA 5BU9A 3WH8A 3GNNA 3BARA 3G2GA 1RP9A 3UPMA 3GVRA 4YLWA 3AIWA 4EF9A 3F5KA 4IGHA 1E0WA 2BFGA 4H6RA 3T44A 1RR2A 2BGSA 3HFTA 2C91A 4C1KA 2JKAA 1NWRA 4GUJA 3SCRA 1XIFA 5D33A 2VP8A 8XIMA 4QGCA 4LBUA 1ISVA 3NQEA 4K39A 2G3FA 3VIJA 5EY5A 4MZ1A 3HURA 4LT9A 4PUKA 1DWHM 1VP5A 3CPGA 1OFQA 4QX4A 4AEOA 3WMLA 4QSHA 3W28A 2YLAA 4Q7BA 5DF0A 1S5MA 1XYLA 3S1GA 3T0AA 3HG2A 1CYGA 2J24A 3O3RA 3T0TA 8A3HA 3PTQA 3GXIA 2LLEA 4PA8A 4R7JA 1IHIA 3IV8A 2D0FA 1FWSA 4HTYA 3UZZA 1KO0A 2VR5A 4YPJA 3MSRA 5CZTA 1CTNA 5HINA 1W5PA 4J9JA 4E8CA 1J0JA 1ZBVA 3EEGA 2F38A 5AHEA 3UESA 3ITCA 3CHCA 2YXOA 1I2PA 4JTHA 3TFCA 3E12A 4H9VA 1Q7ZA 2QCDB 5BCAA 3REQA 3KBWA 5F4SA 1HGYA 1TCDA 2Z1VA 4PB4A 3MB9A 1W8GA 4XWUA 3GRIA 5AYYA 3E5PA 3B9AA 3GVVA 4KERA 3CUFA 5CPLA 3ENLA 4KFNA 3OVQA 2VZVA 3TSMA 2I7GA 3WLLA 2WHJA 3BL3A 3M46A 2HV5A 1IR2A 2J47A 3E2SA 2P1FA 3GTNA 3K4WA 4IJRA 4QS5A 5F2MA 2TSYA 1KM2A 3EA2A 1AW1A 2CETA 4P7OA 2GQ9A 4KEVA 4GXPA 2RFGA 1N82A 3MJYA 1US2A 4EF8A 4UZUA 4PCTA 1KC7A 5CPTA 3VVGA 1TPH1 3CWOX 4A8IA 4BI6A 2QV4A 4KEUA 1E4NA 3UWWA 4AYGA 4HB7A 4LAKA 2JK2A 3KAOA 1AL8A 1EC7A 1LWHA 2NLIA 4JFUA 4CVUA 5AC8A 4K8GA 1GQLA 2NWRA 3FXGA 3R43A 5G4HC 2IPJA 3TC6A 4DUWA 1ZNNA 2JIWA 1A0EA 1H7WA 4LWWA 4XKYB 1GW9A 4GBUA 3G8EA 5BNKA 4PMQA 5T9BG 2C7FA 4NL1A 2ZUWA 1XGEA 2DY3A 1P43A 3WYZA 1Q4NX 1RY8A 3WJZA 1OY0A 3UWQA 3W7PA 2BY0A 4QAIA 1MYRA 3AS1A 1N55A 4XD5A 1YPFA 4P5UA 4DB7A 4NASA 1V4YA 1PL9A 4UNKA 3URAA 3IACA 3QFWA 5EFDA 3AU6A 1XRTA 3U2EA 3ZSTA 1E1FA 1W54A 3O6YX 1RK6A 1E0UA 3L66A 3FS2A 3WN6A 1FDZA 2FYMA 3VKBA 1Q6QA 5CJ5A 4A3UA 3HQOA 1XPGA 3MCNA 5TQLA 1SZRA 3PZTA 3RUBL 3OGRA 3S6TA 1F6PA 1I9CB 4PBFA 5CG0A 4WIWA 1VFOA 4YS1A 4IIGA 1PV8A 4FIQA 5HR6A 3MO7A 3A22A 1SSGA 4Z17A 3FX4A 4B9ZA 2PDWA 3CIVA 1XLHA 4A2SA 4JYFA 2FMOA 2QCEA 3M5XA 2Z26A 3TK7A 3LUTA 4IG2A 1Y0EA 3CZJA 3B0PA 2UY2A 3N15A 5CLWA 4AF0B 4DXXA 4YVPA 2XN2A 3LBMA 1LRQA 1TPEA 2WZIA 4B90A 5BWAA 1QHOA 4J28A 3J7HA 4P8XA 3EZ4A 2QULA 4L1GA 4UFLA 2C8NA 3NQ6A 4O1DA 3GR7A 4I90A 4K1GA 3GQYA 1GQIA 2IPFA 2WLYA 5A8PA 3AALA 1JUKA 4C1NB 2DPEA 3NYZA 4OBSA 4RR4A 1SJAA 2NX9A 4QNEA 3WEOA 1M03A 3S8HA 3T42A 3CAQA 3OGVA 1G69A 2FTYA 2J4GA 4IOTA 3UPWA 2BLEA 1UP2A 1MEHA 1HN1A 5HNNA 4RV3A 3NQVA 3MJMA 2PGFA 5B80A 5LXXA 1UKSA 4WDWA 4N6EA 3TV8A 1R7OA 2REQA 1TJ1A 1LBLA 1IXNA 4GX8A 2DSWA 1Z3NA 5CQ1A 1XFBA 1K8CA 1XC4A 2QCMA 1IGSA 3EOEA 3ZSSA 3G1DA 4IZGA 4JICA 1VEMA 3M0MA 3AJXA 4X0NA 4FZIA 3KCJA 4K37A 3WH6A 4IJCA 3CPRA 1J9YA 2BS9A 1PCWA 3N6QA 4O1AA 2EKGA 4YHEA 1TFVA 4L5ZA 5A6SA 2J7FA 1AUSL 4EK7A 4H83A 4XD3A 4QP0A 2YDSA 4Q8OA 4M6UA 3WQGA 4JS3A 4JTKA 5G4EA 4IQEA 1YKWA 4UFKA 5FEPA 2EBNA 3C2RA 1PDZA 1H0IA 3ERPA 4F0HA 1YW1A 4H7VA 4CD6A 2ZZ3A 4ZQNA 2FGLA 3TROA 1B30A 1X8FA 4A35A 2YR1A 2C1HA 2OSWA 2VR2A 3ABXA 4AZHA 4ATWA 3PAOA 4AZCA 3ZIZA 4JN8A 3SW6A 5CSRA 2ZA3A 4ICNA 2Z4GA 2FZNA 4XUGA 1WXJA 4FI4A 1XYFA 4Z08A 4F9DA 1ME9A 1OGGA 4W5ZA 1EJ7L 2GFTA 1RUSA 3L4TA 1C93A 3ANUA 1IWAA 3IIVA 2I5QA 4JTTA 4JIPA 4XO6A 5FOOA 5A69A 3D6NA 2X7WA 2FPYA 2HEJA 1E43A 4Q8NA 1V08A 2OSXA 1GOMA 3EKGA 1XBXA 1XLLA 4IP7A 3TSDA 4OV9A 1YBQA 2E6DA 1NM9A 3VIIA 3GC5A 3IEBA 3PVFA 1OIMA 4XBJA 1FWAC 4IX0A 2PU0A 3BLPX 4FEZA 2X1TA 3PJWA 2EJ1A 1MRAA 3DBNA 1WDQA 3ISIX 3RO6A 4NAEA 3HPAA 1S2WA 1DJZA 2FGBA 2Z7KA 1Y5VA 2ZX9A 3RLUA 1E71M 3MHUA 4JZ5A 1L0PA 1E9LA 3N2MA 4UIOA 1UH2A 2XFRA 1DIOA 1QPQA 4MPQA 1MWOA 4PMNA 1OC6A 5REQA 1C29A 5A1AA 1GPFA 4GI9A 3WL0A 1CDGA 3JZEA 4N9EA 1V0NA 1VFUA 3R8RA 5DEZA 2ZRXA 4B5UA 3GBDA 3H2AA 3S9YA 3CU2A 3W83A 4M6QA 3UFYA 2FJKA 4RE2A 3RPTA 4L4PA 3SGGA 2CITA 4Z1BA 1KNWA 4RCXA 3PBMA 3BW4A 3SCNA 2WKLA 1P0BA 3W88A 3ARPA 1OFDA 2DQWA 2UY3A 4KWUA 3S83A 2XTKA 4ASTA 3BPWA 1TV2A 1EJVC 4WEVX 3FN9A 2Y62A 3CWNA 5C70A 4MJZA 3H2OA 3PANA 1KB3A 1KFBA 3UERA 2D1ZA 2PDCA 2ZIDA 3QPZA 4GOAA 1ICSA 1B57A 2GJLA 3MDUA 1W9VA 2HNHA 2UZ9A 3H53A 3L68A 3LGGA 1BRLA 4J27A 4TXEA 1KR0A 5DY2A 3VD9A 3G3MA 1XUZA 4RE4A 3NPUA 2PLJA 3MV11 3NOYA 3TFXA 2VVSA 3INPA 4IQLA 4QLLA 3OTRA 5BOOA 1LRTA 5AHFA 1B9BA 3SY1A 3NPVA 3Q2DA 1FXQA 2VWTA 3EB3A 3B8DA 1JRBA 2NLYA 3H2MA 2WNQA 3ZR6A 2IKGA 4YWIA 4HHPA 4F0SA 3UWZA 1T41A 4PUUA 1A3WA 4HNVA 2W27A 5BOEA 2V38A 3P61A 3WMSA 2BOGX 4BK9A 3OOQA 3QY7A 3YPIA 1PE1A 2CXEA 4W84A 2WWCA 4PZVA 3NYDA 2ZVRA 5G4WA 2GJXA 2YCKX 2HZGA 3DYOA 4Q4RA 3NQDA 2GDQA 4CD7A 3MKKA 4NZ3A 2YIHA 4ZE5A 5JVLA 2V0TA 1Q8AA 4DRSA 2WKGA 1ZGDA 3M43A 2GQAA 1QW8A 1A4LA 1EDTA 4LCSA 4Q32A 3W86A 1U83A 2FB2A 4BWLA 4P8VA 3CAWA 5G5IA 4OOZA 4PH6A 1R3SA 3WLKX 3GE7A 2XGZA 3EX4A 3VNMA 1QAPA 1LQ0A 4UTWC 1UWSA 4MY1A 1F7BA 1PYFA 2P76A 1TO3A 2BHYA 4HCDA 4RDZA 3FCPA 1P1MA 1LBFA 1EHNA 4DZAA 4LNCA 2ISFA 2XSBA 3DYPA 2VKZG 4GUGA 3L23A 1RZMA 4O1EA 3CQHA 3N12A 3QXBA 2EO7A 2PDPA 3WK1A 4ORMA 2ODOA 3SIMA 2FMNA 3KWSA 3G1YA 3RPDA 3LHYA 1K9FA 3T05A 4AIEA 3O63A 2YFNA 2W79A 3V5OA 5IOBA 3AHYA 2BOEX 4GQQA 4R9XA 4FLQA 3SEPA 4GK8A 3ITTA 2E6AA 4EE9A 3VINA 1H60A 1KGWA 1TTQA 4BA0A 3G1SA 3KOXA 1TJ0A 4AD3A 4M7TA 3STGA 1DQWA 2WJZA 1XIMA 5A6BD 5I07A 1B1YA 1T7LA 2E5BA 5I3IA 3CUJA 1BXCA 2INZA 3VTRA 3WNLA 5EU9A 2WKJA 3KFTA 2FTWA 2BMBA 2OO0A 5D8WA 1HKMA 1XIDA 5BW6A 4XKYA 4O1FA 1PWLA 5HQMA 1EIXA 4GRSA 3DC8A 3FIGA 4D6DA 4JTGA 4PMVA 4B9YA 4B5NA 1EBGA 2DZPA 3F4CA 1S5VA 3PG8A 2H8XA 3FYYA 4QTGA 5BMWA 2V67A 3K8LA 4Y7EA 1BWVA 2XGBA 3KTXA 3BWWA 1DJIA 2O9TA 1BF6A 2QCNA 4O0ZA 1CENA 2CZDA 3QPEA 5HUOA 3AIQA 4QITA 5CCZA 2GOUA 3VCCA 2VRKA 4W8BA 2V5JA 3S2JA 3G1AA 4QEHA 1EP1A 4IMEA 1K8XA 1BWLA 4RDWA 4ZO6A 3W82A 3WQPA 3PUDA 5KETA 1GOWA 3EDEA 5FL1A 1OD0A 1S2VA 3HGOA 2Y5EA 2VXNA 1P6BA 3FLUA 1J0KA 4JDYA 5U7SA 1B54A 5FESA 1YNPA 4DO6A 4H8UA 2FVKA 4XZBA 4HU3A 1KCKA 4F2UA 1UWAA 3MVIA 1SR9A 2GJXB 3FV9A 3MKVA 2WMHA 5DMYA 2QPSA 3TKFA 3W7JA 2GSHA 4DWSD 3RPMA 3BGAA 5DY3A 2J62A 1E1CA 4UOJA 4MAVA 4RNIA 4E0CA 3PHAA 4PTDA 3SI9A 1GHRA 2VD9A 3WLHA 1ZBWA 3W2UA 2DH2A 2C3ZA 5CZSA 1Z7AA 4BFAA 1SJDA 1VCVA 1YTKA 1R6WA 4YN5A 3GIQA 1EJUC 1VJZA 1W5OA 3TAKA 4U3AA 2DVXA 3QVQA 3UZYA 2Z25A 4UMCA 4Q22A 3SCWA 1QNOA 2PD9A 1M7JA 1PZ1A 1BFNA 3CUGA 3W7GA 2B0MA 1AH3A 4EXAA 4Q8WA 3BICA 3L4WA 4HN8A 3PWIA 4FMVA 3DYMA 4WXYA 1IV8A 4HSHA 2DZTA 3W81A 3O1NA 1CIUA 4B5XA 3AZTA 2W62A 4MADA 4HU4A 1W3JA 3LD5A 1DOSA 1H5VA 1EOKA 5FSEC 3OQEA 2HS6A 1J0HA 4DO7A 2BASA 1GZGA 1VLWA 3D0CA 3NAVA 1UH4A 1SO5A 1YLVA 2G37A 1RHCA 5AHLA 2G97A 3QHMA 1BTCA 1XLJA 2J7CA 4E38A 3ELFA 1OADA 4FAMA 3LHWA 3TTOA 1E1EA 1H61A 5AC4A 1OSEA 5LIWX 4WDTA 4DF1A 5EMJA 1F61A 4O4WA 3PPHA 4DBSA 4IT1A 2CZVA 4EPDC 3U2CA 4KCVA 4E8GA 4Z2KA 3OZYA 1B9ZA 1A5KC 4Z0SA 1H5YA 1QWKA 3NDYA 2I17A 1XCFA 3ARVA 2X0SA 3EXTA 3VD3A 4EACA 1Z89A 4MHBA 1DJHA 2ISSA 4FSAA 5LZLA 4NY2A 1KLZA 1V51A 3QLLA 4D6HA 5BRBA 1LJYA 4AD4A 1OWQA 4GC3A 4U28A 1RLCL 3CLWA 4WGHA 1FH8A 1XYBA 3BAKA 3BLFA 2X2YA 4E3TA 3ZT7A 1JDEA 1UZ1A 2ZRUA 3AXMA 1DWFM 3LLXA 1UIPA 2Y8KA 3HPSA 1H7OA 4ZR8A 3RIKA 8XIAA 3GNPA 1Q6RA 1MFVA 4GNJA 2RKXA 1F76A 2Y89A 3CWHA 1K77A 5H91A 1SUXA 5LYRA 2VFGA 3LCIA 4C6OA 4XG1A 3TVAA 2VHLA 5E9XA 5DLCA 4PMZA 1KKOA 1F3WA 3BTNA 2VTFA 1VR6A 2MUCA 2R6OA 4PFHA 3NPWA 3FDKA 4U2ZA 3THAA 4DF0A 4MYXA 1K9EA 4HKPA 3AZSA 3GVWA 2E0PA 3W70A 2VEKA 4ZQRA 3OW1A 2ZE0A 3MP4A 1CGWA 3WH9A 3SCQA 1FDYA 1QVBA 1WB0A 2VVNA 5EMUA 3VPLA 1RCQA 3NDZA 1IEIA 1DTNA 4E4UA 3G5EA 3XISA 4NZCA 1SW3A 1H11A 4I8DA 1E73M 1QNQA 3I6EA 4UCGA 4DWSA 1ITQA 1S39A 5A8NA 2YDRA 1EJRC 4J3UA 5CJNA 1ML1A 4JTAA 3JZUA 1P7TB 4AZ5A 4GNKB 3ICJA 1XLIA 1C91A 3U7BA 4Y9PA 3WQEA 3ABZA 3T2PA 4H8HA 3R94A 4F79A 3POHA 2AQWA 5T26A 4H2CA 4JL2A 4R5EA 3KEHA 1ZBKA 2BBFA 3GNOA 2B81A 1UBSA 2VQTA 4LRSA 4HA0A 2HVOA 4LVAA 1GG0A 5H8UA 1XF0A 1XIJA 1E51A 3QW3A 4PRTA 3TP4A 2ZFAA 1XQLA 3PBWA 1C3FA 3WD0A 1NQ6A 1AMKA 1R9ZA 1NVMA 4ILSA 4HHMA 2ISDA 4TMBA 1MMFA 1ZZMA 2BB0A 2AL1A 1IF2A 3EWDA 3TYUA 3H21A 4RDVA 1WXZA 1KTNA 2DT0A 3P5YA 4QISA 2QVNA 4O1BA 1FY6A 3PBGA 1TMLA 2ZZ4A 2AMXA 2OJPA 4GFSA 4W7UA 4S23A 3EA1A 1KCLA 3NQFA 4Y90A 4P61A 1RPXA 4GCXA 3VI2A 3HZ3A 4W93A 1YTDA 1FXPA 1ITXA 3CEUA 4W8AA 2E1WA 2R14A 3A3XA 3WQ5A 3SCPA 4DNHA 4GD0A 3UBPC 2A3BA 4B92A 1XLEA 4H41A 3W01A 3W7KA 3WUBA 4HPXA 5EMLA 2CBJA 1TVLA 1EB3A 5IDZA 2XIMA 1S1PA 1MZHA 1TA3B 1I2QA 2Y0FA 3U8GA 1CGXA 3T7VA 4MB1A 2C0AA 2YLLA 3V0TA 3GC4A 4KCWA 4H6EA 3UWEA 4AHOA 5KZEA 4ES4A 3O8AA 3WLMA 1JXKA 1HKWA 2OLSA 3OJGA 3DESA 2CLHA 2X1RA 4UCFA 2W5FA 3RR4A 4JD4A 4NP7A 3A4AA 1E6QM 4DUXA 3EX6A 1W0MA 2C15A 1XM3A 5A6JA 1JZ3A 1RA0A 1W56A 1XKYA 5K9XA 1XH2A 1PIIA 1AQ0A 1W6TA 3ABOA 3LPOA 4NUWA 1KFCA 1WZMA 2R1NA 2NWSA 3TZNA 4M29A 4LC8A 1V3MA 3TA6A 5GNYA 1EO7A 2CBVA 5CGMA 4LW7A 2P88A 3SUVA 2WC3A 3TE9A 4QQ3A 5BU6A 3TIMA 1SFLA 3W53A 3GW3A 2ZA2A 1XSJA 2O7SA 1PWMA 4ZXLA 2VL4A 3NG3A 3OLGA 3PUGA 1G7UA 3TN4A 4GZIA 3JW7A 3K13A 4FXRA 4JNMA 2J8TA 3WDJA 3V1HA 3UNDA 2NT0A 3I7RA 3ATZA 4URIA 4DYEA 2DZUA 3BCDA 5M17A 4IFOA 3QZAA 2POZA 2PEVA 3S2LA 2XM1A 3LI0A 3U4AA 4M19A 2F8QA 1UR8A 3WLJA 5I02A 3FJ6A 3AIUA 3OZPA 1R7AA 1GWJA 4C6CA 3H22A 3U2ZA 1V02A 4B3ZA 5A2BA 3AI0A 6XIAA 3EGJA 3CO4A 4WY0F 4ZO8A 3E2VA 3MSYA 1EX1A 4NQ1A 4WOQA 4WQ6A 1BSLA 1V6WA 4JCMA 1NFBA 3TC7A 3V3WA 3WLIA 4N7QA 4AD5A 2QJHA 2VRQA 3ZR5A 5HJYA 4FNSA 4I7WA 5REQB 5L6UA 4BF7A 4ZCWA 3UVIA 3IGSA 4K8HA 1YTEA 3LU2A 4ICMA 2C0HA 1E55A 2CWNA 1VIWA 1JPDX 2G3JA 3N2OA 1UPPA 2ASHA 3SO7A 4JQ1A 3JRKA 4L4MA 2AKZA 4AHPA 2D20A 2O7QA 3AYRA 4OWGA 4GLEA 3EDFA 3NL6A 2UY5A 3UW6A 4NJGA 4N4PA 1LTDA 1YDYA 1PXGA 1GVOA 1W3HA 2D73A 1SYTA 3R0DA 3CMFA 4V1XA 4DBEA 2HE8A 1GK8A 1OX4A 3WDRA 1K02A 2HWGA 3B8WA 3A12A 3OBAA 1V3IA 5HA7A 4BI7A 3CHDA 4FR1A 4WR3A 4H8VA 5CJMA 1QT1A 4IJBA 1KXTA 3NQ8A 3EB2A 2VC9A 3QHNA 1TV7A 3GXPA 1PKYA 3CJPA 3TJLA 4M82A 1H4PA 4JL1A 3DU0A 1RQBA 3E74A 4RL3A 3GD6A 3MVTA 4CUCA 4JN7A 2GGJA 4Q6XA 3C5QA 1GYNA 1GPWA 3HN3A 4PN2A 4R7OA 4GFIA 3UR2A 1XG3A 4UFIA 2X41A 3VAVA 4ROQA 4OECA 4FOKA 5HPOA 3RJYA 3F4WA 2FZ9A 3EKZA 1A50A 2XHYA 1ME8A 4HMDA 4OU1A 4GH3A 4C6JA 4XAFA 4G5DA 1L6GA 1TREA 3ZT6A 1LDCA 4AZIA 5HMFA 2X7VA 4BEQA 2DUZA 4UR7A 2HSAA 2WBGA 3WBYA 4J2PA 3T4CA 2ABAA 5ABHA 1W1A1 2NXIA 2HDJA 1WKYA 2EPOA 1JF5A 1PS9A 1Q6GA 3EWBX 3W87A 4L1WA 1I45A 3LYEA 5CSUA 5FACA 1OYBA 1UWIA 2QQ6A 4HZ8A 3BLOA 5D9MA 3MY9A 4PSRA 2Z1SA 3CTLA 3R25A 2D0GA 2UWFA 1AG1O 2R24A 2XJ7A 4L64A 4UQ9A 1W9DM 3LTPA 3OYXA 4PMYA 4J3WA 2GUBA 5CGTA 3LCLA 3T2OA 3N73A 2OQYA 2VDHA 5A8MA 2AKMA 3FYOA 1J0IA 2FTPA 2VD8A 2J66A 3E3HA 5A6TC 1CEOA 1Z8AA 4HT3A 1BHGA 3M0LA 4PMDA 4DI9A 1FH7A 2X30A 2BOFX 4Q8QA 2F6UA 4FK9A 1VCFA 3TLLA 1VBRA 2E09A 4D2JA 1CB2A 3CMGA 4DBWA 5I3GA 2G3MA 1FOBA 5SWUA 3HOJA 3AXXA 3TA9A 5D8ZA 3FDGA 2WNZA 4HOZA 1GTEA 1U1UA 4AZBA 2VCAA 4O11A 2HVMA 4IPLA 3NQBA 1GYLA 3S6OA 4O0QA 3SR7A 3M5ZA 1DBTA 1VEOA 2VZOA 2IKJA 5LNRA 1JZ5A 1UUQA 2VC7A 3B06A 4XZIA 2WPBA 3S2NA 3CPUA 4AY8A 3ZQ9A 4H3DA 5ECVA 3AROA 1W3LA 4WDUA 4GCAA 4XZLX 2A6NA 3MT1A 3KOFA 2ADAA 2PTDA 2BXVA 1X6NA 1Y7VA 3RU8X 2XIBA 3TYAA 2CKRA 1G0CA 1RCOB 3C2EA 2E68A 4AX6A 3A4WA 5C8BB 3C2FA 1OINA 2Y7EA 1J79A 2WVTA 1L2QA 4DIAA 2MANA 2BODX 3N3TA 4CNOA 2YXGA 1V0LA 4S39A 3PY2A 2BGNE 3L12A 4HPJA 3ORWA 1EYWA 4NF7A 4V27A 2QUMA 3IIPA 3CAVA 4L6HA 3RX2A 3UA3A 3W76A 2G5WA 4JTFA 3VX0A 1GZ1A 3PNUA 4WJ8A 4BQ5A 3ZLGA 1HJWA 1AH0A 4JKKA 3EXSA 5CC5A 2HRWA 3P14A 3ZO9A 1VH7A 4OFCA 3PBYA 2CC0A 4PMXA 2QDGA 5I6SA 4ZO9A 2QJJA 1E4MM 1ME7A 1RY0A 3FA3A 2Y5JA 3SSJA 1XDLA 2YBTA 3QY8A 1CLVA 5CPSA 3AMDA 3MZ2A 2RDUA 1EWEA 4EP8C 3GM8A 2R9RA 4DVOA 3WK3A 5IDIA 3KLLA 4G9PA 3W1TA 5FI8A 5GQBA 1V79A 1OT1A 2NQHA 4PMRA 1WBJA 5HULA 3V0UA 3UXLA 3UCQA 5F2LA 1R3TA 2PODA 1Q63A 3WK0A 2CNCA 1TRIA 4HCLA 4M7SA 4KFOA 4KWSA 4LY4A 1V7YA 1VJIA 5A2CA 3HPFA 1E6ZA 2PDUA 3R79A 2QCFA 4NZFA 4CQ8A 3C4UA 1ZB5A 1SGJA 1VRDA 2WYSA 6ENLA 3M5YA 1IYXA 4GZ7A 2FHFA 4DEFA 4JX6A 3WL1A 3NGJA 4GVGA 1S2CA 1AW5A 3H24A 1NTHA 5HWMA 4QIUA 3MANA 1Q6EA 4AIBA 2FZDA 5C54A 8TIMA 1Q85A 3E5BA 3TWAA 4BZYA 3BLIA 3EDKA 4G7FA 4HYRA 2P0OA 2I56A 4EPBC 2F9RA 2BDQA 4UR8A 3SQSA 3G0XA 4OE7A 1QO5A 1XYCA 3OO2A 3TJIA 4F2TA 2GJPA 1NF0A 3VIOA 4HYVA 4D71A 3W7LA 3KTCA 2WMFA 1O12A 2PDYA 3QSTA 4LUTB 1Q2RA 4NILA 3DFOA 4L61A 2BGQA 2WAGA 1K4GA 2B7QA 3UY7A 3WQDA 3MS8A 3HU7A 1DORA 3QC3A 2A5HA 2QZRA 1GG1A 4N9DA 4TOQA 3LRLA 1HG3A 4FB7A 1CBGA 4YWSA 1UUMA 4K8EA 4H9UA 3SY5A 1E4LA 4I5RA 4QE1A 4CN6A 3NQ7A 3Q4DA 5BYWA 4IL0A 2XG9A 4RXFA 4NSBA 2W91A 1FWDC 2D23A 1BD0A 2ZRWA 3RLHA 1O5XA 2VURA 2WZHA 3MW7A 3WDHA 1W3KA 2FGZA 1CGTA 1FUYA 4BQ3A 3THUA 1UC5A 1PX3A 2NQLA 4PUNA 4O57A 1VD6A 1TMHA 3TTSA 3MCMA 4ACZA 1J0ZA 3T6CA 1XBZA 2XIIA 3OZMA 2HVNA 1NEYA 5E0KA 4D8AA 2VGBA 3NSMA 2C79A 3RDKA 3O05A 3NL2A 3VKCA 2ZRVA 3I4KA 2ABBA 2WZTA 1HW6A 2ZZ7A 3U5UA 4XAYA 2DJXA 5A8GA 1TUFA 2WNNA 4NI3A 1NU5A 5D9OA 4DN1A 3WFLA 3EA3A 3CYVA 2PMQA 4J3ZA 1RXOB 3OHMB 4RNHA 3QYSA 5AB3A 2VEFA 3VNLA 1JZ6A 1V77A 2VELA 5I00A 2HE5A 2YCEA