1KM2A

Crystal structure of orotidine monophosphate mutant q185a with 6-azaump
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
211
structure length
211
Chain Sequence
MNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAAGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
publication title Mapping the active site-ligand interactions of orotidine 5'-monophosphate decarboxylase by crystallography.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 83
structure length 211
sequence length 211
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2001-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1km2A00
1ME8A 2QF7A 1XDLA 1XKYA 3PBUA 3MP4A 4TIMA 1FWWA 3L9CA 3LCXA 2BSLA 1NVMA 4TMBA 2WO5A 4J9JA 1G4TA 5FESA 4RZ5A 1I2OA 3VFLA 1EUNA 2WNQA 2H8ZA 4QNWA 2PURA 3WK1A 1W5OA 5F4WA 1B9BA 1EWDA 3N19B 1G7UA 4BI5A 5AHFA 2CU0A 2A6LA 2CLOA 2Z2UA 3HGRA 1AL8A 5AFDA 4N9EA 3W7CA 1QCWA 4RV8A 4M7SA 1X7FA 4JYFA 4MZ8A 3L65A 4MKNA 3W7QA 3ZWTA 3W6YA 1H61A 4M6PA 4OHQA 5HWJA 1FWRA 3K30A 3STEA 2NX9A 3MHGA 1W5PA 2DZVA 2VFHA 4OWGA 4GUHA 4JGDA 4JTGA 3A23A 4U4MA 1SFJA 3EWWA 3A22A 2EHHA 3P81A 3L5LA 4QJ1A 5G1YA 4XQ6A 3UWVA 1S5WA 4ZQPA 3EWXA 4O0KA 1EEPA 1H1ZA 3HPSA 5AYXA 3FIGA 2J9XA 2PE4A 3OIXA 1PHWA 1SO3A 3RMJA 2CLKA 1KFLA 1LRQA 3P8JA 4NT0A 1KFEA 4WY0F 4AB4A 1T99A 3LCIA 1A50A 3LHUA 4OT7A 1TTJA 1ZAHA 1OX5A 2ZRXA 1OK6A 3G3DA 4M7TA 3LRMA 4UR7A 4MY8A 1O95A 3M5VA 1UBSA 4ZMGA 4MVAA 1QAPA 3GXTA 3HQ1A 3RLUA 3GKAA 5DBUA 3KAOA 1R2SA 4XZ9A 3NPWA 2HSAA 5DCDA 3NDOA 4JXCA 1WOAA 4CNPA 5HULA 1X1ZA 3TNOA 3B4UA 2DP3A 3MMTA 4KKXA 1F74A 3GDMA 5HNRA 4K36A 5C2XA 3P80A 4YMZA 2YGYA 2VKZG 1KLYA 3W85A 2VEIA 1TTIA 3OVQA 4UTJA 2QEZA 4GUGA 4N9CA 2X1SA 5I3JA 5D30A 2F84A 4HSNA 5GVJA 3RFAA 2Y62A 5LKYA 3KRUA 3PB2A 1UUOA 1W5QA 5K9XA 3TXZA 5CKSA 1PHQA 4I7VA 4WZHA 3D0CA 1XC4A 4EVZA 2YFNA 4N9BA 1YTKA 3C8FA 5EYWA 2DZUA 4MFEA 3W7GA 4AMAA 4MZYA 1IXOA 2NUWA 4UTMA 4K8EA 4O4VA 4PA8A 5FF7A 4JTFA 4ZVJA 4N6FA 5F2LA 5FF4A 5CG7A 3PSWA 3UXDA 3N14A 1XM3A 4OV4A 3W1TA 3NG3A 2G95A 2QCLA 1DBTA 3G24A 4L4MA 1HFBA 4LVFA 1FQ0A 1B4EA 1ICQA 3W74A 4XKYB 2GVLA 1LROA 4MJMA 3DFTA 3ANYA 3T55A 5FEXA 5HR7A 1F2JA 2Z1BA 1N8FA 3G22A 5G5IA 3MP5A 3HG2A 3W3OA 3MI6A 3TJLA 1H7PA 3B06A 3DHDA 1V7YA 4EOUA 3TDFA 3DFQA 3W7DA 1LCOA 4IPJA 1GJPA 4JTIA 2X30A 3DFNA 4OGZA 1LLWA 1G69A 2Y7DA 4PFMA 1F6PA 2Y70A 1K02A 4NZFA 3ELFA 4NUWA 2CWNA 1W1ZA 3ABOA 2OT0A 4LTSA 3M6YA 3LV6A 3O8AA 1I2NA 3GDTA 4FX6M 2E5DA 3M0ZA 3O6YX 3DXIA 4FNSA 3N9RA 4BR1A 3LB0A 4XUGA 4TMCA 1SZGA 3PM6A 4LC8A 1ZY9A 4ZL1A 3E96A 3UNDA 1WXJA 1D3HA 5DXYA 1RQHA 4C1LA 4JX6A 3E9AA 5K9DA 3R13A 1FCUA 3M41A 2NV2A 3LHYA 2NZLA 3RU6A 2TPSA 1XXXA 1ZNNA 4WX2A 4AF0B 4ADTA 2ISSA 5D03A 5HINA 1HO1A 5HWMA 5CPLA 1S5TA 3GB6A 1F05A 3UPWA 5AYYA 1GVFA 1QOQA 3OA3A 3LCGA 3QFEA 3T44A 1XBZA 2H6RA 4GC4A 3Q37A 1GVSA 2EPHA 3W7LA 4BI6A 2NX3A 1A5SA 2RDTA 3R89A 3WJZA 4DPQA 3TA6A 1WQ5A 1OYBA 1Y0EA 3F4NA 3S0CA 2X2GA 3C52A 2H8XA 4G1KA 1O4UA 1MEIA 3CTLA 4ZQCA 2ZZ2A 4N4QA 3WJYA 1WOBA 3BGGA 1C29A 3DBPA 4Z08A 3W72A 2ZDRA 1TJPA 3C2EA 1KM6A 5G2IA 1IIHA 3VCRA 4WD0A 2X1RA 1BWKA 2P10A 3SSJA 4MUZA 1XCFA 2ZRYA 4UFIA 3V1PA 4NVTA 4O50A 3O15A 3QPYA 2Y7FA 5I3HA 1EP3A 2QCEA 4AEOA 3G1SA 4NXKA 3KRSA 4O10A 1W56A 1S5VA 2ZZ6A 3HMJG 3H55A 1KW1A 2QJGA 3PWAA 1KV5A 4UC5A 4O15A 2CLMA 4MY9A 3KX6A 4OV9A 5D37A 3RK8A 3W1RA 4JYEA 2WJZA 3CEUA 3HO8A 2GUUA 3KOFA 4IUOA 1W0MA 2ZTJA 5LNSA 2ZZ4A 1O5KA 3PB0A 1DV7A 2O7QA 5H91A 3NNTA 5KSWA 3BVJA 4RJEA 4JICA 1TMHA 4Y96A 2ISVA 3W7OA 4FF7A 3M5XA 4HNUA 3HF3A 1TB3A 4MZ1A 4UNKA 1GVQA 1PCWA 3QEZA 3UPBA 4LRTA 2VFEA 1EB3A 4FX8A 2QDHA 4RK8A 4WXZA 3EXRA 4RZ4A 4DO5A 3PC0A 4H4IA 2DJLA 3WK2A 5HJLA 1I8JA 4K7YA 3NYZA 1H7XA 3EX3A 3NL5A 1PCKA 3IIPA 2EAWA 3DZ1A 1FWTA 1UUMA 3A21A 2WOQA 1VYSX 2VFIA 3PS7A 5LNUA 3QMTA 3W2LA 3QW3A 3S1VA 3M47A 5DY3A 3WJSA 1HUVA 3NR0A 1P4CA 4JTUA 4LVBA 4HHPA 4AXKA 2YR1A 3A9IA 1QPNA 4O0ZA 2A1YA 5AC7A 1OFEA 3ABQA 1I45A 2YFOA 2XFWA 4LVDA 1IXNA 3N9SA 4JS3A 3THQA 1TTPA 3HB9A 2W0UA 3WK0A 3KVKA 1BEUA 3C2FA 3LRLA 4IX2A 2J27A 3EXTA 1F5ZA 1LBMA 2WV8A 2RDWA 3I6RA 4FX7A 4IWWA 4UIOA 4FEZA 1W5NA 3DFSA 3ZFHA 1H5YA 5I3IA 4YCPA 3UY7A 4MY1A 2QJIA 3NEVA 5HUPA 1TRIA 3G3MA 3M43A 5K2ZA 3UQNA 1DQXA 3A24A 2WNNA 1JULA 2V30A 2YDAA 2ZYFA 3BLEA 2R91A 2XN0A 2DZTA 1M7OA 2I14A 3SGUA 1GVOA 4O8RA 1ZHAA 3VE9A 3PBYA 4UTTC 4N02A 4LWWA 5L6UA 3L0NA 3PUOA 3LTYA 4I9AA 1O60A 3VKJA 5EMUA 2Y7GA 3GKFA 4K8HA 4FNUA 3PR2A 5A5WA 1OFQA 3P60A 3QH2A 3LBMA 4GFSA 3W9ZA 2J88A 2A5HA 2ZQ0A 3OVPA 4LUIA 5D02A 5FF0A 3W1PA 1OFOA 3W76A 4L4LA 3AJXA 2NWSA 3BARA 2A4AA 4E2DA 5DN1A 1RVGA 2F7FA 3TH6A 1QO2A 2CLEA 4ALDA 1P0KA 4Z1DA 1JUEA 5CSSA 3HGJA 4XTIA 1TREA 4W9TA 2QAFA 3G0SA 1KTNA 5F4XA 3SIZA 4UR8A 3QPZA 5E1QA 4OBTA 1ONRA 1DVJA 3L68A 3L21A 1OFDA 2VELA 4O54A 2ALDA 1GG0A 1H51A 3OEXA 2E6DA 1FBAA 3TX9A 3EXSA 5DLCA 4RZ6A 3EWYA 1KLZA 1K7FA 5AHNA 4DXVA 1QDSA 1H1YA 4HN4A 4DO4A 4UTWC 2GVGA 4IMEA 5MHBA 4FNQA 1G4PA 3I7RA 3W07A 3W1MA 1GPWA 3F1QA 4BF9A 4CCDA 1YLVA 3LX9A 3LM7A 2QCHA 1XBYA 1DKWA 2Y61A 7TIMA 1FXQA 1LORA 1W8SA 2WSQA 3MW7A 4I7UA 1ZAJA 3C56A 2CLLA 2DORA 4CQ9A 3G1VA 4GRSA 2R8WA 4JDYA 1JVNA 1UCWA 5G2WA 1UB3A 4MLRA 2FQIA 1LP6A 1ML1A 3A5FA 2R14A 1QNVA 3S1XA 2V8ZA 4AVFA 4AWUA 1JQXA 1F7BA 4DEFA 1YDVA 2EF9A 1FCVA 3PBVA 3G1AA 3W7PA 4JNMA 3CIWA 2JGYA 3W2NA 3PG9A 3SGZA 4A22A 3LI1A 4RR4A 3STFA 5DXXA 3CIXA 1OF8A 3UWUA 4TR9A 1EWEA 2E5BA 3UZ5A 1OYCA 5T26A 1KFCA 5G2HA 1F76A 3TC6A 2CZ5A 1VHCA 1YADA 5FI8A 4DBDA 2V9DA 2RH9A 3M1ZA 3NQCA 1I4NA 3UYCA 4AF0A 2PCQA 2VEPA 3NQAA 2FPTA 3BG5A 1EUAA 4CQAA 3C3NA 1B4KA 2ZA1A 1TPDA 3LCLA 4FIRA 3CB8A 5DCEA 3S5OA 5EPDA 5BOOA 3LTSA 1FUYA 2ZA2A 4R53A 2PRHA 3LCWA 3F4WA 4X22A 3SI9A 1IXQA 3SY5A 3PULA 5AYZA 2H90A 5LGXA 1R2RA 5D2WA 1W3IA 4P2VA 1TO3A 5D32A 2WKJA 3FKRA 3N3MA 5KMYA 3HG3A 1KFBA 1AK5A 3TCEA 4YCOA 4RXGA 3E02A 3DU0A 5IBXA 3CC1A 2C18A 3W84A 2Y63A 3GX9A 3S1UA 2ZZ1A 3UWYA 5K4XA 1MEWA 2DU2A 3QMRA 1NFBA 4A2RA 4K39A 3TR2A 2C6QA 4O57A 2O7SA 3S9YA 1Q6LA 1GWJA 4BWLC 3G1DA 4WY0B 3C2VA 4IPIA 4JX4A 2UV8G 1N55A 5E0KA 1V5XA 3L5AA 3NQDA 1LRTA 3HPZA 2VOMA 3G0UA 3IGXA 2CW6A 4NNBA 4OE7A 2HTMA 4IXHA 4EWND 1QPQA 4O1AA 4JTLA 4B5NA 2YX0A 3P67A 1TPWA 5CZJA 3L0GA 4JY8A 5D2YA 3PBWA 2OT1A 2C19A 3N2XA 2ABBA 2BX7A 4O1BA 3WJXA 2ZTKA 4FXSA 4GJ1A 4S1FA 2ABAA 4AH7A 3EX1A 4ADUA 1DHPA 3U6WA 2Y7EA 1WX0A 3LHWA 4A29A 3O6DA 1CW2A 3C4UA 2C16A 3O16A 5FEWA 3VE7A 4GWEA 5C6MA 1AW1A 1D3GA 3L66A 3SFKA 3LDVA 1GG1A 1AL7A 3TU9A 2ZZ7A 2QUVA 1Z44A 1LM1A 4QM1A 4ADSA 1QMLA 3LI0A 4HPJA 2ATMA 4WJEA 3CHVA 3BLIA 3KFTA 3OVRA 3T78A 1G67A 3B0UX 2ZRUA 3IVUA 1L2UA 4O19A 4PODA 2ZCGA 4JDBA 1WV2A 3CPRA 2C15A 4UFMA 2TYSA 5EL1A 2CLFA 2JKEA 4JR5A 3I65A 1BKSA 3INPA 4HKPA 2HS6A 3LLDA 4IX0A 1ICSA 3NQMA 3SJ3A 2J9YA 4S2CA 4DO6A 2FDSA 2J6XA 1SO4A 1VLIA 2HS8A 2RKXA 3UWZA 1A5AA 2GOUA 1JCJA 5AHEA 3DKJA 1EA0A 5F2GA 4O1CA 3PSVA 3B0VC 3W7HA 4O52A 1K03A 5KTLA 3Q94A 3FS2A 3FLUA 4Z0JA 5FEZA 3C0JA 3TFXA 2C13A 1DJNA 3GDRA 3W83A 4ML9A 3P5ZA 3ZR4A 2FFCA 1J4EA 2QJHA 1FX6A 1GT8A 2NLIA 3NPXA 4DQWA 3QM3A 4PCFA 1ZCOA 5BW6A 2OMAA 2Q3RA 3U2OA 5E93A 1L9WA 3G18A 2V81A 3O07A 5EY5A 3W23A 4JN6A 1TV8A 4RLIA 2ZA3A 1JCYA 4S2BA 4PH6A 4CLMA 2V2DA 3A5VA 3DFPA 2H3DA 3O6CA 2FJKA 3MI2A 3W70A 1Q45A 4O28A 4PEKA 1SW0A 2C0AA 3BO9A 2VC6A 2QCNA 3JR2A 3BPWA 3M9YA 3W87A 2BTMA 3MHFA 4EF8A 4AHOA 3STGA 1EP2A 3OG3A 5FF3A 5SWUA 4OQVA 5K3VA 2E5CA 4GUFA 1SW3A 3S1WA 5CZ0A 2FPVA 3NQ2A 4N4PA 3W22A 3QSTA 1FCBA 1TSIA 1L6WA 2Q8LA 3LHVA 3W75A 1OJXA 2NWRA 3MUXA 1ZFJA 1DL3A 2B7PA 5FEPA 5FF2A 3KVJA 1LOLA 4EIVA 1JRBA 2I1OA 3FKKA 3SECA 3KVLA 3NM3A 4U28A 4Q4KA 1TQXA 4DELA 2JKAA 3TQVA 3CQ0A 1G7VA 1QFEA 4FO4A 1LBFA 1YPIA 3IEBA 4ZQRA 1OYAA 3B0PA 4E38A 1QOPA 5BNKA 3KRZA 1Q6OA 3TFCA 4UMAA 1RZMA 1VCVA 3EWZA 1YYAA 4Y9AA 3UWWA 4X9SA 5CZTA 1NSJA 2V0TA 1HTIA 1VZWA 3IGSA 4GUIA 3W2UA 1KM4A 1DOSA 2G97A 4UNLA 3M7WA 3VNDA 3W7JA 2Q8ZA 1EPXA 2V2HA 5AC6A 3S5NA 3GR7A 1LYXA 1WBHA 3H53A 4RX0A 4XBKA 1O94A 2B7QA 4IOTA 1VRDA 2RHGA 1MXSA 1SSDA 1AW5A 3CEPA 4QSHA 4NZJA 1OX6A 3EKLA 3V75A 1GVRA 1VYPX 2E6FA 4GE8A 4E2BA 3W2KA 2X16A 2VEKA 1JCNA 1H7NA 5AOUA 4MOZA 1TV7A 4DPPA 3PVFA 1RV8A 3NL2A 2ATSA 1YDOA 5KINA 1SO6A 3IIOA 1SZFA 3USBA 1KM1A 1MEHA 1VHNA 4CCCA 1VYRA 2W6RA 3C2OA 3G1FA 5AHMA 1XDMA 3P84A 1LZOA 1SFLA 2NXGA 3NZ1A 1C9DA 3GK0A 4C1KA 4N6EA 1XI3A 4UUIA 3H54A 1LBLA 4MLJA 4NJJA 5CSRA 2E09A 3L5MA 1GTHA 4IMFA 4LU0A 2J9ZA 1P0NA 1M5WA 1OF6A 1RD5A 1XUUA 1JCXA 4MYXA 3TC7A 3MO7A 4UFHA 3FJ6A 1K8XA 4Y6GA 1GTEA 1Z42A 1KA9F 3R5EA 4AWTA 1DORA 2NUXA 4BK9A 3STCA 1SZNA 5LNVA 4N2YA 1R30A 3P61A 4UMCA 3RF9A 5HMSA 1K8ZA 1WA3A 4YLWA 1WAUA 1ZENA 4JTHA 1UJPA 4DBEA 2E68A 2CLIA 3LTPA 5LHFA 4M19A 1TPB1 3ABSA 5EA9A 5LGZA 1SPQA 3RNDA 2VENA 5D38A 3HJZA 2V5BA 1U5JA 1G6CA 4Z0SA 5D2XA 1H60A 5C54A 3NQ6A 3GDLA 1H7WA 4X3ZA 4M5PA 3CLMA 2DZXA 3C2RA 1T8XA 4E0CA 1X8FA 1OG0A 3NL3A 2RFGA 4ICNA 2Y88A 4CNOA 5A8GA 2VEMA 1VLWA 2C3ZA 1YXDA 5K4ZA 4Q32A 3TJXA 1TPH1 3LERA 2QCCA 4UTKA 3W73A 1W3NA 1GYNA 3DI1A 3O06A 3I7QA 5TIMA 3GVGA 3TSDA 3BLFA 3LBCA 3TAKA 4O4WA 1VS1A 3HPXA 3CWOX 5I3KA 1AG1O 4A3UA 5K9CA 3CU2A 4WY0A 1OABA 4R34A 4LVGA 1YPFA 2TSYA 1Q3NA 4A2SA 2GPTA 3G1HA 4Y8FA 4MPQA 2E77A 1OVDA 2GJNA 1H62A 3C6CA 5L9FA 1VCGA 3L0KA 5CPNA 3MBFA 2A7RA 3LXBA 3S8HA 3IIVA 3G8EA 4R33A 1ME7A 3PF3A 1SR9A 4FB7A 4K38A 4AHQA 1GOXA 4XKYA 3CT7A 3PG8A 4LY8A 1BWLA 3HBLA 2G5WA 5BMXA 3CWNA 3LCFA 3YPIA 3TUUA 3FJLA 1CI1A 4JY9A 1GZGA 2B7NA 1R46A 3QRHA 3WK3A 1JUBA 1F73A 3G8RA 1OFBA 3B04A 1TPFA 1Z48A 4TU1A 2Z6IA 1AMKA 5D09A 2ISWA 1TPC1 2VFFA 4PTNA 1TPUA 2ZZ5A 1KM3A 1TTQA 2BWGA 4LNYA 1GQNA 1KM0A 2E6YA 1MSSA 3TROA 2R94A 1KTCA 2B4GA 3Q58A 1UASA 1LDCA 3UWQA 3E12A 3QSRA 3W7EA 1PL9A 5BRBA 4K7VA 1P5BA 3NAVA 1QWGA 1TPVA 3GNDA 1SQ7A 3GAKA 3LGEA 4H3DA 1SW7A 4AAJA 1PIIA 1EP1A 2NXIA 3NL6A 2J24A 1YTDA 2TMDA 4QQ3A 3M5YA 3FA5A 3SR7A 1LRNA 2P1FA 2WPBA 1S3HA 4AWSA 3EWUA 2YW4A 1KTBA 1GEQA 4XWUA 1FCQA 2Y89A 2YYUA 3WJWA 1W37A 2WNZA 1PV8A 2A7PA 1J2WA 4NX0A 2FPYA 3G1XA 3DKLA 1HO4A 3FOKA 1QO5A 1QPOA 2CZFA 3PAJA 1I2PA 1PE1A 1FWNA 2GJLA 2QDGA 3MJYA 3W1AA 3P7YA 3W7KA 4HNNA 2QKFA 3ATYA 1KM2A 2JBMA 3W7IA 2AQWA 1B3OA 3CM4A 1W31A 4LV9A 5IM51 8TIMA 2EKCA 2GVJA 3UY8A 3NM1A 5CGQA 2FTPA 3DAQA 3TSBA 3QW4B 3S6DA 4HT3A 2QCMA 2OCZA 2RDUA 5D2VA 4O16A 1TCDA 4UMBA 4OU1A 4LVAA 4MIMA 4CNNA 4HPXA 5BMWA 3NVTA 3IV3A 4POCA 2JGQA 1P1XA 4JD4A 4KFNA 2FB2A 3ABRA 3E49A 4PC8A 2VXNA 3M16A 1TYGA 4GXMA 3HGSA 1H7OA 3GDKA 2ZZ3A 4LS0A 1EIXA 5G1TA 3GXNA 3M44A 1QPRA 4O1DA 3O1NA 2QCDB 5AHLA 1IF2A 2VFDA 3P82A 3L67A 3U8GA 4BWLA 1B57A 4BFAA 4ZZ9A 1TIMA 1O5XA 4O11A 2A2IA 3N2MA 4YWIA 1G4EA 4UFLA 2BZNA 3NZRA 2AAMA 2XN2A 3TQ0A 3DI0A 3W2MA 1VGAA 4QAIA 2ZBTA 1Q6QA 2PRLA 4ZQMA 3KXQA 4O53A 1RPXA 4MFDA 3S5ZA 5G4WA 3AO0A 1KBJA 2CLHA 2V2CA 3B05A 3EX6A 3IGUA 3EX2A 4Q33A 4LUJA 5AHIA 2FIQA 5LNWA 1ICPA 5HUOA 3LXCA 2KZHA 1LOSA 4I7WA 5IBXC 2QUUA 3DFOA 2WSRA 5CPMA 1KFJA 2A85A 1R2TA 1A5CA 1DJQA 4NNAA 3GYEA 3ZS4A 1X6UA 2CFFA 3EEGA 1XUZA 3LCHA 1OFPA 1A53A 4WQ6A 4K6AA 5KZEA 1OX4B 1OFRA 2QR6A 3GAYA 1F6KA 3THAA 1WDWA 6TIMA 3ATZA 4UCGA 4AHPA 5DBTA 2Z0IA 1Z41A 4O14A 3TMLA 1JRCA 4LT9A 1H63A 1IGSA 2DZWA 3FFSA 1GYLA 2ZFAA 4HIBA 3HG5A 1TPEA 4DF1A 2BLEA 3P8IA 5DY2A 3G0XA 4M6VA 5ABTA 1I2RA 1OK4A 2OJPA 3EWBX 3VI2A 4IMDA 3BG9A 4NXSA 1E51A 1YDNA 1LTDA 3QF0A 3W7RA 2ZRWA 3IIZA 3W1UA 3LXAA 3IIXA 2YSWA 1HL2A 3GNNA 3LV5A 2B7OA 3LHZA 5LNRA 4P61A 3GZ3A 3NQGA 1KBIA 3S42A 1JR1A 1OHLA 4GNJA 4CCEA 1TQJA 4MYAA 4FIQA 1FDJA 1RR2A 4FNRA 1ZJIA 4YL2A 4KFOA 3IVSA 3PUEA 1AW2A 5LSMA 3MYPA 2E1DA 1X1OA 1XBVA 1NF7A 3E0IA 4WUIA 3R8RA 3P62A 4K37A 2Z6JA 3KHJA 6ALDA 3B8DA 4ORMA 4RKAA 4JIPA 3W71A 1I2QA 1JQVA 3TXVA 4FXRA 3N73A 3QQ1A 4NJIA 4N9DA 3TMQA 1JJKA 4IQLA 2LLEA 3O63A 3W1NA 4NJGA 4QISA 5J5DA 4JTTA 2CZEA 4TX9A 3O05A 4IGHA 2YW3A 2YCEA 2YPIA 1WBJA 1HG3A 5AB3A 1K7EA 3M5ZA 4LS2A 3W1LA 2TRSA 4KWWA 2NXHA 1FDYA 5CZSA 1W3TA 1A5BA 3LOTA 4X2RA 1N7KA 1RQBA 1WYIA 5I3GA 4LV4A 5C55A 4RXFA 1T0OA 5D04C 2GQ8A 4MJZA 1VPXA 3MBDA 3NA8A 1YTEA 1K3UA 3Q2DA 2WSYA 1K8YA 2A6NA 4H6KA 3TQKA 1BTMA 2EGZA 3I68A 3MYOA 3P5YA 4CQ8A 2NV1A 3G1YA 1TV5A 4UTUA 3MWAA 3BW4A 5TBOA 4IJBA 2C1HA 2A7NA 2ZRZA 5LZLA 1NF0A 4FNTA 1QR7A 5K7JA 3W86A 4JTKA 2H3BA 1KM5A 4JYDA 2XN1A 3NPVA 3FYOA 4HSOA 1SU5A 5CPOA 1H50A 2PC4A 5TQLA 1TRDA 4LW7A 1VC4A 3DENA 3PUDA 1NAL1 4Y90A 4XTDA 1FXPA 2G96A 3JRKA 4UTLA 3BK0A 2AGKA 1J5TA 1L6YA 3T4CA 4IXXA 1VQTA 5G4EA 3QYQA 3W1XA 1ALDA 3IRDA 3TK7A 4O17A 2WQPA 1G4SA 3TKFA 4O13A 1IIGA 3N34A 3S5YA 4ONVA 3TV8A 3TW7A 1JUKA 2D73A 2NX1A 2QUTA 4EF9A 1IXPA 3NXFA 2Y85A 1SZEA 2JKPA 5LHEA 2X1TA 4NQ1A 5J5RA 5HQEA 2BXVA 1KV8A 3HOJA 1MZHA 5D33A 5F2IA 4JX5A 4NJHA 1MO0A 2Q3OA 5F1UA 4M6QA 2FLIA 4O12A 2B0MA 1PVNA 4BI7A 3NGJA 3W88A 4FHAA 3F03K 4HNVA 3T7VA 2GQ9A 1XL9A 3GIYA 4UTIA 3BW2A 3RLVA 2VFGA 2DZPA 2DZSA 3SZ8A 4JTJA 3GLCA 1KFKA 1W5MA 2NUYA 3MI3A 4LOCA 5F2MA 4IMCA 4JIQA 1JCMP 3TE9A 1PS9A 1FDZA 2CZDA 4WOZA 3TW6A 3QC3A 1ZALA 1FY6A 5AC8A 5AN7A 3OHIA 3KVMA 4NNCA 2YXGA 2I9EA 2W79A 1VR6A 4GBUA 3NO5A 4XBSA 1JCLA 3QZEA 5I3FA 1XFBA 3UXAA 3QQ0A 5D05A 3HG4A 1YXCA 1CX9A 2IQTA 5F1VA 4LRSA 1M6JA 3NPUA 5EBUA 4UXDA 3NQVA 3UD6A 5EKYA 4Z1CA 4ZQNA 1SUXA 4DF2A 5U7SA 5DCBA 1D9EA 2HMCA 3I7SA 5KZDA 4QITA 4O18A 4WXYA 3LRKA 4UTTA 3QJAA 2V5LA 3EB2A 3FYPA 5KITA 3R12A 4IMGA 4NU7A 2Y6ZA 2PRMA 5H2ZA 2JK2A 4WOQA 2V82A 3BV4A 2FB3A 3PY2A 2OZ0A 3R2GA 4D2JA 2DJXA 1VH7A 2ZRVA 3DHFA 4PL2A 2QAPA 2OX1A 2QCDA 1LLZA 4PL1A 1NEYA 1FWSA 4ORIA 4TO8A 1DQWA 1VCFA 4YXGA 2QCGA 4Z1BA 4KWVA 2A0NA 1ME9A 3B03A 1U83A 1L6SA 4JTEA 3TAOA 3NOEA 1ZAIA 3TSMA 5DELA 2A21A 1H7RA 4ZQOA 4RCXA 1RQEA 4UFKA 2YZRA 2YYTA 2QCFA 3BGJA 3NQFA 1LOQA 4KFPA 2C14A 3W1QA 4NJKA 1XBXA 4JEQA 1OFAA 1TJRA 3SW6A 3UZJA 4UTHA 2GQAA 3IVTA 2X1UA 3WFAA 3GXPA 1M7PA 3EX4A 2E6AA 3HIJA 3EKZA 3OBKA 4UTWA 3W2JA 1OX4A 3NQ8A 3FEMA 4Z1AA 1SSGA 4DF0A 1C8VA 3MHUA 3HGOA 5HR6A 3GR8A 3QMSA 4JTSA 1EX5A 2P0OA 3P74A 3LHTA 3BW3A 3W7MA 3NQ7A 5D2TA 3ZWSA 3MP3A 1W54A 4FNPA 3LLFA 1K7XA 4LC6A 4UFJA 4HNTA 3W7NA 5U4NA 3BG3A 5HWNA 1R47A 1SO5A 3TIMA 4R7JA 4LS1A 1VJIA 3JS3A 1T96A 4QIUA 1ADOA 4NX5A 3T40A 3DGRA 4QNEA 1Q6RA 3C61A 3NQEA 5KZMA 1THFD 3DH7A 4A21A 4GUJA 1YXYA 5C5YA 3L2IA 5F4SA
chains in the Genus database with same CATH superfamily
1ME8A 4F0HA 3PBUA 1FWWA 3UA4A 4XD4A 2WO5A 1OC5A 4I9JA 2WNQA 3RN6A 1JDCA 4Y9MA 1XLCA 2VT0A 2PURA 1IR2A 1G7UA 2A6LA 3WMLA 2CBVA 4GXWA 2CLOA 3B9DA 2XIOA 3HGRA 4D6IA 4IF2A 3WQGA 5AFDA 4N9EA 4RV8A 1A5OC 1YHTA 2C8NA 2Y8VA 4OHQA 1CLXA 1ISYA 2DZVA 1GVYA 4AC7C 2VFHA 4GUHA 4JGDA 3GNOA 4JTGA 3A23A 4U4MA 1SFJA 2VGGA 1E0UA 3L5LA 1U1HA 3UWVA 4ZQPA 3SGGA 3WLMA 1H1ZA 3AHYA 3TVAA 1EO7A 3OIXA 1VIWA 4S3BA 3SQLA 3EB4A 2VVNA 1SO3A 3PJUA 1LRQA 4JKLA 3P8JA 1KFEA 4W7VA 5C8BB 1A50A 4INFA 2P3ZA 3UF9A 4JAWA 3G3DA 4M7TA 3GTNA 3BLKA 2Z1WA 3LRMA 9RUBA 4UR7A 3WF4A 3COTA 2W62A 4XKMA 1S2UA 1JIBA 1ZSXA 4MY8A 3CL7A 1HJUA 1UBSA 4EPKA 4ZMGA 2D69A 4FR6A 4O1EA 1EFZA 4HMEA 2ZVRA 3H2CA 4C6EA 3NPWA 3NDOA 4KT2A 4KIEA 5HULA 1X1ZA 3B4UA 3JUGA 5I02A 4K36A 1B3YA 2G0WA 1A5MC 3P2VA 3N25A 2VKZG 3K5XA 3W85A 4QJ3B 2OG9A 2XIQA 3VKAA 5FSEC 2X1SA 2YCJA 3WDIA 5AYBA 2V3FA 1RP8A 2Y62A 3KRUA 2PDJA 3EAUA 2OOFA 3MZNA 1RCQA 3WFLA 2J74A 5CKSA 4FPSA 1BF2A 3D0CA 3PNUA 4M6UA 4HPGA 3ALGA 3C8FA 5EYWA 4E2VA 3ZOAA 2NUWA 2DPEA 2GSJA 4OBSA 4GJIA 4PA8A 2B31A 5FF7A 4ZVJA 3WYZA 3AYVA 3MA8A 4N6FA 3NSXA 3FCPA 3PSWA 3UXDA 2FZDA 1XM3A 4GK8A 3CS2A 3CUGA 4M1BA 1DBTA 3G24A 1HFBA 1VFOA 2PDBA 4LVFA 2EJ1A 3WQ8A 5FAJA 2PFHA 1TJ2A 3AIBA 2C91A 1LROA 4MJMA 5MF5A 3WZ0E 3VIFA 4KMQA 5HR7A 4ZA0A 1N8FA 3HG2A 3WQWA 1CCWB 3B06A 3DHDA 3RYSA 4PSRA 2QT3A 3T0TA 5HK4A 3VVGA 3ITTA 3QTPA 4RE0A 4NZ4A 1KO0A 2OZ3A 1PB0A 4OOUA 1F6PA 1K02A 1LQ2A 4Q8PA 4B92A 4WIWA 3I6EA 1NP2A 5LIWX 1DJIA 2WW5A 1IEVA 4G5DA 4HB7A 4BS0A 3SRHA 2ISDA 3TZFA 1M7JA 2NSXA 3LB0A 4AD2A 4XUGA 2ZVIA 3WDHA 3P6LA 5DF0A 2G41A 1BPLB 4F0MA 2PDKA 1W1A1 1WXJA 1TR1A 4OUIA 5HNUA 1RQHA 4JX6A 3PAOA 3K4AA 5K9DA 1FCUA 5FJPA 3M41A 3T2OA 3RPDA 1AVAA 5BWFA 2NV2A 4KESA 1ZNNA 2WHKA 3L7RA 2ISSA 5HWMA 3OBEA 1EGMA 3DECA 2FKPA 3UPWA 3OA3A 3LCGA 3OODA 3WLOA 1XRTA 4GIYA 2NX3A 1O68A 4Q4QA 4G9PA 3WJZA 4DPQA 2FVKA 1EDGA 2VCBA 3BZGA 3H70A 1Y0EA 2V3EA 3S0CA 3C52A 3UXLA 3BSMA 3CNYA 1XIIA 1FVPA 2ZZ2A 4DYEA 1EOMA 4K68A 3W72A 3GXFA 1IIHA 4D6GA 1OCBA 3WF2A 4R3UA 4WF7A 4JFVA 4UFIA 3O15A 3QPYA 3W02A 4JIHA 2QXWA 1EP3A 4U31A 4B5SA 3K8KA 3FW6A 1ISVA 1S5VA 2ZZ6A 2J7HA 2QJGA 4Z2IA 2BY0A 4O15A 4OV9A 3KX6A 3W1RA 4JYEA 1E9YB 3QGVA 1BSLA 2ZTJA 3GE7A 4RE2A 3ZSTA 1DV7A 3BVJA 1TMHA 2ISVA 3VOJA 2OLHA 3W7OA 3HQOA 1MXGA 5JXQA 3R58A 2QLYA 1GVQA 2WJDA 1PCWA 7ENLA 4LUSA 4LRTA 2C7FA 2VFEA 1EB3A 2PZNA 3SCNA 2YB1A 5DMMA 5CJNA 4RZ4A 4PUNA 2PDFA 4AU0A 4DO5A 4H4IA 2DJLA 1GK8A 2PS2A 4UQ9A 7PTDA 4K7YA 4M1RA 4PMOA 4V33A 4KH2A 4HOWA 4CCZA 2OODA 3VA8A 1QHZA 3WEZA 3B40A 3SFWA 1FWTA 3A21A 1VYSX 4H01A 3W4RA 3QMTA 1HKIA 3KS6A 4LY4A 3M47A 5DY3A 1QNOA 3WJSA 2PSNA 2WZMA 2OLAA 1WDPA 5G1MA 5AC7A 3U5UA 3FAWA 3MUAA 4YTSA 2HISA 1E0WA 1M03A 3REQB 4P7NA 2W0UA 4GGBA 3AS2A 4JEJA 3C2FA 3LRLA 4H9YA 5LA0A 3EXTA 5FJJA 1LBMA 3I6RA 3AXXA 2P53A 4UIOA 2XU2A 1BVNP 1QBAA 2BG5A 4OBRA 3DFSA 2EKGA 1UIPA 2DW6A 3RM9A 5AVNA 3VX0A 2JFEX 2QJIA 1GKPA 3KTSA 4K3ZA 1XYFA 1IGWA 1B5TA 2WNNA 1JULA 2V30A 4DY1A 1S2TA 4RV3A 2WC3A 1REQB 1XH2A 2DZTA 1M7OA 2I14A 4GYJA 2C1IA 3VE9A 3N15A 4UTTC 1J2BA 2XPKA 4N02A 4LWWA 5L6UA 4JFSA 4YIWA 1KXTA 1S1PA 5EMUA 2IW0A 4FNUA 4AFYA 1OFQA 3QH2A 3LBMA 4GFSA 3W9ZA 1AUSL 3WELA 4BA0A 3OVPA 4L4LA 3AJXA 3NCOA 1JGMA 2NWSA 2FTYA 2A4AA 3UJFA 4I5XA 4E2DA 3U9IA 3MCNA 4AVNA 5DN1A 2ZC1A 1C8QA 2WZTA 1MQRA 3GZAA 1VBUA 1O12A 1LG1A 4HU0A 4Y8EA 3CHFA 1JUEA 1YRRA 3TCSA 1TREA 1PIFA 4W9TA 2WCAA 2QAFA 1U30A 1CLKA 5F4XA 1XIDA 1Z7AA 3DN5A 5E1QA 1POKA 3L21A 1XICA 4UTFA 1GG0A 3CGTA 1H51A 2X1IA 3OEXA 2VUYA 5DLCA 4AYGA 1H3GA 4RZ6A 2YA0A 3EWYA 1P43A 4JPGA 2W4XA 5A8QA 4DO4A 4GH1A 4FNQA 1G4PA 5MKGB 3CQHA 2Z00A 3OBAA 1EBGA 2V69A 2IS7A 1LORA 1W3LA 3WG6A 4I7UA 4LYRA 4XISA 4J40A 4CNSA 2CHOA 1C9WA 3WEMA 3N4FA 6XIMA 2C79A 5IXEA 4AG0A 1UB3A 2FQIA 1NWSA 2I5QA 2GGJA 3A5FA 1Z8AA 1R3TA 4JL1A 2OXNA 3BE7A 1HP4A 1JGIA 4AWUA 1JQXA 1F7BA 2J7GA 1GKRA 1FCVA 3G1AA 2JGYA 1JG9A 3VIGA 2RAGA 4RR4A 4LQ1A 2X7WA 4DZAA 3O6AA 3UZ5A 4B5TA 1D2KA 3K4WA 1ISXA 2DY3A 3UNTA 4HZ6A 3M1ZA 5F7UA 3EA3A 4AF0A 1T41A 1XLFA 2PCQA 2VEPA 4H9TA 1LG2A 4CQAA 1E3ZA 2ZA1A 2X40A 5DCEA 5EPDA 1EC8A 2D3LA 1OGGA 3NYDA 3KL0A 4PMZA 4Q8NA 4I5UA 3F4WA 3ZYZA 3GRIA 3UU0A 1IXQA 3KBSA 2ZC8A 3KL5A 3N13A 5D2WA 1IWBA 2OU4A 3L4VA 4GY0A 3N3MA 1RA0A 4DWSA 5KMYA 2WSPA 1UA7A 1AK5A 3GIPA 3WDPP 4YCOA 4RXGA 5E9XA 4Z2KA 3E6EA 1EOKA 4BEQA 4FXJA 2HVMA 3S4TA 5K4XA 2DU2A 1B1YA 3GG0A 3TR2A 3VCNA 5CC5A 1K6WA 4MWAB 4UWMA 4UZSA 4O57A 2Z28A 1GWJA 1UZDA 2DIKA 1KKOA 4WY0B 1N55A 3NQDA 1LRTA 3IGXA 5E6ZA 4OE7A 4EWND 3NO3A 3PZVA 4O1AA 4GZ7A 4L1GA 3KE0A 1TPWA 5CZJA 3L0GA 3WCZA 2OT1A 1N8IA 3WJXA 4FXSA 4GJ1A 1UWQA 4S1FA 4I9TA 3BAIA 3EX1A 1MXDA 4ADUA 3E0WA 2YCIX 3U6WA 2Y7EA 4A29A 2ZOXA 1U1JA 3TC3A 4B2DA 5JIWA 1OC6A 4GINA 5C6MA 3BMXA 1AW1A 1GQKA 3SFKA 3IACA 3LDVA 3AFBA 1YE6A 1EKOA 1QMLA 3CB3A 3VGEA 4IMAA 3BLIA 5FAGA 4FK9A 1G67A 2D22A 1ZL1A 3T08A 3N11A 2J7DA 5LIUX 2WMFA 3NGFA 1BKSA 1TUXA 1U2YA 5H6HA 4MB4A 1T40A 4GIEA 3MVIA 4P8WA 3VTRA 4GA8A 2J9YA 1EJVC 1I0BA 1VLIA 2RKXA 3UZXA 3UWZA 1A5AA 4HPNA 1JCJA 5AHEA 4LANA 4NG3A 5FIPA 1OD8A 5D9PA 4IZGA 4L6HA 3SUUA 2OYMA 2YDRA 2VZUA 1K03A 4GD0A 4G7EB 3FS2A 3FLUA 5FEZA 3EPMA 3C0JA 2C13A 3GDRA 4MWAD 3VILA 4YTRA 4ML9A 1P6BA 1MI3A 4K2SA 2WVTA 1C8XA 1H41A 2FFCA 1J4EA 2QJHA 2WMGA 1GT8A 3NPXA 5BW6A 2PUZA 2EG8A 3B9AA 2PGFA 3G18A 3K46A 1KXVA 3W23A 4JN6A 3M0XA 1YEYA 4RLIA 3OZYA 3KW3A 4WDWA 4D71A 1DHKA 1TMLA 4CLMA 2Z1VA 3QTGA 3DFPA 3W29A 3TYDA 4ZO6A 4O28A 3D6NA 2R6OA 2OSXA 3IGHX 3S47A 2QCNA 3G77A 3BPWA 2PD9A 3SSZA 4GC3A 2NW0A 4I8DA 4EF8A 2W92A 3C0QA 2YL6A 1EP2A 5FF3A 5SWUA 4V15A 5K3VA 1SJCA 1DIEA 5M3WA 5CZ0A 1UWIA 1FCBA 1TSIA 2GVEA 2Q8LA 3LHVA 4CN1A 2NWRA 4XG1A 1BXBA 1PIGA 2IKJA 1ZFJA 4TVCA 1KRMA 4GLEA 1DE5A 3MSYA 1JRBA 1U5HA 3SECA 2GWGA 4U28A 4DELA 4GVIA 3M0IA 2JE8A 4FO4A 1LBFA 1J6OA 1YPIA 8XIMA 4CD6A 3BOXA 1XIFA 1XW8A 1UR4A 8RUCA 4Y9AA 1KNWA 4QEHA 3WH8A 3CPUA 5HNTA 3MDUA 3ITGA 2G97A 1SM9A 4H00A 2DH3A 5AC6A 2W67A 1CXEA 2UWFA 5TNVA 3SCWA 4RX0A 1O94A 2B7QA 4IOTA 1VRDA 1PKLA 4QSHA 1OX6A 3N3TA 1VYPX 4ZO9A 3W2KA 4V2XA 1LUCA 3PVFA 1RV8A 3NL2A 2ACQA 2GWNA 3SADA 1RALA 1YDOA 1SO6A 4HJWA 3MQTA 1VHNA 4GACA 4CCCA 2GJPA 2DW7A 2QUMA 3QR3A 1CYGA 5CSUA 5A8MA 3SBFA 1QK0A 4J7RA 4W89A 1OD0A 4C6IA 3APGA 4JCMA 1SFLA 3GK0A 1RY8A 1PYFA 4V1XA 4IIFA 4GABA 1X6LA 4IFOA 5CSRA 1GONA 4X60A 1OC7A 1PTGA 1A49A 3ITVA 4UFHA 3FJ6A 4LXFA 3CUZA 4DNHA 1GTEA 4XD6A 1DORA 4G56A 1FTXA 3HURA 3STCA 4Z2HA 2ACSA 5CEWA 1SZNA 1W91A 1NFGA 4UMCA 4YLWA 1E5NA 1WAUA 4JTHA 4IPLA 4AD0A 3HA1A 2E0PA 3F5LA 7REQB 1KBLA 1GQLA 4HHLA 5EA9A 2ZX8A 1YNPA 3RNDA 4ECLA 4LPCA 5D38A 3HJZA 1G6CA 1E73M 4MAZA 4IQJA 5GPRA 4Z0SA 2V5KA 5C54A 3GDLA 1A3WA 4H7CA 3HTWA 3LZ5A 4ICNA 1N82A 1E1CA 2XH7A 4Q32A 1TPH1 3QR1A 2QCCA 1RAKA 1E6RA 1GYNA 3EA1A 3SRKA 4O4WA 1Z69A 3A13A 1V0MA 4AX6A 5A6BA 1TZZA 3EOSA 1QNPA 1OABA 4LVGA 3G1HA 5IFPA 3KBWA 2GL5A 3FVDA 4LEQA 3F5JA 3C6CA 1M9HA 1VCGA 3KLLA 3IJ6A 2A7RA 3LXBA 1UPPA 4ACZB 1LF1A 3L2MA 2GVYA 4Q4MA 1W1PA 4K38A 4AHQA 3OZOA 3BJTA 3PPHA 4QLLA 3CTTA 4QS5A 4GQGA 4W88A 1CI1A 2PDNA 1VPQA 1R46A 3UR8A 2R1KA 3EDEA 3H21A 4FR1A 2XDFA 1OFBA 2HDJA 3B04A 1TPFA 1WE5A 1E71M 1NOWA 1UZHA 3RLGA 1XSIA 1TPC1 1TPUA 4F2TA 5E70A 2E6YA 4MDPA 4AD4A 3MU7A 1LDCA 3UWQA 4GY1A 5BRBA 4XAZA 4AZCA 4RNFA 3GU2A 4C6KA 4WSKA 4UB9A 5LYRA 3UJRA 1VEPA 3LGEA 1PIIA 2NXIA 3PZQA 3M5YA 3WD0A 5LIKX 1RVKA 5I5RA 2WPBA 1S3HA 4BJHA 4AWSA 2X41A 3TYEA 2OWCA 3TN4A 3U4FA 1JL8A 1FCQA 3PWIA 6REQA 1J2WA 3G1XA 3SJNA 3NWRA 2D2JA 1I2PA 3FX4A 5DANA 2NQ9A 3W7KA 1J0HA 3IK4A 3ATYA 2XH0A 1EJUC 1B9ZA 1NELA 1R85A 1IWPA 2EKCA 2GVJA 3NM1A 2VGBA 3WMSA 3M07A 4HT3A 4FZIA 3BWWA 5D4YA 3TTYA 4OU1A 4J3WA 3NQBA 5BMWA 2AQOA 1ISWA 3N17A 1P1XA 3UCDA 2FB2A 1PKYA 2CBUA 4GVGA 3A4AA 1W2PA 1TIWA 2INZA 1TYGA 4GXMA 1H7OA 4C5YA 3BURA 3LPFA 4L7ZA 1EIXA 3M44A 4O1DA 3O1NA 2V5JA 2VFDA 3L67A 1B57A 3FDKA 1TIMA 4E8CA 4HP5A 2A2IA 4Q7IA 4XUYA 1UIOA 4EAYA 3S6TA 3RHGA 1R87A 4FI4A 3A47A 4ZSTA 3N2CA 3U2CA 4JBRA 5G4WA 3GH5A 1UR3M 4Q33A 4HVXA 2FIQA 3BJFA 3RDKA 3LXCA 1KGUA 4I7WA 2BDQA 2OFJA 2WSRA 4PMDA 4DUVA 1OIMA 5IFTA 2BY2A 1A5CA 1LT7A 4EXQA 4TUFA 5B7YA 3LCHA 1OFPA 3FJ4A 1DJYA 3OGSA 2C1GA 4FXFA 2QR6A 1GVEA 3OVGA 1V6VA 5C2CA 1ZBVA 4UCGA 3VDCA 2OTDA 4AHPA 9XIAA 3T0DA 4BQ5A 4LT9A 1JZ2A 2L5HA 3EMZA 4LCQA 3WUFA 1M41A 5ABTA 3L4YA 2TODA 3UG3A 2OJPA 4NAEA 4IMDA 4QRNA 4NXSA 3QOMA 4ASTA 1UH4A 2YL9A 3QF0A 3KP0A 2HWGA 3R0KA 4IIDA 3W1UA 1HKJA 1B30A 3IIXA 2ZX7A 4QE1A 4S3AA 2B7OA 2GUBA 2VRQA 2Z4GA 5M03A 1K8CA 4A3RA 2BHUA 3CK5A 3LA4A 3S42A 3KDNA 1OM0A 1OHLA 3I3DA 4GNJA 2GGHA 2VMFA 1Q65A 4QG9A 4FIQA 1FDJA 1VBGA 3GWQA 2Z26A 4PCTA 1HVXA 2E1DA 1WB0A 1RK5A 5M17A 4FLRA 4C6BA 2VCAA 1KBKA 4GI4A 2Z6JA 6ALDA 3MY9A 1YPXA 3EYPA 2PAJA 4MF4A 3CJPA 4M3PA 2P50A 4CQBA 1JQVA 3BAKA 4PUKA 3DG7A 3QQ1A 4N9DA 1LWHA 2LLEA 2VQTA 1JZ4A 1JYNA 1UYQA 2YW3A 2QULA 3WQ4A 3WQFA 3SUTA 3LK6A 5ECVA 4KRUA 1FWJC 2OEMA 4X2RA 1RQBA 1OB0A 1SVDA 3ANVA 2V5CA 1KCXA 1NFPA 4RXFA 5D04C 1VPXA 3KOZA 5HXMA 2JIEA 3PZNA 3NA8A 2WSYA 2A6NA 2GYIA 2FGZA 3I68A 1TR9A 2VDHA 4GMEA 3WKZA 3MWAA 4U3AA 3WH6A 3WLQA 3CZLA 1UR9A 3N1AA 4P7LA 3W86A 4JTKA 1KM5A 2A3AA 4PUEA 5CG0A 1XDJA 4HSOA 3TLQA 2R1MA 1GJWA 5TQLA 2XH2A 3P14A 5HQLA 4W85A 2G96A 3JRKA 4OFCA 1RPKA 4B3LA 1UWRA 4R7OA 4RZBA 3KM8A 1J5TA 1FFRA 1JF5A 3QYQA 1ALDA 2WQPA 1F3EA 3TKFA 4HHHA 4QJ4B 4O13A 1KCLA 1Q63A 4KCTA 2GGIA 2HNEA 4OOZA 3TV8A 5E6YA 1CXFA 3TW7A 2XGIA 1BWVA 5I78A 4PRTA 1JUKA 4JQ1A 2Y2WA 4EF9A 2X0SA 2Y85A 4QCEA 3HN3A 1MW1A 1V02A 2VEGA 3RXZA 1SZEA 3UVAA 3LMYA 4HU3A 5C7VA 1MZHA 1IEXA 2XUCA 4DN1A 4NJHA 1VFHA 3AXKA 5F1UA 1SMAA 4CD7A 2QIIA 5HPCA 1UZ4A 4BI7A 1HNYA 3F03K 4F9JA 3PFRA 1XQKA 2J8GA 1UR1A 3MKVA 2OSWA 4Q7NA 3GLCA 3L4WA 1KFKA 1QUMA 1EQCA 3MI3A 4LOCA 1DWFM 1BGAA 3TW6A 1TUFA 1EGZA 4NNCA 2JQXA 4XBSA 1ZTVA 3CL8A 3AYSA 4M8UA 5D05A 3IUDA 1YXCA 1CX9A 3HPFA 4C6DA 3GD6A 4LRSA 3NPUA 5EBUA 3UD6A 4ZQNA 4DF2A 1L2QA 5FD0A 4GO9A 2HMCA 3H24A 3KBMA 4O18A 4DI9A 3LRKA 4UTTA 3QJAA 3FYPA 3EB2A 3TN3A 2VGIA 2KAUC 2Z1SA 3R12A 4IMGA 5H2ZA 1MUWA 3VOCA 3S2LA 4KF1A 3DYPA 2VZOA 1R7OA 3PY2A 4XIMA 1G5AA 3R2GA 3WQVA 4D2JA 3SEPA 4PE8A 1CZ1A 2QCDA 4PMVA 3WDRA 3VKCA 1HQTA 4PL1A 3AHZA 4PB5A 3GNXA 1WKYA 3WUBA 4US5A 1JDEA 3PJWA 4KWVA 1AA1B 1S2CA 2O0TA 2YBTA 3TYBA 4DNMA 4JTEA 4MKSA 3APTA 1MUMA 1QI3A 3DC0A 5DELA 5CZKA 3WF3A 1H7RA 3IJ7A 1E4MM 3VM7A 4CQDA 2Z1KA 1L8PA 2QJNA 3NQFA 1LOQA 4KFPA 1UD6A 2O55A 2XM1A 1OFAA 1TJRA 1E5JA 3WLTA 1R3RA 2X1UA 3WFAA 3BCFA 3QKZA 3UR7A 1QU4A 3SM0A 2E6AA 4P8UA 3DBNA 3W2JA 1Q4WA 2HQAA 2CXGA 1C8VA 4KERA 2ASHA 4FOUA 2R1PA 3URNA 4S23A 4DBUA 3W7MA 1UQZA 4FNPA 5CH9A 1V4YA 1K7XA 1TX0A 5U4NA 3BG3A 5HWNA 1R47A 3TIMA 4R7JA 4LS1A 1A4MA 3JS3A 1VJSA 3C61A 2R82A 4IIHA 4OTKA 4P8VA 1THFD 3TJIA 2J66A 3CZKA 4A21A 1A3HA 4D6JA 3QMRA 3R8GA 1XDLA 4C6NA 3KP1A 3MP4A 3LCXA 4ACYA 1NVMA 4LUSB 2QMKA 1I2OA 3QZAA 2HVNA 3E2SA 5FJTA 1W5OA 1UKSA 1NQ6A 5IDZA 5FKYA 4O1FA 7A3HA 3WSUA 4EPDC 1TFVA 1TWIA 4M7SA 3E0FA 4IICA 3WQ5A 5ABHA 2PTDA 3XIMA 3EDFA 1QNQA 4MKNA 3W7QA 3W6YA 1MNSA 2GUYA 4M6PA 3V0TA 3MV11 3T0AA 2XSAA 3W53A 2O92A 3EWWA 1EDTA 4CEXC 4H2HA 4DHGA 4QJ1A 1DE6A 4XQ6A 2YLLA 1JZ3A 1SR0A 3EWXA 4O0KA 2A3CA 3GR4A 3HPSA 5AYXA 2AL2A 2J9XA 4B90A 2PE4A 2CLKA 3LSCA 2NSOA 1BKHA 1T99A 3LCIA 3Q67A 1ZAHA 2ZRXA 1FH8A 1JI1A 3MTWA 5DMLA 1R3VA 3USZA 1RBLA 1WDSA 3RRAA 1A0CA 3M5VA 3EA2A 4UCFA 3HQ1A 2R24A 1EQPA 5JIPA 5DBUA 1R5YA 1BD0A 3HV9A 3QHOA 4ZB0A 4XZ9A 3VIPA 4EPEC 1V77A 2HSAA 1H49A 1WOAA 4CNPA 2PTYA 4ZO8A 3W24A 3TNOA 5DRIA 3MMTA 4KKXA 3GDMA 5CAHA 3WLLA 5BXSA 3P80A 1E70M 3IJQA 3E2VA 1QW9A 1MRAA 2ISFA 4D8AA 2QEZA 2BFGA 3ZXWA 1DJHA 5D30A 3PZUA 4GZJA 2CNCA 3WNOA 4IM4A 3ZLGA 4FAMA 5GVJA 3RFAA 3PB2A 1CGTA 1DIDA 4GHRA 3KL3A 5K9XA 2E8YA 4I7VA 4A35A 2HRWA 4WZHA 2DIEA 2YFNA 1YTKA 2DZUA 2A3EA 2Y4SA 3W7GA 2OO0A 1E6NA 3EKGA 4PB4A 1IXOA 4F4RA 4K8EA 1TX2A 3VIJA 4O4VA 3TTEA 1JF6A 2DZAA 2POZA 1IZCA 1NTHA 5F2LA 5FF4A 3TLLA 5CG7A 3N14A 5A95A 2HBVA 4IP4A 4OV4A 2G95A 2QCLA 1U1UA 1ICQA 3TN5A 3VIMA 3W74A 2GVLA 3PZOA 4PYSA 4W7UA 3ANYA 3AROA 3T55A 1F2JA 1PAMA 2WCSA 1OT1A 2YKKA 3W3OA 3TJLA 3BQ5A 2QW5A 1GW1A 1V7YA 4D6FA 2DSWA 1MRQA 4F40A 3TDFA 3QFWA 2IPWA 1NDWA 1LCOA 4W8LA 3S2NA 3A3XA 1GJPA 4JTIA 2F8QA 1RXOB 3WH7A 4OGZA 1E72M 2Y7DA 4C6QA 3KBNA 2J7BA 3GTFA 3ELFA 1VF8A 4GNVA 1W1ZA 5A6MA 4ZOBA 5IDIA 3CL6A 3K13A 1W1IE 1DYSA 3GDTA 3AMCA 4IT1A 5REQA 1I1XA 2PDGA 1WKDA 3QY6A 4FNSA 4BR1A 2GSHA 3LD5A 1SZGA 3PM6A 4LC8A 1ZY9A 2OELA 4ZL1A 3EWDA 3UNDA 1D3HA 2FHFA 4C1LA 3WQEA 5BOEA 3OYZA 1IWAA 1RUSA 1AQMA 2YBUA 4BCEA 3LHYA 2NZLA 1XXXA 3CWHA 1FHLA 3RCNA 2BHZA 1B54A 4WX2A 4AF0B 3PN8A 3FA3A 5HINA 3KCJA 1HO1A 5A6KA 4BF5A 1QOQA 2BODX 2QDEA 3E3HA 3QFEA 1CEOA 2H6RA 4GC4A 3AQUA 2HE8A 3Q37A 1GVSA 3DG6A 4JN8A 4JTQA 3VNJA 2RDTA 4AWEA 5HJXA 3F4NA 2X2GA 4J3UA 4W7WA 2XSXA 1XSJA 3PPGA 3TN6A 4DWSB 3JU2A 5CC6A 3T8QA 1E0TA 1AH0A 4XZWA 3L4ZA 4N4QA 3WJYA 4DAIA 1C29A 1I1WA 4W5ZA 5G2IA 4WJ8A 1XYMA 2X1RA 3BAYA 1BVZA 4B3ZA 1IT7A 1VKFA 4MUZA 3UZWA 3UXKA 2HCVA 2HVOA 3GIQA 5I3HA 1SJAA 4V1YA 3G1SA 1BYAA 3NSNA 4PTXA 1J9YA 3RX4A 4NXKA 3ES8A 3KRSA 2HXUA 3MWCA 3AICA 4LYKA 3H55A 3H2FA 4BQ3A 1DWIM 4FALA 3RUBL 3HO8A 4MGGA 2GUUA 3KOFA 4YNGA 3ITYA 2MANA 4LAKA 2W3ZA 1J5SA 5LNSA 3VUPA 4QHRA 4HHMA 2O7QA 3NNTA 4NKCA 4QDMA 2VD8A 5KSWA 4JICA 1V0NA 4Y96A 1ECQA 3L23A 4BKNA 4FF7A 1HKWA 3KCLA 1HF6A 3HF3A 1TB3A 5EBAA 4MZ1A 2YA1A 1UQYA 4UNKA 3UPBA 4FLQA 1I6NA 2QDHA 2PD5A 4WXZA 4J5NA 1OEPA 1GJUA 1W9VA 2PDWA 3GC4A 1LWJA 1QRQA 3VGFA 2O4QA 2EBNA 5HJLA 4GQRA 5H1WA 4LNCA 1H7XA 3EX3A 4W5UA 1PCKA 2EAWA 2OGYA 2VFIA 3PS7A 4RPPA 3RX3A 1OCQA 4QG8A 1MFUA 2GOKA 3AWNA 5IHSA 5BRQA 5I0DA 4HK5A 1P4CA 1XGDA 1H5VA 4LVBA 3GXDA 4AXKA 4J1OA 2YR1A 3U7BA 1QPNA 4GBDA 1OT2A 2A1YA 3H7RA 3H2MA 4DWSD 2CHNA 1JYXA 3P3BA 1FH7A 2QNEA 1V7AA 3A64A 4JS3A 3THQA 1TTPA 3HB9A 5I7GA 4Q4RA 3WK0A 1BEUA 3CMJA 2INEA 3UCCA 2J27A 4H8NA 2G50A 1F5ZA 4XZLX 3GXIA 2Y5EA 4FEZA 1L8NA 3QY8A 4HZMA 4M82A 2FGBA 3PK7A 4LYPA 5AECA 5EMLA 2GQ3A 3TOPA 4YCPA 1US0A 4MY1A 3BJSA 1J0YA 2CKSA 1FWDC 5K2ZA 4FMVA 1DQXA 3UQNA 3MVTA 4P7OA 1Q8AA 3C0SA 3BLEA 2R91A 1QT1A 3PUOA 3LTYA 1JAEA 1F3XA 1ZJBA 3OGRA 3VZXA 3UWEA 3GKFA 4K8HA 2ZUTA 5A5WA 3OP2A 2Q71A 1PKNA 3EDJA 2W66A 5FF0A 3W1PA 1EDQA 1EBHA 2REQA 4Z17A 3W76A 1A5UA 3OW1A 3BARA 1PYMA 4DYJA 2OX4A 3OZPA 3TW9A 1E6ZA 3SCSA 3TH6A 4ALDA 4MWAC 4Z1DA 1CT5A 3OLEA 4L4PA 4G2DA 3BLPX 3SIZA 1H1NA 4OBTA 1ONRA 4AIEA 3ZSSA 2WVVA 4KS0A 1A5KC 2PTXA 1S2WA 4KRTA 1FBAA 3K8LA 3GY1A 2QJJA 2CC0A 1W2VA 5AHNA 3CLWA 4DXVA 3B4YA 3KOYA 1H1YA 2GVGA 5BROA 3STPA 2W91A 3W1MA 1GPWA 4ZR8A 4BF9A 3IUHA 4WKAA 1XBYA 2WANA 1DKWA 1GCYA 3VOFA 4CU7A 7TIMA 3OB8A 1FXQA 2WSQA 1ZAJA 1IEWA 3MKCA 1E56A 1LUCB 4GRSA 3E0LA 2QF8A 5E9AA 4ZTXA 1JVNA 1SFTA 4S3EA 1LP6A 1ONWA 2RDXA 3S1XA 3UG5A 2V8ZA 3B8SA 2RGLA 4DEFA 2EF9A 3PBVA 3W7PA 3G2GA 3WH5A 5CC3A 1ITUA 5A8PA 4ROPA 2OYLA 3UJSA 1NH6A 3CIXA 4C1NA 3ONBA 1NWRA 3B8UA 1PPIA 4D6EA 4ZTYA 3PUGA 4DBWA 2CZ5A 1VHCA 1Q6GA 2XM2A 4IG2A 2I17A 1HT6A 4GGHA 3NQAA 3BG5A 4HZ8A 4AZHA 1TPDA 4B4FA 1TA3A 3C0LA 1UD2A 5FL1A 5CSYA 5C71A 1A5LC 2H90A 3WUEA 1W3IA 4P2VA 3KOWA 1TO3A 4PTDA 5D32A 4RNHA 5HMEA 2BXZA 2BY3A 1UD3A 4R9XA 3E02A 1ONEA 3DU0A 3T81A 1E1CB 4KCUA 3GX9A 3S1UA 3FGCA 1FWEC 1RJRA 2ZZ1A 1PEZA 2ZXDA 1MEWA 4A2RA 1NFBA 1LWIA 3IWPA 2A3LA 1SYTA 3SAZA 4MNJA 2PC8A 2VC5A 4XAYA 1QPKA 4IPIA 1V5XA 3G0UA 2VOMA 1EC7A 1JYVA 4IXHA 4AZIA 2CESA 4JTLA 2YX0A 1Q13A 3M0YA 1WP6A 3V5FA 5LA1A 2ABBA 2BX7A 4O1BA 4H7ZA 1VD6A 5T8GA 3GC2A 4GISA 3NO1A 1P1MA 5HPOA 3QN3A 2D2GA 2D24A 5FEWA 4HMDA 1C90A 1GG1A 5H8PA 2QUVA 1LM1A 4QM1A 1ADSA 2ZUMA 3HJEA 1EF3A 1G9HA 4HPJA 4S3GA 2ATMA 3S3GA 4Q6JA 2PDIA 3UP8A 3MUCA 3OVRA 1WZLA 2ZRUA 3IVUA 1L2UA 1POJA 4O19A 4C6LA 4S3DA 4JDBA 4MNKA 3VM5A 3JW7A 2C15A 5EL1A 3WMCA 1I0DA 3VFCA 2PWEA 1B3XA 1OQFA 2WK2A 4HKPA 4U2YA 2DDXA 4A8LA 2HS6A 1B2YA 4AZCB 3SN1A 3UFYA 4DIAA 4S2CA 4DO6A 2J6XA 4KWUA 1AODA 1SO4A 2HS8A 3CXOA 3PJXA 3T9PA 2GOUA 5DFAA 2WPGA 1TCMA 3H7UA 1ZCCA 3DKJA 3WDJA 4O1CA 3PZGA 3PSVA 3B0VC 4PGLA 2ZICA 4O52A 1HIZA 3CQIA 4PRRA 2ICSA 3ZR6A 3Q94A 1QXLA 3TFXA 5CAKA 1F4HA 1DJNA 6REQB 1RLCL 3EOOA 3ZR4A 1W9UA 5A6BD 1FX6A 3OO2A 3VABA 3D3AA 4PCFA 3B3DA 3DYMA 2V81A 3O07A 1WAWA 1D7FA 4PUMA 4QE5A 3MUIA 3CYJA 3QXBA 2V2DA 2H3DA 4EKJA 1E6SM 3MI2A 4NHVA 1EJXC 4PEKA 4DVOA 3FJNA 1SW0A 1E9LA 2VURA 2YZ5A 2VO5A 1G94A 1JYWA 3BO9A 2VC6A 1S5MA 3JR2A 3VNIA 2J6VA 3MHFA 5BXPA 3R7MA 4QROA 4AHOA 1HJXA 3U57A 3VD9A 3S1WA 2FPVA 1H4PA 3ITXA 3NQ2A 4N4PA 3W22A 2VZVA 1L6WA 1HJSA 1LL4A 2PDXA 3VOGA 1VAHA 1T5AA 5FEPA 3SCUA 4DAFA 1Y5VA 1LOLA 4EIVA 1JNEA 2JALA 2W9MA 3FKKA 4WRHA 1TQXA 2J13A 1W6TA 1G7VA 1HL8A 4HQVA 3GVWA 4Q8MA 3B0PA 4R88A 4KEUA 1QOPA 1WDRA 2FHBA 4LF2A 1Z9AA 3WLRA 3AXIA 4PR4A 4Q8VA 3EWZA 1CWYA 1NSJA 1JCTA 4LB4A 3QY7A 1DOSA 5AYIA 2QPUA 3M7WA 4UNLA 3W7JA 1EPXA 2GLKA 3TNBA 5HJYA 1CPUA 1JNDA 1WBHA 3H53A 4H6QA 3M0KA 3CQJA 4ZCWA 3Q45A 3UJEA 1AW5A 1XF0A 5DO8A 2XWDA 4L9XA 3VIIA 3WD4A 3NUKA 4M24A 2E6FA 4E2BA 2X16A 4AIBA 2VEKA 1H7NA 2X42A 2BY1A 4DPPA 5JH2A 1R38A 3VMPA 1F3TA 5KINA 5EFFA 4NAEB 1XISA 1BYCA 5AHMA 3UZYA 1XDMA 4TV5A 3P84A 3AMLA 1JAKA 4Z2LA 3WNMA 4GYFA 3K1GA 2C71A 1C9DA 1E1FA 3GHUA 3GG8A 4N6EA 1XGEA 1XI3A 1A0DA 4JKMA 1MW3A 2Y0FA 3H54A 1GEHA 1LBLA 4HA0A 5GNYA 1LL7A 4AYSA 4IMFA 4CU6A 1P0NA 1RD5A 1JCXA 4MYXA 3PPCA 5H8UA 4H19A 1TZ7A 1KA9F 2UZ9A 2YL5A 1DJGA 2ZX6A 3V35A 2WKLA 5LNVA 4FLSA 4NF7A 3P61A 3WIJA 1XLHA 1K8ZA 2DZBA 2VCCA 1R3QA 1ODZA 1UJPA 3SDOA 1XINA 3BUVA 1EYWA 2CLIA 4NZ3A 2E68A 4M19A 1TPB1 1EHNA 5LGZA 4MDOA 3WD3A 2VENA 3R10A 4AUBA 3NQ6A 4X3ZA 5LXXA 2XVPA 4M5PA 3CLMA 4ROQA 3C2RA 1T8XA 3H2NA 3CUHA 2RFGA 2Y88A 3A4XA 5A8GA 1VLWA 4TOQA 3TJXA 3KWSA 3MPGA 3W73A 1W3NA 3DI1A 3UG8A 3O06A 3I7QA 3ITOA 1V3IA 2OEJA 3TSDA 3BLFA 2OWXA 3SCQA 1OGSA 2GGEA 2O9TA 3D3FA 3G1RA 3TAKA 1VS1A 4A3UA 1GOOA 4R34A 3ZVIA 2E77A 4WCJA 4QFUA 4AISA 5KETA 4IGMA 1GYMA 5CPNA 1IT0A 1OCNA 4C7GA 1SR9A 5ABFA 2J8FA 2PGRA 1PWMA 3AMGA 1EYEA 2VZTA 1O6IA 3HBLA 4ZO7A 5BMXA 3LCFA 1YMYA 4JY9A 1GZGA 1UA3A 3QRHA 5A2BA 1EJWC 1JDDA 2NQZA 1Z48A 2ISWA 2FMNA 3N4AA 4JFUA 2XVKA 3CUJA 1TTQA 3AS0A 4LNYA 1CENA 1GQNA 4TV6A 1KM0A 1QNRA 1V8EA 5I2UA 4HK7A 2R94A 1KTCA 2B4GA 3Q58A 4ERAA 1UASA 1ZS2A 4GJJA 3W7EA 1CXLA 1GW9A 5JBFA 4M29A 3TYAA 3MZ2A 3H22A 1QWGA 2JEQA 3GNDA 3H23A 2ONEA 2Q09A 4H9VA 3NVDA 1EP1A 2CKRA 2J24A 2OVLA 1XKJA 1EHAA 4XIAA 3M0MA 2GSEA 4AEFA 3EWUA 2YW4A 4XWUA 4Q8TA 3T2QA 1TJ0A 4NX0A 1IZKA 2FPYA 4L6OA 3FOKA 2Z2AA 2CZFA 1ZUAX 3PAJA 3T6CA 3MJYA 1VJZA 4DWDA 1UD8A 2JBMA 1P0EA 2AQWA 1B3OA 5IM51 8TIMA 5FL0A 2ESCA 3UY8A 5CGQA 3WNLA 4E4FA 3QW4B 3TTSA 3SUVA 2XFYA 1KCZA 4O16A 4MIMA 4HU8A 3NVTA 3IV3A 4Q4OA 1YQ2A 2VX4A 4JD4A 3VGHA 4C65A 2QVNA 1XH1A 3AALA 4MPKA 4YTTA 3CBWA 3HGSA 4PZVA 3GDKA 4LS0A 2Y8KA 2DVTA 5A6SA 1JD9A 3GXNA 4NZ5A 2WM0A 4QTGA 1QPRA 4KRZA 2QCDB 2ZWYA 2CETA 3VAVA 4GXPA 1IF2A 3P82A 4BWLA 2NVCA 4ZZ9A 1ONXA 4DI8A 1O5XA 3MB9A 3N2MA 3OTRA 1G4EA 2VM8A 4UFLA 5A94A 2YJQA 2BZNA 2WC7A 3NZRA 4AEEA 2AAMA 1E15A 3W2MA 2ZBTA 1RJQA 3WX7A 1Q6QA 4MJ4A 4XZNX 2H9AA 4X61A 1VFSA 3S5ZA 4JKKA 2CLHA 3VU2A 4LAZA 4ZOAA 3EX2A 5AHIA 4LUJA 8A3HA 2OYKA 1LOSA 2DUXA 5IBXC 3DFOA 5CPMA 2A85A 5D9NA 4I6VA 5CLWA 4YPJA 2CFFA 3VKDA 1P6WA 1XUZA 1A53A 1EJSC 1OCJA 4K6AA 3GAYA 1VBHA 3DFYA 3GO2A 4RW5A 2WCGA 3KTXA 1NOFA 2OEKA 1Z41A 4O14A 1FHDA 1MWOA 1H63A 3N6QA 1GYLA 3I4KA 3P8IA 5DY2A 3G0XA 1W1B1 1OK4A 3VI2A 3O3RA 5I06A 3BG9A 2FH6A 3WN6A 4HD5A 1YDNA 4KBXA 2PP3A 5E0FA 1XQLA 4DJFC 3MDWA 2ZRWA 4AZBA 3IIZA 3NZQA 3TYUA 4KEZA 2YSWA 1AZ2A 3GNNA 4DLFA 3VO0A 3WF0A 5M5DA 5LNRA 4DRSA 4IJRA 4F2BA 3FA4A 4TTGA 2VGFA 1P7TA 2FDMA 5HMDA 4DUXA 4ZFMA 2DVUA 1TQJA 4MYAA 4OIFA 5XINA 1ZJIA 4YL2A 3RGTA 1UH3A 3PUEA 4DJEC 4EACA 1FWGC 5LSMA 3BC9A 4US5D 3GFXA 1X1OA 1PZ0A 4CNUA 4CEUC 1NF7A 3E0IA 1RP9A 4M81A 4WUIA 3P62A 1VP5A 2V67A 3B8DA 3WY1A 1UBPC 1GZ1A 3OA5A 4HU4A 4ORMA 3G5EA 1UR8A 1I2QA 2XJ7A 3TXVA 2AL2B 3N73A 2X8RA 3TMQA 2WVSA 4QISA 3PZ9A 2Q6ZA 3QYSA 1CB2A 2CZEA 3O05A 3WLHA 5CBBA 2YCEA 2YPIA 4QDPA 5AB3A 3M5ZA 3W1LA 1KRBC 4Q4SA 2TRSA 4KWWA 2NXHA 4LV4A 5C55A 4IISA 3PZIA 3VDHA 3MBDA 1KWGA 2J79A 5E5CA 4GQBA 3TQKA 2VUNA 4B5UA 1KCKA 2WNWA 4CQ8A 2NV1A 3G1YA 3MSGA 2GGGA 3T1GA 1CLVA 2C0HA 3O2LA 4NAFA 4IJBA 2C1HA 1NF0A 4RDWA 5K7JA 4PULA 1Q66A 3ERPA 4JIRA 3VIKA 4V27A 3FYOA 1HGYA 1RH9A 3DENA 4B9YA 3PUDA 1KWKA 1BG4A 1XG3A 3CYVA 2RJHA 4R7WA 3QV8A 3ITCA 3CPGA 3VNMA 4MAVA 3AHTA 3W1XA 1UP0A 1CGVA 1IZJA 4LB3A 2J78A 4L5ZA 2Z25A 1EJ7L 4HA4A 4ATWA 4XSLA 1W17A 1IIGA 3T2PA 1FKXA 4A8NA 2D73A 2QUTA 4Z42C 2PEVA 5C7HA 1AQFA 4NQ1A 5J5RA 5BU6A 7CGTA 1KKRA 3C86A 1MO0A 1B3ZA 1PX3A 2FLIA 4O12A 1K6AA 1PVNA 4GY7A 1A4LA 3NGJA 4DJDD 1XLMA 4HYRA 2PGWA 3KDOA 3RLVA 4DO7A 2VVSA 4JTJA 3SZ8A 2NUYA 1I75A 4IMCA 1R7AA 4QX4A 4ATLA 2DGAA 3QC3A 2I7GA 2PLKA 1ZALA 3FVMA 3B0XA 3KVMA 3I6TA 2I9EA 2IKIA 1VBRA 2YXGA 4GBUA 3NO5A 1JCLA 3QZEA 3ZT5A 1A5NC 1XFBA 2QYGA 3H2EA 4RDYA 3KRBA 5REQB 2IQTA 1EJTC 5F1VA 5E0CA 1CDGA 4UXDA 1CGXA 2JF6A 1B3WA 2QJMA 5DCBA 4U5IA 1D9EA 2WMJA 4CD4A 1WZMA 1YNYA 2V5LA 2WZHA 3TQPA 4NU7A 3U7VA 2Y6ZA 3K1DA 3H8AA 4PSPA 4YVVA 2V82A 4I90A 2FHCA 1DPMA 3SCVA 2YXOA 4OECA 2ZKMX 4XBJA 1R8LA 4PL2A 2W61A 1VBJA 4LAUA 2OX1A 4GQQA 1DQUA 4AZGA 4FOKA 2Y8UA 1NEYA 4ORIA 1KD0A 3N2BA 1JFXA 4PFHA 1GOKA 1VCFA 1VFFA 3ECQA 4Z1BA 2DV0A 2AOSA 3B03A 2E25A 3TAOA 3URQA 3VD4A 4AIOA 1SGJA 2QPXA 2VL4A 3ZJ6A 4CQCA 1BYBA 2A21A 4GPNA 1Q6EA 4HOXA 1RQEA 2YZRA 1S46A 1B3VA 2XVNA 4ENLA 3W1QA 4AD3A 2AGTA 4TQTA 3DESA 3SW6A 3J7HA 3UZJA 4WDTA 2GQAA 1BQCA 3IVTA 1UKQA 4LYQA 3NQ8A 1GGOA 1BVWA 3CHDA 1S39A 5A6TC 3IJLA 5HR6A 4L6DA 3L2LA 3KOXA 1EX5A 2P0OA 6TAAA 4KPLA 4J3SA 2ZE3A 3P74A 4MADA 3WMBA 1C8YA 5D2TA 3FV9A 3MP3A 5ABEA 1RHCA 5KZ6A 4UFJA 3W7NA 4GCXA 1SO5A 4AY7A 1VJIA 4QIUA 1VFLA 2P5NA 3PHAA 1HGWA 4NX5A 4QNEA 4J3TA 4GIAA 3DH7A 3ZT6A 4GUJA 2VP8A 1P6CA 5F4SA 1E4LA 1UJQA 3POCA 4EE9A 1GQIA 5AC5A 1XKYA 4TIMA 3L9CA 4LSBA 3F2DA 1G4TA 4FOJA 3MJMA 1ITCA 1R86A 1QHPA 2IXVA 4QNWA 5F4WA 1B9BA 3N19B 1WUFA 4BI5A 5AHFA 2Z7KA 4A6GA 4XO6A 3GC5A 1ZBCA 3QV6A 2Z2UA 4OJYA 1FP9A 1AL8A 1XP3A 2ZUVA 1QCWA 1F4AA 2BB0A 1X7FA 4JYFA 1WNOA 1MW2A 1Y8BA 3L65A 4G7EA 3ZWTA 4FS9A 3LUTA 5HWJA 1FWRA 3STEA 2NX9A 2FJUB 3PPFA 1O7AA 3P81A 3EPNA 4ZODA 1UWSA 1S5WA 4GYPC 3ZMRA 4UR9A 2BASA 1FWCC 1NOUA 3FIGA 3ZLHA 2UY2A 1PHWA 5EMMA 1KFLA 1UUQA 4AB4A 3LHUA 1TTJA 1Q7QA 1OX5A 1J6PA 2XIMA 1OK6A 3VMOA 5CCZA 1MQPA 1RY0A 1ZP3A 2YCKX 1NJJA 2IUZA 4GI9A 1QAPA 1RJPA 1X38A 3KAOA 1R2SA 4HYVA 2P3EA 5DCDA 4JXCA 3A4JA 2VOTA 3V1HA 2E3ZA 2DP3A 2A3BA 3IAQA 3D46A 5C2XA 1R9XA 3N12A 3VIOA 4X0VA 4FP1A 2YGYA 3CV1A 2VEIA 1F3WA 1TTIA 3AMDA 3OVQA 4QLKA 4UTJA 3CUFA 3IJIA 3RPMA 4N9CA 4KW2A 2FVMA 3KBJA 1M04A 3W82A 4JTDA 4JZ5A 5CPSA 3IANA 5LKYA 1W5QA 2TAAA 4H1ZA 1OGBA 1V0KA 3TXZA 4WDXA 1PHQA 3ES7A 2REQB 3V16A 1E9ZB 1XC4A 4EVZA 2PI6A 4N9BA 3HMCA 5TF0A 4EAMA 4MZYA 3BMWA 2D3NA 1CXHA 4JTFA 3GBDA 2GDUA 2WZIA 2FYMA 5BOFA 2X0YA 3GHRA 3WLIA 3PTQA 3R0DA 4W4QA 4L4MA 3GW0A 4X2PA 1W3KA 5EMJA 2FZ8A 3HV8A 4L1XA 2WVVB 4XKYB 1UW9A 4QQUA 1U22A 1PZ3A 2PDMA 3DFTA 2PLMA 4Q8QA 5FEXA 4ZE4A 3G22A 5G5IA 4PN2A 3PJTA 2Y5SA 4UBPC 3BICA 1L0PA 4H2CA 3UEQA 1V51A 3WBYA 3W7DA 4XO7A 4IPJA 1JPIA 1LLWA 3L4XA 5DRCA 1G69A 4PFMA 5XIMA 2Y70A 3UETA 4NZFA 3KZPA 1K4HA 1RA5A 1BGGA 1NIUA 3ORWA 1ITQA 2CWNA 1XRSA 3RG6A 4J2PA 3CV6A 4LTSA 2EJAA 4TX8A 3O8AA 3LENA 4FX6M 3O6YX 3M7SA 3AC0A 4QAWA 3A3WA 4TMCA 3TYZA 2ZDSA 5I09A 1IEIA 2DQXA 1X6NA 1TZ9A 2IQDA 1MUCA 4WJXA 2PU1A 4C1NB 2FVLA 1AMYA 1Y5XA 4W87A 2BVDA 2Y1HA 3E9AA 3R13A 3NFUA 2E40A 1XYAA 2V38A 3A6OA 4IG2B 4GVHA 3RU6A 5D03A 5CPLA 3IARA 1F05A 1AD4A 1GVFA 3NZGA 3M64A 4QEEA 1CECA 1UC4A 2A3HA 2QV4A 4BI6A 1A5SA 3R89A 1IT8A 3TA6A 1OYBA 1XGZA 2XHYA 4IPNB 3H4XA 2H8XA 2XG9A 5BYWA 3SN0A 4G1KA 2I9UA 2CLPA 4PEEA 1MEIA 3VDGA 4ZQCA 3V36A 1XD1A 3BGGA 1M65A 3DBPA 4Z08A 4D6HA 4D9PA 2ZDRA 3FGCB 1TJPA 3C2EA 4JN7A 4ZE5A 2NV9A 4HA3A 3VCRA 4WD0A 4L9YA 4C6PA 1BWKA 1CTNA 3LPPA 3SSJA 4NVTA 4O50A 2Y7FA 3BCDA 4AD1A 2QCEA 4J35A 4AEOA 1Z89A 4US6A 3K4DA 1W9DM 3LQLA 3W81A 1W56A 1TJ1A 4B9ZA 3SN4A 1KW1A 1KV5A 4UC5A 4MY9A 5D37A 1SZRA 2WJZA 3CEUA 5HANA 1W0MA 4JL2A 1XRFA 3D5HA 1O5KA 4C91A 4LAMA 3KTCA 3BQ6A 4JQ2A 1AJZA 5H91A 3LG3A 4P7QA 4RJEA 3QVQA 3ZO9A 1QI5A 3IJ9A 3GG1A 2PB1A 2UY5A 3M5XA 1X97A 3QEZA 2G3IA 5J04A 3EXRA 3UYIA 1UROA 1MNZA 1WKEA 1W1YA 3PZTA 1F8MA 3AZSA 1IQ8A 3NYZA 3NL5A 2QZRA 3AMKA 3DZ1A 2F6UA 2PGEA 1UUMA 2WOQA 5E09A 3QW3A 2GFTA 2WC4A 4OVXA 3WL1A 1XHGA 4JTUA 2FZ9A 4HHPA 3A9IA 4O0ZA 3G6MA 3WFZA 5CXPA 3P0WA 1Y65A 4ML4A 3AIEA 3W0KA 2YFOA 3R1ZA 4LVDA 2WHLA 4GX9A 2XINA 3N9SA 4WSHA 1ISZA 1QTWA 5BZAA 1UKTA 2G8ZA 3OIHA 3GHSA 2I16A 2CEQA 1PDYA 3AIRA 4U5KA 3GNRA 1FWFC 1LJYA 2POTA 1W5NA 3BSGA 1FRBA 4W84A 3F4DA 5M1TA 2PMQA 3UJ2A 3UY7A 1OWQA 2DT1A 3NEVA 3WENA 2XIJA 4NIRA 3A24A 1JEZA 1E1EA 1QNSA 2YDAA 4C7FA 2ZYFA 4O8RA 3PBYA 3DERA 3ZZ1A 1FHVA 4UQAA 2Q01A 2I5GA 4C6MA 3L0NA 3CUIA 1O60A 1DXIA 3VKJA 4LF1A 2Y7GA 2DT2A 3HZ3A 4KCVA 3PR2A 3P60A 1QASA 1PUDA 4OKDA 1R9YA 2OWWA 2J88A 2ZQ0A 5I23A 8XIAA 1EZ2A 1JZ8A 1QI0A 1TKKA 2F7FA 1P0KA 1DWJM 2HK1A 1N2VA 4S3FA 3PTKA 4Q8WA 2DQWA 3G0SA 4EX4A 3WO8A 2VNCA 4UR8A 3IUIA 4PUUA 4IL2A 1UP2A 1DVJA 2KX9A 2VELA 2FH8A 4O54A 2ALDA 5EGRA 4XAPA 1EPVA 3TX9A 3EXSA 3RJYA 1O5QA 2QGHA 3B0YA 4S39A 1K7FA 4RPQA 1QDSA 1C7SA 3WBXA 3U48A 4UTWC 5MHBA 3LQGA 2V68A 3QQWA 3LS9A 2FTWA 1YLVA 3FK4A 3LX9A 2QCHA 3EMCA 1HW6A 4DUWA 3MW7A 3BH4A 3C56A 4R9OA 2CLLA 2J7FA 5GNXA 2R8WA 3GVVA 2GDVA 4JDYA 3XINA 1GUVA 3MMDA 5G2WA 4URIA 4MLRA 2D0HA 2R14A 2PDLA 1V6XA 3EMQA 3HU7A 4Y7EA 1XH0A 3CIWA 3W2NA 1J93A 3PG9A 3OLDA 4A22A 1UOKA 3LI1A 4EANA 3STFA 4LBRA 5DXXA 3UWUA 4TR9A 2Z24A 1EWEA 2E5BA 1OYCA 4P7RA 2UBPC 5T26A 3ICJA 4H8UA 1F76A 5G2HA 3TC6A 1YADA 3FDGA 1JZ7A 2NVAA 1XLIA 2V9DA 4DBDA 2E9MA 2RH9A 3U2EA 1GNXA 3NQCA 1I4NA 3UYCA 4A4AA 1H2JA 4DLMA 2FPTA 2YDSA 1EUAA 3EEZA 1V3JA 2ALRA 1VFMA 1B4KA 3LCLA 1DJZA 4S3KA 4FIRA 3CB8A 3WLSA 5BOOA 3LTSA 4L9ZA 2ZA2A 3ZIZA 3GS6A 1OG6A 3LCWA 4C6FA 2YOCA 1XG4A 4XZIA 3SY5A 5T9CE 5LGXA 5JUVA 1R2RA 1BXNA 3WDQA 4XZMX 3FKRA 3I4EA 3HG3A 1B90A 1KFBA 4M56A 5IBXA 3CC1A 5FCZA 3W84A 3MUY1 5XIAA 3GVQA 3IS4A 3UCQA 2Y63A 4WHBA 1XIGA 2PZ0A 3V3WA 4AQLA 4WLCA 3KUMA 4K39A 3BXWA 1K77A 5C9ZA 3EOLA 4GQ0A 4I6KA 2C6QA 3C8NA 1UD5A 2O7SA 3S9YA 4PUDA 2Z1XA 1Q6LA 2NLYA 3C2VA 2UV8G 3L5AA 1D3CA 1Z6KA 2CBJA 3HQNA 3HPZA 1UZ1A 2CW6A 4NNBA 2PCEA 1NDZA 1QPQA 1XYCA 1EH9A 2EPMX 4JY8A 3K2GA 5D2YA 2C19A 3N2XA 1CIUA 1GVIA 2ABAA 1DIOA 4AH7A 2OQLA 5ABFB 1DHPA 4DJFA 4M0XA 3PFMA 1WX0A 3LHWA 3FAXA 4ZXOA 1PSCA 1PJ9A 2E9LA 2C16A 3VE7A 3W6LA 3RR4A 4JQ3A 2ZE0A 1AL7A 4MB5A 2ZZ7A 4XZHA 1Z44A 2NQLA 3MKKA 2ACUA 4WJEA 5DMNA 5I24A 3T78A 3ZVHA 3B0UX 4IUGA 4PODA 4RE4A 2ZCGA 3NJ3A 4ZFCA 4DJEA 1KRAC 3VDAA 1PKMA 4REQA 4UFMA 1Q6CA 2JKEA 4JR5A 5ECUA 4NI8A 3I65A 4TVUA 3INPA 3CZ8A 4RW3A 3LLDA 4PBFA 4DXXA 3M6DA 4MUPA 4WKFA 3SJ3A 4PRWA 1YBQA 1O1HA 4U2ZA 1X39A 3GW3A 1C92A 4XZBA 3CZJA 1EA0A 1X7IA 5F2G