1KM2A

Crystal structure of orotidine monophosphate mutant q185a with 6-azaump
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
211
structure length
211
Chain Sequence
MNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAAGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mapping the active site-ligand interactions of orotidine 5'-monophosphate decarboxylase by crystallography.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
molecule keywords OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
total genus 83
structure length 211
sequence length 211
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2001-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1km2A00
3PWAA 4ZQPA 2NLIA 4NQ1A 3HMJG 5DY3A 5A5WA 3TE9A 1LRQA 5C2XA 1ZNNA 3LHWA 5T26A 5KMYA 2NV1A 1LRNA 4W9TA 5G1YA 4M6PA 3LTPA 3GX9A 1KM0A 1GTHA 4MLRA 4AHOA 3PUEA 2QF7A 3TK7A 4FNUA 3W22A 3EXSA 3ANYA 4FF7A 5LZLA 2EAWA 3BW4A 5H2ZA 4WOZA 4R34A 3P74A 3MUXA 1QFEA 3UXDA 4JTSA 3GYEA 2BXVA 3KRZA 4JY8A 1TIMA 2QCEA 1IXQA 1QPQA 3KVLA 1KTNA 1UBSA 1ONRA 1F6KA 3QSRA 3NYZA 1QOPA 3NPVA 4UMCA 1JCXA 3TQKA 1XBYA 3MP4A 3IVTA 4N6FA 1EUAA 1GEQA 1SO5A 3EXRA 5AC7A 2YFOA 3B05A 4JS3A 1KM5A 4JTEA 3LXCA 3W7MA 3LLDA 4FNTA 3TSMA 1AW2A 1WAUA 3DFOA 2WV8A 3E96A 1FWTA 3PC0A 4MJZA 3ABQA 2VEIA 1XBVA 4JNMA 5G4WA 3HGSA 3HIJA 4P61A 4JDBA 5HINA 2JGQA 4ZMGA 3UY7A 3MI2A 2PCQA 3E02A 1TJRA 3KX6A 1VHNA 1EWEA 3GXTA 1JUEA 5CZ0A 3HPSA 2WQPA 1LBFA 2FJKA 4M6QA 3A9IA 3EX2A 2NX9A 1N7KA 3R5EA 3S5NA 4IWWA 4GWEA 1PCKA 4S2BA 2V82A 2YW3A 2I1OA 2Z6IA 5I3GA 4DQWA 2GQ8A 4ZZ9A 3FKKA 5D2WA 3HPXA 2QJIA 4ADUA 3GAYA 3TAKA 4DEFA 5FESA 5K2ZA 2LLEA 3FJ6A 3IIVA 1RQEA 4HT3A 1GVQA 2O7SA 3STGA 1B9BA 1D3GA 3G8RA 1BWKA 4OBTA 3UWYA 4CLMA 2RH9A 2VFHA 1JRBA 3ZFHA 1J2WA 4YLWA 3CC1A 4FO4A 5LSMA 4AWTA 3LCGA 1WX0A 3KAOA 1ICQA 2A6LA 2QCGA 4FEZA 5LNWA 4LRSA 3TA6A 1EPXA 1FXPA 4Y90A 5D09A 3C56A 3WJZA 3IGSA 3MBDA 5LNVA 3DENA 3P84A 5D02A 3Q37A 2V30A 2C18A 3I7RA 1FUYA 4CQ8A 3TDFA 3EX4A 2Y7GA 4RLIA 1U5JA 5E0KA 1H7RA 1WQ5A 3A23A 3D0CA 2GJLA 1KBIA 1KV5A 3G1HA 4EVZA 3M44A 1L6YA 1X1ZA 1R2SA 2W79A 5U7SA 3HGJA 3N2MA 3C2VA 4JXCA 5K3VA 5KTLA 3A24A 2DORA 4O0ZA 2A7RA 4YWIA 3PR2A 3G8EA 1JCJA 1LOSA 3W2MA 1W37A 4JTLA 1TJPA 3W1LA 4AVFA 4R53A 2ABBA 3SI9A 1IXPA 4XKYB 3W2LA 3TNOA 1B4EA 4MY8A 1XKYA 2HS8A 1FWSA 3W1XA 3LRKA 1OK6A 2NV2A 2QAFA 2Y7EA 3P7YA 4XWUA 2GJNA 4ZL1A 1TPEA 4FB7A 1JR1A 3QC3A 1SUXA 3W7QA 1XM3A 1ML1A 3HB9A 4AEOA 3USBA 3S1VA 3ABOA 1ZY9A 3W7CA 1QMLA 2CFFA 3VE7A 2VFEA 2E68A 1OFPA 1GT8A 4MOZA 5G2IA 4O10A 5AHNA 3UWVA 4IUOA 1A50A 1FY6A 4N02A 1KFKA 4X2RA 2CZFA 1SO6A 3N9RA 5BNKA 3PG9A 3IRDA 4FXRA 4GUIA 2RDWA 2Q3RA 1QO5A 2X1UA 2WO5A 3EB2A 3A5FA 1J5TA 1FDYA 3BW3A 1L6SA 3UPWA 1AK5A 1MEWA 1XUUA 3LHUA 3RNDA 3LTSA 4MFDA 3V75A 3S9YA 1B4KA 2FB2A 3PULA 3CEUA 3HJZA 3EWBX 3F1QA 1TPVA 3SW6A 5DELA 4P2VA 4GNJA 3EX1A 2ZDRA 1O60A 1LM1A 2BX7A 4UTHA 3GXNA 3TC7A 1XL9A 4TMCA 5D38A 2OJPA 1QNVA 2J27A 5K7JA 1K8YA 4IMFA 1I2NA 2DZTA 2QCFA 2FPTA 2DZUA 3WK2A 1I2RA 3C2RA 4A22A 4WD0A 1WYIA 1N8FA 3N9SA 4UTUA 2FPYA 2A6NA 3ELFA 2DJXA 3KXQA 4K6AA 3DFPA 5EKYA 1SZNA 5F2IA 2JKEA 3LXBA 3LCIA 5EYWA 3JS3A 1VCGA 4LTSA 1RZMA 3M1ZA 4FX7A 1G6CA 5CSSA 3MHFA 2QUVA 3W76A 3NVTA 3A21A 1GG1A 2ZTKA 1PIIA 4L4LA 1C8VA 3NEVA 5D33A 1KW1A 2EHHA 4UCGA 3TXVA 2RDUA 3W7PA 3M5VA 4O13A 4Q33A 4PTNA 4DPPA 3ZS4A 3NQAA 1R47A 4GXMA 3W7HA 3EKZA 3B0VC 2OMAA 5D2XA 4EF9A 3LM7A 4A21A 3PS7A 4JD4A 4PODA 2R14A 1QPOA 3TMQA 4WZHA 4QNEA 4Z1CA 2QCDB 1KTBA 3PB2A 2CLLA 3TJXA 3KFTA 3W3OA 3MW7A 5AB3A 4JR5A 3NQGA 3G18A 3DZ1A 2FIQA 4GE8A 4JN6A 2JK2A 3VFLA 4Y6GA 2Z0IA 1ME7A 4OV9A 1EA0A 3WJSA 5DCBA 1T8XA 2CLHA 4E0CA 4RX0A 4R33A 4UUIA 1Z42A 2NZLA 2VFDA 1I45A 4K8EA 3NQ2A 4Z0SA 3CPRA 4LUJA 4OWGA 1IIHA 1MEIA 2ZZ2A 3B03A 2J9ZA 4PA8A 4UFMA 3UWZA 2NWRA 3E0IA 2QCLA 3O06A 4IXXA 4LC6A 3GVGA 5CSRA 2EGZA 2GVGA 1VS1A 4JTTA 3ZWSA 1TTJA 3TROA 4M6VA 1LCOA 3QQ0A 4G1KA 4UR8A 3IVUA 3EX6A 2W0UA 5KINA 4E2DA 1UUMA 2WOQA 3BG3A 5AHIA 5FF3A 5HUOA 3H55A 3DI0A 3G1FA 1L9WA 1W5QA 3GNDA 3LRMA 3S42A 1ZAHA 1RQBA 2QJGA 3C3NA 3EX3A 4N4PA 5AOUA 2JBMA 3S5YA 4K36A 2ZRWA 4UXDA 3MYOA 3NQFA 2ZRZA 3G24A 1XFBA 1KLYA 4UTTC 5CKSA 1VR6A 2Z6JA 4RK8A 2WKJA 2E5CA 3QFEA 3G3MA 3TQ0A 5FF0A 1OFAA 5KSWA 1YXYA 3C8FA 5TBOA 3STCA 1NAL1 4LVDA 1W3IA 1R46A 2FB3A 5MHBA 3DFNA 1T99A 3W2JA 1M7PA 4EOUA 1W1ZA 3QW4B 5BMXA 2ZQ0A 1QOQA 4OE7A 3LCXA 2C19A 3N19B 1VZWA 5AYZA 2TMDA 3NA8A 3H54A 2A21A 1JCYA 4LV4A 1RVGA 4O52A 3L21A 3JR2A 3SGUA 3THQA 2QDGA 5KITA 1GWJA 4JTJA 3W83A 2G5WA 1JULA 1UASA 2V8ZA 4K7YA 2ZRUA 2HS6A 2VOMA 2ZA2A 3HGRA 1S5TA 2Y6ZA 3T7VA 2QUUA 1TO3A 3BVJA 2C0AA 4NU7A 4O17A 4BI6A 4E38A 2NX1A 4CNOA 1THFD 3LHTA 1H60A 3TKFA 3UWQA 5K4XA 1TPUA 2VFFA 4HNNA 3W7KA 1H61A 4RZ6A 5FEWA 3DAQA 5K9DA 4GUFA 2CLMA 1SO3A 3LCLA 4FNSA 4DBEA 1K8ZA 1OFDA 1JCLA 3LCHA 2PC4A 1LBLA 1FWWA 1P0NA 1EP2A 1SZFA 4UMAA 3S6DA 1YLVA 2X30A 3SFKA 3W88A 3S5ZA 1OX6A 3SIZA 2WNQA 1OABA 1VLWA 1K7FA 5KZEA 4NZFA 1SO4A 3TV8A 8TIMA 4MJMA 1E51A 2V2HA 4ORIA 4IMDA 5I3JA 4NX5A 4FNQA 5DCEA 5AYYA 2H6RA 1G7UA 2ZRVA 3VNDA 5FEZA 1PV8A 1FBAA 4O1DA 1Q6RA 1BEUA 3P81A 2NXGA 3SZ8A 3RU6A 4N2YA 2ZZ4A 2H8ZA 1AG1O 3BW2A 4IMGA 4XTIA 3W7DA 3F4WA 2J24A 2YR1A 2V81A 2BTMA 2WSYA 3BG5A 2C15A 3W87A 1HG3A 4TIMA 2A5HA 3FA5A 4AMAA 1RR2A 2C13A 3OEXA 4HN4A 1YTDA 2OT1A 1LYXA 1OF6A 1D9EA 5FF7A 4ZQRA 3NQEA 2TPSA 1VCVA 1FCVA 4GUGA 3G0UA 2RDTA 4QM1A 4XUGA 2D73A 5D05A 2A2IA 3DKJA 3O63A 4GUJA 3EKLA 2BSLA 2Y63A 5HJLA 1WOBA 3R89A 1OHLA 1RQHA 1P0KA 3IV3A 2FPVA 2YYTA 4BI7A 1DOSA 2JKAA 3TW6A 3LBCA 4O14A 2ZRXA 5BOOA 4CCCA 4UTKA 3WJXA 3UNDA 2QJHA 4A29A 3TC6A 2YPIA 3HQ1A 3UZJA 3AO0A 6TIMA 1LDCA 3NAVA 1H7PA 1TPC1 3M16A 4LOCA 5DBTA 3L5AA 4RJEA 4FXSA 4JTFA 2JKPA 1S5VA 4LT9A 4LWWA 3L68A 3M5YA 2X2GA 2NUXA 2PE4A 1K3UA 4AHQA 1DBTA 1GZGA 2ISSA 5CG7A 4MZYA 3FYPA 1GYNA 3P60A 3UPBA 4LC8A 3NZRA 1VLIA 3O1NA 3TSBA 3BLEA 4I9AA 1KM3A 5FF4A 4HSNA 4S1FA 2CLEA 1NF0A 1XI3A 2UV8G 4CQAA 3G3DA 7TIMA 4N4QA 4UFLA 2YFNA 1UB3A 1RD5A 5LHEA 4LS1A 1P1XA 1W3NA 3RFAA 3RK8A 2ISVA 1O95A 1W5MA 3LV6A 3BPWA 5DLCA 4LNYA 4AWSA 1OJXA 3W7OA 1O5KA 3LERA 3MBFA 1G4EA 2Q3OA 3KVJA 3O05A 3W1MA 1G7VA 4LV9A 4AWUA 1KM6A 2HTMA 1LLWA 3O07A 2QCHA 3KHJA 2FTPA 2GPTA 4JYFA 3QEZA 2V5BA 2A7PA 1DV7A 1S3HA 3RLVA 4WOQA 3TXZA 5CPOA 5HMSA 4UTWC 4NXKA 1BTMA 4OGZA 3SY5A 5F4WA 1GJPA 4ICNA 1DHPA 1TQXA 3C0JA 4IOTA 4E2BA 3EWWA 2NUWA 1BKSA 3NGJA 1PL9A 1H62A 5FEPA 1HL2A 3W86A 1VH7A 4GJ1A 4JGDA 2V9DA 3Q2DA 4DF2A 3T78A 4XBKA 4CCDA 4I7WA 3TJLA 5G2HA 1GVOA 3L5MA 3BGJA 2VELA 3CEPA 1WDWA 2B7OA 4Y8FA 3DKLA 3I6RA 4BR1A 4HNUA 2NWSA 1NSJA 2ATSA 2Z2UA 3WFAA 3L2IA 3EXTA 2DU2A 1XCFA 3NQMA 3BLFA 3W2UA 4DO6A 1DJNA 3UZ5A 3M7WA 4FIRA 3PUDA 1LBMA 3P67A 1EEPA 2F7FA 5LHFA 1TTIA 2QCMA 4MUZA 4EF8A 1K03A 3M9YA 4B5NA 1UJPA 3G0XA 3EWZA 2NX3A 3PAJA 4O50A 2OZ0A 2YZRA 3QPYA 3FEMA 3CWNA 4N9BA 1CW2A 3S1XA 1TSIA 5HNRA 2GQAA 1K8XA 2TSYA 4LUIA 2V5LA 3EWUA 1YDOA 2E6YA 1VHCA 1AL7A 3B8DA 3W2KA 2ZBTA 3S0CA 1H7NA 4UFKA 3BV4A 4ZQCA 3P80A 5EL1A 3M43A 4IMCA 1SSDA 2XN0A 5CZSA 3TW7A 1MZHA 3MO7A 5D37A 4IX0A 4XZ9A 1PE1A 4DXVA 3PBVA 5D2VA 1G4PA 1K7EA 1RV8A 3LGEA 1NF7A 3STFA 4EWND 4QSHA 1G69A 1YTKA 4IXHA 1C29A 4PL1A 4ZVJA 3LHVA 3BK0A 3IIZA 1P5BA 1OX5A 1JVNA 2C1HA 4JX4A 1LTDA 5C55A 4H3DA 1XDLA 2DZVA 3TH6A 4WY0B 1LORA 3GDMA 2PURA 3M0ZA 4TX9A 4HNTA 4NNAA 4O1BA 2Y7FA 4QNWA 1ZAIA 3LOTA 4TR9A 1DVJA 4X22A 5BRBA 4O16A 5LGZA 1YXDA 2GQ9A 2TYSA 4ZQNA 4PL2A 4NVTA 3W7JA 3OBKA 2A7NA 4KFOA 1A5BA 2FLIA 1H1ZA 2G95A 5J5DA 4JTHA 4Q32A 5TIMA 3SECA 4K37A 3HPZA 3BGGA 1TPH1 3P62A 4JTUA 1NEYA 1EUNA 4ADSA 3B04A 4K8HA 3T44A 3UQNA 1OYBA 4NXSA 3Q58A 4NNBA 4CNNA 1XBZA 4UMBA 4WXYA 1TB3A 4UTIA 3UY8A 1IF2A 3DFTA 2QKFA 5I3IA 1JQXA 1A5SA 2B7PA 3KRSA 3C4UA 4KWVA 3VCRA 4LVBA 4H6KA 2PRMA 4DBDA 3NQ7A 5FI8A 4IGHA 4WX2A 4UTTA 5EY5A 2QR6A 3FIGA 1TCDA 4GC4A 5DCDA 3HO8A 3C6CA 4EIVA 3I65A 3GDRA 4AAJA 1GOXA 3NM1A 3LI1A 1KLZA 4MY9A 3BLIA 3LDVA 3O6DA 1I4NA 1AW5A 4ORMA 5AYXA 4DF0A 2ZRYA 3OIXA 1F2JA 4DELA 3EWYA 4D2JA 3A22A 1ICSA 1Q3NA 2X1TA 5C6MA 5KZDA 4LVGA 5HQEA 4UIOA 4CQ9A 2CLIA 1TYGA 4U28A 5AN7A 3P61A 4QISA 1YPFA 3IIOA 2RHGA 3LI0A 5K9CA 3NPUA 1VJIA 3JRKA 3FYOA 2C6QA 4FX8A 4MLJA 3P5YA 4AH7A 2XFWA 3F4NA 3CT7A 3TQVA 4ADTA 4BK9A 3ABSA 2YW4A 1OYAA 1X6UA 4UTMA 3W75A 1QDSA 3MMTA 3TX9A 2XN2A 6ALDA 4NJJA 3TCEA 4KFNA 4WY0A 1H5YA 4JIPA 1O5XA 3DXIA 1KM4A 3W84A 1SSGA 3TMLA 5K9XA 1EX5A 3MI3A 5ABTA 3BO9A 2J9XA 1X1OA 4OV4A 3RMJA 2I14A 1KTCA 2CLFA 5AFDA 4NUWA 3G1DA 3L5LA 1UCWA 1AMKA 2CLOA 3UWUA 3P8IA 1SFLA 1PS9A 1JUBA 4AB4A 1OFQA 4JEQA 4NJIA 4GRSA 3GKFA 2ZZ3A 4Y96A 1R2TA 2CW6A 4ALDA 3PSVA 5K4ZA 3TFXA 2FDSA 3M41A 1SU5A 3CQ0A 3MWAA 5EA9A 3QYQA 1F76A 1KFEA 5F2MA 5HR7A 4O4WA 1A5AA 1OFRA 5G1TA 1ICPA 4ZQOA 1EWDA 3GAKA 3IIXA 5HULA 4LS0A 1TPDA 4AF0A 4JDYA 4UR7A 1IGSA 1ZENA 3LB0A 4JICA 1HUVA 2NXHA 1LOQA 5DXYA 3ATYA 4Z1BA 1T0OA 1X8FA 1PHQA 2CLKA 2E1DA 4OQVA 3WK1A 1DQXA 3CWOX 4FX6M 3DHDA 3IEBA 1NVMA 3NQCA 1F7BA 1KFLA 2CZ5A 4XQ6A 2ZZ5A 1I2PA 3GR7A 1DL3A 3LXAA 4LU0A 5EBUA 1W3TA 3QW3A 4O8RA 3WJWA 4CCEA 1GYLA 3W1AA 3TUUA 5SWUA 3NM3A 2C16A 3IIPA 1EP3A 3O15A 4NJGA 3QPZA 1GVRA 1QO2A 1YYAA 3KVKA 4FNRA 3T4CA 3WK0A 1FQ0A 1M7OA 3FFSA 3MHUA 1M5WA 2R94A 1DORA 3KOFA 1ZCOA 2B4GA 3M6YA 1FX6A 3QM3A 4HPJA 1T96A 4I7UA 5AHMA 5G4EA 2G96A 2WJZA 5L9FA 5LNUA 3DU0A 5KZMA 3O8AA 3S1WA 3NPWA 1Y0EA 3QRHA 4UC5A 2DZXA 3W7GA 1KM2A 4L4MA 4OHQA 1FCQA 2X1SA 3GDLA 2ISWA 4A2SA 3Q94A 4AXKA 4WJEA 1Q45A 5J5RA 2YSWA 5F1VA 4HHPA 4TMBA 3BARA 3P5ZA 2PRLA 5L6UA 3U8GA 1H7OA 1JUKA 4HKPA 2Y88A 1Z44A 3HBLA 1MEHA 2FFCA 3KVMA 3TSDA 3W74A 5F4SA 1GTEA 3OVQA 1X7FA 5FEXA 3OG3A 3H53A 2BZNA 2CU0A 4RCXA 3A5VA 1KM1A 1TRIA 1YXCA 4O1AA 4DPQA 1M6JA 3E9AA 3FLUA 2JGYA 3R2GA 1YDNA 5EMUA 2AGKA 5D32A 3BG9A 2E6DA 4LW7A 4Z1AA 1F73A 1HTIA 1C9DA 4LVAA 1JCMP 2O7QA 5AHFA 1TV5A 1Q6OA 1VCFA 1SZGA 1L6WA 2Z1BA 5DXXA 3I7SA 2QCDA 1GVSA 5AHEA 5EPDA 1K7XA 1R30A 4N6EA 5CZTA 4O1CA 2IQTA 3HG4A 4MIMA 4N9DA 1TV7A 3M5ZA 1GG0A 4K7VA 1SZEA 5U4NA 1KBJA 1H51A 2B0MA 4UFJA 4YCOA 1WXJA 1WA3A 3SGZA 2A4AA 3W1NA 5BW6A 3PBYA 3L0GA 3PB0A 4M7TA 5FF2A 2WPBA 4O19A 2GVLA 1WBJA 2Y7DA 2YGYA 4MZ1A 4C1LA 4LVFA 3L0NA 2HMCA 3NNTA 4IX2A 2J9YA 1FCUA 4PFMA 3W1QA 4O28A 3PM6A 5A8GA 3B0UX 4QITA 4BI5A 3NZ1A 1GPWA 1K02A 2YXGA 4FIQA 4M7SA 3PF3A 3CU2A 3LRLA 3W1PA 1XXXA 4LRTA 4RXGA 1TREA 3CLMA 3IGUA 4NNCA 2E09A 3LBMA 5HWNA 3MJYA 1SW0A 2BLEA 3NL5A 4N9EA 3W07A 3SR7A 4K38A 1G4SA 3NR0A 4ZQMA 4POCA 4JYEA 1CI1A 3EWXA 3LHYA 2YX0A 4NZJA 1Q6QA 1XC4A 4QJ1A 2B7QA 3UYCA 4JY9A 1QR7A 3L66A 2Y70A 1O4UA 4ML9A 3GR8A 2C14A 3HG5A 1W5OA 3CIWA 2Q8ZA 1TV8A 1LP6A 3I7QA 2BWGA 2KZHA 3TIMA 3S5OA 3THAA 3P8JA 5C5YA 3MP5A 1SW7A 1SQ7A 3O6CA 2YCEA 2WNZA 4BWLA 2J6XA 4DO5A 1CX9A 2VENA 3C52A 1V5XA 2ZZ6A 1B57A 1F6PA 1W54A 2E77A 1H7WA 3W2NA 5LNSA 3QMTA 4KWWA 1FDZA 2ZA1A 2RKXA 2YDAA 3CTLA 3OVRA 4UFIA 2E5BA 1EP1A 4R7JA 3QMSA 3NQ8A 3PBWA 2ABAA 1EIXA 4HIBA 1KFJA 1NFBA 3N2XA 4O11A 4X3ZA 1AL8A 3MP3A 4YXGA 2H3DA 1EB3A 3HF3A 3ATZA 4A2RA 1OFOA 2ATMA 4RZ4A 1ME8A 3W7LA 1W56A 4BF9A 2Y85A 2ZZ7A 2GVJA 1MO0A 2VEMA 3TAOA 5F1UA 1J4EA 5DBUA 4XKYA 3GK0A 3LV5A 1GVFA 5F2GA 1I2OA 2OT0A 1D3HA 1HFBA 3RF9A 3PBUA 4LY8A 5LNRA 2HSAA 3M47A 3INPA 1FXQA 3UWWA 3DFQA 1LRTA 4UTJA 1G67A 2DZPA 3C2FA 2AAMA 2QAPA 2ZA3A 3B06A 4UFHA 5H91A 2DZWA 1ZFJA 4O53A 2W6RA 2QEZA 3IVSA 1OFEA 3QH2A 3G0SA 3NDOA 4AHPA 5IM51 3STEA 2R91A 2CWNA 3NXFA 2DZSA 4UTLA 4I7VA 5D2TA 1F5ZA 3K30A 3N14A 3QZEA 4XBSA 1OG0A 2P10A 4Y9AA 4YCPA 4PC8A 4JIQA 2QUTA 3F03K 1A5CA 2WNNA 3N3MA 3W23A 2B7NA 5CPLA 3TR2A 2ZTJA 3VI2A 1VYPX 3VE9A 4QQ3A 2H3BA 3GLCA 1OF8A 2NXIA 3QMRA 3CIXA 3HG2A 1H50A 2E5DA 4RXFA 2TRSA 4X9SA 4GBUA 1LROA 3CM4A 2WSQA 3NQVA 2QCNA 5CZJA 5E93A 3T40A 4JTIA 1W0MA 1OYCA 2VC6A 5F4XA 4ONVA 3LLFA 1YPIA 3W85A 1JJKA 1TRDA 3B0PA 4O15A 3O16A 1R2RA 3L9CA 1I8JA 4GUHA 3LHZA 5E1QA 1SPQA 1MSSA 3G1YA 1Q6LA 3R12A 1TPWA 2DJLA 3NL6A 1ZHAA 1YTEA 1TQJA 3OHIA 3QJAA 2XN1A 1U83A 4HNVA 3HGOA 4MKNA 4IPJA 1O94A 2ALDA 2P1FA 4RV8A 3AJXA 4Z1DA 3L65A 4O18A 4JX6A 1KV8A 3OVPA 4FNPA 4WUIA 1VYSX 3GZ3A 1H63A 2OCZA 4IPIA 3W70A 5IBXA 4J9JA 4MY1A 3C61A 3LTYA 1QWGA 4NX0A 4BFAA 1IXOA 3NL3A 1N55A 3U2OA 1JQVA 5IBXC 4YMZA 1PCWA 3W6YA 3GIYA 4Z08A 4M5PA 1Z41A 2VXNA 3G1XA 4JX5A 3G22A 3V1PA 2F84A 1VGAA 3GKAA 3HG3A 1YADA 1ALDA 4TU1A 2C3ZA 3FJLA 1LLZA 2YYUA 1QPNA 1RPXA 3W7EA 1FCBA 3B4UA 1MXSA 3DI1A 4NT0A 2EKCA 1IXNA 5BMWA 2ZZ1A 4IJBA 3IGXA 3W72A 3C2OA 1I2QA 4FHAA 3QQ1A 5TQLA 2GUUA 2A1YA 1BWLA 3L67A 3LX9A 3PY2A 1DKWA 1ADOA 3PSWA 5D03A 1OX4B 1VPXA 4JTKA 3N34A 4MFEA 2X1RA 2Y61A 3CB8A 3PUOA 1Z48A 1PVNA 3W1TA 1W31A 1G4TA 4O54A 4N9CA 5AC6A 1QPRA 4O0KA 5F2LA 1ME9A 1S5WA 1JCNA 2CZDA 3MYPA 4RR4A 4JTGA 3T55A 4MYAA 1KA9F 2VEKA 1TTPA 5HWJA 3W1UA 4BWLC 1KFBA 2J88A 4RKAA 4NJKA 4A3UA 4U4MA 3W7NA 3W73A 3S8HA 2CZEA 1DJQA 2EPHA 1WOAA 3RLUA 3UXAA 2PRHA 3FKRA 3I68A 3FS2A 5HR6A 4WQ6A 4WY0F 4OU1A 2V2CA 1SR9A 3GDKA 3GDTA 3YPIA 1TMHA 3U6WA 1XUZA 1FDJA 1L2UA 1ZALA 5G2WA 5AC8A 1XBXA 4O12A 2H90A 5LGXA 4MVAA 3FOKA 3PVFA 3W9ZA 1ZAJA 1XDMA 3G1AA 2EF9A 1VRDA 4AF0B 3O6YX 2RFGA 4NJHA 3E49A 5G5IA 5DY2A 1JRCA 3NO5A 5D04C 3NOEA 4HSOA 4YL2A 3G1SA 1LOLA 4GFSA 4LS2A 1AW1A 1FWRA 3VKJA 2A0NA 1OX4A 2NUYA 5CGQA 3HOJA 4IMEA 3W71A 2A85A 1DQWA 4JYDA 1F05A 1OVDA 3QSTA 3QF0A 5D2YA 1P4CA 4IQLA 4DF1A 2VFIA 5D30A 1W5PA 5HWMA 2ZFAA 3WK3A 5CPNA 4UNKA 2ZYFA 3NQDA 5GVJA 3DHFA 1PHWA 1V7YA 2OX1A 3SSJA 5AHLA 2VKZG 4TO8A 2R8WA 4KKXA 3C2EA 2ZCGA 2QDHA 2V0TA 4Q4KA 3S1UA 2I9EA 3E12A 5LKYA 4HPXA 4UTWA 3NQ6A 3TU9A 4M19A 3ZR4A 1VQTA 1OFBA 4H4IA 1VC4A 3NG3A 1ZJIA 1A53A 3GNNA 2P0OA 4RZ5A 4MZ8A 2FQIA 3OA3A 1HO1A 1WBHA 3LCWA 3W7RA 1VYRA 2X16A 4K39A 2E6FA 3R13A 4CNPA 2V2DA 4O4VA 4MPQA 4S2CA 3M5XA 3MI6A 2Y89A 5HUPA 3ZWTA 3NPXA 1KFCA 2Y62A 1GQNA 1UUOA 1LZOA 3G1VA 1H7XA 3SJ3A 2G97A 4QIUA 5I3KA 1QAPA 3R8RA 2WSRA 3EEGA 3MHGA 5CPMA 4OT7A 1TPB1 1W5NA 3TFCA 3LCFA 4XTDA 2Q8LA 5C54A 4DO4A 3KRUA 3DFSA 2E6AA 1TTQA 4UNLA 4PEKA 3DGRA 2DP3A 4PH6A 5I3HA 3W7IA 1YDVA 4C1KA 1HO4A 3CHVA 4MYXA 3W1RA 1WV2A 2VFGA 1IIGA 1SFJA 1W8SA 4QAIA 3ABRA 3L0KA 4PCFA 4WXZA 3N73A 3UD6A 1SW3A 5I3FA 1B3OA 2H8XA 1QCWA 2GOUA 2QCCA 1OK4A 2AQWA 3DBPA 3PG8A 3P82A 3GXPA 4KFPA 4Z0JA 3NL2A 3WJYA 3DH7A 2VEPA 1TPFA 1H1YA 1F74A 5DN1A 1FWNA 3GB6A 4O57A
chains in the Genus database with same CATH superfamily
1YMYA 4RE4A 1PTDA 2GGJA 4NQ1A 2E9BA 3C3UA 5DY3A 5A5WA 3TE9A 3SCWA 3URBA 1E9IA 1VBJA 1J0HA 4J3XA 5KMYA 4W9TA 3GX9A 3EA2A 4LCSA 1GTHA 4JHZA 3S3GA 4AHOA 1ZU8A 1MW0A 4AC7C 2NVCA 3WDHA 2VX7A 1TV2A 3GM8A 4KBXA 1GQJA 2ZUNA 4RL3A 1BVZA 3P74A 4JTSA 3CUZA 3GO2A 3S6TA 8A3HA 1QPQA 2VCAA 3KVLA 1GKRA 3SCVA 4AYSA 4A05A 1TWWA 4JN8A 2IKIA 4UMCA 3IUHA 4DB7A 3MP4A 3IVTA 4N6FA 1SO5A 3FK4A 1O1ZA 1POJA 3TTYA 2XM1A 4LYQA 1GJUA 3B05A 4JS3A 1KM5A 2YBVA 2WSPA 2YDQA 3LXCA 5HQLA 3W7MA 3LLDA 1X6NA 3TVAA 3SAZA 3SFWA 3DFOA 1T8QA 2Z2AA 3AS0A 2VEIA 4NASA 1JZ3A 3V0TA 1PIGA 4PUUA 2YCLA 3KTSA 3BLLA 3A4JA 2PCQA 1K8CA 2ISDA 1EWEA 2WVVA 1JUEA 4GHRA 3WEZA 4BF7A 3IACA 1MFVA 2NX9A 1N7KA 2YXOA 3LEPA 4L56A 1BFNA 7REQB 1VFUA 5LA0A 2YW3A 1RP9A 1W1TA 3APTA 1OQFA 3MTWA 1Q6GA 2X41A 4ADUA 1RQEA 2QJNA 4URIA 1GVQA 1YRRA 3STGA 1B9BA 1D3GA 3OLIA 3ZFHA 1CENA 1B3WA 3CC1A 3FVDA 5EBAA 1N82A 3KAOA 1ICQA 1BYDA 5LNWA 5BRQA 1H1NA 4IIDA 4WEVX 2HXTA 1FXPA 1SGJA 5I77A 3QTGA 2EO7A 1NOFA 2BOGX 4P7RA 3WUGA 4UCFA 3IGSA 5LNVA 4PMUA 1UPMB 3P84A 2QPUA 3H26A 3Q37A 3GTXA 2C18A 1FUYA 2EG8A 1E40A 2Y7GA 4DM1A 3D0CA 3RUBL 3WLMA 4H2HA 1I1XA 1KBIA 2CBVA 1XCWA 3H7UA 3R0KA 5U7SA 3N2MA 4HK5A 4JXCA 4GQBA 1K6AA 2RJGA 4B4HA 3PR2A 4QCFA 3W1LA 3FCPA 4AVFA 2INEA 5M3WA 2VZSA 4U31A 2RAGA 2DSWA 5I2UA 4XKYB 3W2LA 2WWDA 3PZ9A 1FWSA 3W1XA 3U9IA 2Y7EA 3NTYA 1BHGA 3KE0A 4XWUA 4UQAA 3SUTA 3E2QA 2XZ7A 3SUWA 5FCZA 2GWNA 2OWCA 2Z1SA 5DRCA 3USBA 2OLHA 2QXWA 3C8NA 3ABOA 1I6NA 2V6AA 2IXVA 2E68A 4J5NA 2CNCA 3WCZA 2MUCA 1PYFA 3QHMA 5G2IA 5T91A 3W00A 3RR4A 1UJQA 2CHRA 3EOUA 1A50A 4X2RA 5BROA 4J3UA 1S2UA 1QO5A 2O9TA 1E70M 5HXMA 3BW3A 1MEWA 5CAKA 1DWIM 4U33A 3RNDA 3DHPA 2WYSA 1KGUA 3V75A 3S9YA 4GQGA 2FB2A 3QXBA 4LX4A 4Q6JA 1TR9A 2AL2A 4GNJA 1CBGA 1O60A 2BX7A 3TC7A 1JYVA 1R6WA 4A3YA 5K7JA 1MUCA 4GINA 2ZE3A 3NOYA 3WK2A 1WKYA 1WYIA 4HHLA 2AOSA 1N8FA 2PSNA 3N9SA 3ELFA 3NZGA 4H41A 1HP5A 3KXQA 3DFPA 5EB8A 4IH3A 3LCIA 3DYOA 3B0XA 5CC3A 4P8XA 1NQ6A 3HURA 4DJEC 3KDOA 1RZMA 4FX7A 1G6CA 2GWGA 4HPNA 5T9BG 1BF6A 1GG1A 4L4LA 1C8VA 2DSUA 4MB1A 5JQ9A 3BANA 2ZXQA 4GZEA 4GZJA 3VOGA 3TXVA 3W7PA 4PTNA 4DPPA 5FL0A 5A8PA 4I5RA 1AODA 3W7HA 3LQLA 3R10A 1PKYA 3B0VC 2OMAA 4JTQA 2VRJA 8RUCA 1QPOA 3R0UA 4Z1CA 1W91A 5KZ6A 3JW7A 3UEQA 3MW7A 4D6GA 2IPWA 3DZ1A 1OADA 3VFLA 4LEQA 4HZ7A 1UH3A 1T8XA 2FZMA 3V16A 4MWAE 1XP3A 3F5JA 4MMWA 4R33A 1NWRA 4UUIA 2NZLA 1I45A 3NQ2A 4LUJA 3TNBA 1EJSC 3MUAA 3UWZA 3KUMA 2NWRA 4IXXA 4WKAA 2PI6A 3BH4A 5HDRA 4D8ZA 4DJFA 2GVGA 1PZ3A 3PJUA 3TROA 3DYMA 3IVUA 5A2CA 1GYMA 2WOQA 3UR7A 1L9WA 1W5QA 3URQA 4S3DA 4N4PA 2QJGA 3C3NA 4HHHA 3S5YA 3JZUA 4UXDA 3MYOA 4Y9OA 1OGSA 2XGBA 3NQFA 1GJWA 2W66A 3PZVA 3TTEA 1JDFA 3CMJA 3ZIZA 1DJGA 1JXKA 4G7FA 5KSWA 2ZX8A 1YXYA 5TBOA 4NAFB 2PP1A 1R46A 2FB3A 3GS6A 1S2TA 3DFNA 4EOUA 1WNOA 3RHGA 5BMXA 2ZQ0A 1BPLB 2GSHA 2DIEA 2VWSA 3N19B 1VFFA 1HKWA 5CPSA 3MSYA 4LV4A 1MDRA 4O52A 3BAYA 4JTJA 4B3KA 1YKWA 1WB0A 3V35A 2YCJA 5GJMA 1S5TA 2FHCA 4U5IA 1E6ZA 4DXXA 4IICA 3NSXA 5CCZA 3SEPA 4BI6A 1Q7MA 2D24A 4CNOA 3WFLA 5I0DA 1TPUA 3PTDA 3WQ8A 1WAWA 1FWHC 2WVSA 1XQKA 4HOWA 4RZ6A 1IT7A 5K9DA 3IUDA 4GUFA 1SO3A 3C86A 4CN1A 4GO9A 3LCHA 3FA4A 1FWWA 1P0NA 4JBRA 1EP2A 1QOXA 4H9XA 3S6DA 1YLVA 2PP3A 1OX6A 4I6KA 3SIZA 4CQCA 1SO4A 3TV8A 1EH9A 4MJMA 1E51A 1AQHA 2NLYA 2H6RA 5FJUA 4S23A 3OA5A 1GCYA 4ZB5A 1PV8A 3RN6A 3BICA 1XDJA 3CS2A 5CAHA 3P81A 5E0CA 3U4FA 1FWIC 2Q6ZA 2YR1A 1V77A 4UQ9A 3DECA 4RDWA 2Y1HA 1OBAA 2OT1A 1LYXA 1D9EA 1JZ7A 3CH0A 4AIUA 1BYAA 1VCVA 5FJPA 3G0UA 4RE0A 2PD9A 4FA3A 4QM1A 4F0KA 2O4MA 1Y7VA 4XUGA 1UP2A 3UGVA 5FD0A 1XYCA 2VGBA 3EKLA 5DMMA 2Y63A 3CUJA 4EE9A 3E0LA 3GNPA 3R89A 4V2XA 4C6IA 2YBTA 1RQHA 1JI2A 3ZO9A 1DOSA 3TW6A 4DWSD 3WF0A 4HMCA 4CCCA 3G6MA 4A29A 2YPIA 2PF0A 4KRUA 1DIOA 2XDFA 1C93A 3CL6A 3ARYA 4JTFA 1JDDA 4AY1A 2JKPA 5DT5A 2PLJA 3DHUA 3MO4A 1K3UA 2BXYA 2ISSA 3CV7A 3P60A 2IW0A 2J6VA 4LC8A 4AMCA 1QHPA 7PTDA 5TNVA 4BJHA 4S1FA 5C71A 4CQAA 4L7ZA 3WNPA 5HBFA 4N4QA 4F2BA 1BRLB 2YFNA 1P0EA 1RD5A 3KBSA 3UU0A 2P0IA 3RK8A 3NWRA 2PTWA 3WNOA 4WHBA 3RRXA 3BPWA 1VEPA 2VJXA 4AEFA 3W7OA 3BSGA 4CVUA 1S39A 3EAUA 5DEZA 3KVJA 3O05A 3NEHA 2WHJA 3T2OA 4BKNA 4H6EA 2PDIA 5C9WA 3WLQA 5I07A 1CEOA 3GU9A 5FA5A 3QEZA 3RLVA 3M07A 4WOQA 4YTTA 5CPOA 4GIEA 4UTWC 3SY5A 4OGZA 4DHGA 4ICNA 1DHPA 2OFJA 4MM1A 1H62A 5FEPA 4RNHA 2J7FA 3KBVA 3Q2DA 1P1MA 1RA0A 3ZT6A 2VNCA 5A95A 2PGEA 5DQPA 5G2HA 1GVOA 3T0BA 5A6BD 2VELA 4F9JA 2B7OA 3DKLA 3I6RA 5HNUA 4QJ5B 4HNLA 2XH2A 3AI0A 3B9EA 1RPKA 3BLFA 1J79A 3KBMA 4DO6A 1MNZA 1NP0A 2Z7KA 3PUDA 2VWTA 5A6BA 1QPKA 1EEPA 2F7FA 2GGIA 4IPLA 5LHFA 2QCMA 5M1TA 1FWFC 1K03A 4B5NA 4KWUA 1J0KA 4HD5A 3PAJA 4O50A 2OZ0A 3FEMA 1RY8A 5B7YA 4S3GA 1DJYA 3FSTA 2DT1A 4LUIA 2V5LA 4UOQA 1I0DA 4GKTA 3VGEA 4GIAA 3GNOA 3R8HA 4BY3A 1H7NA 4GZ7A 4F3HA 4ZQCA 3P80A 5EL1A 4CCZA 2XN0A 2ZUMA 3TW7A 3MO7A 4HZMA 3M0YA 4U2ZA 3PZUA 1UKTA 3WQGA 2X0YA 1NF7A 3STFA 1F9CA 4EWND 1PYMA 3BC9A 4KT2A 5CBJA 1TMLA 1YTKA 4W93A 2FDMA 3WELA 1KRCC 2C1HA 4JX4A 5C55A 2DZVA 4UQBA 1TR1A 3GDMA 3BSMA 3M0ZA 3PAOA 4O1BA 4UOZA 4YPJA 3XIMA 2OLSA 4UQEA 1ZAIA 2VI0A 1DVJA 3W7JA 3WUBA 3OBKA 2HNEA 2VGFA 3NJ3A 2FLIA 2POZA 3O2LA 5J5DA 2DY3A 4JTHA 4DIAA 5TIMA 1RBAA 3WLTA 1TPH1 4ICCX 1T7LA 4JTUA 2CEQA 3QV8A 4PMJA 3T44A 4K8HA 3UXIA 4D1IA 1OYBA 1F8MA 1UR8A 3Q58A 5HPOA 3SQMA 2AMGA 1OD8A 1XBZA 1PWMA 2ZX7A 3POHA 2P76A 3MMWA 5A6LA 4UTIA 3UY8A 3FHQA 3N13A 1UOZA 1JQXA 4C6CA 2B7PA 2XIQA 3QKZA 1K9FA 4PGLA 1CXFA 4H6KA 3VZXA 2HXUA 2XU2A 3AIWA 3FIGA 2CXEA 5DCDA 3I65A 3AJ7A 4AAJA 2R24A 1KLZA 4MY9A 3AMKA 3LDVA 5AYXA 5JBEA 2ZVRA 4DF0A 2ZRYA 1F2JA 4DELA 3KTXA 3EWYA 4OFCA 3A22A 2X1TA 4ZO7A 1TELA 4U2YA 1F07A 3QLDA 4CQ9A 3B9OA 1TIWA 1TYGA 1SFSA 5AN7A 1YPFA 3LI0A 5K9CA 4F2UA 3NPUA 2CCRA 1VJIA 3JRKA 1BG9A 3FYOA 4FX8A 3P5YA 1XIMA 2PCEA 4BK9A 2YW4A 1OYAA 1A5NC 3MMTA 4UR9A 3U2ZA 3K46A 1RSCA 2DEPA 4KFNA 4D6FA 1SSGA 4E4UA 3TMLA 5K9XA 4ZXLA 5ABTA 2HPMA 2J9XA 2VCCA 1JAKA 1XD1A 3ZYZA 1R7AA 3UWUA 1OFQA 4NJIA 2BHZA 3VTRA 1CNVA 3A12A 4MNMA 1Y65A 4I3GA 3CQ0A 4KEVA 3LPPA 3MWAA 1B2YA 1KFEA 5F2MA 5HR7A 1A5AA 2KAUC 3VCNA 5G1TA 4G9PA 1K70A 3FAWA 3K4AA 1ICPA 4S3CA 1LWHA 3GW0A 3GAKA 5HULA 3CQKA 4FZIA 4AF0A 1ZENA 3ZLHA 2NXHA 3H6OA 4MADA 1JPIA 2P3EA 1UD5A 1T0OA 1PHQA 6PTDA 2CLKA 3R94A 4OQVA 4W5ZA 4HMNA 4P8WA 3BLKA 5HJYA 1NVMA 3HN3A 5A8MA 2VVSA 3R7MA 2ZZ5A 4ZR8A 4NYYA 1DL3A 4ZXOA 1QW8A 3WMLA 1U2YA 1W3TA 1B3XA 1JCTA 3W1AA 1DJZA 5SWUA 1PDZA 1IQ8A 2C16A 1CT5A 1J0IA 5HPCA 3UXLA 1GVRA 1QO2A 3KVKA 2OEMA 2HWGA 3WK0A 3SCNA 1M7OA 3BAJA 3WH5A 2HVOA 2B4GA 1E0UA 2F38A 1FX6A 3SADA 5AHMA 5G4EA 2G96A 1VENA 3O8AA 3S1WA 2DH2A 5FACA 3NPWA 3VD5A 4MPKA 1HL8A 3HJEA 3FA3A 2DZXA 1U33A 3W7GA 2IPJA 2QQ6A 1WPCA 2X1SA 3BE7A 3FNDA 4AXKA 5C8BB 3QV6A 1Q45A 1J6OA 5J5RA 4HHPA 3H21A 2V5CA 4ENLA 2FZDA 3UZWA 1H49A 1CLKA 2FFCA 3KVMA 3W74A 1BGAA 3OG3A 3H53A 4XAFA 3A5VA 1SVDA 3A3HA 1P6CA 1BQCA 2VRQA 2HBXA 1M6JA 5GNXA 4R7WA 4LUYA 3SN4A 2E6DA 1A5KC 1F73A 4L4PA 1UZHA 3H2EA 3OZOA 2JE8A 3H2CA 4F0HA 2HJPA 4ZTYA 3TCSA 4A8IA 1IR1A 1VCFA 4DYEA 4CVWA 3A4WA 1X98A 1L0PA 1WUFA 2DSKA 2EXOA 3HFYA 2OYKA 3XISA 1GVSA 3LM3A 2IKJA 1LT7A 4D72A 4N6EA 3W37A 5FJJA 3HG4A 4HU0A 5BXRA 3K1DA 1UIOA 5H8PA 1P6BA 4PRWA 2PTZA 4UFJA 4Q6XA 3WKZA 1E5JA 3PBYA 3MKCA 3PB0A 4FK9A 2OWXA 5FF2A 4O19A 3UCQA 4GX8A 5E0FA 4A4AA 4LVFA 4AUBA 3L0NA 3VOJA 1FCUA 1A3XA 4DJDC 4FMVA 2MANA 3W1QA 5BWAA 4IGSA 3QFWA 2VL4A 3B0UX 1JDAA 2FKPA 3MKKA 3W29A 3NZ1A 3VDCA 4Y9NA 3UERA 4FOKA 4C60A 1K02A 4FIQA 4M7SA 3PF3A 5LXEA 2V3GA 3VM7A 4X0VA 3NDZA 1HN1A 5LYRA 1XXXA 3SUUA 1V6XA 1E6RA 2VHLA 4F9DA 2BLEA 3AZSA 3NL5A 1KKRA 3SR7A 4K38A 3NR0A 4ZQMA 6REQA 1AZ1A 2GUBA 3EWXA 1V0LA 3LHYA 1Q6QA 1XC4A 3S47A 2JEQA 4QJ1A 2B7QA 1MQQA 3UYCA 2IUZA 1PUDA 3EMCA 4XBJA 2Y70A 5HNNA 4PMXA 3Q65A 3WQPA 2QJMA 4LNCA 2VO5A 3AMLA 1R8LA 4W7VA 4B91A 3TIMA 1LG2A 3LG3A 3S5OA 3THAA 2V5DA 5BXTA 3GH4A 3P8JA 1FP8A 5C5YA 3PTQA 1SQ7A 3GTIA 1XRVA 2WNZA 4BWLA 1LQ2A 1CCWB 4PFHA 4M80A 5MF5A 2YZ5A 1F6PA 3EZ4A 3W2NA 3QMTA 4ROPA 1XLHA 3NZQA 2ZA1A 2RKXA 1V3IA 5GJPA 3VD7A 8XIMA 3AS2A 3KP0A 2PZNA 5A6SA 1EO7A 5CLWA 2E8YA 1EDTA 3U3HA 3NQ8A 2Z25A 1FH7A 2IQ0A 4KESA 1KFJA 4AZCB 4X3ZA 2DIJA 1FHLA 2OGYA 1EB3A 1H0IA 1EGMA 1CXLA 3EDEA 3VNLA 2QDDA 1ME8A 2CERA 3CHDA 4BF9A 1A4LA 3J7HA 2J62A 1KO0A 1ADDA 4FXFA 4C6EA 2Q8XA 4NG3A 2WKLA 2X1IA 4XZHA 5F2GA 4V28A 1D7FA 4QTGA 3E3HA 3SCRA 1HFBA 2PDCA 1R9ZA 2Y5EA 4MKVA 2HSAA 3VFCA 3T0AA 3UWWA 3AIUA 4OTKA 2DZPA 3PPFA 2QAPA 2OYMA 1VEOA 5H91A 4C6FA 2YA2A 2QEZA 1OFEA 3NDOA 1US2A 1YNQA 4AZ5A 2V68A 1V6WA 3OQEA 4HU8A 1VJSA 4GA8A 1F5ZA 1RAKA 1EQCA 2XVPA 1DIKA 1OG0A 2P10A 2Y4SA 3FEQA 4DN1A 4YCPA 3H4WA 1DIDA 2GJPA 1Q2RA 5A2BA 3UVIA 3VE9A 3PPCA 1TKKA 2WCGA 3AMCA 2H3BA 3SUVA 2NXIA 3CL7A 3NSNA 1JPHA 1H50A 3KW3A 4RXFA 1LROA 2WSQA 5E93A 2QCNA 1DJIA 1U5VA 1MZRA 3LLFA 3V36A 1YPIA 4GNKB 2DGAA 4ZFCA 3PZQA 3D6NA 1A5UA 1XS2A 2W9MA 2WZHA 4WKHA 1KXHA 3BUVA 4E3TA 1OY0A 1MSSA 4HA4A 1NTHA 2R9RA 1TPWA 4H9MA 1TQJA 1WE5A 2XN1A 3HGOA 3SCSA 1OINA 4JTDA 3OZPA 1IWBA 1O94A 2ALDA 2WVVB 4Z1DA 1KV8A 3MCMA 2G3JA 4V27A 4H19A 3VU2A 1H63A 1GK8A 4J9JA 1CWYA 4MY1A 3LTYA 4H00A 1M41A 3PUGA 4LCRA 5EGRA 2XJ7A 4H8HA 4BFAA 1N55A 4KCVA 2OX4A 1ZJAA 2J8TA 5M2FX 2I9UA 1EOMA 4XZIA 1DTNA 3TYBA 3G22A 2CLPA 5AVNA 3TEVA 4GY1A 5C9RA 1YADA 1ALDA 1DJHA 3FJLA 1LLZA 3N17A 2BVTA 1QPNA 4GK8A 3QGVA 1FCBA 3UA4A 1K9TA 5AVHA 4OVXA 3GU1A 3BMVA 1IXNA 4HOZA 2ZZ1A 3ZJKA 4NZ4A 3W72A 3C2OA 1I2QA 2XWDA 1E0TA 3AYSA 2PDFA 3QHNA 2V3EA 1ADOA 3UCDA 2HVNA 1E0XA 3PSWA 1OX4B 2PDLA 3WLRA 3CHCA 3GG8A 4MFEA 3S1GA 4Q8OA 2X1RA 2Y61A 3CB8A 1R85A 4JL1A 1PVNA 4CD6A 4N9CA 4E6MA 1XLLA 4JTCA 5AC6A 1S5WA 3MYPA 4RR4A 4CNTA 4JTGA 3GR4A 4ZODA 1OEPA 2ZE0A 4MG4A 1KFBA 3LMYA 4A8LA 3W73A 4ZOEA 1WOAA 3UXAA 4Z2IA 3I68A 4GX9A 3MDWA 4MSSA 3GDKA 2A3EA 4C6NA 4LH8A 5AC8A 5G2WA 1E15A 1EJTC 3ICJA 2X0SA 3CAWA 4C6BA 3TYAA 3W9ZA 3WDQA 4WDWA 2NT1A 3GVVA 2EF9A 4P8VA 4AF0B 4XG1A 2GUYA 3N12A 1R3WA 4QS6A 3E49A 4I8DA 3CT2A 1VPYA 2OSWA 4IFKB 4YL2A 3G1SA 1RXOB 1AW1A 1O68A 1VAHA 1AH0A 5CGQA 1UBPC 4JYDA 2J78A 4GXWA 1KRBC 3QSTA 2WMIA 3QF0A 2X7VA 5D2YA 3SO7A 3OLGA 4DF1A 3T08A 3VKDA 3QY6A 3C0QA 1Q5MA 5GVJA 2OX1A 3MCNA 1MW1A 4AC1X 2VKZG 3VGBA 1JYWA 4KKXA 2PB1A 2QDHA 2V0TA 4Q4KA 1O66A 5CC5A 4ES4A 4DUWA 5REQA 3NQ6A 4TUFA 3NYDA 1KXVA 1VC4A 4M56A 2ZC8A 1A4MA 2Y0FA 2RGLA 1TZ9A 3R1ZA 1IEQA 1HO1A 1WBHA 2MNRA 2BASA 3W7RA 2PDBA 3RU8X 5GNYA 2XFFA 2X16A 1TG7A 1NDZA 4O4VA 4MPQA 5BU6A 4TOQA 4P7NA 2DZAA 4PRRA 3DG3A 4IGNA 4H9UA 2XH0A 1IT0A 3OGSA 1GQNA 1ZPTA 1BF2A 2WW5A 4C6KA 3SJ3A 2YLAA 4Z2LA 2WSRA 3MHGA 5CPMA 4DJFD 1W5NA 4XTDA 2NQLA 4ERIA 4JIRA 2YJQA 1TV3A 4NZCA 3GWQA 4DO4A 1LG1A 3DFSA 2RUSA 4PEKA 1EEXA 3RLHA 4CGTA 1SM9A 4PH6A 4XAGA 3W24A 4XZMX 4QFUA 3MVTA 3W1RA 1WV2A 1O6IA 4JZ5A 4PCFA 3OTRA 5I3FA 1C91A 3KBJA 2QCCA 2Q09A 4J35A 4ZBCA 3NL2A 3WJYA 1RHCA 1F74A 2FFIA 5JIPA 3W27A 2WPGA 4LCQA 1FHVA 2ZX5A 5CEWA 2OQHA 1NFPA 4QCEA 4QAWA 1LRQA 1ZGDA 1ZNNA 3LHWA 4L5ZA 2NV1A 1LRNA 1V3LA 1Z89A 3PUEA 4KWOA 1LWIA 2QF7A 2AKMA 1ODZA 4QDPA 1XYZA 4FNUA 1JF6A 5HA7A 3EXSA 3ANYA 5LZLA 2AL2B 1XINA 3BW4A 4WJ8A 3VXGA 5AZ1A 2QCEA 3QV7A 3RPMA 2ZUTA 3RYSA 4US5D 2HK1A 1ONRA 2Z26A 3ZSTA 3NPVA 4AFYA 3PZIA 1XBYA 2HE5A 5AC7A 3GG0A 4KQNA 4JTEA 3WD1A 4FNTA 1NIUA 1J2BA 4HGXA 1FWTA 3QV9A 5I09A 4Y8EA 5I3DA 2KX9A 4JNMA 3LGGA 1LUCA 3HGSA 4L9YA 4ZMGA 4IFRA 1OD0A 2QVNA 3UY7A 5JH2A 4O8AA 3SRFA 1A5OC 3QLLA 3WG6A 4Q4PA 2FJKA 4GXPA 4A3QA 4DBWA 3R5EA 3S5NA 5A6MA 4IWWA 2A3CA 4EXAA 1XIGA 4S2BA 2V82A 2WWCA 5DMNA 2Z6IA 5I3GA 2D2GA 1LT8A 2ZUVA 4ZENA 3RDKA 2AKZA 5D2WA 1Q85A 3GAYA 1UG6A 5FESA 1UPPA 4P7OA 3AHYA 3UWYA 4OBTA 4CLMA 4KGLA 2VFHA 3V5FA 4FO4A 1X96A 1WX0A 1EPXA 5REQB 3AHTA 4GOAA 1EJWC 4DY1A 4HYRA 4BQ5A 1UR9A 1G0CA 3NSMA 1ISYA 5CBBA 2GDUA 1QBAA 2OVLA 3MA8A 3N9KA 5MKGB 5D02A 2V30A 1O7AA 4EK7A 4CQ8A 1MRQA 4RLIA 1U5JA 5AC4A 3BMXA 4W89A 3A23A 4DBUA 1Y5VA 2QIIA 1KV5A 4EVZA 3M44A 4DI9A 4W5UA 1L6YA 4XO7A 1HGYA 2OZ8A 3R6IA 1TV4A 3S9ZA 2A7RA 5H8UA 3W2MA 3ALFA 1FWAC 2E40A 5DFAA 5CBIA 2BMBA 5I02A 2WZMA 3TNOA 1B4EA 4MY8A 2HS8A 1PKMA 3CTTA 4IZGA 3IJ9A 5EMYA 5KETA 2GLKA 1JR1A 1PX8A 3QZ6A 3ITYA 3OYZA 4AEOA 1LL4A 4H9TA 3M64A 4J2MA 2NT0A 4M3PA 2D0FA 3VDGA 2VFEA 1EOKA 4A8NA 5AHNA 4QS5A 4IUOA 1SO6A 3N9RA 4C6OA 3ONCA 4FXRA 3DYPA 5D8WA 2X1UA 4M81A 1UWRA 3A5FA 2ZXAA 4QGCA 2PWUA 1VFOA 1FDYA 2FVLA 4R27A 4RDYA 2F6KA 1L6SA 1AK5A 2REQB 5C9ZA 1XUUA 3LHUA 3MZ2A 4GGBA 3L2LA 3W0KA 3FGCB 2I7GA 1VBHA 1B4KA 3PULA 3HJZA 4OECA 3SW6A 5DELA 3F4VA 2CBJA 4TMCA 5D38A 2OJPA 2J27A 3WH6A 3CASA 2FPTA 4ZB2A 1W2VA 3C2RA 2Z7GA 4JFVA 3T05A 4UTUA 4CN4A 1EC8A 2A6NA 2DJXA 1UQZA 4K6AA 3T9PA 4KCWA 3K5XA 2JKEA 1Q6EA 3EWCA 1PSCA 4B5XA 1KD0A 2REQA 3FN9A 2HV5A 2W91A 5EYWA 1L6FA 2XFYA 3JS3A 1VCGA 2WBKA 4M1RA 3NVTA 3A21A 2ZTKA 3WD4A 1VRXA 3NEVA 1RBLA 1RD6A 2VD8A 3V0UA 1KW1A 3VD4A 1J8VA 3PPHA 1QK0A 2EHHA 1ELSA 1J9YA 1O12A 2RDUA 2VDIA 4H9VA 3ZS4A 4XX6A 3NQAA 1R47A 4FSAA 4A21A 1EJRC 3MANA 3UG5A 3AIVA 4JD4A 3IANA 4ACYA 3TMQA 4QNEA 2I56A 1KTBA 2CLLA 3CUGA 1DTUA 3NQGA 3G18A 4GE8A 2FIQA 4QDWA 3VUPA 2JK2A 4S3EA 4Y6GA 3C2YA 1B9ZA 5HQMA 1EHAA 2O9PA 1M7XA 1S3TC 4QP0A 1NM9A 2CLHA 2C91A 1K9DA 2GSEA 3CIVA 4B16A 3KDNA 1FVPA 1XLCA 4C6QA 1HW6A 1Z42A 3FY1A 2EEXA 4Z0SA 4C91A 2PP0A 1MW2A 1IIHA 1UKOA 1WKDA 1SFTA 1PX4A 2J9ZA 2XGZA 4JIIX 2QCLA 2W3ZA 5CSRA 1UC5A 5BZAA 1VS1A 1VFMA 1M03A 5EFDA 1ZS2A 2VUNA 3ZJ8A 1UUMA 4J3WA 2DT2A 3DI0A 3H55A 3LRMA 4PB5A 3GNDA 1X97A 1ZAHA 3SBFA 3AIRA 2V38A 2JBMA 1EC9A 1LL6A 3VMPA 1B5TA 3E74A 3GNRA 4UNIA 3AQUA 2ACSA 4RK8A 2WKJA 2FGLA 3QFEA 2V3FA 1OFAA 3C8FA 1R3SA 2G3MA 2ON3A 1E72M 3EB3A 1EA9C 2P53A 4Q4RA 5MHBA 3W2JA 2CETA 1M7PA 1EX1A 4FPSA 1W1ZA 3E0VA 3WNLA 1A5LC 4MGGA 3LCXA 1A0EA 2QV4A 3L4XA 4GFIA 4OJYA 3JR2A 3SGUA 3THQA 3IJ8A 3M6DA 1AMYA 2QDGA 5KITA 4ICMA 2PWDA 1H41A 1X38A 3GVWA 1JULA 4K7YA 2ZRUA 2ZA2A 4W86A 3HGRA 2Y6ZA 2Y8KA 3T7VA 1TO3A 2ZX9A 3PANA 3OLDA 1QASA 3SDOA 4NU7A 5ABFA 2G3IA 3UWQA 5K4XA 1QW7A 2VFFA 3UGRA 4DXKA 2EKGA 3W7KA 5FEWA 2JIWA 1R0MA 1U30A 2CLMA 1MI3A 3H23A 1K8ZA 3MB9A 1OFDA 4OOZA 3AAMA 4M8UA 3MSGA 4KH2A 3URNA 3A3WA 2WNQA 3BAKA 2EPOA 2V69A 8TIMA 4ORIA 4IMDA 1DWFM 1DIEA 4FNQA 1UD8A 4ILSA 1G7UA 2HRWA 5FEZA 4O1DA 1V6VA 3AXXA 1BEUA 1PIFA 2NXGA 4H01A 3WH7A 2H8ZA 5EMLA 3WQCA 3W7DA 3ES8A 2V81A 2BTMA 3UP8A 4DNHA 5FOOA 4CNUA 3FGCA 4Z1YA 1P43A 4GQ0A 4C6DA 5HATA 4OZOA 3ONBA 1OF6A 4ZQRA 4QQUA 2TPSA 4JFSA 1P48A 3W6MA 3VNIA 2PS2A 3H2MA 4GUGA 4MF4A 4JQ2A 2CKSA 2DIKA 4YN5A 1PZ1A 4GUJA 4XAYA 3THUA 3RM4A 1XQLA 5HJLA 5LA1A 1KRAC 1WOBA 3BCFA 3C0SA 2FTWA 2VEGA 1OHLA 3GW3A 4X63A 4BI7A 4C1NB 2JKAA 5BOOA 2ZRXA 2NVDA 1T5AA 3N6QA 3VX0A 3PZNA 3WJXA 3QR0A 1RK6A 3O6AA 4LYPA 3UNDA 3HQ1A 3WL0A 3LY0A 1TPC1 5DBTA 4LUTB 3CK5A 1H0GA 4LT9A 1F3WA 2NUXA 2PE4A 3UESA 4HPGA 4AHQA 4DJFC 2D20A 4MWAD 3CQJA 3DN5A 1VFHA 2PDXA 4PYSA 3BLEA 4I9AA 1ONWA 3N4AA 4HSNA 3K8MA 3GTFA 2CLEA 1XI3A 2OEKA 2WMGA 3U5YA 1DJXA 2O56A 3GG7A 4UFLA 1ITXA 1EXBA 5LHEA 1H11A 3A47A 5GQBA 1P1XA 3MY9A 2ISVA 1W5MA 2PTYA 2Z1XA 5DLCA 1J10A 5MKGA 2DQXA 4ML4A 4AWSA 3A9BA 2BB0A 1OJXA 1O5KA 4RDZA 1G4EA 5E9XA 3WDJA 1L8PA 3B9AA 2EJAA 3W1MA 3GIQA 3V4BA 2NQ5A 3VIIA 1V93A 2GDQA 3S2NA 1KM6A 2HTMA 1TJ0A 2QCHA 3DESA 2NQHA 1D8WA 2HDJA 1S3HA 5HMSA 3GE7A 1BTMA 1IWAA 1GJPA 1TQXA 3C0JA 3WEOA 4E2BA 1A47A 2PWVA 3EWWA 3KCJA 1UROA 5ENLA 1BKSA 1OCNA 1G5AA 2WMIB 4PMVA 1VH7A 3TWBA 4GJ1A 4YHEA 1E5NA 2V9DA 3HMCA 1J96A 4DF2A 3V5OA 3WUFA 3TJLA 3SB0A 3SN0A 1JZ5A 2Z00A 3CEPA 4Y8FA 4CD7A 3KOXA 5C2CA 3U48A 1GOMA 1C90A 3L2IA 1XICA 3VD3A 1GQLA 1NFGA 3W2UA 1DJNA 3M7WA 4FIRA 1XW8A 3P67A 3TYCA 3VMNA 4Q8TA 3HZ3A 3GFZA 4MUZA 1ZLPA 5BOEA 1S2AA 2XIMA 3FHAA 3G0XA 5GPRA 2YZRA 3QPYA 2WB5A 2F2KA 2GQAA 2V5KA 3EWUA 2DW7A 4B5UA 2DUAA 2E6YA 1AL7A 3BV4A 3M43A 4K1GA 4IMCA 4H04A 3VNZA 5D37A 4IX0A 1PE1A 1E6QM 2Y8VA 4NZ1A 3PBVA 1RV8A 2RGMA 3LGEA 4CN6A 2XVGA 1TX2A 1EJVC 1G69A 5E5CA 4ERAA 2ZWYA 4NAFA 4ZVJA 3BK0A 4LUSA 1XLKA 3IIZA 4YVVA 2OQLA 1CGUA 1QHZA 2D69A 3M0IA 1V4YA 4H3DA 3RM9A 2FYMA 4DO7A 1NWTA 1UWUA 5BXSA 3TH6A 4YHGA 3RX4A 1QI2A 4X2PA 4YU1A 3SY1A 2DUZA 2PURA 2YCKX 4NNAA 1F4HA 3IAQA 2Y7FA 3VNJA 2YB4A 4ZE5A 2PDUA 1DXIA 1R9YA 4WRHA 1YXDA 2GQ9A 4ZQNA 3GIPA 1U1JA 4KFOA 1B3VA 5CQ1A 1H1ZA 4Q32A 1DJWA 1XISA 3SECA 3SURA 4K37A 3HPZA 1GEHA 4ADSA 3BOXA 2H9AB 3QOKA 1KB3A 2WC7A 2WLYA 4NNBA 4CNNA 3DIPA 3GBEA 4LF2A 4MB4A 3H2AA 3S2JA 2BY1A 7A3HA 3PBMA 1IF2A 3DFTA 2QKFA 3NZPA 5CXPA 3KRSA 1FKXA 3GSMA 4D6DA 2HEJA 3NQ7A 4IGHA 3KLLA 4UTTA 4EXBA 4Q8UA 5EY5A 1TCDA 4PUNA 4FOJA 2UBPC 1HKJA 1GOXA 3QQWA 3BLIA 1IZCA 3O6DA 1AW5A 4ORMA 3L4UA 2VC7A 3IUIA 2UWFA 1ICSA 1C92A 5C6MA 4HOXA 5KZDA 5HQEA 4UIOA 4AZBA 3H4XA 2OOGA 1UC4A 4JHMA 3IIOA 1Z69A 4ZOBA 1V03A 3CT7A 2PFHA 3ABSA 3BURA 1ZP4A 4UTMA 4MTVA 3TX9A 2BY2A 4NJJA 3TCEA 1BXNA 1GOOA 5D8ZA 3ANVA 4WY0A 4LBSA 4JIPA 1KM4A 1EX5A 4XD6A 3CH9A 4LAOA 2I14A 1LWJA 4GI8A 2DDXA 1XWYA 3G1DA 3AOFA 1UCWA 1AMKA 2CLOA 4C65A 3CHEA 1JUBA 1PS9A 4QG6A 1JFHA 4JEQA 3GKFA 2ZZ3A 2CW6A 4B5WA 3PSVA 4MHBA 4NP7A 5EA9A 7REQA 2VVNA 5HMDA 1VKFA 3OPSA 1FP9A 1WXZA 3CQHA 4ACZA 4ZCWA 2D2HA 2ZUUA 1CB2A 4ZQOA 1EWDA 3N18A 3VIHA 4EAMA 3IS4A 2VM8A 2BDQA 2J74A 1JZ8A 3LB0A 4PSRA 2E7FA 1LOQA 2JFEX 3LU2A 4HA0A 1ODUA 3ATYA 3REQA 4GG9A 2NSXA 1IZJA 3NDYA 2E1DA 2PBGA 2WK2A 1IEXA 5AC5A 2F8QA 4FX6M 5CC6A 3NQCA 1F7BA 1CDGA 3ARVA 4Q7BA 4XQ6A 2FGBA 1O5QA 1I2PA 3LXAA 3W6LA 4EAYA 1Y5XA 1ZCCA 3HQPA 4HMDA 3CZEA 3IIPA 5M17A 4ATWA 2VX6A 2A3AA 4FNRA 3T4CA 3ZM8A 3KL0A 1FQ0A 3ABZA 1D8CA 3FFSA 3VVGA 3MHUA 1ZCOA 2PGFA 3QM3A 2WJZA 4YJ5A 5L9FA 1AQMA 1E4MM 3B3DA 3DU0A 1W17A 4QBXA 1XHGA 2ESCA 4UC5A 5I06A 4QLKA 4M51A 4OHQA 1JYNA 1UWAA 3GDLA 4XIMA 2HPIA 2OKOA 1WZAA 4WJEA 2O55A 1EGZA 4CU6A 1QI5A 3HPAA 4TMBA 2A3HA 2XFRA 3S2CA 3TZFA 2PLKA 3ARZA 4HKPA 2Y88A 1R3QA 1BSLA 5F4SA 3OVQA 1X7FA 5EU9A 2ZC1A 1V3HA 1KM1A 4DPQA 4PE8A 1CGXA 1CYGA 3WL1A 3AISA 1NELA 1EGVA 1V6UA 2A3BA 1HTIA 1JCMP 2O7QA 3EB4A 1Q6OA 2QLYA 5EMMA 1Z6KA 4H9ZA 1LF1A 4I5UA 5I6SA 4WR3A 3I7SA 4R3UA 5EPDA 1IHIA 3TN3A 3WF1A 3UW6A 3E38A 3PJXA 1TV7A 1NOUA 3PWGA 2X0HA 1GG0A 4K7VA 4KERA 1SZEA 2PWEA 5U4NA 4W85A 1H51A 2B0MA 4NHVA 2A4AA 1E3ZA 3W1NA 4PBFA 7ENLA 1UD4A 3AXIA 1H3GA 1XPGA 1DWGM 3OZMA 5IOBA 4J3ZA 3AXMA 1JAEA 2HMCA 1EIBA 4IX2A 2J9YA 2FTYA 3G2GA 1R9XA 3PM6A 4QITA 2CKRA 3RXZA 3KCOA 4R5EA 1JYXA 2PODA 4NNCA 3MJYA 1J93A 3ID7A 4N9EA 3W07A 3BJTA 3RCYA 1G4SA 2ZADA 4XD5A 4JYEA 5DANA 4F40A 2QZRA 1ONEA 2R1LA 3L66A 3ZLGA 4ML9A 2OPJA 2QF8A 2E4TA 1OG6A 2Q8ZA 4PTWA 3WBXA 5AKQA 1XGDA 3LPGA 3ZT7A 1SW7A 4DUXA 2F6UA 2JQXA 3PK7A 3VIJA 4Z2JA 2J6XA 1CX9A 3F5LA 3MQTA 4V1XA 1TVLA 3GUGA 4LSBA 3WLLA 5LNSA 1XV8A 3ARUA 3E2SA 3OGVA 1DE6A 1FDZA 4UB9A 1FA2A 3OVGA 3CTLA 3CO8A 3GQYA 2HROA 3ARWA 4DWSC 1UMLA 2QIWA 4E8GA 3CZKA 4Q8VA 3PBWA 4NZ3A 4HIBA 3NXLA 3TC3A 3N2XA 1PKLA 7XIMA 4PTDA 4YXGA 3DFYA 4DVOA 4S38A 3HF3A 3ATZA 1QNPA 4GZIA 2HISA 4N7QA 4A2RA 1OFOA 2P50A 4WGXA 4RZ4A 4L80A 3F2CA 2ZZ7A 3F2BA 3CXOA 1ECQA 3VINA 4I9TA 3TQPA 1QXLA 4JQ1A 5DBUA 3GK0A 3E2RA 4A8RA 1GVFA 3UG8A 1D3HA 4PUKA 5LIXX 2CHNA 1LRTA 4UTJA 3B06A 3BLDA 5JIWA 3L2MA 2PDGA 4ZFMA 1ZFJA 3VOIA 3L4ZA 1NQKA 5A8OA 4DJDD 5DF0A 3VCCA 3STEA 1DE5A 2R91A 4KIEA 1ZUAX 4JAWA 4I7VA 5D2TA 3CYVA 1TWIA 3N14A 4DZHA 4Y9AA 4GY7A 3V18A 4PCNA 3AWNA 2WNNA 2GJRA 3N3MA 3L4TA 2O4QA 3W23A 5B7ZA 2B7NA 1OWQA 2QHAA 2ZTJA 3VI2A 2PUZA 8CGTA 4JKMA 4QQ3A 4W7WA 2CZVA 3HG2A 2D0HA 3TLQA 5GJNA 1HJWA 1UH4A 1LLOA 4GBUA 3CM4A 4QR6A 4J1OA 4JTIA 1W0MA 1MNSA 4O15A 1WKEA 3ENLA 3BQ5A 1I8JA 2P5NA 1PJ9A 4Q8NA 1QWKA 5E1QA 3O0FA 1EDQA 3G1YA 2DJLA 4S3BA 1ZHAA 2GK1B 3N6HA 1L2QA 1TUFA 1U83A 4HNVA 3OQ8A 2P1FA 3VOFA 4DWDA 1CPUA 3L65A 4AIBA 3OVPA 4IL2A 1VYSX 2OCZA 2WAGA 1S5NA 3AYRA 3REQB 1XSJA 3QR3A 3U2OA 3L4WA 4YMZA 3W6YA 4ZO9A 4M5PA 1Z41A 3D3AA 5JXQA 3AROA 2F84A 4K68A 5H1WA 2Z1WA 2XG9A 3GKAA 4L1GA 3QTPA 5BXPA 2D22A 4TU1A 1M3UA 2C3ZA 1US0A 2OYLA 3DEQA 3DI1A 4NT0A 1FHDA 1V51A 2HK0A 2FH6A 3VD9A 1IR2A 3ZXWA 4GI6A 2QGYA 4Y7EA 3TP4A 3QQ1A 1IWPA 5TQLA 2DV0A 1B90A 2GUUA 1BWLA 1QNRA 3GVRA 3V5CA 3L67A 1UWSA 1BKHA 1EFZA 4C7FA 2VP8A 4MJ2A 1PDYA 4J27A 4RE2A 3ZLFA 4JTKA 1YPXA 3N34A 2VGGA 3UZZA 1Z48A 3W1TA 1W31A 2ZXBA 2ZUSA 3M4HA 2J4GA 3EDFA 4GIRA 5F2LA 2CZDA 4LPCA 4OKDA 1KA9F 1OCBA 1TTPA 1XGZA 2VEKA 3DG7A 5HWJA 3W1UA 3ZVIA 3D47A 2J88A 4BWLC 4RKAA 2ZOXA 4RW5A 1T41A 1S46A 4JOMA 3N2OA 3RLUA 1V6TA 2PRHA 1GQIA 3BV7A 4D6CA 3FS2A 4WQ6A 4WY0F 3AICA 4OU1A 1SR9A 3K2GA 5ABFB 5E6ZA 1XUZA 3TR9A 3T07A 1AD1A 2R1KA 4QE1A 2FMOA 3T81A 1U22A 5DT7A 3PVFA 3A64A 2VMFA 2F9RA 3SRDA 1XDMA 3G1AA 5H8MA 1VRDA 1JD7A 3STPA 5DMYA 2RFGA 4NJHA 1E3XA 1F3XA 3RG6A 4UBPC 4QSFA 2HNHA 1LOLA 2X8RA 4LS2A 1FWRA 4Q8QA 2NUYA 4IMEA 1N8IA 3W71A 1W3LA 1F05A 2PA6A 4IQLA 5CG0A 4WIWA 3OO2A 1XRFA 1XH2A 4ECLA 4UNKA 2ZYFA 3IK2A 4IIGA 3CV1A 3B8WA 3SSJA 1K4HA 3QGKC 5FL1A 4ZEPA 5I00A 3C2EA 2WMFA 3NIYA 3S1UA 1AQ0A 2BNJA 2ALRA 3LYEA 2YL5A 1RLDA 2C0HA 3EMZA 1JZ4A 1X1NA 1KCKA 4U10A 2WXDM 4L1XA 4MZ8A 4QDMA 3EA1A 4HU4A 1NP2A 4JNZA 5H6HA 3LCWA 3T42A 3VZYA 3U2CA 1VYRA 1BRLA 3ITLA 4IFKA 4CNPA 2V2DA 5IHRA 1NDYA 3LPFA 3NPXA 3S6OA 4NAEB 4WDXA 1Q65A 3R43A 4NKCA 4F48A 1UUQA 3QPEA 5BOFA 5I23A 1WDPA 1H7XA 2G97A 3PN8A 4IIFA 1D3CA 3IJQA 6XIAA 3EEGA 5HOSA 1TPB1 1KBBA 3TFCA 2VGIA 2YCIX 3N6JA 3AU6A 3S9IA 4IL0A 3KRUA 1UKSA 4V15A 2W67A 1UKQA 4UNLA 3KEHA 1W9PA 3S46A 1ECEA 3KOYA 4YYCA 3M0LA 4HK7A 4D71A 4QAIA 3L0KA 5I24A 1XX1A 3WBYA 3K8KA 2GOUA 3JUGA 1GUVA 3DBPA 1YHTA 3P82A 4A6GA 4HA1A 4HP5A 3E1F1 1J6PA 3CBWA 3R4IA 3DH7A 3JU2A 1TPFA 2P8CA 4C6PA 2PAJA 4O57A 4IPNB 2AGTA 4PMQA 2NLIA 2J8GA 3HMJG 5C2XA 5IFTA 2G0WA 1J0YA 3M0HA 4W8AA 5G1YA 1XLMA 3ARRA 4HA3A 3B8VA 3SSZA 4MLRA 1XLEA 2XSBA 3GFXA 3TK7A 3WBWA 4G5DA 3UG4A 3W22A 1JPKA 5ABHA 2GSJA 4GVIA 3MUXA 1QFEA 3UXDA 2BXVA 1MDLA 4JY8A 3CNYA 4UQDA 3OP2A 1RJRA 2FHFA 2CITA 1UBSA 4IISA 4WLCA 3D3FA 1GEQA 1OSEA 3EA3A 3EXRA 2OEJA 5ABGA 1E0WA 3I4KA 2CYGA 3AYTA 1JGMA 1WAUA 1R86A 4J4KA 2WV8A 3E96A 3UFYA 4QJ4B 1V7AA 4JFUA 3AXKA 3CAQA 2NQ9A 1XBVA 5G4WA 1MUMA 3HIJA 2Y8UA 4JDBA 4B5TA 5C9XA 3MI2A 3E02A 1VHNA 3H22A 3UZYA 1XCXA 5CZ0A 2WQPA 4HK6A 4GQRA 3A9IA 3EX2A 3OIHA 3DCPA 1TA3B 3HM7A 3NFUA 1ZP3A 1PCKA 4AISA 2HBVA 2JEPA 1QUMA 3TZNA 1VF8A 3FKKA 1RJPA 1FH8A 2W5FA 2QJIA 1ESWA 4WSKA 3TAKA 5K2ZA 3CB3A 2LLEA 4HT3A 3RLGA 1BWKA 1QATA 2Y5SA 2DSZA 2XZ9A 4YLWA 2ZDSA 2PWHA 4AWTA 1XF0A 2FZBA 2A6LA 1J5SA 2QCGA 4FEZA 4ZO8A 4HNCA 4LRSA 1CTNA 2VUYA 5C7HA 4Y90A 2WHKA 3C56A 3UYIA 1EZ2A 1BXBA 3L4VA 4D6IA 3MWCA 3KM8A 1Q13A 4UWMA 3MS8A 2I57A 3WD2A 1KWGA 3I7RA 3TDFA 5DMLA 1AA1B 6TAAA 1H7RA 1WQ5A 1HJUA 4XAPA 2QULA 1P7TA 3FDGA 3G1HA 2FVKA 1EYEA 2W79A 3HGJA 5K3VA 5M03A 3A24A 4IP4A 2DORA 4YWIA 3E5BA 2Q02A 3G8EA 3BZJA 1LOSA 3GC2A 1W37A 4JTLA 1TJPA 2EQDA 4R53A 4AZ6A 3SI9A 2DVUA 1IXPA 3BXWA 3N2TA 1XKYA 1K9EA 3DUGA 1TJ1A 2NV2A 1PPIA 1NU5A 4ZL1A 1TPEA 3ISIX 1XM3A 2BFGA 4HYWA 3WQVA 3HB9A 1D7KA 1G94A 1LUCB 1TVPA 1ZY9A 4B92A 1US3A 1OFPA 3WSUA 4MOZA 1R87A 4F4RA 3VNMA 1DWJM 1SR0A 2ZX6A 1KFKA 1HL9A 2E3ZA 3PPGA 5A8NA 5BNKA 3IRDA 2WCSA 4GUIA 4HZ6A 1KQYA 5DO8A 2YB1A 1HXJA 2R6OA 2ZKMX 3WH9A 2WO5A 3V7PA 5PTDA 3DC8A 4GO8A 4ZE4A 2G3FA 4W87A 1Q7ZA 2DPEA 2Z1VA 4MFDA 3N2BA 3UCCA 3CEUA 1M7JA 3EWBX 1VFTA 4PR4A 1TPVA 1QI0A 4YTSA 2GGEA 2ZDRA 3MUZ1 1M9HA 4MNKA 3GXNA 4FF5A 1XL9A 1KGXA 3BJFA 4LBUA 1QNVA 4Z42C 1K8YA 1WO2A 4Q8PA 1KNWA 4PN2A 2QCFA 1OT1A 1POKA 1I2RA 2QW5A 4A22A 4WD0A 3WQEA 4Z2KA 1SZNA 1DWAM 3LXBA 1Z3NA 4ATLA 2E28A 3M1ZA 5CSSA 3MHFA 2QUVA 1GOKA 4E8CA 3OW1A 4GYPC 2NQJA 1UZ4A 3TTQA 3APYA 4UCGA 5JUVA 1GHSA 2GYIA 4JIHA 3LUTA 4GXMA 3VPLA 4MDPA 3DC0A 1JZ6A 1BGGA 3PS7A 1LQ0A 4H8UA 4ZSUA 4PODA 2R14A 3G5EA 4WZHA 4FALA 3PB2A 3W3OA 3TJXA 3KFTA 4B3LA 4JR5A 2GJXA 4LY4A 5A6KA 4IUGA 1G1YA 4LB3A 4DZ5A 1I1WA 1ME7A 4OV9A 1FWGC 3VDHA 1QNSA 5DCBA 5E70A 3OZYA 1E9LA 4DJEA 2VC9A 4E0CA 5TF0A 2YL8A 1E1FA 1QBBA 4B2DA 2PEVA 1VIZA 3CPRA 4OWGA 3B03A 1MEIA 2ZZ2A 2QUNA 6CGTA 3UR8A 3H24A 2HQAA 4W7UA 1KWKA 2AQVA 3E0IA 3O06A 3ARQA 4AU0A 3GVGA 2QVHA 1XIFA 3B8UA 1W1A1 3ZWSA 1TTJA 1E1EA 4M6VA 4QRNA 4B2DD 3QQ0A 1IYXA 1FFRA 4LALA 1DXEA 3EX6A 2QT3A 3L7RA 4IG2A 5FF3A 3VKKA 2QPXA 1RQBA 3EX3A 3H70A 5AOUA 2ZRWA 3CMFA 1JI1A 3EOEA 2ZRZA 1FWJC 1XFBA 1NDWA 3W38A 1Q66A 1KLYA 3LSBA 4L65A 5CKSA 4Q7NA 1ITUA 3BQ6A 1MFUA 3G3MA 1XLJA 1ITQA 4KETA 2VZTA 4TX8A 2IKGA 4Z17A 1GVEA 4DZAA 3QW4B 1QOQA 2HCVA 4PMZA 2DW6A 2DH3A 1VZWA 5AYZA 3LA4A 3NA8A 1BTCA 4AZIA 4G7EB 1JCYA 1RVGA 4PMOA 3PJTA 3L21A 2PDKA 1VBUA 1GWJA 4FR1A 3A4AA 2HZGA 3VA8A 2G5WA 3VGGA 3WQFA 4CD5A 1B1YA 3U2EA 2V8ZA 2WMJA 1VFLA 2HS6A 2VOMA 5DX7A 1GPFA 4ZB0A 2XIBA 1EJUC 4Q4MA 4AZCA 3H2OA 3TYZA 3BVJA 2C0AA 3QYSA 4HB7A 4E38A 4QLLA 1W9VA 1THFD 2G8ZA 3NURA 4HNNA 3RR1A 3MCOA 2Q01A 3AHXA 4FNSA 1UOKA 4F0LA 1GOWA 2C79A 1JCLA 1GNXA 1RVKA 2WKGA 4UMAA 2QNEA 2X30A 1E4NA 4V33A 3SFKA 3W88A 3S5ZA 4LEFA 2BXZA 1SMDA 1OABA 1VLWA 1K7FA 5KZEA 4EPBC 3SGGA 4QHRA 5DCEA 2FZNA 4P7LA 1FBAA 3HTWA 3W81A 2W92A 3KBNA 3RU6A 4BEQA 3TOPA 1R3RA 2DZBA 4N2YA 2ZZ4A 4AD0A 1AG1O 3BW2A 4PMDA 4XTIA 3CZJA 3BG5A 4TTGA 1XLFA 5B80A 2C15A 6REQB 4INFA 2GZXA 4TIMA 2A5HA 1RR2A 2C13A 3OEXA 1TUXA 4HN4A 1DYSA 1YTDA 1X39A 4X61A 4AD1A 4E2OA 3NQEA 2OXNA 1KFWA 4OBSA 3NO3A 3T0CA 3WQ4A 2RDTA 3CL8A 4LAKA 3IK4A 1W9UA 4DZIA 1XSIA 5D05A 3DKJA 3ZR6A 4IIHA 3DOPA 2BSLA 5JH1A 1ZSXA 3GDBA 1P0KA 2FPVA 4BHYA 2YYTA 4HU3A 3LD5A 3P2VA 2OZTA 2J13A 4AZGA 1RUSA 1BYCA 3AO0A 6TIMA 3SJNA 4LAZA 3TN5A 2YL6A 3NAVA 1PBGA 1H7PA 3W28A 4AZ7A 4LOCA 4J3SA 3L5AA 4RJEA 4FXSA 3WEMA 4MNLA 3KS6A 4LWWA 4H6QA 3M5YA 2X2GA 3RCMA 1DBTA 2I16A 3QY8A 3AFBA 3UPBA 3NZRA 1VLIA 3O1NA 3P0XA 3ITCA 5FF4A 1EL3A 2UY5A 2NW0A 1NF0A 2UV8G 1F3EA 3G6LA 1UIPA 3WLJA 1JDEA 7TIMA 3UR2A 4LS1A 5M5DA 1W3NA 3OHMB 4DUVA 1G9HA 3MUY1 3KTCA 3RFAA 3IJIA 4LNYA 1OM0A 4YIWA 1KKOA 4GABA 1KCLA 3LERA 5A94A 2G41A 4OUIA 2ICSA 4IF2A 4K2SA 4P8UA 1G7VA 3B8TA 2CC0A 4LV9A 5BU9A 1LLWA 3O07A 3O0KA 1BSIA 4DUOA 5I5RA 2FTPA 4JYFA 3PBGA 2V5BA 1DV7A 2IS7A 2J7HA 1MRAA 4NXKA 4G1NA 1OC6A 4HNOA 5F4WA 3GYCA 2NUWA 4NYUA 4JKLA 2XIJA 5A3HA 1GGOA 4CCDA 3EBVA 4I7WA 3BGJA 1HQTA 1EO5A 3N25A 4BR1A 4HNUA 2NWSA 3CGTA 2ATSA 2Z2UA 1UR2A 3FVMA 1J0JA 1E1CA 1ITCA 3EXTA 5C70A 3T0DA 4HHMA 2DU2A 3AALA 3W82A 2ISFA 1UH2A 4C5ZA 3EWDA 5CZKA 1U1HA 5FAGA 3VM5A 5JU6A 1TTIA 4EF8A 3M9YA 2VQTA 3LMZA 3PZTA 1UJPA 2BODX 3GZAA 3TA9A 3EWZA 2PWFA 1HVXA 2NX3A 3M0MA 1HKIA 2E8ZA 3T0TA 1FWCC 4RNIA 1XYFA 3EMQA 4PB3A 5HNRA 4GISA 1FHUA 2TSYA 4L4OA 3I4EA 2D2OA 1YDOA 1A3HA 1VHCA 4JFTA 3B8DA 1QNOA 2ZBTA 3S0CA 4UFKA 1HVQA 3T2PA 3HA1A 1A49A 4XZ9A 1RJQA 4D8AA 2F61A 1JIBA 4MB3A 3N4FA 3FDKA 1X6LA 4IQJA 2VX4A 4Q4SA 4QSHA 4IXHA 2ZUWA 2EPKX 1V6YA 3R58A 4M1BA 4DYJA 4DWSB 1NARA 5XINA 1XLDA 3BGAA 1JVNA 3IAPA 3OBAA 4F66A 1VP5A 1LORA 2OOFA 1UR1A 2INZA 4HNTA 2DSVA 1UZDA 4FR6A 3VIOA 2B81A 3KL3A 1UD6A 4O16A 5LGZA 4GYJA 3V0SA 2TYSA 1JXJA 4PL2A 3ECQA 1E6XM 4NZ5A 2G95A 5I78A 2QUMA 3Q45A 3BGGA 4NSBA 3ITOA 1UKPA 1EUNA 4AY7A 2Y5JA 3B04A 3GXFA 2BBFA 4LGXA 3UQNA 4NXSA 1EDGA 4P5UA 3TYEA 3SCOA 3RILA 1FWDC