1KLYA

Orotidine monophosphate decarboxylase d70g mutant complexed with 6-azaump
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
212
structure length
212
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIAGFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
publication title Mapping the active site-ligand interactions of orotidine 5'-monophosphate decarboxylase by crystallography.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 82
structure length 212
sequence length 212
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2001-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1klyA00
1H50A 1YLVA 4UTUA 4NX5A 2P0OA 5LNSA 3MHFA 2Y61A 1LLWA 4O57A 3BLFA 5AN7A 4HPJA 1F73A 5HNRA 1KFCA 3UXAA 1W5NA 3W9ZA 4DEFA 2CLKA 1YADA 1O5KA 4UUIA 3STEA 2A7NA 1P1XA 4WX2A 4FIRA 2XN2A 3PB0A 3LGEA 3I7QA 1BWLA 3V75A 3CM4A 4FNRA 1Z48A 4AAJA 4Z1DA 4GUIA 2FQIA 2NUWA 1W3TA 3DFQA 3BLEA 4OHQA 4RK8A 3N2XA 1VZWA 1FDYA 1KBJA 3B03A 2J6XA 2PC4A 1UCWA 4DPQA 2QDHA 1XFBA 4JYFA 3H55A 5LHEA 4E2DA 2ALDA 5FEXA 3TNOA 4M19A 2V5BA 4LVBA 3MHUA 4GE8A 3W1LA 4FB7A 1TTPA 2YYTA 4TMCA 3W75A 2E68A 4XUGA 5CSSA 4LS0A 1K8YA 4R53A 3W23A 1PS9A 2ZRZA 3QPZA 1C29A 3GIYA 3G8RA 1NSJA 2Z2UA 3LXCA 1F2JA 3M5VA 1YDNA 3B8DA 1R46A 3RMJA 3P61A 1RV8A 3W7QA 3C52A 5CZJA 5HR7A 5HR6A 5AB3A 3ZS4A 4OU1A 3P81A 3FIGA 3R13A 3AO0A 4C1KA 3S5OA 3PBYA 1WOAA 1B3OA 1D9EA 2ZTJA 5AFDA 3W2JA 1PHQA 1PL9A 3G22A 2ZFAA 3QRHA 3DBPA 3SR7A 4MY1A 3R8RA 3QC3A 4BFAA 1J2WA 4UFKA 3WJXA 3DFSA 3NQDA 1I2RA 1JCJA 3E49A 1OVDA 3G1AA 4R34A 3S1XA 5K4ZA 1WBHA 2CZFA 4L4MA 3T40A 3NQAA 1R2RA 2NZLA 2WKJA 2B7OA 1Q6QA 1TPEA 5U7SA 4N9DA 3CPRA 4BK9A 2ATSA 2I1OA 1FWWA 5H2ZA 1G4SA 1RQEA 3DKJA 4H6KA 4O8RA 2ZZ2A 3NM1A 4OV4A 1W56A 3NQVA 2WJZA 2CFFA 1D3HA 1S3HA 2V2DA 1GYLA 2QJHA 1G4PA 1NAL1 3W1PA 1T0OA 1OFRA 3UY8A 2YCEA 2WNZA 1S5VA 3S1WA 1O94A 3SIZA 2OCZA 5AC6A 4PFMA 3W7OA 3LTYA 3W7HA 5HQEA 3C2OA 3CB8A 2A2IA 5DBTA 2W0UA 3A5VA 3N3MA 5IBXC 2NWSA 1KM4A 3NQEA 3OHIA 1H63A 4YMZA 3MHGA 4Z1AA 3MBFA 4NJGA 4ZMGA 2J9XA 1D3GA 1B9BA 1TV7A 5G4WA 4A22A 4AHPA 1QDSA 3MBDA 3IV3A 3NPWA 2E5DA 2YSWA 1X6UA 3GKAA 3W2UA 3PG8A 3I7SA 1Y0EA 1WQ5A 1HO1A 4JTKA 3GXNA 1XXXA 4MYXA 4N4PA 3C2RA 2GVJA 4LC8A 3W72A 3H53A 3TQKA 4JN6A 2FB2A 5AHFA 2ZRUA 5LNRA 4MOZA 3M41A 4FXSA 3QYQA 2V0TA 4IPIA 4LOCA 2P10A 4WZHA 3M5YA 2QCDB 1C9DA 2ZBTA 4QNEA 3E9AA 1W31A 3G18A 3HO8A 3N73A 4BF9A 4UMAA 2ZTKA 1SW3A 4KFNA 3O06A 2BX7A 1IXPA 1JCXA 4HIBA 1GZGA 3Q2DA 4NNBA 4W9TA 4ADSA 1OK6A 4XKYA 3SJ3A 3KVMA 1AL8A 5BMWA 3CIWA 3EXRA 2E6FA 3MWAA 1DOSA 5KTLA 4IJBA 3QQ0A 4WJEA 3UY7A 4K8EA 2QKFA 3UXDA 4BR1A 3VE7A 1ZALA 4TX9A 4UTMA 3NPVA 3NVTA 2YXGA 2RDWA 2P1FA 4AH7A 2JGQA 1H7PA 4FNQA 4Q33A 1ONRA 2X2GA 3IVSA 4KFOA 1H60A 3NZ1A 2ABBA 5LGXA 2FTPA 2CLMA 3P74A 3BPWA 1WDWA 2CLHA 1ZAIA 5I3KA 1AW5A 1IIGA 2GOUA 3G1FA 1K7FA 1TMHA 1ZAHA 4PODA 2C6QA 5D32A 5C55A 1TRIA 4LS2A 2CZDA 4POCA 3LCWA 3A23A 3EKLA 3MP4A 3A21A 5I3JA 4EIVA 3DFPA 4JTFA 5EA9A 3ZWTA 4FNPA 4DF2A 2Y70A 3P67A 2GUUA 5G1TA 3JS3A 3L5AA 3M16A 2VEIA 1RVGA 2FPTA 3ELFA 3W7CA 3W1AA 1U5JA 1F74A 2GVLA 4MLJA 3TFCA 4UTTC 4JTGA 4Z08A 2GJNA 1M7PA 4CNPA 2TPSA 4IX0A 4CQ8A 3HGOA 4KWVA 2FJKA 1OFQA 3SY5A 2YGYA 5F4SA 5AHMA 4ORMA 2EF9A 4FNUA 3GB6A 4DBEA 4CCCA 3THAA 3TCEA 2KZHA 1LM1A 2HSAA 4N9BA 2G95A 2G96A 3WK1A 5FEZA 2AAMA 2VENA 4RZ4A 4JR5A 3TW6A 2VFHA 2H8XA 2B0MA 3GDRA 4A29A 1SR9A 4DELA 5K7JA 3TA6A 4UTHA 2A85A 2JKPA 1G4EA 4K7YA 3ATYA 4OGZA 2VC6A 4Z1CA 3G1DA 3ABOA 3W7EA 1TCDA 3OVRA 4K8HA 4ADUA 4BWLA 5K3VA 4A2RA 4O18A 3NL3A 4JTUA 5EYWA 5D2VA 4XWUA 1TO3A 2C18A 3W7RA 4MJMA 1OFDA 3TSBA 2A6LA 3MYPA 2W79A 3MO7A 1HG3A 1Z41A 4M7SA 5A8GA 4HN4A 2VXNA 1BTMA 1HUVA 3JR2A 3P7YA 2R8WA 5L9FA 1N55A 3L2IA 3CTLA 1Q45A 4MIMA 3MUXA 4RLIA 3CWNA 1W3NA 1PVNA 3DGRA 2Z6IA 4UTKA 3B0VC 1BKSA 1KTNA 5G2IA 3VNDA 5C2XA 2CU0A 1YDOA 2Y7GA 2QUTA 1GYNA 5KITA 3EXSA 1OF8A 3BGGA 1ZNNA 4PA8A 4NT0A 4IMDA 3NG3A 1MSSA 4NJKA 1EUNA 2YR1A 1P4CA 1FXPA 2ATMA 1XL9A 2X1SA 5D38A 1EUAA 2RFGA 4YWIA 1NFBA 1MEIA 1OF6A 3MP5A 1DHPA 2DZWA 3S5YA 1QFEA 1FWTA 1ICPA 1SO4A 4IPJA 5GVJA 1KA9F 3NQ8A 4JIPA 1VYRA 2ZYFA 1L6SA 1ME7A 1AK5A 3C3NA 1OX5A 3NQMA 3UQNA 2GJLA 3CIXA 4WQ6A 2YFOA 1RQBA 1AW2A 1QPOA 5F1UA 3LCIA 3OG3A 1TPC1 4EVZA 3NGJA 1KLYA 2DZXA 3M1ZA 1XC4A 3QH2A 3CHVA 5D37A 1EIXA 2NX9A 3TFXA 1VCFA 4LRTA 4ZQRA 4ADTA 4M5PA 3MYOA 1H51A 1X1OA 2NX3A 4L4LA 3TE9A 4H4IA 4PEKA 2X1TA 4O15A 2DZUA 3QMTA 4IMGA 1LOSA 5C6MA 4FHAA 4UNKA 3N9SA 1K8XA 1JRBA 3M6YA 3KRSA 3L0GA 5CZTA 2OX1A 3FOKA 3NM3A 4FEZA 2RDTA 3NQCA 3C0JA 1Z44A 3KVJA 3DI0A 3G1VA 5I3IA 1LBMA 2ZRVA 4JX4A 4UTLA 1YDVA 4DF1A 4RX0A 3HGJA 1RR2A 2QAFA 3F4NA 2PE4A 3U8GA 3UNDA 3DI1A 4NVTA 4XKYB 4DBDA 2Q8LA 2WPBA 2HS8A 1X8FA 2H8ZA 4IGHA 3GLCA 4IUOA 3W71A 2OZ0A 3CU2A 4QISA 3VCRA 1SZNA 4UXDA 1VRDA 4EOUA 3M43A 1H7RA 2QAPA 3N34A 3SECA 5HWJA 4ZQCA 3W74A 4WY0B 4NJJA 1TPUA 1L2UA 1IIHA 2QCGA 5CPMA 2QCNA 4DF0A 1TJRA 1H7WA 4RXFA 2V2CA 2A5HA 4ZL1A 3CT7A 2E6AA 2Y7EA 2JK2A 1G7UA 3P60A 1OHLA 2Y62A 5DCBA 5D2XA 3TROA 4AWTA 4O14A 4QITA 4LW7A 2Q3OA 3HJZA 3W1UA 3OVQA 4S2BA 4XBKA 1GPWA 5I3HA 3DH7A 5CPNA 1KM3A 2VFDA 1WYIA 3GX9A 3G1XA 1VHCA 2EPHA 1IF2A 1OJXA 1DL3A 1FDJA 5FESA 3BLIA 3FJ6A 3LXAA 3Q94A 2EHHA 4PCFA 5IBXA 1XUUA 4CNOA 1TPWA 3GR7A 2XFWA 5HUPA 3W84A 4FO4A 1DQWA 2AGKA 5D04C 4AEOA 3PSVA 3DAQA 5FF0A 1U83A 2CWNA 2ZA2A 3PF3A 3QF0A 4TIMA 4DQWA 1C8VA 2J9YA 3CLMA 4PTNA 1EPXA 1EWEA 2GQ8A 3IVTA 3E96A 2BWGA 4JTTA 1FBAA 1XI3A 2YW3A 3IRDA 1G69A 1FCVA 1R2TA 4XTIA 4NZJA 2E5CA 5HWNA 1J5TA 4BI7A 1FCBA 2IQTA 4LUIA 2WSYA 3S1UA 2ZZ6A 3HPZA 1V5XA 5HMSA 3RLUA 2X30A 2QJIA 2GPTA 5DY3A 1SO3A 5D2YA 2Y6ZA 2V9DA 1YPFA 5HJLA 3RNDA 5AC7A 1EB3A 4Q4KA 1A53A 2VFEA 3LLDA 3OBKA 3W73A 3W1XA 3T7VA 4NU7A 4RZ5A 3TQ0A 4MZYA 5AYYA 1B4KA 2DJLA 2B4GA 3E12A 4UMCA 3KFTA 3O6YX 3LDVA 5KZEA 1TV8A 2ZA1A 3UWWA 1LORA 4ZVJA 1LP6A 4IMFA 3QMSA 3FLUA 4JX6A 3LCFA 3TV8A 1IXQA 3TSDA 1SZGA 1M7OA 4MFDA 4OE7A 2D73A 3EX2A 4O17A 1Z42A 1DKWA 1RQHA 1OFEA 1F6PA 2JBMA 3MP3A 4RKAA 1JVNA 2CLEA 1EP2A 3EEGA 1W5PA 5FF2A 4UTJA 1YTKA 1FCQA 5J5DA 2WQPA 3W2KA 2A1YA 2ABAA 1UUMA 3R2GA 1J4EA 3ZFHA 5KZDA 1W5MA 2QUVA 3ABSA 4HNTA 3QPYA 1WAUA 3W7PA 3LV6A 2DJXA 2WSQA 3UWUA 2ZZ5A 3WK2A 4MKNA 4O11A 3BGJA 1YXYA 1QPRA 3NO5A 1EX5A 1GQNA 4JDBA 3TAKA 4MYAA 1YPIA 3TAOA 1F76A 4UTTA 3IEBA 2X1UA 1I2QA 1H1YA 1MEHA 5D09A 3TUUA 1O4UA 3KVKA 1SW0A 3LHWA 3W70A 4FNSA 4HNVA 1FDZA 4LTSA 4O12A 1RD5A 4GUJA 2G97A 3KHJA 5LSMA 1GTEA 2FPVA 2WO5A 1QNVA 1I2OA 3NL6A 3L9CA 3FEMA 3PY2A 2E6DA 3OVPA 4CNNA 2DZPA 1QO5A 3V1PA 3W2NA 4KWWA 2H90A 1FX6A 3LRKA 1S5WA 3A22A 1KTCA 3T78A 1OYBA 2VFFA 4DPPA 2FIQA 5AHIA 3W7NA 1KTBA 2NUXA 1HL2A 3O16A 5EBUA 2C0AA 1GVFA 1VGAA 1W8SA 1SQ7A 2QCMA 4P61A 3NNTA 3FKRA 3UWZA 3HOJA 1LOQA 3G0UA 1B4EA 1OABA 3QW3A 1UUOA 3GAKA 5LGZA 3W7IA 4K38A 4XZ9A 4DO5A 3W3OA 1RPXA 3NEVA 3KVLA 5KINA 1ICQA 3W1NA 2NUYA 5T26A 1SZFA 4KKXA 5DXYA 3P80A 3W07A 3FS2A 1XBZA 1JCMP 1JUEA 2ZCGA 1N8FA 4TU1A 1KFJA 4O53A 3C61A 4Z0JA 5CZSA 4EF9A 3EWBX 4BI6A 1JCLA 4EWND 3TC6A 2CZ5A 1NVMA 4E38A 5F2MA 1WA3A 4PC8A 5LKYA 4FNTA 4MLRA 1PCWA 3I7RA 2PCQA 1SFLA 3HBLA 4M6PA 2NV2A 4JEQA 2VOMA 3UPWA 4GUFA 3F1QA 3DKLA 2RHGA 3LHUA 5DLCA 3PB2A 3EX1A 1P5BA 5K2ZA 3B06A 1YTEA 4UFHA 3PWAA 1T99A 2B7QA 5E1QA 4AWSA 5FF3A 2CLLA 4N6EA 3DU0A 3EWWA 6TIMA 7TIMA 4O52A 1I45A 1JUBA 2ZZ3A 4WUIA 4NUWA 1MO0A 2FPYA 2OMAA 2WNQA 1B57A 3HB9A 5F2LA 1P0KA 2EGZA 5HINA 3LOTA 4RR4A 2F84A 3HGRA 4GRSA 1XDLA 2GQ9A 4MZ8A 4QSHA 4M7TA 4GUGA 3T4CA 2WOQA 3ABRA 1SPQA 3W6YA 1GG0A 4QNWA 3DFTA 1QPQA 1YXDA 1H7NA 4TO8A 5TIMA 3BK0A 3G8EA 1ZHAA 3TXZA 1GVQA 4HNNA 2DZSA 1Q6RA 2Y88A 4N4QA 1TB3A 3HQ1A 1GVSA 1KM6A 3H54A 1ME9A 1JUKA 1W54A 3HG5A 4LVFA 1L6WA 3P82A 4PL2A 3R5EA 4QM1A 3O8AA 4FIQA 4XQ6A 1QCWA 3GDMA 1RZMA 3MMTA 5DELA 1KM1A 1AW1A 3BARA 4UTIA 3IIZA 1Q3NA 3D0CA 3YPIA 4RZ6A 3LCHA 3GNNA 1XM3A 4O10A 4FF7A 3L68A 3IIVA 4IWWA 3QZEA 3STCA 5LNVA 4IMCA 1BEUA 1WXJA 2DP3A 3P5YA 2VEMA 4O0KA 1BWKA 3WK0A 1EEPA 1E51A 1H62A 3C2FA 2OT1A 3GK0A 1R30A 1WBJA 3IVUA 5HWMA 1THFD 3E02A 2QJGA 3W2LA 5C54A 2R91A 2A7RA 4NX0A 4A3UA 4S2CA 1TREA 4RCXA 8TIMA 3EX6A 5I3FA 2RH9A 3PUDA 4RJEA 3EWXA 1DQXA 2ISVA 3UWVA 4UTWA 1OFBA 4BI5A 3OA3A 3EWUA 3U2OA 4LY8A 3M5ZA 2I14A 5KMYA 1G7VA 1WOBA 4AMAA 1W5OA 1SFJA 3L66A 4YL2A 1JQXA 1YXCA 2FFCA 2C16A 2NV1A 1UJPA 3O1NA 3PVFA 3L67A 4Y90A 1AG1O 5H91A 1FUYA 4FX8A 1QR7A 4PH6A 1GOXA 1XUZA 2W6RA 5LZLA 1TPDA 3GXPA 2V81A 3PM6A 1ML1A 3DXIA 2YYUA 2JGYA 3NR0A 1VPXA 5FI8A 1A50A 4LUJA 3QMRA 3C8FA 3LI0A 4WOZA 1GJPA 2PURA 5EKYA 1CI1A 1TSIA 2I9EA 2V82A 3LLFA 3CEPA 3MI6A 4OWGA 2QR6A 4WXYA 1VLWA 4YCOA 1ZY9A 2BSLA 4LT9A 1UBSA 5D30A 1PHWA 1LLZA 3DFOA 1VYPX 3NQFA 3IGUA 4I7WA 5TBOA 1I4NA 2C15A 2V8ZA 3W7JA 1VS1A 2QF7A 4Z0SA 1H1ZA 4NXKA 2FB3A 1JRCA 3HG2A 4MZ1A 3TMQA 3PULA 4O19A 1LRQA 4TMBA 4GXMA 2A7PA 2VEPA 4WD0A 2ZZ7A 5EMUA 3QFEA 1ZENA 1PV8A 2OT0A 2Y63A 4JS3A 4UFLA 3PBWA 2C1HA 2E09A 3NQ2A 3P84A 3NXFA 3W7DA 1T96A 5LNUA 1VC4A 3GDLA 1T8XA 3QQ1A 5KSWA 2BTMA 3LV5A 1DJNA 1ADOA 5G2WA 3N9RA 3NL2A 4WOQA 3L65A 1WV2A 3G1YA 3FKKA 3GXTA 4JGDA 4WXZA 5AOUA 2VEKA 3TDFA 5AC8A 5DBUA 1K7XA 1YTDA 5D2TA 1K8ZA 1TRDA 2C13A 1I2PA 2ZZ4A 1MXSA 3TU9A 1DBTA 3BVJA 2DZVA 2LLEA 5HUOA 1TPH1 3B05A 4IXXA 1GTHA 1GEQA 1HO4A 3OIXA 4GBUA 4JD4A 1SSDA 4BWLC 3GDTA 4E0CA 2J88A 2C3ZA 5CGQA 3F4WA 2B7NA 3NZRA 5F2IA 3A24A 3NOEA 4HHPA 1SO5A 5C5YA 2Z6JA 2VFIA 1G6CA 1KFBA 2CLFA 2QCHA 3QSTA 4WY0F 5E0KA 2YZRA 4JTIA 1SUXA 1V7YA 2V5LA 1IGSA 4MJZA 4HSNA 1IXOA 1ALDA 3N2MA 4U4MA 6ALDA 1O95A 4JX5A 5D2WA 4NNAA 3LBMA 3BW4A 2GQAA 4LU0A 1K02A 3O63A 1L9WA 1G67A 5CPOA 4JNMA 3KX6A 4ONVA 2JKAA 5F4XA 3LBCA 3ATZA 3T44A 2TMDA 3GVGA 4YCPA 3R89A 2E5BA 2CLIA 1A5AA 4NQ1A 3NPUA 1M5WA 4NJHA 1FCUA 3G1SA 1K3UA 1A5CA 4MUZA 1AL7A 5CKSA 3LRLA 4JTLA 5E93A 3LHYA 4LC6A 1KM0A 3GZ3A 1XKYA 2QCEA 1F5ZA 1LRNA 3ZR4A 3S5NA 3VI2A 3TIMA 5TQLA 1NEYA 4QAIA 4M6VA 5AHLA 4ZZ9A 5EY5A 3CEUA 1F05A 3GDKA 3WJSA 1H7OA 3LTPA 2BLEA 3NYZA 1VQTA 5EL1A 4RV8A 3KOFA 5K9XA 3QEZA 2X1RA 2VKZG 1FXQA 4QJ1A 3EX4A 4AB4A 2RDUA 5G5IA 3NAVA 3B0PA 1A5SA 4RXGA 4O0ZA 2Z0IA 1TQXA 3P8IA 1LOLA 4Y96A 4GWEA 1KBIA 3M47A 3O6CA 3UD6A 4N6FA 4UC5A 4NZFA 4JTSA 3I65A 3KRUA 1F7BA 2G5WA 5FEPA 4J9JA 1OYCA 1LCOA 1LZOA 3IGSA 2A21A 3PC0A 1X1ZA 3N14A 3RF9A 3LHVA 3IGXA 2A0NA 4HKPA 2QCFA 5BOOA 2Q8ZA 4K39A 2WNNA 3LTSA 3L5LA 3LB0A 4P2VA 4MPQA 2E77A 1VR6A 5F1VA 2Y85A 2ZZ1A 1ME8A 3NDOA 1LDCA 1TQJA 3W1TA 1W37A 4HPXA 3NA8A 1IXNA 3QJAA 4JYEA 4JIQA 5AHEA 2AQWA 3EKZA 1FWNA 5J5RA 4O54A 2NXGA 4AVFA 3W88A 3A5FA 1QWGA 3W1QA 1JCYA 3PSWA 1KM5A 1SZEA 3ZWSA 3W87A 3GNDA 5DY2A 1W3IA 3L0NA 1R47A 4X9SA 4CCDA 4FX7A 4AF0A 3E0IA 2H6RA 1TV5A 4UR7A 2YFNA 5G2HA 3SW6A 2E1DA 4JY9A 2QUUA 1M6JA 3HGSA 2X16A 1EP3A 3NQ6A 4IX2A 4JYDA 3W1RA 2HTMA 5CPLA 3THQA 3HMJG 4CCEA 2QEZA 1HTIA 3QM3A 3UWQA 3CC1A 3W7LA 4JDYA 1W1ZA 1VJIA 5FF4A 1QAPA 4GC4A 3DENA 4LVGA 3WK3A 3B0UX 1Q6OA 4ZQMA 1AMKA 1QO2A 2BXVA 3W22A 3B4UA 3SGZA 2WSRA 2J27A 3S9YA 1OK4A 4JXCA 1OX4A 3LXBA 1VH7A 3INPA 3A9IA 2DZTA 3M9YA 1L6YA 4ZQPA 4K36A 1H5YA 4UFMA 4YLWA 1GVOA 4K37A 1ICSA 1GG1A 4E2BA 4A2SA 3KRZA 1LYXA 3C2EA 3SGUA 1G4TA 2O7QA 1W5QA 1QOPA 5U4NA 3G0SA 3HG4A 4LRSA 4QIUA 2NXHA 4CLMA 4ZQOA 1GVRA 3B04A 3O6DA 4XBSA 5BW6A 1LBLA 3L5MA 3EWYA 3GR8A 3F03K 5FF7A 4I7UA 5F4WA 5BNKA 3UPBA 3W86A 4OT7A 5SWUA 2ZDRA 1UASA 3TK7A 1PIIA 3BW2A 3CWOX 3RFAA 3EWZA 1CW2A 3TSMA 3VKJA 1OFAA 1FY6A 1TIMA 5D02A 1PE1A 1TTJA 3HG3A 3C6CA 3UZJA 3S42A 3FJLA 1QMLA 2YW4A 4I9AA 3CQ0A 1ZFJA 1LRTA 4N02A 1VYSX 3G24A 3NQGA 3DZ1A 2C19A 3S8HA 5ABTA 5AYXA 4CQAA 4LNYA 3M0ZA 1K03A 1XCFA 4QQ3A 4GJ1A 3BW3A 2HS6A 3DHDA 3UZ5A 1XDMA 2DU2A 3C2VA 1GWJA 3G0XA 3FYOA 3LHTA 4GFSA 3RU6A 5LNWA 4Y9AA 3TR2A 5AHNA 1FWRA 2TSYA 2TYSA 3WJZA 3OEXA 1OFPA 4AWUA 4JTJA 5K9CA 2ISWA 3HF3A 3WJYA 3W83A 3RLVA 1KLZA 3LRMA 4GUHA 2A6NA 3PR2A 4HNUA 4O1BA 4X2RA 4DXVA 4X22A 1DORA 2VELA 4S1FA 4R7JA 1WX0A 5CSRA 4WY0A 1KM2A 3TMLA 5F2GA 2FDSA 4IOTA 5K9DA 4O16A 3S1VA 1KV8A 4Y8FA 4B5NA 1OYAA 3SZ8A 3T55A 1VHNA 2Z1BA 3BG9A 4ICNA 2PRMA 1ZCOA 2ZA3A 3M5XA 4DO4A 1QOQA 4UMBA 4AXKA 2UV8G 4Z1BA 5EPDA 1Q6LA 1DJQA 3BO9A 1OX6A 3W2MA 2CW6A 1JCNA 1FQ0A 4K6AA 3TJXA 3FYPA 3TJLA 2A4AA 3NQ7A 4O13A 5CZ0A 4LWWA 1JJKA 1I8JA 5G1YA 3U6WA 3LCXA 1EP1A 5LHFA 2Y89A 3IIOA 3IIPA 1VLIA 1SU5A 2Q3RA 3LHZA 5D33A 2JKEA 1LBFA 3SSJA 1TJPA 2NLIA 3MI3A 2R14A 1OFOA 4N9EA 1O60A 4HT3A 1JQVA 3LCGA 3QSRA 3ANYA 4NXSA 3UYCA 2PRHA 4PL1A 2DORA 3C56A 3S5ZA 3I68A 3STGA 4A21A 4OV9A 3LM7A 4LVDA 5DXXA 3GKFA 5CG7A 2YDAA 3VFLA 3TW7A 3W76A 5DCEA 4LVAA 3LI1A 4LV9A 1TPFA 3USBA 4M6QA 3I6RA 3G1HA 4IXHA 4O4VA 3P8JA 1TPVA 3STFA 4OBTA 2ZQ0A 2ZRXA 4IMEA 3P5ZA 1DV7A 1NF7A 4UNLA 2BZNA 3DFNA 3BG3A 1TPB1 4G1KA 4TR9A 3W7KA 1VCGA 4O4WA 1NF0A 3O05A 5I3GA 4YXGA 4H3DA 3BG5A 3LERA 2QCCA 4AF0B 3PUEA 5AYZA 3LCLA 2V2HA 2ZRWA 4O28A 2HMCA 3IIXA 4DO6A 5D05A 1H7XA 5A5WA 4ALDA 2EAWA 1O5XA 4FX6M 3S0CA 3O15A 1N7KA 2EKCA 4AHQA 2YPIA 3PUOA 3MW7A 3FA5A 1R2SA 4OQVA 4AHOA 4FXRA 4C1LA 1JULA 4XTDA 3C4UA 4R33A 3SFKA 4O1AA 3LX9A 4NJIA 3JRKA 1PCKA 4I7VA 3GAYA 4LS1A 4LV4A 2VFGA 1W0MA 3PAJA 1CX9A 4N2YA 4O1DA 1OX4B 1KV5A 3G3DA 2CLOA 3MJYA 5BMXA 1SW7A 2OJPA 3EB2A 3W85A 4JTHA 1F6KA 3VE9A 3EX3A 3PBVA 4CQ9A 4EF8A 1P0NA 3PS7A 3Q37A 3L21A 2CZEA 4KFPA 3DHFA 4U28A 1OG0A 1SO6A 4D2JA 4ZQNA 2WV8A 3R12A 1K7EA 1GT8A 3HPXA 2O7SA 1H61A 2XN0A 1SSGA 4UCGA 3PBUA 3KAOA 1DVJA 3HPSA 3GYEA 5D03A 3M44A 1ZJIA 2QCLA 5IM51 4X3ZA 4NNCA 4GNJA 3KXQA 1KW1A 3K30A 2FLIA 2QDGA 1EWDA 1HFBA 1TTQA 5DN1A 4Y6GA 1TTIA 2E6YA 5BRBA 3FFSA 2ISSA 4MY8A 4O1CA 3TX9A 5K4XA 4UFJA 3S6DA 3EXTA 1KFLA 1UB3A 2C14A 5G4EA 3M7WA 2V30A 3RK8A 3L0KA 4JY8A 1XBVA 1LTDA 3W7GA 1FWSA 3P62A 5FEWA 3NL5A 3O07A 4K7VA 4N9CA 4JTEA 1MEWA 3HIJA 3PG9A 2ZRYA 2PRLA 1LROA 4ORIA 5HULA 2Y7FA 4MY9A 2QCDA 4MFEA 3QW4B 4ML9A 1QPNA 4UFIA 1ZAJA 2XN1A 2YX0A 1VCVA 5L6UA 5DCDA 1S5TA 4O50A 2NWRA 2H3BA 1KFEA 5KZMA 3MI2A 2NX1A 1A5BA 2TRSA 1YYAA 2H3DA 4UIOA 3UWYA 4UTWC 1I2NA 3TKFA 1KFKA 4IQLA 4UR8A 3WFAA 1JR1A 2GVGA 3ABQA 2R94A 3SI9A 3TXVA 3TC7A 2Y7DA 3AJXA 3G3MA 1XBXA 3W1MA 1XBYA 2J24A 2F7FA 4MVAA 2B7PA 4Q32A 1MZHA 3N19B 4HSOA 5MHBA 3Q58A 3BV4A 2NXIA 2RKXA 1EA0A 1TYGA 2J9ZA 3NPXA 3TH6A 3W7MA 3TQVA 1X7FA 3WJWA 4JICA
chains in the Genus database with same CATH superfamily
3LZ5A 1A3WA 4NX5A 5DRCA 2P0OA 3JZUA 2FZBA 2BP1A 2UY5A 4KS0A 1KD0A 4BA0A 1DEDA 2F2HA 1PIGA 4OBRA 3GTFA 3B0XA 1ZBKA 4S3DA 4WX2A 2XN2A 3I7QA 2XSBA 1Q4WA 4S3FA 4FNRA 1S1PA 3H22A 3SCOA 4Z1DA 1HGWA 5A2CA 1EA9C 2FQIA 1W3TA 3ZT5A 3N2XA 4MB5A 1FDYA 2YIHA 2EPNA 2PC4A 3DDMA 1RA0A 4DM2A 2PTYA 4DPQA 1OCNA 2MUCA 4E3TA 2ZX8A 3SRDA 4AD2A 4C6FA 2YOCA 1H1NA 3CL7A 4R5EA 2ALDA 1E0VA 2PU0A 3W1LA 4NL1A 4GY1A 2CKRA 5ENLA 2E0PA 2IKJA 1K8YA 4R53A 3W23A 3PPFA 2DZBA 1QATA 3F7JA 3LXCA 3GU2A 1JIBA 5IOBA 1RV8A 1R3SA 3FIGA 5BXPA 3AO0A 2X7WA 4S23A 4JFUA 2I5QA 5AFDA 4H8NA 3W2JA 1PL9A 2ZFAA 3R8RA 4NZ4A 3NQDA 1I2RA 2VM8A 3E49A 1V3LA 5K4ZA 1E4NA 1ENUA 1FWFC 3LNMA 2PLCA 1W1VA 1R2RA 4HTYA 5FL0A 3USZA 4DZAA 4RZBA 4BK9A 4AZIA 1IR1A 1G4SA 7XIMA 3UR2A 3NSXA 3FDKA 4H6KA 1H41A 2DFAA 1LT7A 3RPTA 2CFFA 1S3HA 2O4QA 4PSPA 2WLZA 1RPKA 3W1PA 3KHDA 4IISA 2Y5EA 4J27A 3VNJA 1OFRA 3UY8A 2Z26A 5A6TC 1J96A 3KBSA 5AYIA 3C2OA 1J10A 5CEWA 4QLLA 3OHIA 1H63A 2HK0A 4YMZA 3R7MA 4HU8A 3MHGA 1AQFA 5BU9A 4KCWA 3GTHA 5G4WA 1HKVA 3SRFA 1QDSA 1UR1A 3ITYA 1ONXA 3AHTA 1VEPA 3BE7A 4PUUA 2E9BA 1E4LA 1XXXA 4GQRA 2W4XA 1B3XA 1Z89A 2GVJA 4IP7A 2QDEA 3H53A 3TQKA 4PN2A 4ECLA 4REQB 5ABFA 5AHFA 2ZRUA 5LNRA 4AU0A 1PZ1A 4MOZA 4A35A 4FXSA 2BFGA 3ZR6A 2QCDB 3FK4A 3GVQA 2ZUTA 3QC0A 1JGIA 3N73A 4BF9A 4DJED 1SW3A 1UC4A 4KFNA 5DMNA 5A2BA 1HKIA 4HIBA 1DP0A 2Z24A 3O3RA 3OP2A 4DJFD 2R1PA 5I24A 4ZOBA 1W9UA 3SJ3A 3WNPA 4E8DA 3WQPA 3EXRA 3M0YA 2WSKA 2WM0A 9XIAA 4WJEA 3UXDA 1G9HA 3N1AA 5REQB 3MS8A 2WC7A 2FKPA 3CUZA 2P1FA 4UR9A 3GTXA 1ONRA 2GWGA 4Y7EA 2ABBA 3T4WA 3EA1A 3P74A 2OEJA 2PU1A 1AW5A 1XIJA 1JZ6A 3RAOA 5C9ZA 3OGSA 1AD1A 3KLLA 1ZAHA 2C6QA 3ARRA 5D32A 4MM1A 4LS2A 4PTXA 2IS7A 4YYFA 3A23A 1FKXA 5FJOA 4EIVA 1DJWA 1E5NA 4JTFA 3ERPA 1FWJC 4FNPA 2VX7A 5C9XA 4PUNA 3P67A 4PCPA 5G1TA 4YVXA 4C6JA 2VEIA 2FPTA 3H7UA 3BAWA 4IMAA 1CDGA 1F74A 1U5JA 5HNNA 1MUWA 4MLJA 4N0RA 1REQB 3MSYA 4UTTC 4Z08A 1M7PA 3K4AA 1Q63A 2C79A 2FFIA 1DIDA 1OFQA 5F4SA 3WQCA 3GB6A 4IIEA 3MUAA 4N9BA 4GYPA 4D6CA 2JE8A 2VENA 4H9YA 4JR5A 2H8XA 1P48A 3KCLA 4BJHA 4DELA 3F2BA 2XPKA 4AZCA 1G4EA 4WGXA 2XGZA 4PSRA 3QHOA 2VC9A 3TYZA 1ELSA 3OVRA 4IP4A 1KO0A 4BWLA 4A2RA 4O18A 1R6WA 4UQBA 2QUNA 3WNMA 1OFDA 3QGAC 2BY3A 3KCJA 1W1B1 4WDWA 4M7SA 5A8GA 4FOKA 4BQ5A 4PE8A 1HUVA 4K3ZA 1QPKA 5L9FA 5CPSA 3ID7A 1AQMA 1WUFA 1I1WA 1R3WA 3IJQA 2J7DA 2P3ZA 5ABEA 1KTNA 5G2IA 3MVIA 2CU0A 1SFTA 4NZ5A 4IQDA 4KCUA 1M65A 1YDOA 3SADA 1GYNA 5KITA 3PBGA 3TW9A 2C7FA 3WSUA 5PTDA 4LYQA 5HMEA 4NT0A 1NP0A 4NJKA 4XIMA 4JFTA 1KGUA 1EUNA 1ZPTA 2Y2WA 1K1DA 2YR1A 2W63A 4JKKA 1FXPA 3U0HA 3W53A 2X1SA 1KQZA 2RFGA 4J7RA 4YWIA 1NFBA 1OF6A 3MP5A 5C0QA 1ICPA 1SO4A 1ZJBA 5GVJA 2Z1SA 5HJYA 1VYRA 2VP8A 2ZYFA 4DJDD 4B16A 2V38A 3CIXA 1VEMA 2XWDA 1C8QA 4BQ3A 1Z9AA 2ZC1A 2DZXA 3CHVA 3TFXA 4LRTA 2ZWZA 4CVWA 3MYOA 1R3RA 5HQMA 2NX3A 1V93A 3GWQA 1VD6A 4PEKA 3KOWA 2DZUA 3WUGA 1P6BA 3R8HA 3TQPA 2ZE0A 1CGWA 3E6EA 3V35A 2PF8A 1ZJHA 3G1VA 1LBMA 4L1WA 2ZRVA 4H9ZA 3VCNA 4RX0A 2ACSA 2WC3A 3K4WA 1XSKA 5CC7A 3F4NA 4ZFCA 4EACA 3DI1A 4NVTA 2D3LA 3OB8A 3S3GA 1BGAA 3TWAA 1TR1A 3GLCA 2GJRA 2GOKA 4IGNA 3VCRA 4KRUA 3ZYZA 1SZNA 3B97A 3MUZ1 4EOUA 3SECA 5HWJA 2OOFA 2DV0A 4HK7A 4XAYA 5IHRA 1YHTA 1QOXA 1MRAA 4FMVA 4NJJA 1L2UA 1IIHA 1H7WA 1BXBA 4RDWA 2DUXA 1UROA 3P60A 1UP2A 1V7AA 2WZMA 4EPDC 4YJ5A 5M1TA 1FH9A 4AWTA 2ONEA 4O14A 1QW8A 4W7WA 2WMFA 2GDVA 4Q22A 1U1JA 2VFDA 5CJMA 4EAMA 3KOZA 4IIGA 2EPHA 4A8LA 3K8KA 1P1MA 3DYOA 4IJCA 4M8UA 4JTQA 4Q8VA 1DPMA 2GYIA 4PCFA 1XUUA 1TPWA 1V02A 3GR7A 3UEQA 1KB3A 3IJ8A 1W1YA 1QI4A 2XFWA 4MSSA 2E8ZA 4V28A 5DO8A 2AGKA 4AEOA 1MW3A 1OD0A 1EOKA 1YQ2A 3QF0A 4DQWA 3KDNA 2J9YA 4NZCA 3QY7A 4AY8A 2J25A 4PBFA 4JTTA 1NTHA 5CZKA 5CBBA 3VKDA 3IRDA 5A2AA 1XKJA 3KTCA 1R2TA 1OQFA 2E5CA 3AROA 1T5AA 1TJ1A 3QGVA 4BI7A 3S47A 2IQTA 4LUIA 4G56A 3UF9A 4YVPA 1V5XA 1DJIA 3BGAA 2BVDA 2GPTA 3MCNA 4W8BA 4RPPA 3W02A 2E1WA 2Y6ZA 1BF6A 1L2QA 3QBUA 1YPFA 4H7ZA 3SCWA 1EB3A 3SN4A 5XIMA 2VFEA 1EFZA 3T7VA 3M0MA 3WNOA 1JGMA 4NU7A 1GUVA 3WQEA 4RZ5A 3TQ0A 4MZYA 1B4KA 4HZ8A 4A3HA 2B4GA 3O7UA 4UMCA 3S9ZA 4AISA 2ZA1A 4GH1A 3VIGA 3RLHA 1JXJA 3QZ6A 3L4ZA 3FLUA 3TV8A 3HPAA 1UIPA 3TSDA 1I60A 1SZGA 1M7OA 2D73A 4WDTA 1OFEA 2O9PA 4P7QA 1X96A 3MP3A 2GUYA 3SCUA 1YE4A 3WMCA 1FRBA 4AZBA 1WP6A 1KXQA 4CD4A 4WJXA 2WQPA 1XIDA 4MWAB 3ZFHA 1XQKA 1UWRA 3Q4DA 3LV6A 1IT8A 3UWUA 2ZX7A 2I56A 4QE1A 4O11A 3ZT6A 1WCGA 2VVSA 2Z27A 1EX5A 1GQNA 3IJDA 2W91A 2DDXA 3U4AA 3MY9A 3IEBA 3BAIA 3FCPA 3LYEA 2J7FA 4EX4A 3KVKA 4ZSTA 1EOMA 2W9MA 2PDMA 3LHWA 3TONA 3W70A 4M80A 4HNVA 3KEHA 4LTSA 1W9DM 2Y8VA 3ZVHB 4GD0A 1QNVA 1I2OA 2WZHA 2XZ7A 1GKPA 3PY2A 2AQVA 3HMCA 3CH9A 2DT2A 3NIYA 3EPOA 1KTCA 2VFFA 3ONBA 4DPPA 5F7UA 2YA1A 3LSCA 3WFLA 2XM1A 1W1TA 3SCRA 3E5BA 1GVFA 1W8SA 5IFPA 3NNTA 3HOJA 4QCFA 7PTDA 3G0UA 1B4EA 1UUOA 1VPQA 2HK1A 3K1DA 3PTDA 2PP1A 1ICQA 2CETA 4DWSA 3W1NA 2HBVA 5DXYA 4D6FA 1CLVA 1XBZA 3UG3A 2PDCA 3MDWA 2ZCGA 3EOEA 3W37A 4QAWA 4TU1A 3UZYA 2XFFA 4V15A 5CZSA 4BI6A 2CZ5A 1NVMA 2VT0A 4ZOCA 4US6A 4B3ZA 1K70A 3ANVA 4FNTA 1Z69A 3I7RA 1ONWA 5HMDA 1ZQ5A 4QE4A 4GUFA 3F1QA 3DKLA 4ACZA 1SJBA 2RHGA 3RR1A 3OW1A 2YCLA 3VX0A 3POHA 4D8ZA 3PWAA 1ZSXA 4R85A 3AHYA 3DU0A 3GXDA 4D8LA 2ZZ3A 1J0JA 1J12A 4NUWA 2OMAA 3VOCA 2J8GA 2WNQA 1MXDA 3OBAA 4LUSB 1J0ZA 2EGZA 3LOTA 2GQ9A 1F3TA 4MZ8A 4QDMA 1QI3A 4GUGA 5EGRA 2GK1A 1SPQA 4KERA 4QNWA 3DFTA 1QPQA 4FZIA 4DUOA 1XWYA 3BK0A 1HT6A 3GY1A 5BOFA 1GVQA 1E73M 1AUSL 3KZSA 3VC5A 5CC5A 1TB3A 1ME9A 4LAOA 2VQTA 3HG5A 3L23A 3FXYA 3R5EA 4QM1A 3VMPA 1QCWA 2EPMX 4WLCA 1KM1A 1GCYA 3DECA 3K5XA 1Q3NA 4UBPC 4RZ6A 2OYLA 3LCHA 2C71A 3R11A 3V1HA 4H9VA 1E9IA 1XM3A 2ZVIA 4O10A 4IFOA 4U33A 3QZEA 1VB9A 3NO1A 2GJXA 4PMUA 2OZTA 5LNVA 4AWEA 4I5XA 1E70M 3P5YA 2VEMA 4O0KA 3TTSA 3WK0A 1XV8A 4R88A 3C2FA 4NASA 1GNXA 3GK0A 1WBJA 1VFUA 1OB0A 3W2LA 1ISXA 1JPKA 1B5TA 5LIWX 1E1CA 4DLFA 4S2CA 2J77A 3UR8A 1IEIA 3W4RA 3A3WA 3PUDA 1I6NA 3ICJA 2ISVA 4UTWA 3ITOA 2PWFA 1TR9A 2HPIA 3VOFA 1G7VA 3CUXA 4NRSA 1WOBA 1SFJA 4N7QA 1X6NA 1JQXA 1Z3NA 3PVFA 3PZ9A 3ITVA 2OLHA 2RGMA 3P3BA 1TPDA 1ML1A 3CZEA 3DXIA 2YYUA 4JCLA 1A50A 3C8FA 1GK8A 4I9TA 1Q6CA 3FYYA 1CI1A 4E4PA 3QKZA 4H9UA 1Y5XA 4HN8A 1MFVA 2QR6A 1PYMA 1ZY9A 4LT9A 3GHSA 5EFFA 1VYPX 8XIAA 1Z32X 1I4NA 2PWEA 2V8ZA 3N4AA 1VFMA 3AWNA 4GY7A 2ZIDA 2FB3A 3HG2A 1DIEA 3TMQA 3H26A 3PULA 4O19A 2Z1VA 1K9DA 2RAGA 4GXMA 4WD0A 4HOXA 5GJMA 1R87A 4J3TA 1XF0A 4BEQA 1YBQB 5EMUA 2GSHA 5E70A 1FWBC 4A6GA 1ZENA 1GOKA 2OT0A 4ZO9A 2CHRA 3PBWA 1RXOB 3P14A 3AS3A 3EDDA 3NQ2A 3UG8A 3KTSA 3I6EA 1E6PA 1YX1A 3GDLA 2Q01A 3GH4A 4PMYA 3RDKA 2BTMA 3LV5A 1DJNA 4AG0A 3SBFA 1S1RA 3A9BA 1WB0A 2VEKA 1Q6EA 1TWIA 4AIEA 2ZZ4A 3WQDA 3TU9A 2BY2A 3VILA 3B05A 1QT1A 2CBVA 2OGYA 4JD4A 1Y65A 1SSDA 4C6DA 2F6XA 3PZUA 2J88A 1XLAA 5LYRA 2BODX 3A24A 3ABXA 4QS6A 1FWGC 4JFVA 1SO5A 3TTQA 2VZSA 3RITA 3TCSA 3H12A 2PGWA 2CLFA 3K46A 4JTIA 3VO0A 2HZGA 4MJZA 1MMFA 1JYNA 3N2MA 1QNOA 2WZEA 3PZIA 3WBYA 4CD7A 4LU0A 3WLQA 1MVYA 3D46A 4NZ3A 3P6LA 1HIZA 1BG9A 4HMNA 5CPOA 2WANA 3TN5A 4ROPA 5F4XA 3LBCA 3T44A 3PZVA 1Q7MA 3GVGA 4XZWA 2WMIB 3UCQA 4GGBA 3BLKA 3UW6A 4NQ1A 3NPUA 3GNOA 3WL1A 3CUGA 3ME3A 3G1SA 2OQHA 1BVWA 3F5LA 5E93A 4GVFA 1KM0A 4DAFA 1F5ZA 1LRNA 1GQIA 2QVNA 3T07A 3S5NA 4NYYA 3R0DA 5FJIA 4MWAC 4JFWA 4ZB5A 1NEYA 4NP7A 1TX0A 3RLGA 4AZCB 2D23A 2BLEA 1VQTA 3MSDA 4GZIA 3KOFA 5K9XA 3ZZ1A 2VKZG 1FXQA 3EX4A 3OLDA 5G5IA 4F2UA 4KH2A 1A5SA 4RXGA 4O0ZA 4R9XA 4HMDA 3P8IA 1LOLA 1AQHA 1E40A 3M47A 5M5DA 1X39A 3UGVA 4LYKA 2PC8A 4UC5A 3KRUA 1RA5A 2G3NA 3U48A 2P8CA 2PB1A 1OYCA 1LCOA 3IACA 3U2EA 2A21A 2R1KA 4JIRA 3IGXA 2A0NA 2QCFA 2OU4A 3LB0A 4A3QA 4GJJA 1ME8A 1LDCA 1TQJA 1W37A 3RHGA 4HPXA 4DJDC 4XZHA 1ZLPA 3NA8A 1JDDA 2P76A 3KWSA 2AQWA 2PDJA 3EKZA 3LG3A 5J5RA 4AD5A 2DIJA 4OUIA 3QY8A 4ERIA 3A4JA 3E0FA 4TVCA 2PLMA 2XGIA 1JCYA 3TTEA 1KM5A 3W87A 3GNDA 2PLKA 3NEHA 3C0SA 4C1NA 1IEQA 1NH6A 4X9SA 1AFSA 1HXJA 2H6RA 2GVEA 5G2HA 2CXGA 3SW6A 2E1DA 3K1GA 3UVAA 4MF4A 1GOMA 4PR4A 2DIKA 4Q8MA 3PPGA 4CCEA 1HTIA 1RAKA 3QM3A 3WELA 2XFYA 2QIWA 2ZUNA 5FF4A 1VJIA 3BLPX 1EH9A 3SGZA 4CD8A 3S9YA 1BF2A 3INPA 3A9IA 1L6YA 2VOTA 3QLLA 1RHCA 4XISA 4H8UA 1H5YA 1RP8A 4TTUA 1QHZA 4K37A 4A2SA 2CKSA 1KFWA 3GQYA 3SGUA 3T0CA 1W5QA 5U4NA 1NDZA 2ZXDA 2NXHA 1Q13A 4CLMA 3NO3A 1GVRA 2Q09A 3B04A 2X41A 1CGXA 5BW6A 3B8VA 5FF7A 4O0QA 2YXOA 3UPBA 5GJNA 4OT7A 6XIMA 5I03A 5SWUA 1PIIA 4B5VA 4HBKA 2F8QA 3LPFA 4NAFB 1OFAA 1TTJA 2ALRA 2EQDA 2XIMA 3AYVA 1MDLA 2XH4A 4XX6A 2YW4A 2YL9A 1Q2RA 1W1A1 3LBOA 1ITXA 1LRTA 1VYSX 3G24A 1Y5VA 3REQB 1B0IA 4LNYA 3W27A 4FS9A 1LQ0A 1EHNA 4G5DA 4IHCA 1W32A 2HS6A 3DHDA 3WYZA 3UZ5A 2PDQA 3U9IA 2D20A 2KAUC 3TR2A 2TYSA 3WJZA 4AWUA 4JTJA 1AH4A 4XSMA 1I9CB 2A6NA 3PR2A 3RG6A 4X2RA 2D0HA 4X22A 4RW3A 3M07A 1KM2A 3AISA 1NFGA 4JOMA 1RK6A 4NILA 1UG6A 4J4KA 1IHIA 1EC8A 1CGTA 3VIFA 2Z1BA 2Z1KA 3UPMA 2WCSA 1UH3A 1ZCOA 2Z00A 4DO4A 3BOFA 4AXKA 4XD4A 2E28A 3CMJA 4Z1BA 5I00A 5EPDA 2YB1A 1XLCA 4F4RA 1JZ2A 4K6AA 4ZB0A 3UVIA 4QDWA 2BVWA 1OG6A 3KE0A 5G1YA 3U6WA 3H7RA 1EP1A 5LHFA 3LQLA 2Y89A 1UD6A 3IIPA 4YYCA 2JKEA 3VCCA 3UP8A 4HP5A 4TQTA 3KBJA 3MI3A 2R14A 4GX8A 1OFOA 4JHMA 3RUBL 3VGFA 1HKMA 2E9MA 3ANYA 3LCGA 4NXSA 1BWVA 2YL5A 2VZUA 1WZMA 3VDGA 4UB9A 2E7FA 2DORA 3EWDA 3EEZA 3GKFA 1GVEA 3VFLA 1UZ4A 4C6NA 4LV9A 1EHAA 4M3PA 3N6HA 4M6QA 4EKJA 3RILA 5BXTA 1UW9A 4PUDA 2E4TA 3ZSSA 1PZ2A 1PIFA 2JF7A 2E25A 2X7VA 4Z2IA 1NF7A 2BZNA 3BG3A 1E4MM 1CB7B 3EOUA 4O4WA 3V7PA 3WN6A 5AVHA 1X1NA 3B3DA 3LERA 2AMXA 3ARWA 4YS1A 4HTBA 3BUVA 2ZRWA 4O28A 5KETA 2TODA 3EOSA 2PMQA 3M4HA 3KS6A 4ALDA 1KBLA 1S5NA 4IIFA 4IG2B 1QHPA 4GH3A 3SQSA 5E6ZA 3MW7A 4Y9NA 5IRPA 3ORWA 4C1LA 4XTDA 4P7LA 4R33A 3CJPA 4O1AA 2X1IA 4NJIA 1PCKA 3KLKA 1ZBCA 4LV4A 3PAJA 1CX9A 4O1DA 5IHSA 5BMXA 1SW7A 2OJPA 1JI2A 4PCNA 3RN6A 2PP3A 4JTHA 3MKCA 3VE9A 1RJRA 3EX3A 1LWHA 3Q37A 3DHFA 1PXGA 3VU2A 4PULA 1D7KA 3HV9A 3IUIA 1GT8A 3HPXA 1TCMA 3RM8A 3PBUA 1BRLA 3HPSA 1VRXA 5D9OA 3V0SA 1UKPA 2QCLA 1O7AA 5IM51 4XUYA 4QFUA 3ARPA 1TA3B 1EWDA 5GNZA 1TTQA 1WKYA 2E6YA 3FFSA 2XZ9A 7A3HA 4UFJA 4PCTA 3D6NA 4JQ3A 2OO0A 4YIWA 1PWMA 4DN1A 5K4XA 4MPKA 3EXTA 3ZIZA 1KFLA 1GYMA 4P8UA 2C14A 3M7WA 1XBVA 2BVYA 3HJEA 3W7GA 1FWSA 4DI9A 1S46A 3TZNA 1LL6A 1MEWA 3N2OA 3HIJA 4DO7A 4ACZB 2ZRYA 2P5NA 5HULA 4ZB2A 3WD4A 4MFEA 3GBDA 1QPNA 5IDZA 2YX0A 4XD3A 5L6UA 1S5TA 1IZKA 3LM3A 2QLYA 2H3BA 1KFEA 2V5KA 3EAUA 4ZGYA 1Q6DA 2TRSA 5J8LA 1NELA 3UWYA 3EBVA 1JR1A 1T41A 4Q7BA 3TC7A 3VXGA 1E6SM 3OTRA 1R9ZA 3GFZA 4G1NA 2H9AB 4LUYA 4B15A 3O0FA 2F7FA 3N2BA 4MVAA 4J5NA 1MZHA 1POJA 1TYGA 1UR2A 1YE6A 3U5YA 1J0KA 3NPXA 4F0MA 3TH6A 1X7FA 2DSUA 3VIKA 3MHFA 3N12A 3A3HA 3H2EA 4JTRA 1SFSA 4HPJA 1F73A 2HE5A 3TN4A 2PDKA 1V0MA 3UXAA 4DEFA 5BRPA 1MUMA 1YADA 1O5KA 3BXWA 4AW7A 3GUWA 2A7NA 3QHNA 1MW2A 1P1XA 4FIRA 1UZHA 1GOIA 4OFCA 1WZKA 3NUKA 2G0WA 1XGDA 4EXAA 3WH9A 3AMKA 1GHSA 4AAJA 3GG8A 4IJRA 3LMZA 2NUWA 3BURA 3DFQA 4L1GA 3WF0A 2VR5A 1Q7QA 4RK8A 1PB0A 1KBJA 1MNSA 2D2HA 2WWDA 1HL8A 3BJTA 2VUYA 3LUTA 3RX3A 4D6DA 1AD4A 4K1GA 2QJJA 4M81A 3IRSA 4NF7A 4E2DA 3EWCA 3KOYA 4M19A 1KQYA 3UXIA 4GE8A 3G5EA 2YYTA 4TMCA 3W75A 2E68A 4XUGA 5CSSA 2OSWA 1PS9A 2ZRZA 4EP8C 2WHLA 3UJFA 3AALA 3G8RA 2J8FA 1B3WA 5FACA 4B5TA 1ZZMA 2Z2UA 1EQPA 1LQAA 1IT7A 2GSJA 1CGVA 1XFCA 3P61A 5HR7A 5HR6A 2NW0A 1CXKA 5A3HA 5AB3A 2QF8A 3ZS4A 1G0CA 1WXZA 5BROA 2AKMA 2Q6ZA 3FAWA 3R13A 4C1KA 3PBYA 3PJWA 4OTKA 3DBPA 3SR7A 4MY1A 3QC3A 3V0UA 2ZX5A 2ZX9A 1TE6A 1OVDA 4R34A 3TN6A 3T40A 5A6BA 1XIIA 1M7XA 4HQVA 1FWWA 1C7TA 1TMQA 1FHLA 3DKJA 4B4HA 4QSFA 2V5CA 1V51A 1GKRA 3NQVA 1GVIA 2VNCA 2V2DA 1GEHA 1EZ2A 1G4PA 1NAL1 1JD7A 1XLHA 3AYSA 2A3BA 5C9WA 2WNZA 2OYMA 1S5VA 1V6YA 3SIZA 5AC6A 3W7OA 5FAGA 1PWLA 4KRTA 3RRXA 5DBTA 4PBEA 2W0UA 3A5VA 3SCTA 2HEJA 3MMWA 4NJGA 4ZMGA 2J9XA 5JBEA 3WEOA 1RLCL 3URAA 1WKFA 3ZVIA 1O66A 4A22A 3NPWA 2OTDA 5B7ZA 1WDPA 4M24A 1VIZA 3PG8A 2OEMA 1Y0EA 3CAVA 1U30A 2OLSA 4JTCA 4LC8A 4F0KA 4JN6A 2FB2A 2E8YA 1JAKA 1EF3A 3M41A 3QYQA 2JFEX 2V0TA 4HYWA 3M5YA 4ICCX 1C9DA 2VHLA 3E9AA 4DY1A 4Q4MA 1W31A 2R6OA 3WNKA 4K2SA 4GVHA 2BX7A 2DH2A 1JCXA 4NAEA 5CJ5A 2YCIX 9XIMA 4XKYA 3KVMA 1AL8A 4C6LA 5BMWA 1XIHA 3W82A 1V6UA 3QQ0A 4K8EA 2QKFA 3NPVA 2F9RA 2YXGA 1C93A 3KBMA 3RCYA 5A94A 5J04A 4AH7A 2JGQA 2L5HA 4KEVA 2BV9A 4Q33A 3IVSA 5CPTA 2NQZA 1B2YA 1H60A 3NZ1A 1D8WA 4H9TA 1XW8A 3VIIA 4C60A 4C7DA 5I3KA 3TNBA 4WSJA 3BC9A 5C55A 3SSZA 4X63A 2CZDA 2WHJA 3LCWA 3MP4A 1SM9A 4E8GA 3ANUA 5EA9A 3ZWTA 4DF2A 5DQPA 1S38A 3L5AA 3RO8A 1K77A 5A8QA 4JTGA 4Y8EA 5HPCA 2PGFA 2X09A 4C6CA 2QQ6A 1W1PA 1TVLA 3PWIA 4CQ8A 1Q65A 2FJKA 4HJFA 3SY5A 1K4HA 5AHMA 2W61A 4ORMA 3RX2A 2QS8A 1EJRC 1RY0A 3TCEA 1B3ZA 2KZHA 1LM1A 3T2QA 1XQLA 2G95A 2G96A 4HU3A 3SCNA 4HNOA 5FEZA 2AAMA 7REQA 3TW6A 3GO2A 1NU5A 2GGIA 1RALA 4A29A 4HA4A 1Q7ZA 5K7JA 3WNNA 3CV2A 4FLRA 1EGZA 3DUGA 2WC4A 3FW6A 2B81A 1TCDA 3G1RA 3RMEA 4HD5A 3UYIA 3FA4A 4OKDA 3RPMA 2CZVA 4KCTA 2C18A 2ZUWA 3W7RA 3K13A 4MJMA 1SJCA 2VZVA 4I90A 1R7AA 3QPEA 1E0UA 2IPGA 2QPUA 1O12A 3MYPA 2JQXA 3BLLA 4DWSC 4HN4A 1BHGA 3JR2A 2R8WA 3TLLA 1N55A 3XINA 4LJ3A 4AIOA 3ABZA 3HA1A 2VC7A 4RLIA 4D71A 1RJPA 1WPCA 3AFBA 4Q4QA 4UTKA 3B0VC 5CGTA 3VNDA 1XJBA 1P0BA 2XHYA 2XFRA 1P43A 2PDNA 4M1RA 3BGGA 1ZNNA 3NG3A 5BZAA 4YNGA 3E0WA 2PLJA 1S39A 5BRQA 1MEIA 3FAXA 3WLPA 4EK7A 2JIWA 2ACUA 1ME7A 4RNFA 2QIIA 3C3NA 3KOXA 3UQNA 2GJLA 3V16A 4H8HA 1RQBA 1AW2A 1QPOA 2GGJA 1QBBA 4L7ZA 1UR3M 1K9FA 3ARVA 5H8MA 1XC4A 3H21A 2XVLA 5D37A 3FY1A 2NX9A 5M2FX 3H4XA 4L1XA 3VTRA 3HM7A 3QR1A 4IT1A 1A0CA 1X1OA 3EMZA 2FMNA 4LUTB 3TE9A 1MXGA 2VCCA 1KRAC 4O15A 3FNDA 5DRIA 4IP5A 2SFPA 4GACA 4IMGA 5HAOA 5C6MA 1S5MA 4UNKA 2V3DA 3N9SA 4A3YA 1L6FA 1JRBA 1UOZA 3L0GA 1FH7A 3VDBA 4HOZA 2OX1A 3DN5A 4LYPA 3NQCA 3C0JA 1UH4A 1JF6A 1YDVA 5B7YA 3HGJA 1RR2A 3OO2A 3U8GA 1SJDA 4MAVA 4H6RA 4PTVA 4S38A 3CLWA 3GFYA 1X8FA 2H8ZA 5KZ6A 3CUFA 3MCMA 3W71A 2WBKA 3ARUA 4H2CA 2PPGA 2WVVB 3SRKA 1BYDA 2ESCA 4MDOA 1XLKA 3WQGA 1ITQA 1H7RA 3N34A 4UQCA 1ZP4A 2CEQA 3UJEA 3NZQA 5DT7A 2PWUA 5HNTA 1WXYA 1OCBA 1TPUA 1TELA 5CPMA 5DX7A 2QCNA 5FCZA 2VDHA 1KKOA 2V2CA 1BSIA 1XX1A 2JK2A 3VVGA 3RX4A 3WLNA 2Y62A 4QITA 4LW7A 2REQA 4S2BA 1GPWA 3DH7A 1HKJA 1KC7A 2NLYA 2GGHA 1VHCA 2R1NA 1UPMB 5XINA 5GPRA 1FDJA 5FESA 4MDPA 1UH2A 3LXAA 1IT0A 3Q94A 4CNOA 3L7RA 5A8MA 3KL3A 5HUPA 1FOBA 1OADA 2EXOA 3GFXA 4FO4A 3PSVA 3DAQA 1U83A 2CWNA 4PUMA 1BAGA 1CIUA 3CLMA 2YDSA 1JI1A 2FVMA 2YDQA 1OZMA 1XI3A 1JD9A 2YW3A 4B9YA 4BKNA 2FH6A 3SFWA 1FCVA 2FTWA 1KCLA 3A3XA 4E2VA 4RL3A 4NZJA 5HWNA 1J5TA 2XDFA 1FCBA 1OBAA 2OWXA 5HMSA 3GG1A 3B9OA 4RPQA 5DY3A 4C6OA 5D2YA 3N13A 3CNYA 4F8XA 1TV2A 4C6PA 4IFRA 4LY4A 4IL0A 4Q4KA 1CXLA 1JYVA 1XLMA 1K8CA 3CL6A 3W1XA 2ZXAA 3VIOA 2RUSA 2DJLA 1KXTA 4E4FA 3O6YX 4QEHA 4GNKB 5KZEA 4H7CA 3HQNA 2BS9A 3NYDA 6CGTA 4ZVJA 3QMSA 4JX6A 1J93A 4MFDA 4OE7A 4C7GA 4MG4A 3EMCA 4HZMA 1DKWA 1RQHA 1KR0A 2JBMA 1M04A 1CTNA 4LSBA 2G3FA 2CLEA 5FF2A 2OQLA 3BANA 5E0FA 4XAGA 2HBXA 3W0KA 3W2KA 4CQDA 1UUMA 2DSWA 3R2GA 4A8NA 1W5MA 4HNTA 3ZSTA 3N6JA 1WAUA 3QTGA 2DJXA 2WMGA 4MKNA 2OELA 4BS0A 1QPRA 3NO5A 1US2A 3URBA 3WQ6A 1F76A 1I2QA 1HX0A 1ITUA 5D09A 3TUUA 3VKKA 3TYAA 2RGLA 2VX5A 4D6HA 3QLDA 1ISYA 2YBUA 2G50A 1P7TB 1XYZA 3KCOA 3RXZA 4LF2A 3PJUA 9RUBA 1GTEA 4G7EA 1SVDA 2V5DA 4DLMA 3CB3A 1GQLA 1AJ0A 2J78A 4QTGA 3HPFA 4CKQA 4H19A 3CPGA 4LAUA 3V1PA 3W2NA 1T8QA 1KRBC 1FX6A 3A22A 3IANA 3M0LA 3T78A 2AKZA 7CGTA 5AHIA 3VGDA 4M82A 4E5TA 1ODZA 3LZ3A 3UERA 3IUHA 3QW3A 2XINA 4XB3A 3COTA 5LGZA 1IWAA 4XZ9A 1LUCA 1XLIA 4B3LA 5T26A 2EJ1A 3RJYA 4PUJA 1JCMP 2ICSA 1N8FA 3IPWA 4WCJA 1PJ9A 1AVAA 1QI2A 4O53A 1KNWA 2WJDA 4Z0JA 4FAMA 4EF9A 2F2KA 4EWND 3TC6A 4B90A 1F8IA 4E38A 3AI0A 1XRTA 5LKYA 1A5KC 4MLRA 6REQA 4JEQA 3UPWA 1RBLA 1V0NA 5AC4A 1E1EA 3E38A 3PB2A 3LA4A 5DLCA 1P5BA 4DNMA 5K2ZA 3B06A 1FVPA 2B7QA 5E1QA 5FF3A 2CESA 4HYRA 4O52A 4E3VA 1I45A 4RE4A 4A3RA 2FZDA 1JUBA 1V3JA 4WUIA 2IKIA 1RLDA 2YBTA 3MB9A 1FP9A 5CH9A 4RR4A 3HGRA 2QZRA 3M6DA 4PMRA 3F4CA 1PYFA 3VD5A 6ENLA 3W6YA 1GG0A 1YXDA 4WF7A 4FI4A 4WGHA 3G8EA 1ZHAA 1ZBWA 1EEXA 2WYSA 4GISA 4L4OA 1Q6RA 4N4QA 1KM6A 1JUKA 4LVFA 3P82A 3T8QA 4FIQA 4XQ6A 1RZMA 5LIUX 3BARA 3AMCA 3IIZA 1DXIA 2BGNE 3T05A 3U7BA 4O1EA 1UWQA 3DG6A 5LA2A 5JBDA 4R7WA 1X98A 3OG2A 3VNLA 5G4HC 1XIBA 5ABHA 4IMCA 2DP3A 2Z2BA 1BWKA 1WZAA 3UA4A 1JYWA 1E51A 4PCSA 1X97A 2OT1A 1GW1A 1IEVA 1BQGA 3BQ6A 1WO2A 4A3UA 2VR4A 1TREA 1JDEA 8TIMA 4PZVA 3EX6A 2YL6A 5HK4A 2AMGA 4RJEA 2MNRA 9CGTA 1XHGA 1K6WA 5H8UA 2XSAA 1OFBA 2DZAA 4ZXLA 4PUWA 4XZIA 3OA3A 4LY8A 4JN8A 3WENA 3M5ZA 4YTQA 1RK5A 3GYCA 3PFRA 4AMAA 4KESA 1VFHA 3C86A 3WX7A 4YL2A 3VD4A 1YXCA 1UJPA 3O1NA 5BOEA 1AG1O 2QPSA 4PH6A 1XUZA 2W6RA 3BMXA 4CD5A 3NQBA 2V81A 3N2CA 3PM6A 2J79A 3I4KA 1GOWA 2WM1A 1OT2A 3W6LA 1ECQA 3EGJA 2VCBA 5EKYA 3WBEA 4DYEA 3FEQA 1UD5A 3S2JA 4DBWA 2VL4A 4TV5A 4XZMX 4WXYA 3BZGA 2ZXBA 4YCOA 3TYUA 5D30A 1M03A 1UBSA 1LWJA 2PDIA 3NQFA 4YTSA 3IGUA 4HB7A 1A5LC 3W7JA 4Q4RA 1BYCA 4NXKA 1JRCA 5HBFA 1DWIM 4GPNA 4QP0A 1XLFA 4I3GA 1LG2A 4JZ5A 1F9CA 1CWYA 4L61A 2ZUUA 3E2SA 2VEPA 3PN8A 2RJHA 2Y63A 1V3HA 3MSRA 3MANA 4L9XA 4JS3A 1E6NA 1XG4A 4BF7A 1DTUA 1FP8A 5FIPA 2WKGA 1NOWA 2Q02A 3CIVA 3QQ1A 3TYDA 4JIIX 2VZTA 1ADOA 1UWUA 2BY0A 4KRZA 4U31A 4WOQA 1WV2A 3CV6A 4KETA 4BF5A 1S2AA 3FKKA 4TX8A 3SQLA 3AWOA 3ES7A 4AMCA 1OSEA 1GKQA 4JL2A 4D6EA 3V5FA 5AC8A 3W81A 1ISVA 3EYPA 1I2PA 3F4DA 3BVJA 5HUOA 2LLEA 1TPH1 4F9DA 1UQZA 4IXXA 3FGCB 5FKYA 5JXQA 3PJXA 3BAKA 1E0WA 4GKTA 1GHRA 1B9ZA 2HNHA 1XYBA 3ZJ7A 5CGQA 4E6MA 3F4WA 4X0VA 3NXLA 3ARSA 3UFYA 3NOEA 4C6MA 3UZZA 2Z6JA 2VFIA 1KR1A 1G6CA 1KFBA 1XCWA 3QSTA 4WY0F 4DXKA 5E0KA 3PTQA 3CHEA 1IGSA 4UQAA 2PDPA 4JX5A 5I06A 5D2WA 4NNAA 2AL2A 2GQAA 4X0NA 4U2YA 3AXXA 4CNUA 1K02A 4MAZA 3O63A 1L9WA 3TLQA 1JYXA 3KX6A 4ONVA 2EO7A 3DOPA 1PTDA 7ENLA 1F6YA 5CGMA 3O9NA 2IKGA 1A5AA 4J2MA 4IFKA 3F5KA 3EDFA 2NT0A 3NWRA 1FCUA 1K3UA 1A5CA 4J28A 4W87A 4KMQA 4MUZA 4DBUA 3AS1A 1BVZA 4LC6A 2QCEA 3H6OA 1YKWA 2ZUMA 3N04A 1B3YA 1CB2A 1V3KA 4GK8A 4M1BA 5I6SA 1PX3A 2W5FA 4HHHA 3CEUA 3GHRA 3L4YA 1QVBA 1F05A 3GDKA 3WJSA 3URQA 4NSBA 4PFHA 3LTPA 4GA8A 1PAMA 4W85A 3DC0A 3O2LA 4CNSA 3NYZA 5EL1A 4KIRA 5FD0A 3QEZA 4F48A 3H2MA 1UIOA 2V63A 2V3EA 3AIVA 2IQ0A 3SN1A 3NAVA 2WK2A 4D6IA 1EDTA 2BMBA 4B2DA 1TQXA 2Q8XA 3FJNA 4RDVA 4Y96A 3HZ3A 4X2PA 4R27A 4I6VA 4C6BA 1H4PA 2G5WA 1VF8A 5FEPA 4J9JA 1LZOA 1QK2A 3RF9A 4M0XA 5FL1A 3U5UA 3T8LA 5CBIA 3WUEA 4IIBA 4MPQA 2NQLA 1VR6A 4DHGA 2ZZ1A 4PTWA 4ES4A 1IXNA 3QJAA 5B80A 2QT3A 4PGLA 4YU1A 4MKSA 4HZ6A 1SZEA 3PNZA 5DY2A 1W3IA 1WKDA 1QASA 4NIRA 4I6KA 5I77A 3LQGA 2V67A 4FX7A 4AF0A 5E09A 1TV5A 3PZGA 2OLAA 2YBVA 3WLOA 1I75A 2WB5A 2YFNA 2PDLA 5C2GA 3WH6A 1J79A 4GCXA 3R1ZA 3CZKA 1EP3A 1JG9A 4JYDA 3HMJG 2HTMA 3W24A 4XO6A 1ZCCA 2QEZA 3TZFA 2WMHA 3GVRA 3UWQA 3W7LA 1J8VA 4QGCA 4GC4A 2PSNA 5IXEA 3UNTA 1QO2A 2BXVA 3W22A 1KKRA 2OOGA 3B4UA 2WSRA 4UOZA 3WLHA 1JL8A 5HXMA 3ARZA 4Q4OA 3CH0A 5A8OA 1F3XA 2J6VA 3PTMA 3E2RA 1YW1A 5CCZA 1PTAA 3L2LA 4AEFA 2YDRA 3W26A 4K36A 2VGFA 3GHUA 1NQKA 2W27A 1VBGA 1ICSA 2YA0A 4AEEA 3C2EA 1G4TA 2O7QA 4MNKA 1QOPA 3IAPA 2QDDA 3G0SA 4LRSA 4TV6A 2PDUA 1XIGA 3O6DA 4ZOEA 1LBLA 3EWYA 1V4YA 4I7UA 4HPHA 5BNKA 4LB4A 4W84A 5LIXX 3DIPA 3RFAA 3TSMA 1FY6A 5D02A 1PE1A 3HG3A 3C6CA 3UZJA 1ZP3A 1EIBA 3AXKA 3S42A 2WW5A 4H6QA 3V5OA 1QMLA 4ZO7A 4HPNA 1R85A 1E6RA 2JF6A 4I9AA 5HA7A 4N02A 4WVXA 3NQGA 3CTTA 5EMKA 2C19A 5AYXA 5A6JA 4QQ3A 4US5A 3BW3A 2XM2A 1XDMA 2DU2A 3C2VA 1GWJA 4BQ4A 3G0XA 3FYOA 3RU6A 4Y9AA 2FH8A 2VGIA 3SAZA 5AHNA 5XIAA 1JEZA 1FWRA 4QRNA 1RCQA 3HF3A 3WJYA 1D3CA 3RLVA 3VKAA 1XP3A 4GUHA 1XSIA 1HVQA 2FTYA 2VELA 4S1FA 2UZ9A 3CASA 1WX0A 2WJFA 3TMLA 5DMLA 5K9DA 4GO9A 3CXOA 2X0HA 3SZ8A 1JDFA 4JHZA 3T55A 1SYTA 4L4PA 2E40A 4ICNA 4LEQA 1GVYA 7ODCA 3SEPA 1QOQA 2QJNA 2G3JA 4WJ8A 2QMKA 3M46A 5FSDC 1Q6LA 3BO9A 1OX6A 4ILSA 2EJAA 3LENA 3TJXA 3VAVA 3S1GA 3FYPA 3TJLA 2A4AA 3NQ7A 1TG7A 5DMMA 1V0KA 1JJKA 3I3EA 3BJSA 3MMDA 2VD8A 4UQEA 1CXHA 1UR8A 3ZM8A 3WFZA 4J3UA 3UJ2A 4JNYA 3IIOA 4HU4A 1SU5A 5D33A 2DEPA 3CWHA 3IJ7A 5BCAA 1IWBA 5C7HA 2VR2A 1HP4A 1O60A 4HT3A 1JQVA 3VD9A 1F3EA 1ZL1A 4JQ2A 3S83A 1AMYA 4H04A 4V27A 3DFHA 3STGA 4TX6A 3LM7A 3DHPA 3QHMA 1NM9A 3BAXA 4P8VA 5CG7A 2YDAA 5DCEA 3PUGA 4DXXA 3PTKA 1OD8A 4O4VA 1XICA 3BCDA 2INFA 3WLTA 3SUVA 3KUMA 1UPPA 2ZRXA 1DV7A 1TWDA 5LIKX 3UT0A 4UNLA 1XR2A 4G7FA 1SMDA 4G1KA 1BD0A 2OZ3A 4BHYA 4DUWA 4MWAD 1OGSA 1J18A 4CQCA 3L4WA 1QNSA 1SMAA 2QCCA 4WIWA 1US0A 1C9WA 5AYZA 4FLQA 3LCLA 2HMCA 2XG9A 3IIXA 4DO6A 5D05A 1H7XA 1TFVA 2EAWA 3O15A 4S3AA 1TKKA 4AHQA 2YPIA 1QNRA 3OQ8A 1NY1A 4AHOA 4FXRA 1IZCA 1JULA 3VOHA 4GIRA 3A4WA 2Z29A 1PUDA 2XH2A 2GFTA 3G2GA 1VFOA 2DSZA 1H3GA 4GI4A 2PCEA 1CXEA 3D3FA 5I79A 1OX4B 3C3UA 4EPEC 2CLOA 3MJYA 1PDYA 3T6CA 1GONA 1GW9A 3T2PA 3W85A 1CPUA 1FFRA 1F6KA 3ENLA 4HSHA 3TJIA 2DVXA 3PBVA 3ZMRA 1P0NA 3ZLFA 1DTNA 1AH3A 2GGGA 3OZPA 4L6DA 4U28A 3ZJ6A 1Q85A 4D2JA 4ZQNA 3R12A 2PZ0A 5H1WA 3AICA 3GXMA 1ONEA 3AIEA 2O7SA 2XN0A 5AKQA 4UCGA 1H11A 3HN3A 5D03A 3GYEA 1ZJIA 5EFDA 2P53A 1WNOA 3KXQA 3B9EA 4YN5A 2X40A 3MMUA 3XISA 2CC0A 3IJLA 4O1CA 1IV8A 4I5RA 1UKSA 1H09A 3VIJA 4BQ2A 1XDJA 1C92A 1LTDA 4REQA 4ATLA 4N9CA 6REQB 4DNHA 1LROA 1UD2A 4UOQA 4MY9A 2QCDA 2VZOA 2FVKA 3UG4A 4UFIA 1ZAJA 1VCVA 4ZXOA 5DCDA 3KM8A 1NWTA 3SIMA 2NWRA 3MI2A 1YYAA 1EPVA 4AZHA 2HPMA 3WBAA 4UR8A 3WFAA 1HL9A 2IPFA 1F4AA 2Y7DA 3AJXA 4AZ6A 2R24A 1XBYA 5REQA 3SURA 3N19B 1BYBA 2RKXA 1W1IE 1VJSA 2PDBA 3MCOA 5DT5A 3ONCA 4GC3A 3IAQA 1H50A 1YLVA 3W25A 2GJPA 2Y61A 4O57A 3BLFA 5AN7A 2DSVA 5HNRA 2XWEA 1KFCA 2ZX6A 4XO7A 1GGOA 1O5QA 4W8LA 1MNZA 4W89A 3PB0A 4QJ4B 3TYBA 2C0HA 1G01A 1Z48A 4U10A 4HNCA 2XIQA 3L4TA 4GUIA 1REQA 3MTWA 1K9TA 2VURA 3BLEA 4OHQA 1X38A 1UR9A 2HISA 2J6XA 1UCWA 3BOLA 4WKHA 2HVMA 3VPLA 2CBUA 4QJ3B 2VTFA 5LHEA 1PKLA 2GGEA 3N25A 5FEXA 4FR6A 3TNOA 2V5BA 4LVBA 2KX9A 4FB7A 3ZO9A 2D2JA 3GR4A 4LS0A 5MKGB 1I0BA 3WQ5A 3QPZA 1C29A 4BEUA 1IR2A 4OECA 4YVVA 1NSJA 3NDZA 3M5VA 1YDNA 1S2WA 3PP7A 2POZA 5AVNA 3RMJA 2ZADA 4FXJA 3W7QA 1AZ1A 5CZJA 1RY8A 1EDQA 2O56A 3P81A 3S5OA 3CL8A 3DGBA 1D9EA 4UNIA 1W2PA 4JKLA 1NIUA 4GABA 3G22A 3QRHA 1DWGM 4BFAA 5FJRA 1J2WA 1ADSA 2PDYA 3WJXA 5JMUA 4EAYA 4QLJA 3S1XA 3T08A 1NP2A 3EKGA 3NQAA 2NZLA 1XCXA 1OC6A 1Q6QA 3VOIA 1UHVA 3M0IA 3U7VA 5JVLA 4N9DA 1BQCA 4Q6XA 2ATSA 3MZ2A 3IJ6A 3CQKA 4B5WA 1RQEA 1MZRA 3WDPP 4O8RA 2ZZ2A 4OV4A 2QJHA 1T0OA 4AVNA 4Q8QA 3OU8A 1XPYA 3CHCA 2YCEA 4JNZA 3GNRA 3RO6A 1VBJA 4KF1A 3S1WA 2D2GA 1O94A 5C71A 2OCZA 3W7HA 5D8WA 3AMLA 1V79A 3N3MA 2NWSA 3W38A 4ZE5A 3NQEA 5LA1A 5HOSA 5BXSA 2PTZA 4Z1AA 4QEEA 2A3LA 1TWWA 3GM8A 3IV3A 2E5DA 4MNJA 3GKAA 6A3HA 3I7SA 1WQ5A 2CWXA 2J47A 1HO1A 2J13A 4D1IA 1R9XA 1L0PA 4MYXA 1E3XA 4N4PA 4HK5A 2HXTA 3EOLA 2ZWYA 5CAHA 3WMBA 2FHBA 4ICMA 3WLRA 1E15A 4E8CA 4LOCA 2P10A 3OYXA 4WZHA 4QNEA 3GIQA 3C2YA 3G18A 2PWHA 4C6QA 3OBEA 1QJWA 2Y8UA 1GZGA 2Y24A 1UWSA 3BAYA 4MUPA 4W9TA 4ADSA 1OK6A 5LXXA 3CIWA 1IE7C 3N9KA 3K4DA 5KTLA 4U2ZA 2PFHA 1CECA 4MB1A 1W17A 4IJBA 3F2CA 3M0JA 3UY7A 4LAKA 2DH3A 3VE7A 4UTMA 2PWDA 3NVTA 3FVDA 2GWNA 1H7PA 4FNQA 2X2GA 4V33A 4XBJA 4KFOA 3BOXA 4WR3A 5LGXA 2CLMA 3BPWA 3OGVA 2CLHA 1ZAIA 2GOUA 3G1FA 3R0UA 4PEEA 4LB3A 4PODA 2YA2A 1TRIA 1XYMA 3GH7A 2DW7A 4Q8WA 1F4HA 4LXFA 3EKLA 4LFYA 4DJEA 3DFPA 1NOUA 4DJFA 3VNMA 2Y70A 2BHYA 3LMYA 2GUUA 5H8PA 3JS3A 3WDRA 3DX5A 1RVGA 3ELFA 3W1AA 2PDFA 1J0IA 1XH2A 3TFCA 1W3KA 4D9PA 1UMYA 3VUSA 2AL1A 2QYGA 2IPJA 1VIWA 1Y8BA 4DIAA 2PDHA 2TPSA 4IX0A 3HGOA 3H70A 1UWAA 1EDGA 5BU6A 2G37A 2YGYA 2ZOXA 4HCLA 4OZOA 4CCCA 3PZOA 1QRQA 1L8PA 5I5RA 1VJZA 3VUPA 3I10A 3Q67A 3WK1A 1B3VA 2IPWA 4RZ4A 1IEXA 3EZ4A 2UY4A 1J0YA 2VFHA 3ARTA 2B0MA 3GDRA 5D4YA 1SR9A 1EGVA 1S3TC 3TA6A 4UTHA 1CLXA 4K7YA 2GLKA 2R1LA 2VC6A 4Z1CA 3G1DA 3GZAA 3ABOA 4CD6A 5I02A 2WJEA 1AJZA 1BLIA 4XAPA 3NL3A 4JTUA 5EYWA 3GXFA 4QJ5B 2BOFX 1EQCA 3TSBA 3L12A 3QV6A 1A5OC 3HU7A 4H7VA 3NGFA 3WL0A 1Z41A 3HQPA 2VXNA 5CSYA 3P7YA 3L2IA 3T0TA 2BDQA 3CTLA 1Q45A 1I0DA 3AU2A 4MIMA 4UOJA 1JZ3A 3CWNA 2VRKA 4QG9A 2Z6IA 1R8LA 2BG5A 1UWTA 2NQ5A 1BKSA 3B4YA 5C2XA 3VDAA 1FTXA 3TR9A 4TVUA 2QUTA 3EXSA 1OF8A 3CZJA 1Q66A 4IMDA 1MSSA 1YRRA 1P4CA 1XL9A 2J62A 4G6CA 2ACRA 3P0XA 3ZR5A 1DHPA 1EJUC 3AC0A 3MT1A 4IPJA 4Q7NA 1XISA 4MWAA 5AZ1A 4JIPA 1H5VA 1L6SA 1AK5A 1NFPA 2JEQA 5C9RA 1DQUA 4WQ6A 4J1OA 4J3VA 3DEQA 5F1UA 3LCIA 4JTDA 3OG3A 2P0IA 4EVZA 3NGJA 1D2KA 1J6PA 4CN6A 3T81A 1EIXA 4XZLX 4D1JA 1H51A 1PX4A 4L4LA 2PBOA 5ABFB 2EPLX 2X1TA 4EXBA 3QMTA 4MWAE 1XGEA 3QOKA 1K8XA 2EEXA 3M6YA 3KRSA 3FOKA 3NM3A 4FEZA 1MUCA 2RDTA 3THDA 2YLAA 4V1YA 3KRBA 1Y7VA 1W3JA 5I3IA 4B9ZA 4JX4A 4WRHA 2PE4A 3LD5A 3UNDA 2XH7A 4DJDA 2Q8LA 2HS8A 5EB8A 3N6QA 4L6HA 4IGHA 1EJTC 4IUOA 4WKFA 4ERGA 4DZHA 3N11A 5CJNA 1RBAA 2EG8A 3ECQA 4QISA 4HPGA 3QGKC 4UXDA 2IXUA 3M43A 4MJ4A 5ABGA 3M0VA 3QYSA 4CCZA 3W74A 5MF5A 4H9MA 2QCGA 1TUFA 2Q71A 3IWPA 4DF0A 1TJRA 1KRCC 4OVXA 1Q2SA 3AZTA 4ZL1A 3CT7A 2Y1HA 4Z2GA 1GOOA 4CQBA 1OHLA 3E74A 3A4XA 5DCBA 5D2XA 2V6AA 3TROA 4DVOA 2Q3OA 3HJZA 3KDOA 4CVUA 2VUNA 4XBKA 5I3HA 5CAKA 1MW0A 5CPNA 2ZC8A 3WG6A 2E3ZA 1WYIA 4Q8PA 1RP9A 3GX9A 3A6OA 4HHMA 2Z1WA 3AZSA 2CPUA 1OJXA 1DL3A 4H01A 3BLIA 4OOZA 2J4GA 5KEZA 3RJXA 5IBXA 1XYAA 1IYXA 3AIQA 3W84A 5E9AA 2V3GA 1DQWA 1LF1A 5D04C 3XIMA 1RCOB 1Q6FA 4LUSA 4ZA0A 5FF0A 2ZA2A 3PF3A 4L9ZA 1VFTA 3U4FA 2FZNA 4P7RA 3IVTA 1T7LA 2BWGA 1FBAA 3D3AA 2OSXA 1TJ0A 2OEKA 2WHMA 2ANUA 3E2QA 1G69A 2ODOA 4MMWA 2CCRA 1E1FA 3V5CA 4XAZA 3MV01 3WKZA 3HPZA 4GHRA 3RLUA 2PTDA 2QJIA 1SO3A 4ERAA 4OJYA 1TV4A 2V9DA 3S9IA 3RNDA 5HJLA 1GZ1A 1HKWA 4XVDA 4J3WA 2FYMA 1POKA 5TD4A 3WCZA 1EGMA 3B9AA 2WZTA 1M53A 3AHZA 5LXEA 3E12A 4GVIA 3PBMA 4LPCA 1TV8A 4V1XA 4NHVA 5T91A 1FWAC 1LP6A 3CYVA 1MDRA 1U22A 3GSMA 3ZLHA 2UBPC 1XIEA 2CHNA 2NSXA 4GQQA 4A4AA 3GRIA 3H2OA 4O17A 3DG7A 1DJYA 3JZEA 1W6TA 1E9YB 1A49A 4IPPA 4RKAA 5CLTA 1JVNA 1EP2A 1W5PA 3B8IA 1YTKA 1FCQA 5J5DA 2A1YA 2ABAA 5KZDA 2OPJA 3E1F1 3QPYA 3B9DA 3W7PA 4AD3A 5JQ9A 2WSQA 4ZENA 3WK2A 1UR0A 3BGJA 1YXYA 1CEOA 3RCMA 1AODA 4JDBA 4MB4A 4MYAA 1YPIA 1MFUA 1K4GA 4IM4A 2NQ9A 2X1UA 1Z8AA 1MEHA 1WZLA 4P8XA 1IZJA 3C0QA 3BZJA 3NJ3A 1WAWA 4FNSA 1HNYA 1FDZA 4O12A 1HW6A 1RD5A 4GUJA 4DWSD 2G97A 4XD6A 1FHUA 2FPVA 2FHCA 3S4TA 2BY1A 3MA8A 5CC3A 3L9CA 4PMXA 3B8UA 5HANA 1EO7A 2FGZA 2E6DA 4AXNA 3OVGA 3OVPA 4CNNA 2DZPA 3THUA 4KWWA 4S3KA 2H90A 3B8WA 1S5WA 3SDOA 4BZYA 4I8YA 4PMZA 2YKKA 1OYBA 1TVPA 2FIQA 4IGSA 4PTDA 3W7NA 1YBQA 1KTBA 2NUXA 2BGSA 5I07A 3RYSA 3O16A 2C0AA 1SQ7A 2QCMA 3BMVA 4LANA 1LOQA 3LY0A 2DUAA 2WCGA 3E2VA 4AC1X 1E9LA 3BCJA 1UP0A 3W7IA 3CZ8A 4K38A 2QGHA 4JQ1A 5HNUA 4DO5A 1TJ2A 3KVLA 3U2CA 4D6JA 1SZFA 3UJRA 4KKXA 3P80A 2X0SA 3C8NA 1JUEA 3GC4A 3VKBA 4IICA 3PFMA 3R6IA 1KFJA 1RSCA 3EWBX 1JCLA 2D69A 5M3WA 4GINA 5D9NA 3HQOA 1QHOA 2PCQA 1SFLA 4M6PA 2NV2A 3TVAA 3CAWA 3S2LA 5GNXA 2DT0A 2BHZA 3EX1A 1YTEA 3JVAA 1T99A 2CLLA 4N6EA 3C5QA 4IH3A 1BYAA 3A47A 2X2YA 3QV7A 2HVOA 2X42A 2MANA 4A8IA 2WCAA 1D7FA 1B57A 3HB9A 5F2LA 1OGBA 3FJ4A 4G8T