1KM7A

Solution structure and backbone dynamics of gabarap, gabaa receptor associated protein
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
100
structure length
100
Chain Sequence
b'GEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GABA(A) Receptor Associated Protein
molecule tags Protein binding
source organism Homo sapiens
publication title 1H, 13C and '5N resonance assignments of GABARAP, GABAA receptor associated protein.
pubmed doi rcsb
total genus 18
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2001-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1km7A00
3M3JA 2ZCCA 3U8ZA 2WYQA 2FCSA 2D11A 3SHQA 2RR9A 4A3OA 3PS6A 2KVRA 2MQJA 2KO3A 4PYZA 3QAQA 5LXIB 2KN5A 2O2VA 3H1UA 2KD0A 4LJPB 2DENB 2V4LA 2MWSB 4IM0A 2M4NA 4NJ6A 4HPLB 4F8CB 3ZVVA 3VTUA 3N3KB 3KYCD 2K8HA 1AARA 1GG3A 2NBUA 2L05A 2NPTB 4GDLB 4HJKA 3JYUA 3WAOA 1L7YA 1RRBA 2NS5A 2BYVE 4WQOB 1WR6E 5BO4B 3IG3A 2MBBB 4HWIB 4ZRKA 2LUEA 2ZZPB 4K7SA 4WJOA 4ASWC 4BKGA 3NY5A 2JWZA 2RPQA 3ML8A 1VD2A 2C7NB 1F9JA 3A4SC 2KANA 1IYFA 1T0YA 1WX7A 2G4SA 3H7PA 4I6PA 5JH5C 4A20A 2KMCA 1K8RB 2Z0DB 1WJNA 4PYUA 3APFA 5TR5A 1SE9A 1UBIA 4HCPB 2JVCA 2MCNB 2KTRB 4ANWA 4X57B 3WAPA 3R66C 2DYOA 1SIFA 3UGBB 4E71A 4K7UA 3W1YA 5DPRA 2MBOA 2KC1A 2UWQA 2RGFA 2EKEC 3OLMD 3RD2A 1OQYA 3TMPB 2BGFA 3TJPA 4DDGD 1Z5SB 2IO3B 4KDLB 3WAMA 2MBHA 2YLMA 5AZFA 2MW5A 2KLGA 1RFAA 4MSQB 2DZJA 3AULA 2FIFA 2K1FA 4TQ0A 1IPGA 2XK5B 2J0MA 3KUDB 2L8JA 3ONSA 4WJPA 5AZHA 4EEWA 4E3CA 3UQBA 3KYDD 2Z0EB 3AI5A 4G3XB 4MJSA 2O6VB 2J0KA 3UIOB 3DDCB 4BKSA 5L95C 2AL6A 4GGQA 2KKCA 2DX5B 3X23A 1OTRB 3V62A 4II3B 3X0WA 2NR2A 2V3SA 5D94A 3ZTCA 2K39A 1WY8A 4W9DA 5LXHA 2KDIA 3T8MA 3O65B 2XBBC 4HXDA 4RMAA 3JW0X 1Z2MA 5CHVC 2R2QA 3KW5B 5JHBA 2RSUA 4JL9A 2KLCA 2MP2A 3VTWA 3ZW3A 3OAWA 2N1VA 1U4AA 1I35A 4GB9A 3HM6X 3WALA 4FULA 1C1YB 5C23A 2M1MA 2NVUI 1I42A 2LI5A 3GZNI 1WGHA 3VH3B 1C3TA 4M8MA 3PRMB 4W9EA 3JSVB 4PS8A 1UBQA 2LVOA 1GC7A 4KIKA 4J6IA 4KSLC 1WZ3A 5CX3A 2LJ5A 2KTFA 4I6LB 4W9JA 3ZNID 2JZZA 5D2MB 5DPSA 2FCNA 2KWCA 4I6NB 2KHWB 1R4NI 3OJ4B 4AUQC 4OVUA 2D2QA 3V6EB 3Q3JA 3ZNGC 2ZVOA 1UD7A 2KZRA 2WX1A 3H6NA 3DVGY 1KOTA 2HE7A 5HKHA 2O6VD 4KVGB 2N1WA 2BF8B 4DK5A 3N32A 3B0AA 3HIZA 3LJ3A 4AJYB 3QX1A 4CO7A 3DVNU 4B9KA 4DWFA 2LASA 1CMXB 2N7EA 3M63B 1OEYA 4JGHB 4EZKA 1KJTA 2O2VB 1WZ0A 3L13A 1M94A 5G2NA 2MBQA 1WJUA 3EHVA 2K25A 4DBGA 5FR6A 4KDIC 4DHZB 1E8XA 2IO0B 1V86A 4AP4C 2N9XA 3RUIB 4NQKE 4M8NA 1EUVB 2NPTA 4GDLA 1WI0A 3GOEA 1TGZB 2PE6B 4AWJA 4BOSC 3ZUNA 3MHSD 4FJZA 1WE6A 3EECA 4IC7B 4II2B 2ZNVC 2LZ6A 2ZEQA 3VH4B 3BY4B 2D10A 2LXCA 4IWOA 2J0JA 1ZGUB 3KVFB 1X1MA 3A9JB 3L08A 3AU5A 3NHEB 4IW0A 3VAWA 3L17A 4BBNF 1EO6A 2MBEA 1WX8A 2M0XA 4RM8A 2KFJA 1Q5WB 3RZWC 5GMVA 1RLFA 2J7QB 2ZPNA 1WGDA 4P7IA 4ZDVA 2MA9B 1OEYJ 3DVNV 4BKTA 3A1QB 2CHXA 5AZGA 3BINA 5D7GA 5KHQA 2JF5A 4HDOA 2DZKA 4WJQA 2KWUB 2C7HA 3TCAA 1TZ1A 2JUOA 2LD9A 4KV2A 3H7SA 1NI2A 2REXA 4FHKA 4M0WB 4K1RB 2WX0A 4TQ1A 4JIOU 5EDSA 2KX3A 3R7QA 1JRUA 1A5RA 2DYBA 3VHTC 5CHFA 4MJSB 3U30A 2ZNVB 1V5TA 4URKA 1Q1OA 2MRPA 2AL3A 3PPAA 1V9JA 1WJ6A 3WIMA 4HLEA 3PSEB 2Z59B 2CU1A 4ZRJA 1Q0WB 3PLVA 2XEWA 1LXDA 2ZVNA 2L3ZA 5IA7A 1E8ZA 1WXMA 3AU4A 3C0RB 4XZ4A 2KDFB 3PHWB 4NNJB 3DBSA 4EZJA 4XX5A 1VCBA 1FXTB 4WWOA 2M17A 4BFRA 3PZDA 3VUWA 1KM7A 1NBFC 1WGRA 1WR1A 1XQQA 3I3TB 1D3ZA 2B3AA 3QIJA 3P2BA 4ANVA 1E5WA 2M8SA 5C1ZA 2L76A 2N4FA 4NQLB 4HPMB 1IP9A 2NBWB 2K6DB 3A9KA 2GBNA 2C5LC 4TUUA 2OJRA 1UH6A 1V49A 1P98A 3N30A 1WYWB 1ISNA 3DCGA 4HCNB 4BOZB 3T9LA 1XT9B 1ZKHA 1V5OA 3M95A 3DBLI 4W9CA 1J19A 2KWVB 4JQWC 3DOWA 3PREA 5CTRC 3RULA 5DCNA 5L83A 2DAJA 2IO2B 1WMHA 2PE9A 1P3QU 3SDLC 3ZO5B 2I1KA 4MM3A 2PPHA 1S3SG 2FIDA 4NJ7A 4FN2A 2EMTA 3UINB 3APDA 4WWNA 2LRWA 3RYTA 4EUTA 4GXBA 2CHZA 3EFUA 3QK0A 2MX2A 3NOBA 5D6JB 2K8CA 1WXVA 1TTNA 4LDTD 2CKHB 2K8BA 3W1SC 3IVFA 2LWPA 2GBJA 2OOBB 5JHAA 2AWTA 2MSED 4N9F4 4MH0E 4ANXA 2HTHA 3QHTA 3TBLD 4IUMB 5JZEB 3ZDTA 3TL5A 1UGMA 3CSFA 4W9KA 5IAAC 2JXXA 4WJNA 3ZLZA 2C7MB 3UQAA 1V80A 3HK0A 3JVZX 4KZ0A 3QARA 2JRHA 1OGWA 1LQBA 3B08A 2FCMA 1HE8A 2JT4B 3IFWB 3UIPB 4WAAA 3H7PB 1WGYA 3Q3FA 4KZCA 1GNUA 1V81A 5CHWA 3A1QA 2HJ8A 3L10B 3NS8A 3ZTDA 3WA0A 1RAXA 2MLBA 1H8CA 3VVWB 3H9DA 3QQ8B 4DHJB 3L54A 2KTRA 3MTNB 4E74A 2GBMA 3VUYA 2ZCBA 1YIWA 1G6JA 3QWZB 2KJHB 4IWPA 5E6PA 1YD8U 2G3QB 2G4DB 2N9EB 1E90A 2CHWA 3EC8A 3LDZE 4IG7B 3ZRFA 2IY0B 4HVBA 2KDBA 2XK5A 2KOXA 2PJHA 4MSMB 2FCQA 2AEHA 1UELA 4FJYA 2BPSA 2LXAA 4IM3A 4MEMA 3VFKA 5J18A 4PS7A 4PS3A 2CR5A 3MJWA 2V1YA 1WF9A 1ZW7A 2FAZA 4MGYE 5LLIA 1J0GA 2KJRA 4W9IA 3PTFC 4GSWA 4MDKE 1GJZA 4FBJB 2L7RA 1WM3A 2KK8A 1WX9A 5J2RA 4MGIE 3L0WB 2IY1B 1WIAA 2KXJA 3DVGX 4K7WA 4NPNA 4TKNA 5DPTA 2LGDA 3KUCB 1XD3B 2Y5BB 2KQ7A 3ALBA 3V6CB 1NDDA 3PV1A 3WANA 2N7DA 3DPDA 3DBRI 4W9LA 3K9OB 4FJVB 2NBVB 3JSVA 2LVPA 3VQIA 4AOFA 2DZIA 2BKRB 2IZVB 2NCNA 3KUZA 4W9HA 4HK2A 1WE7A 4JLCA 4ZYNA 4IWQA 4LJOB 1WM2A 1P1AA 5G55A 4KIKB 3TIXA 5E6OA 2YVCA 2FUHB 3ZNZB 2C60A 3VTVA 4FA6A 1V6EA 1R4MI 1WMHB 4ICUA 3VDZA 4FHJA 1EF5A 3B1LX 4BVUC 2IYDB 2LGXA 1E8WA 4AJWA 4YL8A 4LCDE 3PRZA 4DHZE 4F7ZA 1YQBA 4K81A 4NAWA 2IBIB 1SGHA 2ZJDA 2JY6A 2JRIB 4EOYA 3RT3B 1WFYA 2R2OA 2RD0A 4NAWB 4NY0A 3RCZA 3HM3A 4G50A 3NZSA 2D3GA 3PGEA 3QCAA 2LGYA 2BYFA 1E7UA 1E8YA 1UZXB 3L16A 3PHXB 2IO1B 2JPHA 2KC2A 4B6WA 4GN1A 2KMAA 1TBEA 2GBRA 2DHZA 1Y8RC 2LVQA 4EFOA 3V60A 2PEAA 3CSTA 4MGKE 2C9WB 2WWZA 2ZPYA 3DBHI 2L0FA 3IHPC 4LDTB 3QC8B 3RZFA 2KJ6A 1LM8B 3U7DA 4FADA 1YJ1A 5AEKB 3NZUA 2BWES 2JZ3B 2D07B 4EKUA 4XC2A 3S2AA 3A9JA 3DQVA 4W9GA 2KQSA 1EF1A 1WH3A 1WRDB 1E7VA 3ENEA 4W9FA 3PVLA 5KHOA 3ZKJC 3K9PB 1WJ4A 4CYEA 4EZLA 2BKFA 1YX6B 2GOWA 2KNBA 3VXWA 1WXAA 3W1SA 1P9DU 1BT0A 1WGGA 2A4ZA 4G0NB 1GUAB 3IBEA 5E6NA 4BBNC 2GMIC 3QJZA 3A33B 2W9NA 2AYOB 3CMMB 4GOCA 3OJ3A 3V61A 1WXSA 3VUXA 4F1SA 4OVVA 5DPWA 3QA8A 2N9PC 3UF8A 5J17A 1P0RA 2BWFA 4FLHA 3R3MA 2QHOA 3ZRCA 2VRRB 1YX5B 2CS4A 4HDQA 3ML9A 2KFKA 3ZIMA 4DDID 1PQSA 2O6VA 1QZEA 3PLUA 3M62B 2KFKB 2HD5B 1KLVA 2LRUA 4TV3A 3ZNHB 4WWPA 3PRPB 3PT2B 3SD5A 2WDTB 4DHJD 1S1QB 2L00B 4ICVA 3KH0A 2KDEB 2FNJB 4GU2A 1J8CA 3ZDMC 4GDKB 1MG8A 2DAFA 4IM2A 3SU8X 4A3PA 4BKSD 4KSKC 1GC6A 1LFDA 2KX0A 2ASQA 4GIVA 4MGZE 4CHKA 4GDKA 4G11A 4ANUA 4DXAB 2MP2B 3CF6E 2UYZB 2DYMA 1L2NA 2K6QA 2GBKA 2DZMA 4ZRIA 4B95A 2EMSA 3A4RA 1V2YA 4GMVA 2I1JA 3AXCA 1H4RA 3A9KB 3HHMA 3ECIA 3D32A 2BYEA 3APCA 3R7RA 2G45B 2A5UA 4MELA 4RM9A 2L0TA
chains in the Genus database with same CATH superfamily
3U8ZA 2WYQA 1D5XC 4A3OA 4YTNB 2IPKD 3U7ZA 1YN3A 3PS6A 3IAM1 2MQJA 2KN5A 3CIRB 3H1UA 3ZJVA 2KD0A 5BYSA 4IM0A 4H2AA 1KLUD 2NTSA 2MJ3A 2M56B 4HJKA 2QILA 3JYUA 3WAOA 2GLSA 1L5PA 1WR6E 3IG3A 2MBBB 4HWIB 2LUEA 2L83A 4N58A 3ML8A 1VD2A 1F0ZA 1KRHA 2WXOA 3H7PA 3PZ7A 2WDVB 1NYRA 5AUIA 4YTMB 1K8RB 4ZOHC 3IAS1 4WQMA 4TMAB 4XDDA 4ANWA 1XLQA 1SJED 2DYOA 3KLSX 4K7UA 2UWQA 2RGFA 2EKEC 1OQYA 2JXTA 2RDGA 2N7JA 1Z5SB 2RDBC 5AZFA 2KLGA 3Q69A 1RFAA 4S0RA 1YMHE 1PFDA 4TQ0A 1IPGA 1FEHA 2L8JA 5AZHA 2CU3A 3AI5A 3MP9A 2KKCA 2D3AA 2GI9A 1VR9A 2K39A 1WY8A 1F77A 1HXYD 2KDIA 5HFYA 1XF5L 4HXDA 3JW0X 1Z2MA 1FRRA 1Q10A 4C56C 4JL9A 3OAWA 2N1VA 4GB9A 3HM6X 2INCC 2LI5A 4K3CA 1C3TA 3PRMB 3JSVB 4PS8A 2LVOA 4KIKA 1KTKA 4J6IA 4I6LB 2JZZA 1L0VB 4I6NB 3P63A 3N20C 3NVZA 5IP4D 1KOTA 3AE4B 3B2GA 4C7ZA 4KVGB 2N1WA 2QEJC 1YN5A 4ITKA 4CO7A 4B9KA 4ZHOA 5G2NA 5AUKA 2MBQA 1WJUA 3EHVA 4DBGA 1E8XA 1T6BX 2N9XA 3RUIB 4NQKE 1EUVB 4AWJA 2BTEA 3Q2AC 3AEEB 3MHSD 4RF0A 1WE6A 3AH7A 3BVZA 2LZ6A 2INNE 3VH4B 2J0JA 3L08A 3A9JB 3VAWA 2M0XA 2WXMA 4RM8A 2KFJA 3RZWC 2J7QB 3Q14C 1EU4A 2MA9B 5IN7A 2WHIA 4ARIA 3A1QB 5D7GA 4Q2JA 2C7HA 1YQ4B 4KV2A 3W5UB 1MPEA 2REXA 2MEKA 2V4IB 4TQ1A 4RH6A 2KX3A 1JRUA 1FMAD 4M0WA 1R7SA 1V5TA 4URKA 2MRPA 2INPE 3WIMA 1BXTA 5H92C 1ROEA 3OG5A 2WXGA 3GZNB 4HKZE 4XZ4A 4NNJB 5GXGB 3KWLA 1VZ7A 4YXDB 1TZOA 3PZDA 4RCOA 1QOAA 1V1PB 3QIJA 1E5WA 3MC9A 2N4FA 2NBWB 4OW0A 4LNOA 1WSPA 2WDQB 1UH6A 1V49A 3N30A 1WYWB 3DCGA 2RDHA 4HCNB 2BQQA 4W9CA 1J19A 4JQWC 2LFIA 1SF0A 1MHXA 2PE9A 4MM3A 2PPHA 1S3SG 3RYTA 2MX2A 1AWDA 4LK0M 2IDYA 2CKHB 1FNWA 3IVFA 2LWPA 3TBLD 1FM0D 3TL5A 5IAAC 2JXXA 2C7MB 3JVZX 3U2SC 3QARA 2HTME 1OGWA 2LGSA 2NMQA 2JT4B 3IFWB 3UIPB 2K0PA 4KZCA 4JWSC 5CHWA 5EE9A 2HJ8A 3ZTDA 1RAXA 2MLBA 3VVWB 1F2RC 3EFCA 3P42A 2W3SA 4IWPA 2KJHB 1SIJA 2N9EB 3ZRFA 3LDZE 1E90A 1TS2A 1QF6A 4MSMB 1UELA 1N60A 1WF9A 1ZW7A 3R2TA 2KJRA 4MDKE 4FBJB 3DWMA 5J2RA 1RWSA 2H88B 4NPNA 1SE3A 1I4XA 2L1AA 5IKCM 1N5XA 1V97A 4WAFA 4R3DA 2LVPA 3VQIA 2VZKB 4AOFA 2NCNA 4W9HA 3H8HA 4LTUA 1WE7A 4JLCA 4ZYNA 4IWQA 5E6OA 4ZHPA 2QSDA 2VH2A 1E8WA 1HQRD 2N9LA 4LCDE 3O13A 4DHZE 1YQBA 2BS2B 4K81A 2IBIB 3W9CB 2WXRA 3I63C 2R2OA 2RD0A 1RFKA 4NY0A 3RCZA 3DHGC 1VDVA 3NZSA 2X38A 4RNAA 2LGYA 1E7UA 3ZJTA 1E8YA 2W54A 3AE8B 3PHXB 1XCTL 3P4SB 2W55A 4L2YA 2WWZA 3DBHI 3U7DA 5G5GA 3NZUA 3C8YA 2JZ3B 3I57A 1LO5D 3RMKC 4EKUA 4XC2A 1MVKA 4YSZB 1WRDB 2JU6X 1MHHE 1YJJA 4EZLA 2QCZA 3W1SA 4ACFA 1BT0A 2E6XA 3GP7A 5E6NA 4BBNC 4GOCA 3OJ3A 1WXSA 4F1SA 4M01A 3LYYA 2LHEA 1P0RA 2BWFA 1Y56A 4RF1A 4FLHA 3V05A 1ZDVA 1F1HA 2KFKA 1EU3A 1T0QC 5FR3A 1QZEA 4HKQA 4AQ7A 3PT2B 3DBRB 3KH0A 5JXVA 3ZDMC 1MG8A 2DAFA 3Q8FA 4BKSD 4KSKC 1GC6A 1LFDA 2ASQA 4ANUA 3CF6E 4ZRIA 1IBXB 2KVZA 5HI1A 2I1JA 2DNFA 3HHMA 3AE1B 3ECIA 4MH8A 3Q8AA 3AN1A 4WWMA 2BYEA 2A5UA 2FCSA 2WU5B 3SFDB 3ETRA 3AMZA 3AE9B 3I9V1 2HDEA 5LXIB 3W5VB 4LJPB 2DENB 3NVWA 2M4NA 4NJ6A 4F8CB 3ZVVA 3P1MA 1GG3A 1NYQA 2L05A 2BYVE 4RFBA 5BO4B 1QOBA 3C19A 4ZRKA 2DWQA 1E0ZA 4RGOS 3NY5A 2RPQA 3A4SC 1I4PA 1IYFA 2AQ1B 1K50A 1YOVB 1WX7A 3FILA 1OQRA 4I6PA 1IGCA 4RGTA 3L4PA 2WXIA 4PYUA 2MCNB 2KTRB 3BK2A 3VRBB 3Q3OC 4E71A 2BT6A 1SBBB 2BVCA 3BZDB 1D5ZC 2KC1A 2MBOA 1VJKA 2MHJA 5FK9C 1MJDA 4JWUC 2BGFA 2GRIA 3TJPA 4CQNA 1FFVA 2IO3B 2SAKA 4KDLB 2MW5A 2QJLA 2DZJA 3AULA 2K1FA 4WJPA 3UQBA 3UIOB 2Z0EB 2JYTA 2DX5B 1OTRB 4II3B 3DBHB 5LXHA 2BS3B 4RMAA 3TEYA 5CHVC 3V3XA 3KW5B 1XO3A 1YNTE 1U4AA 3U52E 5C23A 1I42A 2NVUI 1FNUA 3GZNI 3VH3B 4M8MA 1UBQA 1GC7A 3EA6A 3AEGB 5CX3A 3SEBA 2KWCA 2KHWB 4OVUA 2D2QA 3Q3JA 4L23A 1DGJA 2KZRA 2N9KA 5BMHA 3DVGY 3RI7C 4MM3B 3DVNU 3M63B 2O2VB 4HEA1 1UWXA 2K25A 3E9SA 2KACA 4KDIC 3N9YC 2OHFA 3NS1A 4M8NA 3ZJUA 1WI0A 3ZUNA 3AM9A 1ZXIA 4A9AA 1JCKB 4II2B 3KVFB 3AU5A 2E3TA 2MBEA 3BK1A 1WX8A 1RYJA 2ZPNA 1WGDA 4P7IA 3ZXVA 4JPSA 4XYCA 3TEWA 2JF5A 1JWSD 3RNCC 3TCAA 1TZ1A 2JUOA 2LD9A 3RNBC 3I5JC 1NI2A 4JIOU 1N6ZA 4UDUC 3R7QA 5CHFA 4MJSB 5H8YE 1N5WA 3ZGZA 1XLNA 3PPAA 1V9JA 1WJ6A 3PSEB 2M19A 2CU1A 4ZRJA 1Q0WB 1MFWA 5EE3A 1UUPA 2ZVNA 1N63A 5IA7A 3AU4A 1WXMA 3Q3MC 3PHWB 3DBSA 3NVVA 4EZJA 2V9HA 1FXTB 4WWOA 2M17A 3W2DA 4BFRA 3VUWA 1KM7A 1NBFC 1WGRA 2JSVX 2BB6A 4YSXB 4ANVA 4NQLB 4HPMB 2K6DB 2GBNA 1P98A 2XNAC 1ISNA 1WWTA 1ZKHA 3M95A 2FUG1 3DOWA 3PREA 5CTRC 3RULA 2XN9C 4LNKA 1WMHA 1KFYB 1C76A 2KWDA 1C79A 3ZO5B 4WURA 5EE1A 2FIDA 1SJHD 2WXNA 2EMTA 3AE2B 3ZQ4A 4EUTA 4K3BA 5D6JB 2K8CA 1WXVA 4LDTD 2K8BA 3MC0B 5IOIA 3W1SC 4ANXA 3QHTA 3ZDTA 1UGMA 3UQAA 1V80A 1ZP0B 1YQ3B 3B08A 2H89B 1CK1A 3H7PB 1WGYA 3T3OA 1V81A 3NS8A 3RPFC 2GB1A 3WA0A 2QC8A 3H9DA 4MACA 3MTNB 4YSYB 5T8IA 1FCLA 1QT9A 1D5MC 1YIWA 1G6JA 1J7CA 1RM6C 4OZAA 1ZDXA 4C80A 2LEKA 2RPVA 4OZBA 1JWMD 4FJYA 4B0EA 1C9FA 4PS3A 2CR5A 2WXHA 3BYYB 2IJ0A 1WM3A 2KK8A 1WX9A 2KDMA 4MGIE 1ESFA 4RGMA 3DVGX 4K7WA 5TSSA 3VR9B 4TKNA 3Q6BA 5DPTA 3ALBA 1I7HA 3WANA 3DPDA 1STEA 3DBRI 1MG4A 3K9OB 4FJVB 2NBVB 2DZIA 2BKRB 3KUZA 3Q8CA 1WM2A 3B9JA 3TEZA 3AECB 2FUHB 1YJIA 2WDRB 3FC4A 3VTVA 4ICUA 1I4QA 3VDZA 1EF5A 3DHIC 3U4EG 3PRZA 4NAWA 1SGHA 2JRIB 2QMTA 1WFYA 4NAWB 3SFEB 4G50A 4JX1C 3QCAA 4NAMA 4GLSC 4KGRA 1SB3C 4B6WA 2KMAA 3BVMA 2LVQA 4IDIA 3CSTA 2ZPYA 3IHPC 2L0FA 1FD6A 2KJ6A 1LM8B 1AYFA 4FADA 1YJ1A 5AEKB 4US8A 2D07B 3DQVA 1WH3A 3NVYA 1HA5A 4RGNA 3ENEA 3ZKJC 3PVLA 1OQQA 3P4RB 1WJ4A 4WIPA 2V3PA 1QKZA 3VXWA 2KNBA 3LB8C 1C78A 1WGGA 1TS5A 4G0NB 3T3NA 1JW9D 4PT5A 3A33B 3CMMB 4A6QA 1V1OA 4ARCA 4M00A 3VUXA 3QA8A 2WXQA 2ICIA 2NTTA 2LMCA 3ZRCA 1SE4A 1YX5B 4HDQA 2M0AA 2Z8LA 3ML9A 1JALA 4DDID 1PQSA 2PTLA 3GS2A 2HD5B 1KLVA 2ON8A 3SD5A 3PRPB 1JQ4A 4GU2A 2WQYB 4CHKA 4DXAB 4EE2A 4JE3B 2UYZB 1L2NA 2GBKA 2DZMA 3AXCA 3A9KB 3FKYA 4USAA 3R7RA 2J53A 2KO3A 4PYZA 2O2VA 2V4LA 2MWSB 2WNMA 1EWYC 3VTUA 1K51A 1AARA 2NBUA 2NPTB 1KH0A 4GDLB 1L7YA 1RRBA 2NS5A 4LNFA 1NEKB 4K7SA 4WJOA 4BKGA 5C3JB 2JWZA 1XXGA 1F9JA 4HJGE 1XLPA 2CJNA 2WLBA 4ZRQA 1HTOA 1TS3A 1NI3A 3R8BA 2Z0DB 1WJNA 5TR5A 1SE9A 4HCPB 2JVCA 2JX5A 1FO4A 1HTQA 3WAPA 3R66C 4XDCA 1SIFA 3UGBB 5DPRA 3OLMD 3RD2A 4M02A 1R4MB 4US9A 1J7BA 3TMPB 3HVDA 2YLMA 4KGSA 1PGXA 4MSQB 3DWGC 2FIFA 1ACCA 2J0MA 4AS1A 1F2RI 4P6VF 4MJSA 2J0KA 1DOXA 3DDCB 2VZKD 4GGQA 2ACZB 3V62A 3X0WA 5D94A 4W9DA 2J42A 2WXFA 3O65B 1SSNA 2XBBC 1L6UA 2R2QA 3VTWA 2KLCA 1I35A 2LHDA 4W9EA 3ZYYX 2PVGC 2LJ5A 3ZNID 3GB1A 5D2MB 2FCNA 1MI0A 4FXCA 5BYQA 1R4NI 4AUQC 3V6EB 5HHDG 2ZW0A 3CWIA 2ZVOA 2WX1A 5HKHA 2BF8B 4DK5A 1ET9A 3N32A 3R2IA 3LJ3A 3GE3C 3AEFB 1AN8A 1BMLC 2LASA 2N7EA 4A55A 1OEYA 4JGHB 1KJTA 1WZ0A 1M94A 1FCCC 5MPOA 2PMVA 4AP4C 3GOEA 1KF6B 2PLPA 2PE6B 4FJZA 2ZNVC 2ZEQA 2LXCA 3L17A 2DLBA 1EO6A 1Q5WB 1L0XB 5GMVA 3AE5B 1OEYJ 3DVNV 3RFZB 4BKTA 4DQOC 1E7PB 2CHXA 5AZGA 1CQVA 5KHQA 1TYGB 3NZ3A 3NG0A 4FHKA 4M0WB 2WX0A 1TY2A 3ABVB 1L0YB 1LGRA 3U30A 4BZAA 2ZNVB 2BB5A 4OZCA 1Q1OA 1JMLA 2AL3A 2JZPA 4HLEA 1CJEA 4NZLB 4HROA 1LXDA 1PUTA 1CZPA 1DYQA 4N6EB 4XX5A 1XCQL 1IUEA 3P2BA 1WXQA 2M8SA 5C1ZA 2L76A 1V1PA 3A9KA 2C5LC 4TUUA 2K5PA 1UGJA 4BOZB 1N61A 1V5OA 4B0MA 2V3NA 3DBLB 2DAJA 2IO2B 1UF0A 1P3QU 4ZRPA 4XGAB 3UINB 3APDA 1B1ZA 2WGSA 2LRWA 2X8XX 2CHZA 3EFUA 3QK0A 3RNFC 1SEBD 1QOFA 4LLGM 3P4PB 2MSED 4N9F4 4MH0E 2HTHA 5JZEB 4IUMB 4YT0B 4WJNA 4KKIA 4KZ0A 1AW7A 4HRSA 2JRHA 1UNSA 5D3DA 1I4RA 2WXJA 5I4DA 2IGDA 1C4CA 4BAXA 1GNUA 5IO9A 1H8CA 1N62A 3SR6A 3QQ8B 1FXAA 4DHJB 3TEXA 2KTRA 3VUYA 2Y5CA 5E6PA 2G4DB 2FBWB 2KDBA 1PGAA 2FCQA 2LXAA 1UWMA 4IM3A 3VFKA 5J18A 3MJWA 2V1YA 2FAZA 2JQRB 4W9IA 3GE8C 1GJZA 1V8CA 5C2TB 2IY1B 1WIAA 2KXJA 2LGDA 3NUHB 2D3CA 1I4GA 2L52A 2W82A 2Y5BB 2KQ7A 3V6CB 3KQ4A 1NDDA 3PV1A 1T5XD 2N7DA 4IOIE 1NENB 2MH7A 4W9LA 1QILA 3JSVA 1KLGD 2IZVB 3E56A 3ZXRA 4NJCA 1E9MA 1TKGA 4HK2A 4MT5A 5G55A 3TIXA 2YVCA 2TSSA 2C60A 3Q8BA 1R4MI 1WMHB 2DBYA 4FHJA 4BVUC 2IYDB 4AJWA 1DOIA 4F7ZA 1VZ8A 3AE7B 2JY6A 2LGIA 3MHZA 3HM3A 2BYTA 2D3GA 4KKJA 2EKIA 2BYFA 2QDFA 2PVOD 3BYTB 2K9XA 3N1YC 2OEDA 2JPHA 4GN1A 1TBEA 3MJ5A 1Y8RC 4EFOA 3URYA 2PEAA 4MGKE 1C4PA 1K53A 3QC8B 3PO0A 1FRDA 2BWES 5HG2A 3S2AA 1E10A 1JWBD 2KQSA 1EF1A 1E7VA 2RMMA 5KHOA 3K9PB 4CYEA 2BKFA 1HZ5A 1YX6B 2GOWA 4YTPB 1ET6A 1P9DU 1GUAB 1QLBB 2AYOB 2BS4B 1QQRA 5G5HA 3B2FA 4OVVA 5J17A 3R3MA 2QHOA 1TS4A 1GAQB 3ZIMA 2G9HD 1L4ZB 1OFFA 4DXFA 2KFKB 4WWPA 2CJOA 2WDTB 4PK1A 2L00B 1J7AA 2MJEA 1XEEA 1J8CA 5D3IB 4GDKB 2EELA 4GIVA 4GDKA 3LXFA 3TSSA 2K6QA 3VR8B 4B95A 2I38A 2EMSA 3A4RA 1V2YA 4GMVA 1H4RA 3BIID 1VZ6A 2D5GA 2AQ2B 3APCA 2G45B 4P1CC 1P7EA 2L0TA 3AEDB 3M3JA 2ZCCA 3MC8A 4A8XC 2D11A 3SHQA 2RR9A 3RNAC 2FE8A 1FPYA 2KVRA 3QAQA 1ZE3D 3IXSA 2JWUA 3NJTA 2K3UA 4HPLB 2I2YA 1ZOYB 3N3KB 3KYCD 2K8HA 4WQOB 1WRIA 2WXKA 2ZZPB 4D2KA 4ASWC 2C7NB 2KANA 1ENFA 1FNVA 1JROA 2QIEB 1T0YA 2G4SA 5JH5C 4A20A 2KMCA 4O1NA 3APFA 1UBIA 3FILB 4A90A 4X57B 3W1YA 2PKOA 4C7YA 5BMGA 1GB4A 4DDGD 3WAMA 2MBHA 3N1ZC 1EM7A 2XK5B 3KUDB 3ONSA 4EEWA 4E3CA 4OVZA 3KYDD 4G3XB 2O6VB 5L95C 4BKSA 4QAYA 2AL6A 3X23A 1GPXA 2NR2A 2V3SA 3ZTCA 3AB5A 3T8MA 2WU2B 5JHBA 1F52A 2RSUA 2MP2A 3ZW3A 2Y5PA 2KT7A 2BW2A 1TT5B 3WALA 4FULA 1C1YB 2M1MA 1WGHA 2K22A 2MJDA 2KQ4X 5EE0A 4KSLC 1WZ3A 2KTFA 4W9JA 1NVID 5DPSA 1TKYA 3OJ4B 3ZNGC 1K52A 1UD7A 3H6NA 2YEPF 2HE7A 4WH4A 2O6VD 3IT4B 3B0AA 3HIZA 4AJYB 3QX1A 4DWFA 1SE2A 1CMXB 4EZKA 4ZYSA 3L13A 2YEPB 1ZXHA 5FR6A 4DHZB 2IO0B 1V86A 4L1BA 2NPTA 4GDLA 4S17A 5FKAC 1TGZB 4BOSC 2VH1A 4IC7B 3EECA 1JRPA 3BWUD 2KN4A 3BY4B 2D10A 4IWOA 1ZGUB 1X1MA 4BBNF 3NHEB 4IW0A 1RLFA 2AQ3B 4P1BC 4ZDVA 3HUIA 1T0SC 1T3QA 2UU7A 3BINA 5BYRA 4HDOA 2DZKA 4WJQA 2KWUB 3H7SA 4K1RB 4LNNA 5EDSA 1A5RA 1WGKA 1FIQA 2DYBA 3VHTC 2LJIA 3MFGA 2Z59B 2Y3AA 3AE3B 2WP9B 1EWCA 3PLVA 2XEWA 2L3ZA 2D3BA 1E8ZA 3C0RB 2KDFB 1TKEA 1VCBA 3AEBB 1WR1A 3I3TB 1XQQA 3IT6B 1D3ZA 1D4BA 3Q8EA 2B3AA 1IBXA 2J52A 1JWAD 1IP9A 2OJRA 3BVGA 1HZ6A 2LUMA 1JWUD 3EGRA 3T9LA 1XT9B 1FFUA 3DBLI 1VLBA 1L4DB 2KWVB 5DCNA 4N59A 5L83A 4C4VB 4C4VA 3SDLC 3KWVA 2I1KA 4IKGA 3RNEC 3FAHA 4NJ7A 4FN2A 1PGBA 1PYWD 4WWNA 4GXBA 3NOBA 1TIFA 1TTNA 2OOBB 2GBJA 5JHAA 2AWTA 2L32A 1M4VA 2SEBD 1ZUD2 3AEAB 3CSFA 1SXTA 4W9KA 2ONQA 3ZLZA 4XWWA 2HJ1A 3HK0A 3UI3A 3DHHC 1LQBA 4XWTA 2FCMA 1HE8A 1YN4A 4WAAA 2IGGA 3Q3FA 2PIAA 3A1QA 2WXLA 3HRDD 3L10B 2Q5WD 2PW9A 4XE0A 2W3RA 3L54A 2G1EA 2KAJA 4E74A 2GBMA 4KX6B 2ZCBA 3QWZB 3P4QB 2WXPA 3EUB2 2KYWA 4HPPA 1YD8U 2G3QB 3EC8A 1QOGA 2CHWA 4IG7B 4OHJA 4HVBA 2IY0B 2BBCA 2XK5A 2KOXA 2PJHA 2AEHA 4TSSA 2BPSA 4MEMA 4PS7A 3VRAB 3WCQA 4MGYE 5LLIA 1J0GA 3PTFC 4GSWA 3TUOA 2L7RA 1WYGA 4J3OD 2IGHA 4REZA 2OJWA 3L0WB 3KUCB 1ZPSA 1XD3B 1IGDA 1PDXA 3PZ8A 1TY0A 3RN9C 1XLOA 2V0GA 4LJOB 1P1AA 4KIKB 3ZNZB 4FA6A 1V6EA 1C77A 2R61A 3B1LX 1GOZA 1R4NB 2LGXA 4YL8A 1GB1A 4P16A 4YWGG 2ZJDA 1L6VA 4EOYA 3RT3B 3AE6B 3PGEA 1UZXB 3L16A 2ZW1A 2IO1B 2KC2A 2J4XA 3NRZA 4KGTA 2GBRA 3OWEB 2DHZA 3V60A 2C9WB 1BUIC 4LDTB 3RZFA 1HEZE 1FXIA 3Q3NC 3A9JA 4W9GA 1E6EB 4W9FA 4C00A 1C4AA 1D6EC 1WXAA 3RNGC 2N0SB 2A4ZA 3IBEA 3HVZA 2GMIC 2B76B 3QJZA 2W9NA 3AV8A 1VRAB 1P7FA 3V61A 5LNK1 1B9RA 1DOYA 5DPWA 5E6JA 2N9PC 3UF8A 3N1XC 2VRRB 2CS4A 2O6VA 3PLUA 2JYEA 3M62B 1I4HA 2INDC 2LRUA 4TV3A 3ZNHB 4DHJD 1A70A 1S1QB 4ICVA 2KDEB 2FNJB 4IM2A 3SU8X 4A3PA 2KX0A 4MGZE 4G11A 2MP2B 2DYMA 2KMMA 1TJEA 2AX5A 4LNIA 5BMIA 2WS3B 3J9CA 3D32A 4DXGA 1T0RC 4MELA 4RM9A
chains in the Genus database with same CATH topology
3M3JA 2ZCCA 3U8ZA 2WYQA 2FCSA 2D11A 3SHQA 2RR9A 4A3OA 3PS6A 2KVRA 2MQJA 2KO3A 4PYZA 3QAQA 5LXIB 2KN5A 2O2VA 3H1UA 2KD0A 4LJPB 2DENB 2V4LA 2MWSB 4IM0A 2M4NA 4NJ6A 4HPLB 4F8CB 3ZVVA 3VTUA 3N3KB 3KYCD 2K8HA 1AARA 1GG3A 2NBUA 2L05A 2NPTB 4GDLB 4HJKA 3JYUA 3WAOA 1L7YA 1RRBA 2NS5A 2BYVE 4WQOB 1WR6E 5BO4B 3IG3A 2MBBB 4HWIB 4ZRKA 2LUEA 2ZZPB 4K7SA 4WJOA 4ASWC 4BKGA 3NY5A 2JWZA 2RPQA 3ML8A 1VD2A 2C7NB 1F9JA 3A4SC 2KANA 1IYFA 1T0YA 1WX7A 2G4SA 3H7PA 4I6PA 5JH5C 4A20A 2KMCA 1K8RB 2Z0DB 1WJNA 4PYUA 3APFA 5TR5A 1SE9A 1UBIA 4HCPB 2JVCA 2MCNB 2KTRB 4ANWA 4X57B 3WAPA 3R66C 2DYOA 1SIFA 3UGBB 4E71A 4K7UA 3W1YA 5DPRA 2MBOA 2KC1A 2UWQA 2RGFA 2EKEC 3OLMD 3RD2A 1OQYA 3TMPB 2BGFA 3TJPA 4DDGD 1Z5SB 2IO3B 4KDLB 3WAMA 2MBHA 2YLMA 5AZFA 2MW5A 2KLGA 1RFAA 4MSQB 2DZJA 3AULA 2FIFA 2K1FA 4TQ0A 1IPGA 2XK5B 2J0MA 3KUDB 2L8JA 3ONSA 4WJPA 5AZHA 4EEWA 4E3CA 3UQBA 3KYDD 2Z0EB 3AI5A 4G3XB 4MJSA 2O6VB 2J0KA 3UIOB 3DDCB 4BKSA 5L95C 2AL6A 4GGQA 2KKCA 2DX5B 3X23A 1OTRB 3V62A 4II3B 3X0WA 2NR2A 2V3SA 5D94A 3ZTCA 2K39A 1WY8A 4W9DA 5LXHA 2KDIA 3T8MA 3O65B 2XBBC 4HXDA 4RMAA 3JW0X 1Z2MA 5CHVC 2R2QA 3KW5B 5JHBA 2RSUA 4JL9A 2KLCA 2MP2A 3VTWA 3ZW3A 3OAWA 2N1VA 1U4AA 1I35A 4GB9A 3HM6X 3WALA 4FULA 1C1YB 5C23A 2M1MA 2NVUI 1I42A 2LI5A 3GZNI 1WGHA 3VH3B 1C3TA 4M8MA 3PRMB 4W9EA 3JSVB 4PS8A 1UBQA 2LVOA 1GC7A 4KIKA 4J6IA 4KSLC 1WZ3A 5CX3A 2LJ5A 2KTFA 4I6LB 4W9JA 3ZNID 2JZZA 5D2MB 5DPSA 2FCNA 2KWCA 4I6NB 2KHWB 1R4NI 3OJ4B 4AUQC 4OVUA 2D2QA 3V6EB 3Q3JA 3ZNGC 2ZVOA 1UD7A 2KZRA 2WX1A 3H6NA 3DVGY 1KOTA 2HE7A 5HKHA 2O6VD 4KVGB 2N1WA 2BF8B 4DK5A 3N32A 3B0AA 3HIZA 3LJ3A 4AJYB 3QX1A 4CO7A 3DVNU 4B9KA 4DWFA 2LASA 1CMXB 2N7EA 3M63B 1OEYA 4JGHB 4EZKA 1KJTA 2O2VB 1WZ0A 3L13A 1M94A 5G2NA 2MBQA 1WJUA 3EHVA 2K25A 4DBGA 5FR6A 4KDIC 4DHZB 1E8XA 2IO0B 1V86A 4AP4C 2N9XA 3RUIB 4NQKE 4M8NA 1EUVB 2NPTA 4GDLA 1WI0A 3GOEA 1TGZB 2PE6B 4AWJA 4BOSC 3ZUNA 3MHSD 4FJZA 1WE6A 3EECA 4IC7B 4II2B 2ZNVC 2LZ6A 2ZEQA 3VH4B 3BY4B 2D10A 2LXCA 4IWOA 2J0JA 1ZGUB 3KVFB 1X1MA 3A9JB 3L08A 3AU5A 3NHEB 4IW0A 3VAWA 3L17A 4BBNF 1EO6A 2MBEA 1WX8A 2M0XA 4RM8A 2KFJA 1Q5WB 3RZWC 5GMVA 1RLFA 2J7QB 2ZPNA 1WGDA 4P7IA 4ZDVA 2MA9B 1OEYJ 3DVNV 4BKTA 3A1QB 2CHXA 5AZGA 3BINA 5D7GA 5KHQA 2JF5A 4HDOA 2DZKA 4WJQA 2KWUB 2C7HA 3TCAA 1TZ1A 2JUOA 2LD9A 4KV2A 3H7SA 1NI2A 2REXA 4FHKA 4M0WB 4K1RB 2WX0A 4TQ1A 4JIOU 5EDSA 2KX3A 3R7QA 1JRUA 1A5RA 2DYBA 3VHTC 5CHFA 4MJSB 3U30A 2ZNVB 1V5TA 4URKA 1Q1OA 2MRPA 2AL3A 3PPAA 1V9JA 1WJ6A 3WIMA 4HLEA 3PSEB 2Z59B 2CU1A 4ZRJA 1Q0WB 3PLVA 2XEWA 1LXDA 2ZVNA 2L3ZA 5IA7A 1E8ZA 1WXMA 3AU4A 3C0RB 4XZ4A 2KDFB 3PHWB 4NNJB 3DBSA 4EZJA 4XX5A 1VCBA 1FXTB 4WWOA 2M17A 4BFRA 3PZDA 3VUWA 1KM7A 1NBFC 1WGRA 1WR1A 1XQQA 3I3TB 1D3ZA 2B3AA 3QIJA 3P2BA 4ANVA 1E5WA 2M8SA 5C1ZA 2L76A 2N4FA 4NQLB 4HPMB 1IP9A 2NBWB 2K6DB 3A9KA 2GBNA 2C5LC 4TUUA 2OJRA 1UH6A 1V49A 1P98A 3N30A 1WYWB 1ISNA 3DCGA 4HCNB 4BOZB 3T9LA 1XT9B 1ZKHA 1V5OA 3M95A 3DBLI 4W9CA 1J19A 2KWVB 4JQWC 3DOWA 3PREA 5CTRC 3RULA 5DCNA 5L83A 2DAJA 2IO2B 1WMHA 2PE9A 1P3QU 3SDLC 3ZO5B 2I1KA 4MM3A 2PPHA 1S3SG 2FIDA 4NJ7A 4FN2A 2EMTA 3UINB 3APDA 4WWNA 2LRWA 3RYTA 4EUTA 4GXBA 2CHZA 3EFUA 3QK0A 2MX2A 3NOBA 5D6JB 2K8CA 1WXVA 1TTNA 4LDTD 2CKHB 2K8BA 3W1SC 3IVFA 2LWPA 2GBJA 2OOBB 5JHAA 2AWTA 2MSED 4N9F4 4MH0E 4ANXA 2HTHA 3QHTA 3TBLD 4IUMB 5JZEB 3ZDTA 3TL5A 1UGMA 3CSFA 4W9KA 5IAAC 2JXXA 4WJNA 3ZLZA 2C7MB 3UQAA 1V80A 3HK0A 3JVZX 4KZ0A 3QARA 2JRHA 1OGWA 1LQBA 3B08A 2FCMA 1HE8A 2JT4B 3IFWB 3UIPB 4WAAA 3H7PB 1WGYA 3Q3FA 4KZCA 1GNUA 1V81A 5CHWA 3A1QA 2HJ8A 3L10B 3NS8A 3ZTDA 3WA0A 1RAXA 2MLBA 1H8CA 3VVWB 3H9DA 3QQ8B 4DHJB 3L54A 2KTRA 3MTNB 4E74A 2GBMA 3VUYA 2ZCBA 1YIWA 1G6JA 3QWZB 2KJHB 4IWPA 5E6PA 1YD8U 2G3QB 2G4DB 2N9EB 1E90A 2CHWA 3EC8A 3LDZE 4IG7B 3ZRFA 2IY0B 4HVBA 2KDBA 2XK5A 2KOXA 2PJHA 4MSMB 2FCQA 2AEHA 1UELA 4FJYA 2BPSA 2LXAA 4IM3A 4MEMA 3VFKA 5J18A 4PS7A 4PS3A 2CR5A 3MJWA 2V1YA 1WF9A 1ZW7A 2FAZA 4MGYE 5LLIA 1J0GA 2KJRA 4W9IA 3PTFC 4GSWA 4MDKE 1GJZA 4FBJB 2L7RA 1WM3A 2KK8A 1WX9A 5J2RA 4MGIE 3L0WB 2IY1B 1WIAA 2KXJA 3DVGX 4K7WA 4NPNA 4TKNA 5DPTA 2LGDA 3KUCB 1XD3B 2Y5BB 2KQ7A 3ALBA 3V6CB 1NDDA 3PV1A 3WANA 2N7DA 3DPDA 3DBRI 4W9LA 3K9OB 4FJVB 2NBVB 3JSVA 2LVPA 3VQIA 4AOFA 2DZIA 2BKRB 2IZVB 2NCNA 3KUZA 4W9HA 4HK2A 1WE7A 4JLCA 4ZYNA 4IWQA 4LJOB 1WM2A 1P1AA 5G55A 4KIKB 3TIXA 5E6OA 2YVCA 2FUHB 3ZNZB 2C60A 3VTVA 4FA6A 1V6EA 1R4MI 1WMHB 4ICUA 3VDZA 4FHJA 1EF5A 3B1LX 4BVUC 2IYDB 2LGXA 1E8WA 4AJWA 4YL8A 4LCDE 3PRZA 4DHZE 4F7ZA 1YQBA 4K81A 4NAWA 2IBIB 1SGHA 2ZJDA 2JY6A 2JRIB 4EOYA 3RT3B 1WFYA 2R2OA 2RD0A 4NAWB 4NY0A 3RCZA 3HM3A 4G50A 3NZSA 2D3GA 3PGEA 3QCAA 2LGYA 2BYFA 1E7UA 1E8YA 1UZXB 3L16A 3PHXB 2IO1B 2JPHA 2KC2A 4B6WA 4GN1A 2KMAA 1TBEA 2GBRA 2DHZA 1Y8RC 2LVQA 4EFOA 3V60A 2PEAA 3CSTA 4MGKE 2C9WB 2WWZA 2ZPYA 3DBHI 2L0FA 3IHPC 4LDTB 3QC8B 3RZFA 2KJ6A 1LM8B 3U7DA 4FADA 1YJ1A 5AEKB 3NZUA 2BWES 2JZ3B 2D07B 4EKUA 4XC2A 3S2AA 3A9JA 3DQVA 4W9GA 2KQSA 1EF1A 1WH3A 1WRDB 1E7VA 3ENEA 4W9FA 3PVLA 5KHOA 3ZKJC 3K9PB 1WJ4A 4CYEA 4EZLA 2BKFA 1YX6B 2GOWA 2KNBA 3VXWA 1WXAA 3W1SA 1P9DU 1BT0A 1WGGA 2A4ZA 4G0NB 1GUAB 3IBEA 5E6NA 4BBNC 2GMIC 3QJZA 3A33B 2W9NA 2AYOB 3CMMB 4GOCA 3OJ3A 3V61A 1WXSA 3VUXA 4F1SA 4OVVA 5DPWA 3QA8A 2N9PC 3UF8A 5J17A 1P0RA 2BWFA 4FLHA 3R3MA 2QHOA 3ZRCA 2VRRB 1YX5B 2CS4A 4HDQA 3ML9A 2KFKA 3ZIMA 4DDID 1PQSA 2O6VA 1QZEA 3PLUA 3M62B 2KFKB 2HD5B 1KLVA 2LRUA 4TV3A 3ZNHB 4WWPA 3PRPB 3PT2B 3SD5A 2WDTB 4DHJD 1S1QB 2L00B 4ICVA 3KH0A 2KDEB 2FNJB 4GU2A 1J8CA 3ZDMC 4GDKB 1MG8A 2DAFA 4IM2A 3SU8X 4A3PA 4BKSD 4KSKC 1GC6A 1LFDA 2KX0A 2ASQA 4GIVA 4MGZE 4CHKA 4GDKA 4G11A 4ANUA 4DXAB 2MP2B 3CF6E 2UYZB 2DYMA 1L2NA 2K6QA 2GBKA 2DZMA 4ZRIA 4B95A 2EMSA 3A4RA 1V2YA 4GMVA 2I1JA 3AXCA 1H4RA 3A9KB 3HHMA 3ECIA 3D32A 2BYEA 3APCA 3R7RA 2G45B 2A5UA 4MELA 4RM9A 2L0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M3J A;  2ZCC A;  3U8Z A;  2WYQ A;  2FCS A;  2D11 A;  3SHQ A;  2RR9 A;  4A3O A;  3PS6 A;  2KVR A;  2MQJ A;  2KO3 A;  4PYZ A;  3QAQ A;  5LXI B;  2KN5 A;  2O2V A;  3H1U A;  2KD0 A;  4LJP B;  2DEN B;  2V4L A;  2MWS B;  4IM0 A;  2M4N A;  4NJ6 A;  4HPL B;  4F8C B;  3ZVV A;  3VTU A;  3N3K B;  3KYC D;  2K8H A;  1AAR A;  1GG3 A;  2NBU A;  2L05 A;  2NPT B;  4GDL B;  4HJK A;  3JYU A;  3WAO A;  1L7Y A;  1RRB A;  2NS5 A;  2BYV E;  4WQO B;  1WR6 E;  5BO4 B;  3IG3 A;  2MBB B;  4HWI B;  4ZRK A;  2LUE A;  2ZZP B;  4K7S A;  4WJO A;  4ASW C;  4BKG A;  3NY5 A;  2JWZ A;  2RPQ A;  3ML8 A;  1VD2 A;  2C7N B;  1F9J A;  3A4S C;  2KAN A;  1IYF A;  1T0Y A;  1WX7 A;  2G4S A;  3H7P A;  4I6P A;  5JH5 C;  4A20 A;  2KMC A;  1K8R B;  2Z0D B;  1WJN A;  4PYU A;  3APF A;  5TR5 A;  1SE9 A;  1UBI A;  4HCP B;  2JVC A;  2MCN B;  2KTR B;  4ANW A;  4X57 B;  3WAP A;  3R66 C;  2DYO A;  1SIF A;  3UGB B;  4E71 A;  4K7U A;  3W1Y A;  5DPR A;  2MBO A;  2KC1 A;  2UWQ A;  2RGF A;  2EKE C;  3OLM D;  3RD2 A;  1OQY A;  3TMP B;  2BGF A;  3TJP A;  4DDG D;  1Z5S B;  2IO3 B;  4KDL B;  3WAM A;  2MBH A;  2YLM A;  5AZF A;  2MW5 A;  2KLG A;  1RFA A;  4MSQ B;  2DZJ A;  3AUL A;  2FIF A;  2K1F A;  4TQ0 A;  1IPG A;  2XK5 B;  2J0M A;  3KUD B;  2L8J A;  3ONS A;  4WJP A;  5AZH A;  4EEW A;  4E3C A;  3UQB A;  3KYD D;  2Z0E B;  3AI5 A;  4G3X B;  4MJS A;  2O6V B;  2J0K A;  3UIO B;  3DDC B;  4BKS A;  5L95 C;  2AL6 A;  4GGQ A;  2KKC A;  2DX5 B;  3X23 A;  1OTR B;  3V62 A;  4II3 B;  3X0W A;  2NR2 A;  2V3S A;  5D94 A;  3ZTC A;  2K39 A;  1WY8 A;  4W9D A;  5LXH A;  2KDI A;  3T8M A;  3O65 B;  2XBB C;  4HXD A;  4RMA A;  3JW0 X;  1Z2M A;  5CHV C;  2R2Q A;  3KW5 B;  5JHB A;  2RSU A;  4JL9 A;  2KLC A;  2MP2 A;  3VTW A;  3ZW3 A;  3OAW A;  2N1V A;  1U4A A;  1I35 A;  4GB9 A;  3HM6 X;  3WAL A;  4FUL A;  1C1Y B;  5C23 A;  2M1M A;  2NVU I;  1I42 A;  2LI5 A;  3GZN I;  1WGH A;  3VH3 B;  1C3T A;  4M8M A;  3PRM B;  4W9E A;  3JSV B;  4PS8 A;  1UBQ A;  2LVO A;  1GC7 A;  4KIK A;  4J6I A;  4KSL C;  1WZ3 A;  5CX3 A;  2LJ5 A;  2KTF A;  4I6L B;  4W9J A;  3ZNI D;  2JZZ A;  5D2M B;  5DPS A;  2FCN A;  2KWC A;  4I6N B;  2KHW B;  1R4N I;  3OJ4 B;  4AUQ C;  4OVU A;  2D2Q A;  3V6E B;  3Q3J A;  3ZNG C;  2ZVO A;  1UD7 A;  2KZR A;  2WX1 A;  3H6N A;  3DVG Y;  1KOT A;  2HE7 A;  5HKH A;  2O6V D;  4KVG B;  2N1W A;  2BF8 B;  4DK5 A;  3N32 A;  3B0A A;  3HIZ A;  3LJ3 A;  4AJY B;  3QX1 A;  4CO7 A;  3DVN U;  4B9K A;  4DWF A;  2LAS A;  1CMX B;  2N7E A;  3M63 B;  1OEY A;  4JGH B;  4EZK A;  1KJT A;  2O2V B;  1WZ0 A;  3L13 A;  1M94 A;  5G2N A;  2MBQ A;  1WJU A;  3EHV A;  2K25 A;  4DBG A;  5FR6 A;  4KDI C;  4DHZ B;  1E8X A;  2IO0 B;  1V86 A;  4AP4 C;  2N9X A;  3RUI B;  4NQK E;  4M8N A;  1EUV B;  2NPT A;  4GDL A;  1WI0 A;  3GOE A;  1TGZ B;  2PE6 B;  4AWJ A;  4BOS C;  3ZUN A;  3MHS D;  4FJZ A;  1WE6 A;  3EEC A;  4IC7 B;  4II2 B;  2ZNV C;  2LZ6 A;  2ZEQ A;  3VH4 B;  3BY4 B;  2D10 A;  2LXC A;  4IWO A;  2J0J A;  1ZGU B;  3KVF B;  1X1M A;  3A9J B;  3L08 A;  3AU5 A;  3NHE B;  4IW0 A;  3VAW A;  3L17 A;  4BBN F;  1EO6 A;  2MBE A;  1WX8 A;  2M0X A;  4RM8 A;  2KFJ A;  1Q5W B;  3RZW C;  5GMV A;  1RLF A;  2J7Q B;  2ZPN A;  1WGD A;  4P7I A;  4ZDV A;  2MA9 B;  1OEY J;  3DVN V;  4BKT A;  3A1Q B;  2CHX A;  5AZG A;  3BIN A;  5D7G A;  5KHQ A;  2JF5 A;  4HDO A;  2DZK A;  4WJQ A;  2KWU B;  2C7H A;  3TCA A;  1TZ1 A;  2JUO A;  2LD9 A;  4KV2 A;  3H7S A;  1NI2 A;  2REX A;  4FHK A;  4M0W B;  4K1R B;  2WX0 A;  4TQ1 A;  4JIO U;  5EDS A;  2KX3 A;  3R7Q A;  1JRU A;  1A5R A;  2DYB A;  3VHT C;  5CHF A;  4MJS B;  3U30 A;  2ZNV B;  1V5T A;  4URK A;  1Q1O A;  2MRP A;  2AL3 A;  3PPA A;  1V9J A;  1WJ6 A;  3WIM A;  4HLE A;  3PSE B;  2Z59 B;  2CU1 A;  4ZRJ A;  1Q0W B;  3PLV A;  2XEW A;  1LXD A;  2ZVN A;  2L3Z A;  5IA7 A;  1E8Z A;  1WXM A;  3AU4 A;  3C0R B;  4XZ4 A;  2KDF B;  3PHW B;  4NNJ B;  3DBS A;  4EZJ A;  4XX5 A;  1VCB A;  1FXT B;  4WWO A;  2M17 A;  4BFR A;  3PZD A;  3VUW A;  1KM7 A;  1NBF C;  1WGR A;  1WR1 A;  1XQQ A;  3I3T B;  1D3Z A;  2B3A A;  3QIJ A;  3P2B A;  4ANV A;  1E5W A;  2M8S A;  5C1Z A;  2L76 A;  2N4F A;  4NQL B;  4HPM B;  1IP9 A;  2NBW B;  2K6D B;  3A9K A;  2GBN A;  2C5L C;  4TUU A;  2OJR A;  1UH6 A;  1V49 A;  1P98 A;  3N30 A;  1WYW B;  1ISN A;  3DCG A;  4HCN B;  4BOZ B;  3T9L A;  1XT9 B;  1ZKH A;  1V5O A;  3M95 A;  3DBL I;  4W9C A;  1J19 A;  2KWV B;  4JQW C;  3DOW A;  3PRE A;  5CTR C;  3RUL A;  5DCN A;  5L83 A;  2DAJ A;  2IO2 B;  1WMH A;  2PE9 A;  1P3Q U;  3SDL C;  3ZO5 B;  2I1K A;  4MM3 A;  2PPH A;  1S3S G;  2FID A;  4NJ7 A;  4FN2 A;  2EMT A;  3UIN B;  3APD A;  4WWN A;  2LRW A;  3RYT A;  4EUT A;  4GXB A;  2CHZ A;  3EFU A;  3QK0 A;  2MX2 A;  3NOB A;  5D6J B;  2K8C A;  1WXV A;  1TTN A;  4LDT D;  2CKH B;  2K8B A;  3W1S C;  3IVF A;  2LWP A;  2GBJ A;  2OOB B;  5JHA A;  2AWT A;  2MSE D;  4N9F 4;  4MH0 E;  4ANX A;  2HTH A;  3QHT A;  3TBL D;  4IUM B;  5JZE B;  3ZDT A;  3TL5 A;  1UGM A;  3CSF A;  4W9K A;  5IAA C;  2JXX A;  4WJN A;  3ZLZ A;  2C7M B;  3UQA A;  1V80 A;  3HK0 A;  3JVZ X;  4KZ0 A;  3QAR A;  2JRH A;  1OGW A;  1LQB A;  3B08 A;  2FCM A;  1HE8 A;  2JT4 B;  3IFW B;  3UIP B;  4WAA A;  3H7P B;  1WGY A;  3Q3F A;  4KZC A;  1GNU A;  1V81 A;  5CHW A;  3A1Q A;  2HJ8 A;  3L10 B;  3NS8 A;  3ZTD A;  3WA0 A;  1RAX A;  2MLB A;  1H8C A;  3VVW B;  3H9D A;  3QQ8 B;  4DHJ B;  3L54 A;  2KTR A;  3MTN B;  4E74 A;  2GBM A;  3VUY A;  2ZCB A;  1YIW A;  1G6J A;  3QWZ B;  2KJH B;  4IWP A;  5E6P A;  1YD8 U;  2G3Q B;  2G4D B;  2N9E B;  1E90 A;  2CHW A;  3EC8 A;  3LDZ E;  4IG7 B;  3ZRF A;  2IY0 B;  4HVB A;  2KDB A;  2XK5 A;  2KOX A;  2PJH A;  4MSM B;  2FCQ A;  2AEH A;  1UEL A;  4FJY A;  2BPS A;  2LXA A;  4IM3 A;  4MEM A;  3VFK A;  5J18 A;  4PS7 A;  4PS3 A;  2CR5 A;  3MJW A;  2V1Y A;  1WF9 A;  1ZW7 A;  2FAZ A;  4MGY E;  5LLI A;  1J0G A;  2KJR A;  4W9I A;  3PTF C;  4GSW A;  4MDK E;  1GJZ A;  4FBJ B;  2L7R A;  1WM3 A;  2KK8 A;  1WX9 A;  5J2R A;  4MGI E;  3L0W B;  2IY1 B;  1WIA A;  2KXJ A;  3DVG X;  4K7W A;  4NPN A;  4TKN A;  5DPT A;  2LGD A;  3KUC B;  1XD3 B;  2Y5B B;  2KQ7 A;  3ALB A;  3V6C B;  1NDD A;  3PV1 A;  3WAN A;  2N7D A;  3DPD A;  3DBR I;  4W9L A;  3K9O B;  4FJV B;  2NBV B;  3JSV A;  2LVP A;  3VQI A;  4AOF A;  2DZI A;  2BKR B;  2IZV B;  2NCN A;  3KUZ A;  4W9H A;  4HK2 A;  1WE7 A;  4JLC A;  4ZYN A;  4IWQ A;  4LJO B;  1WM2 A;  1P1A A;  5G55 A;  4KIK B;  3TIX A;  5E6O A;  2YVC A;  2FUH B;  3ZNZ B;  2C60 A;  3VTV A;  4FA6 A;  1V6E A;  1R4M I;  1WMH B;  4ICU A;  3VDZ A;  4FHJ A;  1EF5 A;  3B1L X;  4BVU C;  2IYD B;  2LGX A;  1E8W A;  4AJW A;  4YL8 A;  4LCD E;  3PRZ A;  4DHZ E;  4F7Z A;  1YQB A;  4K81 A;  4NAW A;  2IBI B;  1SGH A;  2ZJD A;  2JY6 A;  2JRI B;  4EOY A;  3RT3 B;  1WFY A;  2R2O A;  2RD0 A;  4NAW B;  4NY0 A;  3RCZ A;  3HM3 A;  4G50 A;  3NZS A;  2D3G A;  3PGE A;  3QCA A;  2LGY A;  2BYF A;  1E7U A;  1E8Y A;  1UZX B;  3L16 A;  3PHX B;  2IO1 B;  2JPH A;  2KC2 A;  4B6W A;  4GN1 A;  2KMA A;  1TBE A;  2GBR A;  2DHZ A;  1Y8R C;  2LVQ A;  4EFO A;  3V60 A;  2PEA A;  3CST A;  4MGK E;  2C9W B;  2WWZ A;  2ZPY A;  3DBH I;  2L0F A;  3IHP C;  4LDT B;  3QC8 B;  3RZF A;  2KJ6 A;  1LM8 B;  3U7D A;  4FAD A;  1YJ1 A;  5AEK B;  3NZU A;  2BWE S;  2JZ3 B;  2D07 B;  4EKU A;  4XC2 A;  3S2A A;  3A9J A;  3DQV A;  4W9G A;  2KQS A;  1EF1 A;  1WH3 A;  1WRD B;  1E7V A;  3ENE A;  4W9F A;  3PVL A;  5KHO A;  3ZKJ C;  3K9P B;  1WJ4 A;  4CYE A;  4EZL A;  2BKF A;  1YX6 B;  2GOW A;  2KNB A;  3VXW A;  1WXA A;  3W1S A;  1P9D U;  1BT0 A;  1WGG A;  2A4Z A;  4G0N B;  1GUA B;  3IBE A;  5E6N A;  4BBN C;  2GMI C;  3QJZ A;  3A33 B;  2W9N A;  2AYO B;  3CMM B;  4GOC A;  3OJ3 A;  3V61 A;  1WXS A;  3VUX A;  4F1S A;  4OVV A;  5DPW A;  3QA8 A;  2N9P C;  3UF8 A;  5J17 A;  1P0R A;  2BWF A;  4FLH A;  3R3M A;  2QHO A;  3ZRC A;  2VRR B;  1YX5 B;  2CS4 A;  4HDQ A;  3ML9 A;  2KFK A;  3ZIM A;  4DDI D;  1PQS A;  2O6V A;  1QZE A;  3PLU A;  3M62 B;  2KFK B;  2HD5 B;  1KLV A;  2LRU A;  4TV3 A;  3ZNH B;  4WWP A;  3PRP B;  3PT2 B;  3SD5 A;  2WDT B;  4DHJ D;  1S1Q B;  2L00 B;  4ICV A;  3KH0 A;  2KDE B;  2FNJ B;  4GU2 A;  1J8C A;  3ZDM C;  4GDK B;  1MG8 A;  2DAF A;  4IM2 A;  3SU8 X;  4A3P A;  4BKS D;  4KSK C;  1GC6 A;  1LFD A;  2KX0 A;  2ASQ A;  4GIV A;  4MGZ E;  4CHK A;  4GDK A;  4G11 A;  4ANU A;  4DXA B;  2MP2 B;  3CF6 E;  2UYZ B;  2DYM A;  1L2N A;  2K6Q A;  2GBK A;  2DZM A;  4ZRI A;  4B95 A;  2EMS A;  3A4R A;  1V2Y A;  4GMV A;  2I1J A;  3AXC A;  1H4R A;  3A9K B;  3HHM A;  3ECI A;  3D32 A;  2BYE A;  3APC A;  3R7R A;  2G45 B;  2A5U A;  4MEL A;  4RM9 A;  2L0T A; 
#chains in the Genus database with same CATH topology
 3U8Z A;  2WYQ A;  1D5X C;  4A3O A;  4YTN B;  2IPK D;  3U7Z A;  1YN3 A;  3PS6 A;  3IAM 1;  2MQJ A;  2KN5 A;  3CIR B;  3H1U A;  3ZJV A;  2KD0 A;  5BYS A;  4IM0 A;  4H2A A;  1KLU D;  2NTS A;  2MJ3 A;  2M56 B;  4HJK A;  2QIL A;  3JYU A;  3WAO A;  2GLS A;  1L5P A;  1WR6 E;  3IG3 A;  2MBB B;  4HWI B;  2LUE A;  2L83 A;  4N58 A;  3ML8 A;  1VD2 A;  1F0Z A;  1KRH A;  2WXO A;  3H7P A;  3PZ7 A;  2WDV B;  1NYR A;  5AUI A;  4YTM B;  1K8R B;  4ZOH C;  3IAS 1;  4WQM A;  4TMA B;  4XDD A;  4ANW A;  1XLQ A;  1SJE D;  2DYO A;  3KLS X;  4K7U A;  2UWQ A;  2RGF A;  2EKE C;  1OQY A;  2JXT A;  2RDG A;  2N7J A;  1Z5S B;  2RDB C;  5AZF A;  2KLG A;  3Q69 A;  1RFA A;  4S0R A;  1YMH E;  1PFD A;  4TQ0 A;  1IPG A;  1FEH A;  2L8J A;  5AZH A;  2CU3 A;  3AI5 A;  3MP9 A;  2KKC A;  2D3A A;  2GI9 A;  1VR9 A;  2K39 A;  1WY8 A;  1F77 A;  1HXY D;  2KDI A;  5HFY A;  1XF5 L;  4HXD A;  3JW0 X;  1Z2M A;  1FRR A;  1Q10 A;  4C56 C;  4JL9 A;  3OAW A;  2N1V A;  4GB9 A;  3HM6 X;  2INC C;  2LI5 A;  4K3C A;  1C3T A;  3PRM B;  3JSV B;  4PS8 A;  2LVO A;  4KIK A;  1KTK A;  4J6I A;  4I6L B;  2JZZ A;  1L0V B;  4I6N B;  3P63 A;  3N20 C;  3NVZ A;  5IP4 D;  1KOT A;  3AE4 B;  3B2G A;  4C7Z A;  4KVG B;  2N1W A;  2QEJ C;  1YN5 A;  4ITK A;  4CO7 A;  4B9K A;  4ZHO A;  5G2N A;  5AUK A;  2MBQ A;  1WJU A;  3EHV A;  4DBG A;  1E8X A;  1T6B X;  2N9X A;  3RUI B;  4NQK E;  1EUV B;  4AWJ A;  2BTE A;  3Q2A C;  3AEE B;  3MHS D;  4RF0 A;  1WE6 A;  3AH7 A;  3BVZ A;  2LZ6 A;  2INN E;  3VH4 B;  2J0J A;  3L08 A;  3A9J B;  3VAW A;  2M0X A;  2WXM A;  4RM8 A;  2KFJ A;  3RZW C;  2J7Q B;  3Q14 C;  1EU4 A;  2MA9 B;  5IN7 A;  2WHI A;  4ARI A;  3A1Q B;  5D7G A;  4Q2J A;  2C7H A;  1YQ4 B;  4KV2 A;  3W5U B;  1MPE A;  2REX A;  2MEK A;  2V4I B;  4TQ1 A;  4RH6 A;  2KX3 A;  1JRU A;  1FMA D;  4M0W A;  1R7S A;  1V5T A;  4URK A;  2MRP A;  2INP E;  3WIM A;  1BXT A;  5H92 C;  1ROE A;  3OG5 A;  2WXG A;  3GZN B;  4HKZ E;  4XZ4 A;  4NNJ B;  5GXG B;  3KWL A;  1VZ7 A;  4YXD B;  1TZO A;  3PZD A;  4RCO A;  1QOA A;  1V1P B;  3QIJ A;  1E5W A;  3MC9 A;  2N4F A;  2NBW B;  4OW0 A;  4LNO A;  1WSP A;  2WDQ B;  1UH6 A;  1V49 A;  3N30 A;  1WYW B;  3DCG A;  2RDH A;  4HCN B;  2BQQ A;  4W9C A;  1J19 A;  4JQW C;  2LFI A;  1SF0 A;  1MHX A;  2PE9 A;  4MM3 A;  2PPH A;  1S3S G;  3RYT A;  2MX2 A;  1AWD A;  4LK0 M;  2IDY A;  2CKH B;  1FNW A;  3IVF A;  2LWP A;  3TBL D;  1FM0 D;  3TL5 A;  5IAA C;  2JXX A;  2C7M B;  3JVZ X;  3U2S C;  3QAR A;  2HTM E;  1OGW A;  2LGS A;  2NMQ A;  2JT4 B;  3IFW B;  3UIP B;  2K0P A;  4KZC A;  4JWS C;  5CHW A;  5EE9 A;  2HJ8 A;  3ZTD A;  1RAX A;  2MLB A;  3VVW B;  1F2R C;  3EFC A;  3P42 A;  2W3S A;  4IWP A;  2KJH B;  1SIJ A;  2N9E B;  3ZRF A;  3LDZ E;  1E90 A;  1TS2 A;  1QF6 A;  4MSM B;  1UEL A;  1N60 A;  1WF9 A;  1ZW7 A;  3R2T A;  2KJR A;  4MDK E;  4FBJ B;  3DWM A;  5J2R A;  1RWS A;  2H88 B;  4NPN A;  1SE3 A;  1I4X A;  2L1A A;  5IKC M;  1N5X A;  1V97 A;  4WAF A;  4R3D A;  2LVP A;  3VQI A;  2VZK B;  4AOF A;  2NCN A;  4W9H A;  3H8H A;  4LTU A;  1WE7 A;  4JLC A;  4ZYN A;  4IWQ A;  5E6O A;  4ZHP A;  2QSD A;  2VH2 A;  1E8W A;  1HQR D;  2N9L A;  4LCD E;  3O13 A;  4DHZ E;  1YQB A;  2BS2 B;  4K81 A;  2IBI B;  3W9C B;  2WXR A;  3I63 C;  2R2O A;  2RD0 A;  1RFK A;  4NY0 A;  3RCZ A;  3DHG C;  1VDV A;  3NZS A;  2X38 A;  4RNA A;  2LGY A;  1E7U A;  3ZJT A;  1E8Y A;  2W54 A;  3AE8 B;  3PHX B;  1XCT L;  3P4S B;  2W55 A;  4L2Y A;  2WWZ A;  3DBH I;  3U7D A;  5G5G A;  3NZU A;  3C8Y A;  2JZ3 B;  3I57 A;  1LO5 D;  3RMK C;  4EKU A;  4XC2 A;  1MVK A;  4YSZ B;  1WRD B;  2JU6 X;  1MHH E;  1YJJ A;  4EZL A;  2QCZ A;  3W1S A;  4ACF A;  1BT0 A;  2E6X A;  3GP7 A;  5E6N A;  4BBN C;  4GOC A;  3OJ3 A;  1WXS A;  4F1S A;  4M01 A;  3LYY A;  2LHE A;  1P0R A;  2BWF A;  1Y56 A;  4RF1 A;  4FLH A;  3V05 A;  1ZDV A;  1F1H A;  2KFK A;  1EU3 A;  1T0Q C;  5FR3 A;  1QZE A;  4HKQ A;  4AQ7 A;  3PT2 B;  3DBR B;  3KH0 A;  5JXV A;  3ZDM C;  1MG8 A;  2DAF A;  3Q8F A;  4BKS D;  4KSK C;  1GC6 A;  1LFD A;  2ASQ A;  4ANU A;  3CF6 E;  4ZRI A;  1IBX B;  2KVZ A;  5HI1 A;  2I1J A;  2DNF A;  3HHM A;  3AE1 B;  3ECI A;  4MH8 A;  3Q8A A;  3AN1 A;  4WWM A;  2BYE A;  2A5U A;  2FCS A;  2WU5 B;  3SFD B;  3ETR A;  3AMZ A;  3AE9 B;  3I9V 1;  2HDE A;  5LXI B;  3W5V B;  4LJP B;  2DEN B;  3NVW A;  2M4N A;  4NJ6 A;  4F8C B;  3ZVV A;  3P1M A;  1GG3 A;  1NYQ A;  2L05 A;  2BYV E;  4RFB A;  5BO4 B;  1QOB A;  3C19 A;  4ZRK A;  2DWQ A;  1E0Z A;  4RGO S;  3NY5 A;  2RPQ A;  3A4S C;  1I4P A;  1IYF A;  2AQ1 B;  1K50 A;  1YOV B;  1WX7 A;  3FIL A;  1OQR A;  4I6P A;  1IGC A;  4RGT A;  3L4P A;  2WXI A;  4PYU A;  2MCN B;  2KTR B;  3BK2 A;  3VRB B;  3Q3O C;  4E71 A;  2BT6 A;  1SBB B;  2BVC A;  3BZD B;  1D5Z C;  2KC1 A;  2MBO A;  1VJK A;  2MHJ A;  5FK9 C;  1MJD A;  4JWU C;  2BGF A;  2GRI A;  3TJP A;  4CQN A;  1FFV A;  2IO3 B;  2SAK A;  4KDL B;  2MW5 A;  2QJL A;  2DZJ A;  3AUL A;  2K1F A;  4WJP A;  3UQB A;  3UIO B;  2Z0E B;  2JYT A;  2DX5 B;  1OTR B;  4II3 B;  3DBH B;  5LXH A;  2BS3 B;  4RMA A;  3TEY A;  5CHV C;  3V3X A;  3KW5 B;  1XO3 A;  1YNT E;  1U4A A;  3U52 E;  5C23 A;  1I42 A;  2NVU I;  1FNU A;  3GZN I;  3VH3 B;  4M8M A;  1UBQ A;  1GC7 A;  3EA6 A;  3AEG B;  5CX3 A;  3SEB A;  2KWC A;  2KHW B;  4OVU A;  2D2Q A;  3Q3J A;  4L23 A;  1DGJ A;  2KZR A;  2N9K A;  5BMH A;  3DVG Y;  3RI7 C;  4MM3 B;  3DVN U;  3M63 B;  2O2V B;  4HEA 1;  1UWX A;  2K25 A;  3E9S A;  2KAC A;  4KDI C;  3N9Y C;  2OHF A;  3NS1 A;  4M8N A;  3ZJU A;  1WI0 A;  3ZUN A;  3AM9 A;  1ZXI A;  4A9A A;  1JCK B;  4II2 B;  3KVF B;  3AU5 A;  2E3T A;  2MBE A;  3BK1 A;  1WX8 A;  1RYJ A;  2ZPN A;  1WGD A;  4P7I A;  3ZXV A;  4JPS A;  4XYC A;  3TEW A;  2JF5 A;  1JWS D;  3RNC C;  3TCA A;  1TZ1 A;  2JUO A;  2LD9 A;  3RNB C;  3I5J C;  1NI2 A;  4JIO U;  1N6Z A;  4UDU C;  3R7Q A;  5CHF A;  4MJS B;  5H8Y E;  1N5W A;  3ZGZ A;  1XLN A;  3PPA A;  1V9J A;  1WJ6 A;  3PSE B;  2M19 A;  2CU1 A;  4ZRJ A;  1Q0W B;  1MFW A;  5EE3 A;  1UUP A;  2ZVN A;  1N63 A;  5IA7 A;  3AU4 A;  1WXM A;  3Q3M C;  3PHW B;  3DBS A;  3NVV A;  4EZJ A;  2V9H A;  1FXT B;  4WWO A;  2M17 A;  3W2D A;  4BFR A;  3VUW A;  1KM7 A;  1NBF C;  1WGR A;  2JSV X;  2BB6 A;  4YSX B;  4ANV A;  4NQL B;  4HPM B;  2K6D B;  2GBN A;  1P98 A;  2XNA C;  1ISN A;  1WWT A;  1ZKH A;  3M95 A;  2FUG 1;  3DOW A;  3PRE A;  5CTR C;  3RUL A;  2XN9 C;  4LNK A;  1WMH A;  1KFY B;  1C76 A;  2KWD A;  1C79 A;  3ZO5 B;  4WUR A;  5EE1 A;  2FID A;  1SJH D;  2WXN A;  2EMT A;  3AE2 B;  3ZQ4 A;  4EUT A;  4K3B A;  5D6J B;  2K8C A;  1WXV A;  4LDT D;  2K8B A;  3MC0 B;  5IOI A;  3W1S C;  4ANX A;  3QHT A;  3ZDT A;  1UGM A;  3UQA A;  1V80 A;  1ZP0 B;  1YQ3 B;  3B08 A;  2H89 B;  1CK1 A;  3H7P B;  1WGY A;  3T3O A;  1V81 A;  3NS8 A;  3RPF C;  2GB1 A;  3WA0 A;  2QC8 A;  3H9D A;  4MAC A;  3MTN B;  4YSY B;  5T8I A;  1FCL A;  1QT9 A;  1D5M C;  1YIW A;  1G6J A;  1J7C A;  1RM6 C;  4OZA A;  1ZDX A;  4C80 A;  2LEK A;  2RPV A;  4OZB A;  1JWM D;  4FJY A;  4B0E A;  1C9F A;  4PS3 A;  2CR5 A;  2WXH A;  3BYY B;  2IJ0 A;  1WM3 A;  2KK8 A;  1WX9 A;  2KDM A;  4MGI E;  1ESF A;  4RGM A;  3DVG X;  4K7W A;  5TSS A;  3VR9 B;  4TKN A;  3Q6B A;  5DPT A;  3ALB A;  1I7H A;  3WAN A;  3DPD A;  1STE A;  3DBR I;  1MG4 A;  3K9O B;  4FJV B;  2NBV B;  2DZI A;  2BKR B;  3KUZ A;  3Q8C A;  1WM2 A;  3B9J A;  3TEZ A;  3AEC B;  2FUH B;  1YJI A;  2WDR B;  3FC4 A;  3VTV A;  4ICU A;  1I4Q A;  3VDZ A;  1EF5 A;  3DHI C;  3U4E G;  3PRZ A;  4NAW A;  1SGH A;  2JRI B;  2QMT A;  1WFY A;  4NAW B;  3SFE B;  4G50 A;  4JX1 C;  3QCA A;  4NAM A;  4GLS C;  4KGR A;  1SB3 C;  4B6W A;  2KMA A;  3BVM A;  2LVQ A;  4IDI A;  3CST A;  2ZPY A;  3IHP C;  2L0F A;  1FD6 A;  2KJ6 A;  1LM8 B;  1AYF A;  4FAD A;  1YJ1 A;  5AEK B;  4US8 A;  2D07 B;  3DQV A;  1WH3 A;  3NVY A;  1HA5 A;  4RGN A;  3ENE A;  3ZKJ C;  3PVL A;  1OQQ A;  3P4R B;  1WJ4 A;  4WIP A;  2V3P A;  1QKZ A;  3VXW A;  2KNB A;  3LB8 C;  1C78 A;  1WGG A;  1TS5 A;  4G0N B;  3T3N A;  1JW9 D;  4PT5 A;  3A33 B;  3CMM B;  4A6Q A;  1V1O A;  4ARC A;  4M00 A;  3VUX A;  3QA8 A;  2WXQ A;  2ICI A;  2NTT A;  2LMC A;  3ZRC A;  1SE4 A;  1YX5 B;  4HDQ A;  2M0A A;  2Z8L A;  3ML9 A;  1JAL A;  4DDI D;  1PQS A;  2PTL A;  3GS2 A;  2HD5 B;  1KLV A;  2ON8 A;  3SD5 A;  3PRP B;  1JQ4 A;  4GU2 A;  2WQY B;  4CHK A;  4DXA B;  4EE2 A;  4JE3 B;  2UYZ B;  1L2N A;  2GBK A;  2DZM A;  3AXC A;  3A9K B;  3FKY A;  4USA A;  3R7R A;  2J53 A;  2KO3 A;  4PYZ A;  2O2V A;  2V4L A;  2MWS B;  2WNM A;  1EWY C;  3VTU A;  1K51 A;  1AAR A;  2NBU A;  2NPT B;  1KH0 A;  4GDL B;  1L7Y A;  1RRB A;  2NS5 A;  4LNF A;  1NEK B;  4K7S A;  4WJO A;  4BKG A;  5C3J B;  2JWZ A;  1XXG A;  1F9J A;  4HJG E;  1XLP A;  2CJN A;  2WLB A;  4ZRQ A;  1HTO A;  1TS3 A;  1NI3 A;  3R8B A;  2Z0D B;  1WJN A;  5TR5 A;  1SE9 A;  4HCP B;  2JVC A;  2JX5 A;  1FO4 A;  1HTQ A;  3WAP A;  3R66 C;  4XDC A;  1SIF A;  3UGB B;  5DPR A;  3OLM D;  3RD2 A;  4M02 A;  1R4M B;  4US9 A;  1J7B A;  3TMP B;  3HVD A;  2YLM A;  4KGS A;  1PGX A;  4MSQ B;  3DWG C;  2FIF A;  1ACC A;  2J0M A;  4AS1 A;  1F2R I;  4P6V F;  4MJS A;  2J0K A;  1DOX A;  3DDC B;  2VZK D;  4GGQ A;  2ACZ B;  3V62 A;  3X0W A;  5D94 A;  4W9D A;  2J42 A;  2WXF A;  3O65 B;  1SSN A;  2XBB C;  1L6U A;  2R2Q A;  3VTW A;  2KLC A;  1I35 A;  2LHD A;  4W9E A;  3ZYY X;  2PVG C;  2LJ5 A;  3ZNI D;  3GB1 A;  5D2M B;  2FCN A;  1MI0 A;  4FXC A;  5BYQ A;  1R4N I;  4AUQ C;  3V6E B;  5HHD G;  2ZW0 A;  3CWI A;  2ZVO A;  2WX1 A;  5HKH A;  2BF8 B;  4DK5 A;  1ET9 A;  3N32 A;  3R2I A;  3LJ3 A;  3GE3 C;  3AEF B;  1AN8 A;  1BML C;  2LAS A;  2N7E A;  4A55 A;  1OEY A;  4JGH B;  1KJT A;  1WZ0 A;  1M94 A;  1FCC C;  5MPO A;  2PMV A;  4AP4 C;  3GOE A;  1KF6 B;  2PLP A;  2PE6 B;  4FJZ A;  2ZNV C;  2ZEQ A;  2LXC A;  3L17 A;  2DLB A;  1EO6 A;  1Q5W B;  1L0X B;  5GMV A;  3AE5 B;  1OEY J;  3DVN V;  3RFZ B;  4BKT A;  4DQO C;  1E7P B;  2CHX A;  5AZG A;  1CQV A;  5KHQ A;  1TYG B;  3NZ3 A;  3NG0 A;  4FHK A;  4M0W B;  2WX0 A;  1TY2 A;  3ABV B;  1L0Y B;  1LGR A;  3U30 A;  4BZA A;  2ZNV B;  2BB5 A;  4OZC A;  1Q1O A;  1JML A;  2AL3 A;  2JZP A;  4HLE A;  1CJE A;  4NZL B;  4HRO A;  1LXD A;  1PUT A;  1CZP A;  1DYQ A;  4N6E B;  4XX5 A;  1XCQ L;  1IUE A;  3P2B A;  1WXQ A;  2M8S A;  5C1Z A;  2L76 A;  1V1P A;  3A9K A;  2C5L C;  4TUU A;  2K5P A;  1UGJ A;  4BOZ B;  1N61 A;  1V5O A;  4B0M A;  2V3N A;  3DBL B;  2DAJ A;  2IO2 B;  1UF0 A;  1P3Q U;  4ZRP A;  4XGA B;  3UIN B;  3APD A;  1B1Z A;  2WGS A;  2LRW A;  2X8X X;  2CHZ A;  3EFU A;  3QK0 A;  3RNF C;  1SEB D;  1QOF A;  4LLG M;  3P4P B;  2MSE D;  4N9F 4;  4MH0 E;  2HTH A;  5JZE B;  4IUM B;  4YT0 B;  4WJN A;  4KKI A;  4KZ0 A;  1AW7 A;  4HRS A;  2JRH A;  1UNS A;  5D3D A;  1I4R A;  2WXJ A;  5I4D A;  2IGD A;  1C4C A;  4BAX A;  1GNU A;  5IO9 A;  1H8C A;  1N62 A;  3SR6 A;  3QQ8 B;  1FXA A;  4DHJ B;  3TEX A;  2KTR A;  3VUY A;  2Y5C A;  5E6P A;  2G4D B;  2FBW B;  2KDB A;  1PGA A;  2FCQ A;  2LXA A;  1UWM A;  4IM3 A;  3VFK A;  5J18 A;  3MJW A;  2V1Y A;  2FAZ A;  2JQR B;  4W9I A;  3GE8 C;  1GJZ A;  1V8C A;  5C2T B;  2IY1 B;  1WIA A;  2KXJ A;  2LGD A;  3NUH B;  2D3C A;  1I4G A;  2L52 A;  2W82 A;  2Y5B B;  2KQ7 A;  3V6C B;  3KQ4 A;  1NDD A;  3PV1 A;  1T5X D;  2N7D A;  4IOI E;  1NEN B;  2MH7 A;  4W9L A;  1QIL A;  3JSV A;  1KLG D;  2IZV B;  3E56 A;  3ZXR A;  4NJC A;  1E9M A;  1TKG A;  4HK2 A;  4MT5 A;  5G55 A;  3TIX A;  2YVC A;  2TSS A;  2C60 A;  3Q8B A;  1R4M I;  1WMH B;  2DBY A;  4FHJ A;  4BVU C;  2IYD B;  4AJW A;  1DOI A;  4F7Z A;  1VZ8 A;  3AE7 B;  2JY6 A;  2LGI A;  3MHZ A;  3HM3 A;  2BYT A;  2D3G A;  4KKJ A;  2EKI A;  2BYF A;  2QDF A;  2PVO D;  3BYT B;  2K9X A;  3N1Y C;  2OED A;  2JPH A;  4GN1 A;  1TBE A;  3MJ5 A;  1Y8R C;  4EFO A;  3URY A;  2PEA A;  4MGK E;  1C4P A;  1K53 A;  3QC8 B;  3PO0 A;  1FRD A;  2BWE S;  5HG2 A;  3S2A A;  1E10 A;  1JWB D;  2KQS A;  1EF1 A;  1E7V A;  2RMM A;  5KHO A;  3K9P B;  4CYE A;  2BKF A;  1HZ5 A;  1YX6 B;  2GOW A;  4YTP B;  1ET6 A;  1P9D U;  1GUA B;  1QLB B;  2AYO B;  2BS4 B;  1QQR A;  5G5H A;  3B2F A;  4OVV A;  5J17 A;  3R3M A;  2QHO A;  1TS4 A;  1GAQ B;  3ZIM A;  2G9H D;  1L4Z B;  1OFF A;  4DXF A;  2KFK B;  4WWP A;  2CJO A;  2WDT B;  4PK1 A;  2L00 B;  1J7A A;  2MJE A;  1XEE A;  1J8C A;  5D3I B;  4GDK B;  2EEL A;  4GIV A;  4GDK A;  3LXF A;  3TSS A;  2K6Q A;  3VR8 B;  4B95 A;  2I38 A;  2EMS A;  3A4R A;  1V2Y A;  4GMV A;  1H4R A;  3BII D;  1VZ6 A;  2D5G A;  2AQ2 B;  3APC A;  2G45 B;  4P1C C;  1P7E A;  2L0T A;  3AED B;  3M3J A;  2ZCC A;  3MC8 A;  4A8X C;  2D11 A;  3SHQ A;  2RR9 A;  3RNA C;  2FE8 A;  1FPY A;  2KVR A;  3QAQ A;  1ZE3 D;  3IXS A;  2JWU A;  3NJT A;  2K3U A;  4HPL B;  2I2Y A;  1ZOY B;  3N3K B;  3KYC D;  2K8H A;  4WQO B;  1WRI A;  2WXK A;  2ZZP B;  4D2K A;  4ASW C;  2C7N B;  2KAN A;  1ENF A;  1FNV A;  1JRO A;  2QIE B;  1T0Y A;  2G4S A;  5JH5 C;  4A20 A;  2KMC A;  4O1N A;  3APF A;  1UBI A;  3FIL B;  4A90 A;  4X57 B;  3W1Y A;  2PKO A;  4C7Y A;  5BMG A;  1GB4 A;  4DDG D;  3WAM A;  2MBH A;  3N1Z C;  1EM7 A;  2XK5 B;  3KUD B;  3ONS A;  4EEW A;  4E3C A;  4OVZ A;  3KYD D;  4G3X B;  2O6V B;  5L95 C;  4BKS A;  4QAY A;  2AL6 A;  3X23 A;  1GPX A;  2NR2 A;  2V3S A;  3ZTC A;  3AB5 A;  3T8M A;  2WU2 B;  5JHB A;  1F52 A;  2RSU A;  2MP2 A;  3ZW3 A;  2Y5P A;  2KT7 A;  2BW2 A;  1TT5 B;  3WAL A;  4FUL A;  1C1Y B;  2M1M A;  1WGH A;  2K22 A;  2MJD A;  2KQ4 X;  5EE0 A;  4KSL C;  1WZ3 A;  2KTF A;  4W9J A;  1NVI D;  5DPS A;  1TKY A;  3OJ4 B;  3ZNG C;  1K52 A;  1UD7 A;  3H6N A;  2YEP F;  2HE7 A;  4WH4 A;  2O6V D;  3IT4 B;  3B0A A;  3HIZ A;  4AJY B;  3QX1 A;  4DWF A;  1SE2 A;  1CMX B;  4EZK A;  4ZYS A;  3L13 A;  2YEP B;  1ZXH A;  5FR6 A;  4DHZ B;  2IO0 B;  1V86 A;  4L1B A;  2NPT A;  4GDL A;  4S17 A;  5FKA C;  1TGZ B;  4BOS C;  2VH1 A;  4IC7 B;  3EEC A;  1JRP A;  3BWU D;  2KN4 A;  3BY4 B;  2D10 A;  4IWO A;  1ZGU B;  1X1M A;  4BBN F;  3NHE B;  4IW0 A;  1RLF A;  2AQ3 B;  4P1B C;  4ZDV A;  3HUI A;  1T0S C;  1T3Q A;  2UU7 A;  3BIN A;  5BYR A;  4HDO A;  2DZK A;  4WJQ A;  2KWU B;  3H7S A;  4K1R B;  4LNN A;  5EDS A;  1A5R A;  1WGK A;  1FIQ A;  2DYB A;  3VHT C;  2LJI A;  3MFG A;  2Z59 B;  2Y3A A;  3AE3 B;  2WP9 B;  1EWC A;  3PLV A;  2XEW A;  2L3Z A;  2D3B A;  1E8Z A;  3C0R B;  2KDF B;  1TKE A;  1VCB A;  3AEB B;  1WR1 A;  3I3T B;  1XQQ A;  3IT6 B;  1D3Z A;  1D4B A;  3Q8E A;  2B3A A;  1IBX A;  2J52 A;  1JWA D;  1IP9 A;  2OJR A;  3BVG A;  1HZ6 A;  2LUM A;  1JWU D;  3EGR A;  3T9L A;  1XT9 B;  1FFU A;  3DBL I;  1VLB A;  1L4D B;  2KWV B;  5DCN A;  4N59 A;  5L83 A;  4C4V B;  4C4V A;  3SDL C;  3KWV A;  2I1K A;  4IKG A;  3RNE C;  3FAH A;  4NJ7 A;  4FN2 A;  1PGB A;  1PYW D;  4WWN A;  4GXB A;  3NOB A;  1TIF A;  1TTN A;  2OOB B;  2GBJ A;  5JHA A;  2AWT A;  2L32 A;  1M4V A;  2SEB D;  1ZUD 2;  3AEA B;  3CSF A;  1SXT A;  4W9K A;  2ONQ A;  3ZLZ A;  4XWW A;  2HJ1 A;  3HK0 A;  3UI3 A;  3DHH C;  1LQB A;  4XWT A;  2FCM A;  1HE8 A;  1YN4 A;  4WAA A;  2IGG A;  3Q3F A;  2PIA A;  3A1Q A;  2WXL A;  3HRD D;  3L10 B;  2Q5W D;  2PW9 A;  4XE0 A;  2W3R A;  3L54 A;  2G1E A;  2KAJ A;  4E74 A;  2GBM A;  4KX6 B;  2ZCB A;  3QWZ B;  3P4Q B;  2WXP A;  3EUB 2;  2KYW A;  4HPP A;  1YD8 U;  2G3Q B;  3EC8 A;  1QOG A;  2CHW A;  4IG7 B;  4OHJ A;  4HVB A;  2IY0 B;  2BBC A;  2XK5 A;  2KOX A;  2PJH A;  2AEH A;  4TSS A;  2BPS A;  4MEM A;  4PS7 A;  3VRA B;  3WCQ A;  4MGY E;  5LLI A;  1J0G A;  3PTF C;  4GSW A;  3TUO A;  2L7R A;  1WYG A;  4J3O D;  2IGH A;  4REZ A;  2OJW A;  3L0W B;  3KUC B;  1ZPS A;  1XD3 B;  1IGD A;  1PDX A;  3PZ8 A;  1TY0 A;  3RN9 C;  1XLO A;  2V0G A;  4LJO B;  1P1A A;  4KIK B;  3ZNZ B;  4FA6 A;  1V6E A;  1C77 A;  2R61 A;  3B1L X;  1GOZ A;  1R4N B;  2LGX A;  4YL8 A;  1GB1 A;  4P16 A;  4YWG G;  2ZJD A;  1L6V A;  4EOY A;  3RT3 B;  3AE6 B;  3PGE A;  1UZX B;  3L16 A;  2ZW1 A;  2IO1 B;  2KC2 A;  2J4X A;  3NRZ A;  4KGT A;  2GBR A;  3OWE B;  2DHZ A;  3V60 A;  2C9W B;  1BUI C;  4LDT B;  3RZF A;  1HEZ E;  1FXI A;  3Q3N C;  3A9J A;  4W9G A;  1E6E B;  4W9F A;  4C00 A;  1C4A A;  1D6E C;  1WXA A;  3RNG C;  2N0S B;  2A4Z A;  3IBE A;  3HVZ A;  2GMI C;  2B76 B;  3QJZ A;  2W9N A;  3AV8 A;  1VRA B;  1P7F A;  3V61 A;  5LNK 1;  1B9R A;  1DOY A;  5DPW A;  5E6J A;  2N9P C;  3UF8 A;  3N1X C;  2VRR B;  2CS4 A;  2O6V A;  3PLU A;  2JYE A;  3M62 B;  1I4H A;  2IND C;  2LRU A;  4TV3 A;  3ZNH B;  4DHJ D;  1A70 A;  1S1Q B;  4ICV A;  2KDE B;  2FNJ B;  4IM2 A;  3SU8 X;  4A3P A;  2KX0 A;  4MGZ E;  4G11 A;  2MP2 B;  2DYM A;  2KMM A;  1TJE A;  2AX5 A;  4LNI A;  5BMI A;  2WS3 B;  3J9C A;  3D32 A;  4DXG A;  1T0R C;  4MEL A;  4RM9 A; 
#chains in the Genus database with same CATH homology
 3M3J A;  2ZCC A;  3U8Z A;  2WYQ A;  2FCS A;  2D11 A;  3SHQ A;  2RR9 A;  4A3O A;  3PS6 A;  2KVR A;  2MQJ A;  2KO3 A;  4PYZ A;  3QAQ A;  5LXI B;  2KN5 A;  2O2V A;  3H1U A;  2KD0 A;  4LJP B;  2DEN B;  2V4L A;  2MWS B;  4IM0 A;  2M4N A;  4NJ6 A;  4HPL B;  4F8C B;  3ZVV A;  3VTU A;  3N3K B;  3KYC D;  2K8H A;  1AAR A;  1GG3 A;  2NBU A;  2L05 A;  2NPT B;  4GDL B;  4HJK A;  3JYU A;  3WAO A;  1L7Y A;  1RRB A;  2NS5 A;  2BYV E;  4WQO B;  1WR6 E;  5BO4 B;  3IG3 A;  2MBB B;  4HWI B;  4ZRK A;  2LUE A;  2ZZP B;  4K7S A;  4WJO A;  4ASW C;  4BKG A;  3NY5 A;  2JWZ A;  2RPQ A;  3ML8 A;  1VD2 A;  2C7N B;  1F9J A;  3A4S C;  2KAN A;  1IYF A;  1T0Y A;  1WX7 A;  2G4S A;  3H7P A;  4I6P A;  5JH5 C;  4A20 A;  2KMC A;  1K8R B;  2Z0D B;  1WJN A;  4PYU A;  3APF A;  5TR5 A;  1SE9 A;  1UBI A;  4HCP B;  2JVC A;  2MCN B;  2KTR B;  4ANW A;  4X57 B;  3WAP A;  3R66 C;  2DYO A;  1SIF A;  3UGB B;  4E71 A;  4K7U A;  3W1Y A;  5DPR A;  2MBO A;  2KC1 A;  2UWQ A;  2RGF A;  2EKE C;  3OLM D;  3RD2 A;  1OQY A;  3TMP B;  2BGF A;  3TJP A;  4DDG D;  1Z5S B;  2IO3 B;  4KDL B;  3WAM A;  2MBH A;  2YLM A;  5AZF A;  2MW5 A;  2KLG A;  1RFA A;  4MSQ B;  2DZJ A;  3AUL A;  2FIF A;  2K1F A;  4TQ0 A;  1IPG A;  2XK5 B;  2J0M A;  3KUD B;  2L8J A;  3ONS A;  4WJP A;  5AZH A;  4EEW A;  4E3C A;  3UQB A;  3KYD D;  2Z0E B;  3AI5 A;  4G3X B;  4MJS A;  2O6V B;  2J0K A;  3UIO B;  3DDC B;  4BKS A;  5L95 C;  2AL6 A;  4GGQ A;  2KKC A;  2DX5 B;  3X23 A;  1OTR B;  3V62 A;  4II3 B;  3X0W A;  2NR2 A;  2V3S A;  5D94 A;  3ZTC A;  2K39 A;  1WY8 A;  4W9D A;  5LXH A;  2KDI A;  3T8M A;  3O65 B;  2XBB C;  4HXD A;  4RMA A;  3JW0 X;  1Z2M A;  5CHV C;  2R2Q A;  3KW5 B;  5JHB A;  2RSU A;  4JL9 A;  2KLC A;  2MP2 A;  3VTW A;  3ZW3 A;  3OAW A;  2N1V A;  1U4A A;  1I35 A;  4GB9 A;  3HM6 X;  3WAL A;  4FUL A;  1C1Y B;  5C23 A;  2M1M A;  2NVU I;  1I42 A;  2LI5 A;  3GZN I;  1WGH A;  3VH3 B;  1C3T A;  4M8M A;  3PRM B;  4W9E A;  3JSV B;  4PS8 A;  1UBQ A;  2LVO A;  1GC7 A;  4KIK A;  4J6I A;  4KSL C;  1WZ3 A;  5CX3 A;  2LJ5 A;  2KTF A;  4I6L B;  4W9J A;  3ZNI D;  2JZZ A;  5D2M B;  5DPS A;  2FCN A;  2KWC A;  4I6N B;  2KHW B;  1R4N I;  3OJ4 B;  4AUQ C;  4OVU A;  2D2Q A;  3V6E B;  3Q3J A;  3ZNG C;  2ZVO A;  1UD7 A;  2KZR A;  2WX1 A;  3H6N A;  3DVG Y;  1KOT A;  2HE7 A;  5HKH A;  2O6V D;  4KVG B;  2N1W A;  2BF8 B;  4DK5 A;  3N32 A;  3B0A A;  3HIZ A;  3LJ3 A;  4AJY B;  3QX1 A;  4CO7 A;  3DVN U;  4B9K A;  4DWF A;  2LAS A;  1CMX B;  2N7E A;  3M63 B;  1OEY A;  4JGH B;  4EZK A;  1KJT A;  2O2V B;  1WZ0 A;  3L13 A;  1M94 A;  5G2N A;  2MBQ A;  1WJU A;  3EHV A;  2K25 A;  4DBG A;  5FR6 A;  4KDI C;  4DHZ B;  1E8X A;  2IO0 B;  1V86 A;  4AP4 C;  2N9X A;  3RUI B;  4NQK E;  4M8N A;  1EUV B;  2NPT A;  4GDL A;  1WI0 A;  3GOE A;  1TGZ B;  2PE6 B;  4AWJ A;  4BOS C;  3ZUN A;  3MHS D;  4FJZ A;  1WE6 A;  3EEC A;  4IC7 B;  4II2 B;  2ZNV C;  2LZ6 A;  2ZEQ A;  3VH4 B;  3BY4 B;  2D10 A;  2LXC A;  4IWO A;  2J0J A;  1ZGU B;  3KVF B;  1X1M A;  3A9J B;  3L08 A;  3AU5 A;  3NHE B;  4IW0 A;  3VAW A;  3L17 A;  4BBN F;  1EO6 A;  2MBE A;  1WX8 A;  2M0X A;  4RM8 A;  2KFJ A;  1Q5W B;  3RZW C;  5GMV A;  1RLF A;  2J7Q B;  2ZPN A;  1WGD A;  4P7I A;  4ZDV A;  2MA9 B;  1OEY J;  3DVN V;  4BKT A;  3A1Q B;  2CHX A;  5AZG A;  3BIN A;  5D7G A;  5KHQ A;  2JF5 A;  4HDO A;  2DZK A;  4WJQ A;  2KWU B;  2C7H A;  3TCA A;  1TZ1 A;  2JUO A;  2LD9 A;  4KV2 A;  3H7S A;  1NI2 A;  2REX A;  4FHK A;  4M0W B;  4K1R B;  2WX0 A;  4TQ1 A;  4JIO U;  5EDS A;  2KX3 A;  3R7Q A;  1JRU A;  1A5R A;  2DYB A;  3VHT C;  5CHF A;  4MJS B;  3U30 A;  2ZNV B;  1V5T A;  4URK A;  1Q1O A;  2MRP A;  2AL3 A;  3PPA A;  1V9J A;  1WJ6 A;  3WIM A;  4HLE A;  3PSE B;  2Z59 B;  2CU1 A;  4ZRJ A;  1Q0W B;  3PLV A;  2XEW A;  1LXD A;  2ZVN A;  2L3Z A;  5IA7 A;  1E8Z A;  1WXM A;  3AU4 A;  3C0R B;  4XZ4 A;  2KDF B;  3PHW B;  4NNJ B;  3DBS A;  4EZJ A;  4XX5 A;  1VCB A;  1FXT B;  4WWO A;  2M17 A;  4BFR A;  3PZD A;  3VUW A;  1KM7 A;  1NBF C;  1WGR A;  1WR1 A;  1XQQ A;  3I3T B;  1D3Z A;  2B3A A;  3QIJ A;  3P2B A;  4ANV A;  1E5W A;  2M8S A;  5C1Z A;  2L76 A;  2N4F A;  4NQL B;  4HPM B;  1IP9 A;  2NBW B;  2K6D B;  3A9K A;  2GBN A;  2C5L C;  4TUU A;  2OJR A;  1UH6 A;  1V49 A;  1P98 A;  3N30 A;  1WYW B;  1ISN A;  3DCG A;  4HCN B;  4BOZ B;  3T9L A;  1XT9 B;  1ZKH A;  1V5O A;  3M95 A;  3DBL I;  4W9C A;  1J19 A;  2KWV B;  4JQW C;  3DOW A;  3PRE A;  5CTR C;  3RUL A;  5DCN A;  5L83 A;  2DAJ A;  2IO2 B;  1WMH A;  2PE9 A;  1P3Q U;  3SDL C;  3ZO5 B;  2I1K A;  4MM3 A;  2PPH A;  1S3S G;  2FID A;  4NJ7 A;  4FN2 A;  2EMT A;  3UIN B;  3APD A;  4WWN A;  2LRW A;  3RYT A;  4EUT A;  4GXB A;  2CHZ A;  3EFU A;  3QK0 A;  2MX2 A;  3NOB A;  5D6J B;  2K8C A;  1WXV A;  1TTN A;  4LDT D;  2CKH B;  2K8B A;  3W1S C;  3IVF A;  2LWP A;  2GBJ A;  2OOB B;  5JHA A;  2AWT A;  2MSE D;  4N9F 4;  4MH0 E;  4ANX A;  2HTH A;  3QHT A;  3TBL D;  4IUM B;  5JZE B;  3ZDT A;  3TL5 A;  1UGM A;  3CSF A;  4W9K A;  5IAA C;  2JXX A;  4WJN A;  3ZLZ A;  2C7M B;  3UQA A;  1V80 A;  3HK0 A;  3JVZ X;  4KZ0 A;  3QAR A;  2JRH A;  1OGW A;  1LQB A;  3B08 A;  2FCM A;  1HE8 A;  2JT4 B;  3IFW B;  3UIP B;  4WAA A;  3H7P B;  1WGY A;  3Q3F A;  4KZC A;  1GNU A;  1V81 A;  5CHW A;  3A1Q A;  2HJ8 A;  3L10 B;  3NS8 A;  3ZTD A;  3WA0 A;  1RAX A;  2MLB A;  1H8C A;  3VVW B;  3H9D A;  3QQ8 B;  4DHJ B;  3L54 A;  2KTR A;  3MTN B;  4E74 A;  2GBM A;  3VUY A;  2ZCB A;  1YIW A;  1G6J A;  3QWZ B;  2KJH B;  4IWP A;  5E6P A;  1YD8 U;  2G3Q B;  2G4D B;  2N9E B;  1E90 A;  2CHW A;  3EC8 A;  3LDZ E;  4IG7 B;  3ZRF A;  2IY0 B;  4HVB A;  2KDB A;  2XK5 A;  2KOX A;  2PJH A;  4MSM B;  2FCQ A;  2AEH A;  1UEL A;  4FJY A;  2BPS A;  2LXA A;  4IM3 A;  4MEM A;  3VFK A;  5J18 A;  4PS7 A;  4PS3 A;  2CR5 A;  3MJW A;  2V1Y A;  1WF9 A;  1ZW7 A;  2FAZ A;  4MGY E;  5LLI A;  1J0G A;  2KJR A;  4W9I A;  3PTF C;  4GSW A;  4MDK E;  1GJZ A;  4FBJ B;  2L7R A;  1WM3 A;  2KK8 A;  1WX9 A;  5J2R A;  4MGI E;  3L0W B;  2IY1 B;  1WIA A;  2KXJ A;  3DVG X;  4K7W A;  4NPN A;  4TKN A;  5DPT A;  2LGD A;  3KUC B;  1XD3 B;  2Y5B B;  2KQ7 A;  3ALB A;  3V6C B;  1NDD A;  3PV1 A;  3WAN A;  2N7D A;  3DPD A;  3DBR I;  4W9L A;  3K9O B;  4FJV B;  2NBV B;  3JSV A;  2LVP A;  3VQI A;  4AOF A;  2DZI A;  2BKR B;  2IZV B;  2NCN A;  3KUZ A;  4W9H A;  4HK2 A;  1WE7 A;  4JLC A;  4ZYN A;  4IWQ A;  4LJO B;  1WM2 A;  1P1A A;  5G55 A;  4KIK B;  3TIX A;  5E6O A;  2YVC A;  2FUH B;  3ZNZ B;  2C60 A;  3VTV A;  4FA6 A;  1V6E A;  1R4M I;  1WMH B;  4ICU A;  3VDZ A;  4FHJ A;  1EF5 A;  3B1L X;  4BVU C;  2IYD B;  2LGX A;  1E8W A;  4AJW A;  4YL8 A;  4LCD E;  3PRZ A;  4DHZ E;  4F7Z A;  1YQB A;  4K81 A;  4NAW A;  2IBI B;  1SGH A;  2ZJD A;  2JY6 A;  2JRI B;  4EOY A;  3RT3 B;  1WFY A;  2R2O A;  2RD0 A;  4NAW B;  4NY0 A;  3RCZ A;  3HM3 A;  4G50 A;  3NZS A;  2D3G A;  3PGE A;  3QCA A;  2LGY A;  2BYF A;  1E7U A;  1E8Y A;  1UZX B;  3L16 A;  3PHX B;  2IO1 B;  2JPH A;  2KC2 A;  4B6W A;  4GN1 A;  2KMA A;  1TBE A;  2GBR A;  2DHZ A;  1Y8R C;  2LVQ A;  4EFO A;  3V60 A;  2PEA A;  3CST A;  4MGK E;  2C9W B;  2WWZ A;  2ZPY A;  3DBH I;  2L0F A;  3IHP C;  4LDT B;  3QC8 B;  3RZF A;  2KJ6 A;  1LM8 B;  3U7D A;  4FAD A;  1YJ1 A;  5AEK B;  3NZU A;  2BWE S;  2JZ3 B;  2D07 B;  4EKU A;  4XC2 A;  3S2A A;  3A9J A;  3DQV A;  4W9G A;  2KQS A;  1EF1 A;  1WH3 A;  1WRD B;  1E7V A;  3ENE A;  4W9F A;  3PVL A;  5KHO A;  3ZKJ C;  3K9P B;  1WJ4 A;  4CYE A;  4EZL A;  2BKF A;  1YX6 B;  2GOW A;  2KNB A;  3VXW A;  1WXA A;  3W1S A;  1P9D U;  1BT0 A;  1WGG A;  2A4Z A;  4G0N B;  1GUA B;  3IBE A;  5E6N A;  4BBN C;  2GMI C;  3QJZ A;  3A33 B;  2W9N A;  2AYO B;  3CMM B;  4GOC A;  3OJ3 A;  3V61 A;  1WXS A;  3VUX A;  4F1S A;  4OVV A;  5DPW A;  3QA8 A;  2N9P C;  3UF8 A;  5J17 A;  1P0R A;  2BWF A;  4FLH A;  3R3M A;  2QHO A;  3ZRC A;  2VRR B;  1YX5 B;  2CS4 A;  4HDQ A;  3ML9 A;  2KFK A;  3ZIM A;  4DDI D;  1PQS A;  2O6V A;  1QZE A;  3PLU A;  3M62 B;  2KFK B;  2HD5 B;  1KLV A;  2LRU A;  4TV3 A;  3ZNH B;  4WWP A;  3PRP B;  3PT2 B;  3SD5 A;  2WDT B;  4DHJ D;  1S1Q B;  2L00 B;  4ICV A;  3KH0 A;  2KDE B;  2FNJ B;  4GU2 A;  1J8C A;  3ZDM C;  4GDK B;  1MG8 A;  2DAF A;  4IM2 A;  3SU8 X;  4A3P A;  4BKS D;  4KSK C;  1GC6 A;  1LFD A;  2KX0 A;  2ASQ A;  4GIV A;  4MGZ E;  4CHK A;  4GDK A;  4G11 A;  4ANU A;  4DXA B;  2MP2 B;  3CF6 E;  2UYZ B;  2DYM A;  1L2N A;  2K6Q A;  2GBK A;  2DZM A;  4ZRI A;  4B95 A;  2EMS A;  3A4R A;  1V2Y A;  4GMV A;  2I1J A;  3AXC A;  1H4R A;  3A9K B;  3HHM A;  3ECI A;  3D32 A;  2BYE A;  3APC A;  3R7R A;  2G45 B;  2A5U A;  4MEL A;  4RM9 A;  2L0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...