1KM7A

Solution structure and backbone dynamics of gabarap, gabaa receptor associated protein
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
100
structure length
100
Chain Sequence
GEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GABA(A) Receptor Associated Protein
publication title 1H, 13C and '5N resonance assignments of GABARAP, GABAA receptor associated protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 18
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2001-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1km7A00
2BWES 1WMHA 4FJYA 2K25A 2AYOB 3T8MA 3H7PB 4BKSD 2R2OA 3L13A 3M63B 5GMVA 3W1SC 4K81A 1MG8A 4IWPA 2KD0A 4IWQA 2MSED 1G6JA 2RGFA 1E7VA 3BINA 3VUYA 4BBNC 3PT2B 4FN2A 2K8HA 3PRZA 3PZDA 3AU5A 4FULA 4AOFA 2DZKA 1E8XA 2LXCA 2G4SA 3QIJA 3SD5A 4ANXA 2BWFA 2Z0DB 4EOYA 2KFKB 1J19A 1WF9A 2KWVB 1XT9B 2JPHA 1WXVA 3PTFC 2NBUA 4DDGD 2JF5A 2GBRA 3VTVA 3A4SC 2LGDA 2KDEB 2LVQA 2UWQA 1V6EA 2N1WA 2CU1A 3ZNGC 1IP9A 3A9KB 3LDZE 2KKCA 3ZTCA 1L7YA 4G50A 2KQSA 3PGEA 3IFWB 2FIDA 3RT3B 3A9JA 3W1YA 2M1MA 4EZJA 3IG3A 3VH4B 1WGRA 4FBJB 1WRDB 3QQ8B 2W9NA 1YQBA 3APFA 3KYCD 3ZNHB 4DK5A 1WY8A 1V5TA 2MBEA 2ZCBA 4WJQA 4M0WB 2YVCA 3A1QA 1LQBA 4N9F4 4NQLB 1WJUA 2K1FA 2LRUA 4DHJB 5LXIB 2KLGA 1WZ3A 3AU4A 2ZPNA 1V49A 2R2QA 1E8ZA 2DHZA 3OJ3A 3CSFA 4GB9A 2DYMA 4BKGA 3EC8A 4TKNA 3ZIMA 4GSWA 1E8WA 4GIVA 2K6QA 3ALBA 3OAWA 3C0RB 4DBGA 3VTUA 3U8ZA 1TTNA 2KHWB 2AL6A 4KZ0A 2FAZA 3ZNID 4E74A 4HCPB 2KC1A 4GXBA 3JSVA 2JZZA 3R7QA 1I42A 4HVBA 3PHXB 2BKRB 2MX2A 2L0FA 3K9PB 1JRUA 5BO4B 4MJSB 5EDSA 3A9JB 1M94A 2V3SA 4DWFA 1EF1A 2MCNB 2M8SA 1ZKHA 2MQJA 2XBBC 3CF6E 3EHVA 4HDQA 5CX3A 4TUUA 2KC2A 2KTRA 2LUEA 2GBJA 2J0KA 4II2B 5E6PA 4EKUA 2L05A 2JY6A 2NS5A 2OOBB 2V4LA 4W9EA 3A1QB 4HWIB 4MH0E 3RCZA 1D3ZA 3KH0A 4OVUA 5LXHA 2BYFA 1WFYA 1I35A 2ASQA 4MM3A 5DPSA 3MJWA 1WGHA 3ZTDA 2MRPA 5AEKB 4AJWA 3DBHI 2K39A 2GMIC 1NI2A 4FJZA 2D2QA 2DZIA 3H7PA 4HPMB 4ZRJA 3B0AA 4FHKA 2D07B 4HCNB 1NBFC 1S3SG 4DDID 2K6DB 3VUXA 4NQKE 5KHOA 3X0WA 1V81A 3R3MA 2KX0A 2AWTA 3OJ4B 4G0NB 3M3JA 3RZFA 4G11A 3VVWB 2LI5A 5IA7A 4TQ0A 1OTRB 1Y8RC 2C7NB 3I3TB 1WZ0A 2IZVB 2NPTB 3IHPC 3L17A 4KV2A 1R4MI 3R7RA 2M0XA 2KFKA 5JHAA 2EMTA 4ANUA 3PVLA 2VRRB 1IPGA 2DENB 2L3ZA 3ECIA 2Y5BB 1XD3B 3QHTA 5JH5C 2FIFA 3MTNB 3R66C 3QAQA 1LXDA 4MGKE 2IY0B 3DVGY 4A3OA 3K9OB 1EO6A 1V80A 2RSUA 2ZVNA 3A9KA 3MHSD 4MGZE 4WQOB 2KDBA 2BGFA 1PQSA 1WR6E 3PPAA 2KWUB 2AL3A 2KJHB 1C1YB 3L16A 4W9IA 3B08A 4DHZE 1WX8A 1UGMA 2MLBA 1WX7A 2JWZA 3L54A 3QX1A 4DHJD 2I1JA 4KIKA 3TBLD 2KDFB 5E6NA 4CHKA 4NJ7A 4HDOA 1EF5A 1UBQA 3NS8A 3V62A 1V9JA 1L2NA 2ZVOA 3H7SA 3UIPB 2DX5B 3V6EB 2KXJA 5G2NA 1HE8A 3ZO5B 4NJ6A 3VFKA 1WJ6A 2DAFA 3O65B 3UF8A 4TV3A 3PSEB 2C7MB 3VH3B 4LCDE 4RM8A 3V60A 5D2MB 3TIXA 3KUCB 3PRPB 1GNUA 3VAWA 1BT0A 1YJ1A 2NBVB 3ZVVA 2L7RA 2NVUI 5CHFA 2LJ5A 2FNJB 3IBEA 2EKEC 3JYUA 3NY5A 3KUZA 3QA8A 2JXXA 4IW0A 4MJSA 3UINB 3X23A 1NDDA 2KANA 2D3GA 2NBWB 3RZWC 3VUWA 1WGYA 4XX5A 1KLVA 3ZRFA 2RPQA 5AZFA 2JZ3B 2JT4B 3SU8X 2KDIA 4EUTA 4K7SA 2L8JA 1E8YA 2MBHA 2GBNA 4PS8A 2DZMA 4KIKB 4F8CB 3KYDD 4ASWC 1KOTA 3H6NA 3ZKJC 1F9JA 4B95A 3HM3A 5G55A 3LJ3A 4FLHA 1FXTB 4K7WA 3WAOA 2AEHA 4WWOA 2CKHB 3GZNI 5AZGA 1WE7A 3TMPB 3ZDMC 4GU2A 2ZEQA 3JVZX 1OEYJ 2LVOA 2J0MA 4BVUC 4W9LA 2DYBA 2G4DB 2G45B 4ICUA 1ZGUB 3GOEA 2O2VB 2B3AA 1WXMA 3ZDTA 3ZNZB 3A4RA 3DVNU 3Q3FA 2N1VA 3VTWA 3RYTA 2GBKA 2GBMA 2KNBA 2D10A 4WJPA 4FJVB 4GOCA 4KSKC 3N32A 4JIOU 1YX6B 2NPTA 2JRHA 3M95A 3PRMB 4HXDA 2PEAA 3N30A 4GDKA 2LRWA 3APCA 1P1AA 1WM2A 3PHWB 2LD9A 4ANWA 2A4ZA 4IUMB 1Q5WB 1WXAA 5DPTA 3D32A 4AP4C 1AARA 4RMAA 2IO2B 3PLUA 4MEMA 2XK5A 3HK0A 2IY1B 4HJKA 4IM3A 5LLIA 2KMAA 4MELA 2YLMA 5AZHA 3UIOB 4K1RB 2PE6B 3DBSA 1TBEA 3T9LA 3AULA 5D7GA 3TL5A 3QCAA 4LDTB 3NHEB 2WX1A 4JQWC 3ZW3A 2KQ7A 2MBBB 3TJPA 2KVRA 2LGYA 3OLMD 4BFRA 4BOZB 2KO3A 2ZNVC 3P2BA 1UBIA 1E5WA 2MW5A 1T0YA 2M4NA 3PS6A 4MSQB 3W1SA 3Q3JA 2FCNA 1KM7A 4ZRKA 3L08A 4E71A 1WM3A 4ZDVA 4KZCA 1P0RA 2V1YA 4IC7B 4PYZA 2RR9A 1ISNA 1P3QU 1WYWB 2K8BA 1UZXB 4GDKB 3EFUA 4WJNA 1XQQA 2OJRA 1TZ1A 4GGQA 3U30A 2N4FA 2EMSA 3NOBA 2G3QB 4GMVA 3VDZA 2KK8A 4JLCA 2HD5B 3KVFB 4JL9A 2JUOA 2WX0A 2XK5B 3KUDB 3ML8A 1WH3A 2ZCCA 1J8CA 2A5UA 5J2RA 2D11A 2IO1B 3M62B 2C7HA 3QC8B 3AXCA 5D94A 1GUAB 4ICVA 1UD7A 4FA6A 2MA9B 2MBQA 1RLFA 1U4AA 2FUHB 2IBIB 3IVFA 4MGYE 3ML9A 3ONSA 5C1ZA 2J0JA 4P7IA 4PYUA 4W9FA 3VQIA 4AUQC 1V5OA 1ZW7A 4OVVA 2FCMA 2O6VA 3DDCB 4F7ZA 2FCQA 2N9EB 2REXA 5J17A 2IO0B 3HIZA 1UH6A 3DQVA 4IWOA 4W9GA 2BPSA 2KWCA 3L0WB 1SIFA 4I6PA 1GJZA 2DYOA 4MGIE 2WWZA 1H4RA 1X1MA 2BKFA 2CS4A 2J7QB 3NZSA 1YD8U 4I6LB 4XZ4A 1LM8B 2GOWA 3H1UA 4PS7A 2O2VA 4W9HA 2N9PC 3CMMB 2MP2B 2KJRA 4AJYB 4W9JA 2NCNA 4BKSA 2BYVE 3WA0A 1J0GA 1SE9A 2L00B 4GDLB 3QARA 4W9KA 1UELA 1RAXA 5TR5A 1C3TA 1RFAA 3N3KB 1WXSA 3A33B 1E90A 4B9KA 5J18A 1RRBA 3H9DA 3QK0A 3RUIB 4EFOA 1LFDA 2C9WB 1P98A 2KTFA 4PS3A 4X57B 4AWJA 4A3PA 2C5LC 1Q0WB 3HHMA 1WE6A 4LJOB 2KX3A 4K7UA 4F1SA 2IYDB 2LWPA 4KSLC 2O6VB 2QHOA 3ZUNA 5C23A 2KZRA 4M8NA 1TGZB 4WJOA 4BKTA 1EUVB 3DCGA 4YL8A 5HKHA 4WAAA 4KDIC 2N7EA 2BF8B 2BYEA 2HJ8A 4NPNA 4M8MA 3PREA 4LDTD 4HPLB 2C60A 1SGHA 5DCNA 2Z0EB 1E7UA 3WAMA 2JRIB 4FADA 1K8RB 1WMHB 3DPDA 3B1LX 4EEWA 1KJTA 4MSMB 3ZLZA 1GG3A 2HE7A 2XEWA 1WJNA 2ZPYA 2M17A 3U7DA 4EZKA 2RD0A 2KMCA 5L95C 3AI5A 3PLVA 1S1QB 1GC6A 4FHJA 4GN1A 4IM0A 4W9DA 4HLEA 5DPWA 4IG7B 5KHQA 2N9XA 3CSTA 1OEYA 3HM6X 3WANA 3KW5B 3L10B 2N7DA 4CYEA 1VD2A 3V61A 1A5RA 4WWNA 3DBRI 1OGWA 2MWSB 4J6IA 4W9CA 5CHVC 2KJ6A 3NZUA 3ZRCA 2L0TA 1WI0A 4NY0A 5E6OA 4NAWA 1V2YA 4BBNF 2WDTB 2Z59B 1IYFA 1Z2MA 3DBLI 4KDLB 1GC7A 2FCSA 2MBOA 3APDA 3EECA 1Z5SB 2KLCA 1P9DU 4CO7A 3QWZB 3UQAA 2ZNVB 2LXAA 4ZRIA 4E3CA 3VHTC 4KVGB 2LZ6A 4I6NB 3SDLC 1WIAA 1WR1A 1YX5B 2CHZA 2PPHA 3WAPA 4MDKE 2PJHA 2L76A 2DZJA 2LVPA 4II3B 3DOWA 3V6CB 4BOSC 4DHZB 2KFJA 5JZEB 2MP2A 4RM9A 1YIWA 5JHBA 1OQYA 2K8CA 2CHWA 4ANVA 4URKA 2CR5A 4GDLA 2LGXA 2DAJA 2LASA 4NNJB 2I1KA 3JSVB 3VXWA 1VCBA 2PE9A 2IO3B 3UGBB 1V86A 5FR6A 4A20A 4LJPB 4G3XB 4HK2A 2UYZB 3WALA 5CHWA 4NAWB 4IM2A 3RD2A 4JGHB 3JW0X 3BY4B 1Q1OA 2KOXA 2CHXA 2KN5A 3RULA 5CTRC 2O6VD 4ZYNA 1QZEA 5IAAC 3ENEA 3S2AA 4EZLA 2KTRB 1WJ4A 1WX9A 3DVNV 3DVGX 3WIMA 5D6JB 4WWPA 3PV1A 1H8CA 5DPRA 2ZJDA 1R4NI 3SHQA 3TCAA 4TQ1A 2ZZPB 3QJZA 5L83A 3UQBA 2HTHA 4B6WA 2WYQA 2JVCA 1WGDA 1WGGA 4DXAB 4XC2A 2NR2A 1CMXB
chains in the Genus database with same CATH superfamily
4BKSD 3M63B 3J9CA 4K81A 1MG8A 4YSXB 4LNFA 4BBNC 1I4GA 4AOFA 2WU2B 3DHIC 2JPHA 2PTLA 1WXVA 2W54A 2GBRA 3P42A 3A4SC 2KDEB 2CU1A 1VZ6A 1NYRA 3LDZE 2KKCA 1RYJA 1SIJA 2HJ1A 3ZTCA 3PGEA 3IFWB 2FIDA 1XXGA 5IOIA 3A9JA 3RT3B 1WGRA 4B0EA 1C4PA 3APFA 1V5TA 4WJQA 4N9F4 1LQBA 2KLGA 1QF6A 3AU4A 2R2QA 1E8ZA 2Z8LA 1GB1A 3OJ3A 4GB9A 3EC8A 1E8WA 4DBGA 1TZOA 1ZPSA 3U8ZA 1V1OA 5H8YE 3RPFC 2J53A 2KT7A 3N9YC 4HVBA 2BKRB 2MX2A 5EDSA 4DWFA 3EHVA 2XBBC 2B76B 2KC2A 2LUEA 2J0KA 2K9XA 2L05A 2NS5A 3BK2A 4W9EA 4HWIB 3DWGC 3ETRA 1FNWA 1NI3A 5LXHA 1WFYA 3MJWA 2X8XX 3P4QB 1FNUA 3DBHI 2K39A 5EE9A 2WP9B 3H7PA 2D07B 4HCNB 1NBFC 4DDID 2K6DB 2KX0A 4G0NB 2RDBC 4TQ0A 3I3TB 1WZ0A 1JWUD 2IZVB 2NPTB 3IHPC 3L17A 2AQ3B 2KFKA 2EMTA 2DENB 1YQ4B 1XD3B 3MTNB 3ABVB 3QAQA 3PO0A 1LXDA 4C7ZA 2ZVNA 1N63A 2W3RA 3PPAA 3L16A 3B08A 2MLBA 1WX7A 3GP7A 4XDDA 4M0WA 2YEPB 2KDFB 2WQYB 4OVZA 4NJ7A 2WXMA 1NVID 1N61A 1CJEA 4N6EB 1L2NA 5AUIA 2INPE 3UIPB 2DX5B 4ZRQA 3ZO5B 2DAFA 3UF8A 3PSEB 1FCLA 2C7MB 5JXVA 2K22A 1BT0A 3ZXVA 2FNJB 2EKEC 1VR9A 2JXXA 3QA8A 2JQRB 1NDDA 2KANA 4MACA 4BZAA 1JWAD 1KLVA 3ZRFA 2JT4B 2KDIA 1MHXA 2V3PA 2GBNA 4KIKB 2QMTA 2WXIA 4ASWC 1KOTA 1MJDA 3HM3A 1FXTB 4LK0M 3GZNI 1SE4A 3TMPB 3MC0B 3JVZX 2LVOA 2J0MA 4BVUC 2WDVB 3T3NA 2DYBA 2G4DB 3ZNZB 3Q3FA 3DVNU 3KWLA 2GI9A 3H8HA 2BBCA 3GE3C 4JIOU 2WXNA 2JRHA 3M95A 3PRMB 2N9LA 3Q8AA 3PZ8A 3APCA 2K0PA 2WXJA 1FRRA 2LD9A 3AMZA 4IUMB 2CJOA 3GS2A 4AP4C 4RMAA 5LLIA 2YLMA 3SR6A 4ZHOA 3DBSA 3QCAA 4RH6A 3ZW3A 2KVRA 1XLQA 2MW5A 2JU6X 2M4NA 3L08A 3NZ3A 4E71A 4KGTA 3EFUA 3Q8CA 1C78A 4WJNA 1TZ1A 4GGQA 4WAFA 2EMSA 2XN9C 1RFKA 4JLCA 2HD5B 4DQOC 4C4VB 3KUDB 3EGRA 2ZCCA 4MH8A 1JWBD 1GUAB 4ICVA 1UD7A 4FA6A 2D5GA 2MBQA 4RCOA 3IVFA 3ML9A 3ONSA 2W82A 3NVZA 4PYUA 3AE7B 4YSZB 4OVVA 4ARIA 2FCQA 4IWOA 1ZDVA 1UWMA 4IOIE 2BPSA 1SXTA 3NRZA 3NUHB 4XGAB 1H4RA 3PZ7A 1YD8U 3WCQA 3H1UA 2GOWA 5BYQA 2MP2B 1C77A 2ONQA 2WXQA 3I57A 4W9JA 2NCNA 4BKSA 1JWSD 1TS3A 5TR5A 3AEEB 2MHJA 3C8YA 5J18A 2JZPA 3N1ZC 2BB5A 1RRBA 3RUIB 1Y56A 2C9WB 2C5LC 2I2YA 1Q0WB 3HHMA 1WE6A 4K7UA 2HDEA 4KSLC 4YTPB 1FXIA 2O6VB 2QHOA 1FRDA 1TGZB 4WJOA 1KRHA 3RMKC 2VH1A 1WXQA 4HPLB 2C60A 3E56A 1PYWD 1WMHB 3B2GA 3B1LX 4EEWA 1TKEA 3ZLZA 1GG3A 3AM9A 2KYWA 3VR8B 5G5HA 3RNAC 2M17A 3LYYA 4KGRA 1ZXIA 3AI5A 2Q5WD 5KHQA 3CSTA 1YN3A 3TEZA 3L10B 4DXGA 1FXAA 1K52A 2GLSA 1VD2A 3V61A 3NVVA 2YEPF 3DBRI 1L0YB 3ZJTA 2MWSB 4W9CA 4J6IA 1D6EC 1IYFA 3DBLI 4KDLB 1GC7A 4HKQA 3APDA 5EE1A 2IGGA 2KLCA 2KN4A 4KVGB 4PT5A 1KLGD 1YX5B 2R61A 2PJHA 2L76A 4II3B 3RI7C 3ZYYX 5JHBA 2CU3A 4GDLA 2DAJA 1TT5B 4NNJB 2IO3B 4N58A 1VDVA 1QOBA 5FR6A 4A20A 4LJPB 4G3XB 2UYZB 3KQ4A 5CHWA 4NAWB 5HI1A 3RD2A 4JGHB 2NTSA 2KOXA 2CHXA 5CTRC 2O6VD 4EZLA 4AQ7A 2KTRB 4D2KA 3WIMA 3FILB 2L83A 4GLSC 5E6JA 3SHQA 1KTKA 3TCAA 4LNNA 4B6WA 2WYQA 4RGOS 1FPYA 2E6XA 4XC2A 4N59A 3L13A 5GMVA 3W1SC 4IWPA 2KD0A 4IWQA 3AB5A 2LGSA 3VUYA 3MC9A 2WHIA 3PRZA 3SD5A 1F52A 2BWFA 1J19A 1XT9B 3PTFC 3VTVA 3Q8FA 4FXCA 2LVQA 3AEGB 2KVZA 2N1WA 3ZNGC 3A9KB 4O1NA 4R3DA 3VH4B 3QQ8B 5EE0A 1MFWA 1YQBA 4C7YA 4US9A 2ZCBA 1HTQA 2YVCA 1KH0A 1WJUA 5LXIB 4DHJB 1B9RA 2ZPNA 1V49A 3CSFA 4OZBA 2QEJC 3DHGC 1F77A 3ZJUA 2K6QA 3I5JC 3GE8C 1XLPA 4XWWA 2BS2B 1TTNA 2KHWB 2MJEA 4E74A 1C4AA 1I42A 2PVOD 2L0FA 3W9CB 5BO4B 4MJSB 1I4QA 3AEDB 4TMAB 1EF1A 2MCNB 2M8SA 3CF6E 4HDQA 2JSVX 4M00A 2QILA 5E6PA 3RFZB 2JY6A 1TJEA 1I35A 2ASQA 3Q69A 4MM3A 2MRPA 2L1AA 1EWCA 3U7ZA 1NI2A 2D2QA 2DZIA 1EM7A 4FHKA 1S3SG 5IKCM 4NQKE 2V3NA 3X0WA 1V81A 3OJ4B 3M3JA 2BQQA 4G11A 1R4MB 3AV8A 3AN1A 1OTRB 3IT4B 2QCZA 4KV2A 5FK9C 4ANUA 3MC8A 3AEAB 1T0SC 2FIFA 3R66C 1FFUA 3K9OB 1EO6A 2RSUA 4WQOB 4RGTA 2KDBA 3AH7A 2KWUB 4DHZE 3ZQ4A 4XE0A 4ZRPA 2JWZA 5HFYA 4DHJD 4KIKA 1F2RC 4RF1A 4CHKA 3Q8EA 3ZGZA 5C3JB 3V6EB 1MG4A 1HE8A 5IO9A 4NAMA 3VFKA 3Q8BA 2KWDA 3N1XC 3U4EG 1IBXB 4TV3A 1QOFA 4ARCA 4LCDE 4RM8A 5D2MB 3TIXA 3KUCB 1JCKB 2L7RA 2WXRA 1VZ7A 3IBEA 4YSYB 3NY5A 3KUZA 1L5PA 5FR3A 2D3GA 1YN5A 2LGIA 2DLBA 1SE2A 4F8CB 1F9JA 2TSSA 2BS3B 1QQRA 3WAOA 1C9FA 3IT6B 4WWOA 1GAQB 1N62A 3ZDMC 4GU2A 1OEYJ 3AEFB 2G45B 3GOEA 1WXMA 2N1VA 3VTWA 1YN4A 4FJVB 4GOCA 2IPKD 1WYGA 4JPSA 1WM2A 2A4ZA 2NMQA 5DPTA 2AX5A 1ACCA 3NJTA 2FBWB 3IAM1 4YXDB 4IM3A 5AZHA 3UIOB 1TS4A 1TBEA 2QSDA 3TL5A 1T0QC 4LDTB 2LJIA 2WX1A 1V1PB 3TJPA 2LHEA 3OLMD 4BFRA 2ZNVC 1FMAD 1UBIA 3PS6A 3W1SA 3Q3JA 5BMIA 3EFCA 1ZOYB 4KZCA 3LXFA 1EU3A 1HTOA 1HA5A 2V1YA 1P7EA 2RR9A 1ISNA 3RNBC 4ZYSA 4J3OD 3P4SB 3U52E 3V3XA 1PGBA 2BW2A 1UF0A 3KVFB 3RNEC 2XK5B 2WXPA 3ML8A 1J8CA 2WS3B 5D94A 4UDUC 2MA9B 3Q14C 4P7IA 1J7AA 4AUQC 1V5OA 1TYGB 2O6VA 2N9EB 2PVGC 1UH6A 3DQVA 4W9GA 3L0WB 3AE1B 3W2DA 2WWZA 1F2RI 2BKFA 2CS4A 4XZ4A 2O2VA 1RM6C 2JYTA 3BVZA 1CQVA 1LO5D 2BYVE 2L00B 2LEKA 3QARA 1P7FA 1RFAA 3A33B 1E90A 1L6UA 2QJLA 3AE6B 1JWMD 3CWIA 3RNCC 3Q3OC 1P98A 4PS3A 4AWJA 4A3PA 1F0ZA 2KX3A 1ZUD2 4BKTA 3BVMA 1EUVB 1WWTA 4NPNA 2BF8B 2HJ8A 4LDTD 1OQRA 2DNFA 2WXLA 2Z0EB 2JRIB 4FADA 4WQMA 3FKYA 2HE7A 1STEA 2ZPYA 1SE3A 3U7DA 4EZKA 2RD0A 2KMCA 1SEBD 4P1BC 2INCC 3PLVA 1S1QB 4W9DA 5DPWA 1TIFA 3N1YC 1FIQA 1K53A 1DOXA 2N7DA 2QDFA 4B0MA 4C56C 4YTNB 1OGWA 3ZRCA 3NZUA 4ZHPA 2L0TA 1WI0A 4NY0A 1JROA 3BZDB 4NAWA 3TUOA 2FCSA 1FD6A 1Z5SB 3UQAA 3VHTC 3BYYB 3SDLC 1E0ZA 2RDGA 3V6CB 2L32A 1TY2A 4BOSC 5JZEB 1E9MA 3Q3NC 2K8CA 2CHWA 2WXOA 2CR5A 2LASA 4AS1A 2IGDA 3VXWA 3DWMA 3UGBB 4A8XC 4IDIA 1HQRD 1Q1OA 2KN5A 4ZYNA 1GB4A 1WJ4A 3AEBB 1XLOA 3PV1A 2ZJDA 1R4NI 4LTUA 3QJZA 5L83A 5I4DA 1NEKB 2JVCA 1WGGA 1CMXB 3AECB 4FJYA 3T8MA 3H7PB 1XLNA 3MJ5A 2R2OA 3FC4A 2VH2A 2BS4B 1G6JA 1IGDA 1QKZA 2RGFA 2K3UA 3PZDA 4FULA 1SJHD 1E8XA 1OQQA 2IGHA 2LXCA 2AQ1B 2G4SA 2WLBA 3QIJA 4ANXA 2Z0DB 2KFKB 1WF9A 4DDGD 2WXKA 2BVCA 2LGDA 2SAKA 2UWQA 1V6EA 1EWYC 1T6BX 1L7YA 1DOYA 4EZJA 1V8CA 2X38A 5D3DA 2SEBD 1WRDB 2KDMA 5H92C 3KYCD 3ZNHB 2I38A 4DK5A 1I4HA 4M0WB 1KLUD 2K1FA 2LRUA 1WZ3A 4BKGA 2WDRB 4GIVA 1ZXHA 4CQNA 3VTUA 4LNKA 4C80A 2AL6A 4KZ0A 3ZNID 2KC1A 4GXBA 3JSVA 4C00A 4L1BA 3K9PB 1JRUA 1M94A 2V3SA 1RWSA 5EE3A 5CX3A 4TUUA 2GBJA 4EKUA 1PGAA 2V4LA 3A1QB 4LLGM 1D3ZA 2ON8A 2BYFA 3DBHB 2E3TA 5DPSA 1L0VB 1YOVB 5IP4D 5AEKB 2ICIA 4FJZA 1ET6A 4ZRJA 5BMHA 1C76A 3R2IA 3VUXA 3R3MA 2AWTA 1DYQA 1WGKA 3VVWB 4USAA 1Y8RC 2C7NB 3LB8C 3R7RA 2M0XA 5JHAA 3PVLA 2VRRB 2L3ZA 2G9HD 2Y5BB 1I4PA 5JH5C 3MFGA 1T3QA 2PLPA 4MGKE 4MGZE 3MHSD 2V4IB 4IKGA 2AL3A 2KJHB 1C1YB 1KFYB 4W9IA 1I4RA 3BVGA 4K3BA 4BAXA 1N5XA 2I1JA 5E6NA 3RNGC 4HDOA 1UBQA 2D3CA 1L4DB 1V9JA 2MJ3A 3BK1A 2M56B 3BIID 4P16A 4NJ6A 2FUG1 2RMMA 3R8BA 2J42A 4XDCA 3V60A 1GNUA 5CHFA 2LJ5A 4RF0A 3UINB 2MEKA 3SFEB 2NBWB 3VUWA 3RZWC 1WGYA 3EUB2 3SU8X 2W3SA 4EUTA 4K7SA 2L8JA 4MT5A 2MBHA 4PS8A 3H6NA 3GZNB 4JWSC 4FLHA 4WIPA 2CKHB 4ZOHC 3URYA 1WE7A 2ZEQA 2WXHA 2N0SB 4ICUA 3KWVA 1ZGUB 3ZDTA 2GBKA 2KNBA 2D10A 3BYTB 1OFFA 1BUIC 3N32A 1YX6B 2IDYA 2INNE 2NPTA 4HXDA 1AN8A 1NENB 2LRWA 1UWXA 1JALA 3IAS1 1P1AA 3P63A 3VR9B 4H2AA 1F1HA 3D32A 1AARA 2IO2B 2VZKB 1E7PB 2XK5A 2IY1B 2Y3AA 4MELA 1JQ4A 4NZLB 4K1RB 3AULA 5D7GA 3NHEB 4JQWC 3MP9A 2LGYA 4BOZB 1E5WA 1VRAB 1L4ZB 1KM7A 4ZRKA 1WM3A 4ZDVA 1P0RA 2K8BA 4GDKB 1XQQA 4XYCA 2PMVA 4PK1A 1HXYD 1ET9A 3U30A 3AE5B 2G3QB 4GMVA 2KK8A 2JUOA 2WX0A 3O13A 1SBBB 5J2RA 3AXCA 1RLFA 1L0XB 1SB3C 2J52A 4MGYE 5C1ZA 4W9FA 3VQIA 3HIZA 4DXFA 1UGJA 2CJNA 2KWCA 1SIFA 4MGIE 1X1MA 3B2FA 3NZSA 1LM8B 4PS7A 2IJ0A 4W9HA 2MH7A 2N9PC 2J4XA 2KJRA 1NYQA 2BYTA 1SE9A 4GDLB 4P6VF 4W9KA 1UELA 2M0AA 5GXGB 3H9DA 3QK0A 4EFOA 1LFDA 1A70A 1HZ6A 2WDQB 5TSSA 1QOGA 2IYDB 2VZKD 3ZUNA 3W5UB 5C23A 4M8NA 3AE4B 3DCGA 4YL8A 1CK1A 2N7EA 1XEEA 4M8MA 4OHJA 1SGHA 5DCNA 2GB1A 1E7UA 3WAMA 1K8RB 1FM0D 1XF5L 2JXTA 1KJTA 1I7HA 2AQ2B 1XCQL 1WJNA 1DGJA 1UNSA 3HRDD 2LFIA 1GC6A 4FHJA 4GN1A 4IM0A 1K51A 3P1MA 1WRIA 4QAYA 3WANA 3DBRB 3KW5B 4C4VA 2OEDA 1IGCA 1A5RA 3NVYA 4WWNA 3ZJVA 5E6OA 2MJDA 3DBLB 4BBNF 1Z2MA 1ZP0B 3SFDB 1ZE3D 1P9DU 3QWZB 4REZA 1JW9D 3NVWA 2GRIA 1WR1A 3VRAB 3C19A 2PPHA 4MDKE 1PFDA 2DZJA 2LVPA 3DOWA 4WWMA 4DHZB 2MP2A 4RM9A 1YIWA 2JX5A 1OQYA 2WU5B 4ANVA 1TS5A 4URKA 4RFBA 1YJIA 2W55A 2I1KA 1VCBA 2PE9A 5C2TB 3DHHC 1VJKA 1AYFA 4IM2A 3RULA 2WXGA 1EU4A 1WX9A 3DVNV 2NTTA 2OJWA 4WWPA 4MM3B 3I9V1 2H89B 2HTHA 1ZDXA 1WGDA 3HVZA 4DXAB 2Y5PA 2LMCA 2NR2A 3ENEA 2BWES 1WMHA 2K25A 2AYOB 3P4RB 1DOIA 5HHDG 2EKIA 2MSED 2D3BA 1E7VA 2BTEA 3BINA 3PT2B 4FN2A 3AE8B 2K8HA 4WH4A 3AU5A 4ITKA 2DZKA 3W5VB 3TSSA 4EOYA 1QILA 4ACFA 2KWVB 2NBUA 2JF5A 1GOZA 1QLBB 1PUTA 3R2TA 3MHZA 4M02A 1QOAA 1IP9A 1TKGA 4G50A 2KQSA 3KLSX 3W1YA 2M1MA 1TKYA 3AE2B 3IG3A 4FBJB 1D5MC 2W9NA 5BYRA 1J7CA 3NS1A 1WY8A 2MBEA 1MPEA 2BT6A 3A1QA 4NQLB 1YQ3B 1JMLA 2ZW1A 1JRPA 2DHZA 1PGXA 1C79A 2DYMA 4TKNA 3ZIMA 4GSWA 1XCTL 1LGRA 3ALBA 3OAWA 3C0RB 1Q10A 2FAZA 2Y5CA 4HCPB 4S0RA 3RNFC 4HROA 1SSNA 2JZZA 3R7QA 3PHXB 1VZ8A 3A9JB 3VRBB 2MQJA 1ZKHA 2KTRA 4II2B 1FEHA 4S17A 3RCZA 2OOBB 4MH0E 3FILA 3KH0A 4OVUA 4A90A 5D3IB 1YNTE 2PIAA 1N60A 1WGHA 3ZTDA 2WXFA 4KKJA 2FE8A 4AJWA 4RGMA 2GMIC 1D5ZC 4HPMB 3B0AA 4Q2JA 2D3AA 5KHOA 3RZFA 2LI5A 3GB1A 5IA7A 1YMHE 1R4MI 1SJED 1WSPA 3UI3A 3B9JA 1IPGA 3ECIA 3QHTA 2WNMA 2IY0B 3DVGY 4A3OA 1V80A 3A9KA 1PDXA 2BGFA 1PQSA 1WR6E 4US8A 1WX8A 1UGMA 2N9KA 1ENFA 2PW9A 3L54A 3QX1A 2KAJA 3Q6BA 3TBLD 4HKZE 1N5WA 1EF5A 4RGNA 1TY0A 3NS8A 3V62A 2ZVOA 3H7SA 4JWUC 1YJJA 2KXJA 5G2NA 5G5GA 2QC8A 1WJ6A 1D4BA 3O65B 3P4PB 4KGSA 1B1ZA 4L23A 2EELA 3VH3B 2PKOA 5FKAC 3PRPB 3VAWA 1YJ1A 2NBVB 3ZVVA 4OW0A 2NVUI 4IW0A 3JYUA 4JE3B 4YT0B 4MJSA 1J7BA 3X23A 4HRSA 4XX5A 5HG2A 1BXTA 1AWDA 4OZCA 2RPQA 5AZFA 2JZ3B 2DBYA 2V9HA 1E8YA 3ZXRA 2DZMA 1MI0A 3KYDD 3ZKJC 4B95A 5G55A 3LJ3A 4K7WA 1MHHE 2AEHA 5AZGA 1HZ5A 4W9LA 1UUPA 2O2VB 2B3AA 1D5XC 1IUEA 3A4RA 3RYTA 2HTME 2GBMA 4K3CA 4P1CC 4WJPA 1ROEA 1M4VA 4KSKC 2LHDA 1AW7A 3IXSA 2V0GA 3V05A 3FAHA 2PEAA 3AE3B 3N30A 4GDKA 1KF6B 3PHWB 4ANWA 2WGSA 1Q5WB 1WXAA 3PLUA 4KX6B 4MEMA 4XWTA 3HK0A 4HJKA 2KMAA 2PE6B 3TEXA 3T9LA 2JWUA 2KQ7A 1MVKA 2MBBB 4LNIA 4A9AA 2KO3A 3P2BA 4OZAA 4MSQB 1T0YA 2FCNA 2M19A 4IC7B 4PYZA 2UU7A 1WYWB 1P3QU 4YWGG 3RN9C 1UZXB 1ESFA 2K5PA 2OJRA 2N4FA 3NOBA 1IBXA 4HJGE 3VDZA 4JL9A 1WH3A 2A5UA 2D11A 2IO1B 3M62B 2C7HA 3QC8B 4NJCA 4A6QA 1U4AA 2FUHB 2IBIB 2J0JA 1CZPA 4KKIA 3E9SA 1ZW7A 2FCMA 3DDCB 4F7ZA 1E6EB 2REXA 1QT9A 5J17A 2IO0B 5BMGA 4I6PA 1GJZA 2DWQA 2DYOA 2KQ4X 4I6LB 2J7QB 2KMMA 3AE9B 3TEYA 3CMMB 4AJYB 3WA0A 1J0GA 3SEBA 1RAXA 2XNAC 5IN7A 1C3TA 3N3KB 1WXSA 4B9KA 1T5XD 4L2YA 2KTFA 4X57B 4LJOB 4F1SA 2BB6A 2LWPA 5BYSA 2KZRA 1TS2A 5HKHA 3EA6A 4WAAA 2G1EA 4KDIC 3BWUD 2BYEA 1L6VA 3PREA 1N6ZA 2ACZB 1C4CA 2L52A 1XO3A 4LNOA 1V1PA 1E10A 5LNK1 3DPDA 4MSMB 2XEWA 1T0RC 3Q2AC 3TEWA 4WURA 1VLBA 2INDC 2LUMA 5L95C 4RNAA 4A55A 4HLEA 1I4XA 4IG7B 2N9XA 1FO4A 3Q3MC 3L4PA 4HEA1 3OWEB 1OEYA 3HM6X 3NG0A 5AUKA 4CYEA 5CHVC 2KJ6A 1K50A 4TSSA 1V2YA 1V97A 2WDTB 2Z59B 1R7SA 2MBOA 3EECA 5T8IA 4CO7A 2QIEB 2ZNVB 2LXAA 4ZRIA 4E3CA 2LZ6A 2N7JA 3CIRB 4I6NB 2ZW0A 1WIAA 2CHZA 3WAPA 2H88B 2KACA 3HVDA 4YTMB 2KFJA 1BMLC 2RPVA 2RDHA 1HEZE 2OHFA 2LGXA 3JSVB 1V86A 5MPOA 4HK2A 3WALA 3OG5A 1SF0A 2JYEA 3JW0X 3BY4B 4EE2A 1QZEA 5IAAC 4M01A 3S2AA 1FNVA 1FFVA 1R4NB 3T3OA 3HUIA 3DVGX 5D6JB 3I63C 1H8CA 4JX1C 4HPPA 5DPRA 1FCCC 4TQ1A 2ZZPB 3U2SC 1GPXA 3UQBA 3N20C
chains in the Genus database with same CATH topology
2BWES 1WMHA 4FJYA 2K25A 2AYOB 3T8MA 3H7PB 4BKSD 2R2OA 3L13A 3M63B 5GMVA 3W1SC 4K81A 1MG8A 4IWPA 2KD0A 4IWQA 2MSED 1G6JA 2RGFA 1E7VA 3BINA 3VUYA 4BBNC 3PT2B 4FN2A 2K8HA 3PRZA 3PZDA 3AU5A 4FULA 4AOFA 2DZKA 1E8XA 2LXCA 2G4SA 3QIJA 3SD5A 4ANXA 2BWFA 2Z0DB 4EOYA 2KFKB 1J19A 1WF9A 2KWVB 1XT9B 2JPHA 1WXVA 3PTFC 2NBUA 4DDGD 2JF5A 2GBRA 3VTVA 3A4SC 2LGDA 2KDEB 2LVQA 2UWQA 1V6EA 2N1WA 2CU1A 3ZNGC 1IP9A 3A9KB 3LDZE 2KKCA 3ZTCA 1L7YA 4G50A 2KQSA 3PGEA 3IFWB 2FIDA 3RT3B 3A9JA 3W1YA 2M1MA 4EZJA 3IG3A 3VH4B 1WGRA 4FBJB 1WRDB 3QQ8B 2W9NA 1YQBA 3APFA 3KYCD 3ZNHB 4DK5A 1WY8A 1V5TA 2MBEA 2ZCBA 4WJQA 4M0WB 2YVCA 3A1QA 1LQBA 4N9F4 4NQLB 1WJUA 2K1FA 2LRUA 4DHJB 5LXIB 2KLGA 1WZ3A 3AU4A 2ZPNA 1V49A 2R2QA 1E8ZA 2DHZA 3OJ3A 3CSFA 4GB9A 2DYMA 4BKGA 3EC8A 4TKNA 3ZIMA 4GSWA 1E8WA 4GIVA 2K6QA 3ALBA 3OAWA 3C0RB 4DBGA 3VTUA 3U8ZA 1TTNA 2KHWB 2AL6A 4KZ0A 2FAZA 3ZNID 4E74A 4HCPB 2KC1A 4GXBA 3JSVA 2JZZA 3R7QA 1I42A 4HVBA 3PHXB 2BKRB 2MX2A 2L0FA 3K9PB 1JRUA 5BO4B 4MJSB 5EDSA 3A9JB 1M94A 2V3SA 4DWFA 1EF1A 2MCNB 2M8SA 1ZKHA 2MQJA 2XBBC 3CF6E 3EHVA 4HDQA 5CX3A 4TUUA 2KC2A 2KTRA 2LUEA 2GBJA 2J0KA 4II2B 5E6PA 4EKUA 2L05A 2JY6A 2NS5A 2OOBB 2V4LA 4W9EA 3A1QB 4HWIB 4MH0E 3RCZA 1D3ZA 3KH0A 4OVUA 5LXHA 2BYFA 1WFYA 1I35A 2ASQA 4MM3A 5DPSA 3MJWA 1WGHA 3ZTDA 2MRPA 5AEKB 4AJWA 3DBHI 2K39A 2GMIC 1NI2A 4FJZA 2D2QA 2DZIA 3H7PA 4HPMB 4ZRJA 3B0AA 4FHKA 2D07B 4HCNB 1NBFC 1S3SG 4DDID 2K6DB 3VUXA 4NQKE 5KHOA 3X0WA 1V81A 3R3MA 2KX0A 2AWTA 3OJ4B 4G0NB 3M3JA 3RZFA 4G11A 3VVWB 2LI5A 5IA7A 4TQ0A 1OTRB 1Y8RC 2C7NB 3I3TB 1WZ0A 2IZVB 2NPTB 3IHPC 3L17A 4KV2A 1R4MI 3R7RA 2M0XA 2KFKA 5JHAA 2EMTA 4ANUA 3PVLA 2VRRB 1IPGA 2DENB 2L3ZA 3ECIA 2Y5BB 1XD3B 3QHTA 5JH5C 2FIFA 3MTNB 3R66C 3QAQA 1LXDA 4MGKE 2IY0B 3DVGY 4A3OA 3K9OB 1EO6A 1V80A 2RSUA 2ZVNA 3A9KA 3MHSD 4MGZE 4WQOB 2KDBA 2BGFA 1PQSA 1WR6E 3PPAA 2KWUB 2AL3A 2KJHB 1C1YB 3L16A 4W9IA 3B08A 4DHZE 1WX8A 1UGMA 2MLBA 1WX7A 2JWZA 3L54A 3QX1A 4DHJD 2I1JA 4KIKA 3TBLD 2KDFB 5E6NA 4CHKA 4NJ7A 4HDOA 1EF5A 1UBQA 3NS8A 3V62A 1V9JA 1L2NA 2ZVOA 3H7SA 3UIPB 2DX5B 3V6EB 2KXJA 5G2NA 1HE8A 3ZO5B 4NJ6A 3VFKA 1WJ6A 2DAFA 3O65B 3UF8A 4TV3A 3PSEB 2C7MB 3VH3B 4LCDE 4RM8A 3V60A 5D2MB 3TIXA 3KUCB 3PRPB 1GNUA 3VAWA 1BT0A 1YJ1A 2NBVB 3ZVVA 2L7RA 2NVUI 5CHFA 2LJ5A 2FNJB 3IBEA 2EKEC 3JYUA 3NY5A 3KUZA 3QA8A 2JXXA 4IW0A 4MJSA 3UINB 3X23A 1NDDA 2KANA 2D3GA 2NBWB 3RZWC 3VUWA 1WGYA 4XX5A 1KLVA 3ZRFA 2RPQA 5AZFA 2JZ3B 2JT4B 3SU8X 2KDIA 4EUTA 4K7SA 2L8JA 1E8YA 2MBHA 2GBNA 4PS8A 2DZMA 4KIKB 4F8CB 3KYDD 4ASWC 1KOTA 3H6NA 3ZKJC 1F9JA 4B95A 3HM3A 5G55A 3LJ3A 4FLHA 1FXTB 4K7WA 3WAOA 2AEHA 4WWOA 2CKHB 3GZNI 5AZGA 1WE7A 3TMPB 3ZDMC 4GU2A 2ZEQA 3JVZX 1OEYJ 2LVOA 2J0MA 4BVUC 4W9LA 2DYBA 2G4DB 2G45B 4ICUA 1ZGUB 3GOEA 2O2VB 2B3AA 1WXMA 3ZDTA 3ZNZB 3A4RA 3DVNU 3Q3FA 2N1VA 3VTWA 3RYTA 2GBKA 2GBMA 2KNBA 2D10A 4WJPA 4FJVB 4GOCA 4KSKC 3N32A 4JIOU 1YX6B 2NPTA 2JRHA 3M95A 3PRMB 4HXDA 2PEAA 3N30A 4GDKA 2LRWA 3APCA 1P1AA 1WM2A 3PHWB 2LD9A 4ANWA 2A4ZA 4IUMB 1Q5WB 1WXAA 5DPTA 3D32A 4AP4C 1AARA 4RMAA 2IO2B 3PLUA 4MEMA 2XK5A 3HK0A 2IY1B 4HJKA 4IM3A 5LLIA 2KMAA 4MELA 2YLMA 5AZHA 3UIOB 4K1RB 2PE6B 3DBSA 1TBEA 3T9LA 3AULA 5D7GA 3TL5A 3QCAA 4LDTB 3NHEB 2WX1A 4JQWC 3ZW3A 2KQ7A 2MBBB 3TJPA 2KVRA 2LGYA 3OLMD 4BFRA 4BOZB 2KO3A 2ZNVC 3P2BA 1UBIA 1E5WA 2MW5A 1T0YA 2M4NA 3PS6A 4MSQB 3W1SA 3Q3JA 2FCNA 1KM7A 4ZRKA 3L08A 4E71A 1WM3A 4ZDVA 4KZCA 1P0RA 2V1YA 4IC7B 4PYZA 2RR9A 1ISNA 1P3QU 1WYWB 2K8BA 1UZXB 4GDKB 3EFUA 4WJNA 1XQQA 2OJRA 1TZ1A 4GGQA 3U30A 2N4FA 2EMSA 3NOBA 2G3QB 4GMVA 3VDZA 2KK8A 4JLCA 2HD5B 3KVFB 4JL9A 2JUOA 2WX0A 2XK5B 3KUDB 3ML8A 1WH3A 2ZCCA 1J8CA 2A5UA 5J2RA 2D11A 2IO1B 3M62B 2C7HA 3QC8B 3AXCA 5D94A 1GUAB 4ICVA 1UD7A 4FA6A 2MA9B 2MBQA 1RLFA 1U4AA 2FUHB 2IBIB 3IVFA 4MGYE 3ML9A 3ONSA 5C1ZA 2J0JA 4P7IA 4PYUA 4W9FA 3VQIA 4AUQC 1V5OA 1ZW7A 4OVVA 2FCMA 2O6VA 3DDCB 4F7ZA 2FCQA 2N9EB 2REXA 5J17A 2IO0B 3HIZA 1UH6A 3DQVA 4IWOA 4W9GA 2BPSA 2KWCA 3L0WB 1SIFA 4I6PA 1GJZA 2DYOA 4MGIE 2WWZA 1H4RA 1X1MA 2BKFA 2CS4A 2J7QB 3NZSA 1YD8U 4I6LB 4XZ4A 1LM8B 2GOWA 3H1UA 4PS7A 2O2VA 4W9HA 2N9PC 3CMMB 2MP2B 2KJRA 4AJYB 4W9JA 2NCNA 4BKSA 2BYVE 3WA0A 1J0GA 1SE9A 2L00B 4GDLB 3QARA 4W9KA 1UELA 1RAXA 5TR5A 1C3TA 1RFAA 3N3KB 1WXSA 3A33B 1E90A 4B9KA 5J18A 1RRBA 3H9DA 3QK0A 3RUIB 4EFOA 1LFDA 2C9WB 1P98A 2KTFA 4PS3A 4X57B 4AWJA 4A3PA 2C5LC 1Q0WB 3HHMA 1WE6A 4LJOB 2KX3A 4K7UA 4F1SA 2IYDB 2LWPA 4KSLC 2O6VB 2QHOA 3ZUNA 5C23A 2KZRA 4M8NA 1TGZB 4WJOA 4BKTA 1EUVB 3DCGA 4YL8A 5HKHA 4WAAA 4KDIC 2N7EA 2BF8B 2BYEA 2HJ8A 4NPNA 4M8MA 3PREA 4LDTD 4HPLB 2C60A 1SGHA 5DCNA 2Z0EB 1E7UA 3WAMA 2JRIB 4FADA 1K8RB 1WMHB 3DPDA 3B1LX 4EEWA 1KJTA 4MSMB 3ZLZA 1GG3A 2HE7A 2XEWA 1WJNA 2ZPYA 2M17A 3U7DA 4EZKA 2RD0A 2KMCA 5L95C 3AI5A 3PLVA 1S1QB 1GC6A 4FHJA 4GN1A 4IM0A 4W9DA 4HLEA 5DPWA 4IG7B 5KHQA 2N9XA 3CSTA 1OEYA 3HM6X 3WANA 3KW5B 3L10B 2N7DA 4CYEA 1VD2A 3V61A 1A5RA 4WWNA 3DBRI 1OGWA 2MWSB 4J6IA 4W9CA 5CHVC 2KJ6A 3NZUA 3ZRCA 2L0TA 1WI0A 4NY0A 5E6OA 4NAWA 1V2YA 4BBNF 2WDTB 2Z59B 1IYFA 1Z2MA 3DBLI 4KDLB 1GC7A 2FCSA 2MBOA 3APDA 3EECA 1Z5SB 2KLCA 1P9DU 4CO7A 3QWZB 3UQAA 2ZNVB 2LXAA 4ZRIA 4E3CA 3VHTC 4KVGB 2LZ6A 4I6NB 3SDLC 1WIAA 1WR1A 1YX5B 2CHZA 2PPHA 3WAPA 4MDKE 2PJHA 2L76A 2DZJA 2LVPA 4II3B 3DOWA 3V6CB 4BOSC 4DHZB 2KFJA 5JZEB 2MP2A 4RM9A 1YIWA 5JHBA 1OQYA 2K8CA 2CHWA 4ANVA 4URKA 2CR5A 4GDLA 2LGXA 2DAJA 2LASA 4NNJB 2I1KA 3JSVB 3VXWA 1VCBA 2PE9A 2IO3B 3UGBB 1V86A 5FR6A 4A20A 4LJPB 4G3XB 4HK2A 2UYZB 3WALA 5CHWA 4NAWB 4IM2A 3RD2A 4JGHB 3JW0X 3BY4B 1Q1OA 2KOXA 2CHXA 2KN5A 3RULA 5CTRC 2O6VD 4ZYNA 1QZEA 5IAAC 3ENEA 3S2AA 4EZLA 2KTRB 1WJ4A 1WX9A 3DVNV 3DVGX 3WIMA 5D6JB 4WWPA 3PV1A 1H8CA 5DPRA 2ZJDA 1R4NI 3SHQA 3TCAA 4TQ1A 2ZZPB 3QJZA 5L83A 3UQBA 2HTHA 4B6WA 2WYQA 2JVCA 1WGDA 1WGGA 4DXAB 4XC2A 2NR2A 1CMXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BWE S;  1WMH A;  4FJY A;  2K25 A;  2AYO B;  3T8M A;  3H7P B;  4BKS D;  2R2O A;  3L13 A;  3M63 B;  5GMV A;  3W1S C;  4K81 A;  1MG8 A;  4IWP A;  2KD0 A;  4IWQ A;  2MSE D;  1G6J A;  2RGF A;  1E7V A;  3BIN A;  3VUY A;  4BBN C;  3PT2 B;  4FN2 A;  2K8H A;  3PRZ A;  3PZD A;  3AU5 A;  4FUL A;  4AOF A;  2DZK A;  1E8X A;  2LXC A;  2G4S A;  3QIJ A;  3SD5 A;  4ANX A;  2BWF A;  2Z0D B;  4EOY A;  2KFK B;  1J19 A;  1WF9 A;  2KWV B;  1XT9 B;  2JPH A;  1WXV A;  3PTF C;  2NBU A;  4DDG D;  2JF5 A;  2GBR A;  3VTV A;  3A4S C;  2LGD A;  2KDE B;  2LVQ A;  2UWQ A;  1V6E A;  2N1W A;  2CU1 A;  3ZNG C;  1IP9 A;  3A9K B;  3LDZ E;  2KKC A;  3ZTC A;  1L7Y A;  4G50 A;  2KQS A;  3PGE A;  3IFW B;  2FID A;  3RT3 B;  3A9J A;  3W1Y A;  2M1M A;  4EZJ A;  3IG3 A;  3VH4 B;  1WGR A;  4FBJ B;  1WRD B;  3QQ8 B;  2W9N A;  1YQB A;  3APF A;  3KYC D;  3ZNH B;  4DK5 A;  1WY8 A;  1V5T A;  2MBE A;  2ZCB A;  4WJQ A;  4M0W B;  2YVC A;  3A1Q A;  1LQB A;  4N9F 4;  4NQL B;  1WJU A;  2K1F A;  2LRU A;  4DHJ B;  5LXI B;  2KLG A;  1WZ3 A;  3AU4 A;  2ZPN A;  1V49 A;  2R2Q A;  1E8Z A;  2DHZ A;  3OJ3 A;  3CSF A;  4GB9 A;  2DYM A;  4BKG A;  3EC8 A;  4TKN A;  3ZIM A;  4GSW A;  1E8W A;  4GIV A;  2K6Q A;  3ALB A;  3OAW A;  3C0R B;  4DBG A;  3VTU A;  3U8Z A;  1TTN A;  2KHW B;  2AL6 A;  4KZ0 A;  2FAZ A;  3ZNI D;  4E74 A;  4HCP B;  2KC1 A;  4GXB A;  3JSV A;  2JZZ A;  3R7Q A;  1I42 A;  4HVB A;  3PHX B;  2BKR B;  2MX2 A;  2L0F A;  3K9P B;  1JRU A;  5BO4 B;  4MJS B;  5EDS A;  3A9J B;  1M94 A;  2V3S A;  4DWF A;  1EF1 A;  2MCN B;  2M8S A;  1ZKH A;  2MQJ A;  2XBB C;  3CF6 E;  3EHV A;  4HDQ A;  5CX3 A;  4TUU A;  2KC2 A;  2KTR A;  2LUE A;  2GBJ A;  2J0K A;  4II2 B;  5E6P A;  4EKU A;  2L05 A;  2JY6 A;  2NS5 A;  2OOB B;  2V4L A;  4W9E A;  3A1Q B;  4HWI B;  4MH0 E;  3RCZ A;  1D3Z A;  3KH0 A;  4OVU A;  5LXH A;  2BYF A;  1WFY A;  1I35 A;  2ASQ A;  4MM3 A;  5DPS A;  3MJW A;  1WGH A;  3ZTD A;  2MRP A;  5AEK B;  4AJW A;  3DBH I;  2K39 A;  2GMI C;  1NI2 A;  4FJZ A;  2D2Q A;  2DZI A;  3H7P A;  4HPM B;  4ZRJ A;  3B0A A;  4FHK A;  2D07 B;  4HCN B;  1NBF C;  1S3S G;  4DDI D;  2K6D B;  3VUX A;  4NQK E;  5KHO A;  3X0W A;  1V81 A;  3R3M A;  2KX0 A;  2AWT A;  3OJ4 B;  4G0N B;  3M3J A;  3RZF A;  4G11 A;  3VVW B;  2LI5 A;  5IA7 A;  4TQ0 A;  1OTR B;  1Y8R C;  2C7N B;  3I3T B;  1WZ0 A;  2IZV B;  2NPT B;  3IHP C;  3L17 A;  4KV2 A;  1R4M I;  3R7R A;  2M0X A;  2KFK A;  5JHA A;  2EMT A;  4ANU A;  3PVL A;  2VRR B;  1IPG A;  2DEN B;  2L3Z A;  3ECI A;  2Y5B B;  1XD3 B;  3QHT A;  5JH5 C;  2FIF A;  3MTN B;  3R66 C;  3QAQ A;  1LXD A;  4MGK E;  2IY0 B;  3DVG Y;  4A3O A;  3K9O B;  1EO6 A;  1V80 A;  2RSU A;  2ZVN A;  3A9K A;  3MHS D;  4MGZ E;  4WQO B;  2KDB A;  2BGF A;  1PQS A;  1WR6 E;  3PPA A;  2KWU B;  2AL3 A;  2KJH B;  1C1Y B;  3L16 A;  4W9I A;  3B08 A;  4DHZ E;  1WX8 A;  1UGM A;  2MLB A;  1WX7 A;  2JWZ A;  3L54 A;  3QX1 A;  4DHJ D;  2I1J A;  4KIK A;  3TBL D;  2KDF B;  5E6N A;  4CHK A;  4NJ7 A;  4HDO A;  1EF5 A;  1UBQ A;  3NS8 A;  3V62 A;  1V9J A;  1L2N A;  2ZVO A;  3H7S A;  3UIP B;  2DX5 B;  3V6E B;  2KXJ A;  5G2N A;  1HE8 A;  3ZO5 B;  4NJ6 A;  3VFK A;  1WJ6 A;  2DAF A;  3O65 B;  3UF8 A;  4TV3 A;  3PSE B;  2C7M B;  3VH3 B;  4LCD E;  4RM8 A;  3V60 A;  5D2M B;  3TIX A;  3KUC B;  3PRP B;  1GNU A;  3VAW A;  1BT0 A;  1YJ1 A;  2NBV B;  3ZVV A;  2L7R A;  2NVU I;  5CHF A;  2LJ5 A;  2FNJ B;  3IBE A;  2EKE C;  3JYU A;  3NY5 A;  3KUZ A;  3QA8 A;  2JXX A;  4IW0 A;  4MJS A;  3UIN B;  3X23 A;  1NDD A;  2KAN A;  2D3G A;  2NBW B;  3RZW C;  3VUW A;  1WGY A;  4XX5 A;  1KLV A;  3ZRF A;  2RPQ A;  5AZF A;  2JZ3 B;  2JT4 B;  3SU8 X;  2KDI A;  4EUT A;  4K7S A;  2L8J A;  1E8Y A;  2MBH A;  2GBN A;  4PS8 A;  2DZM A;  4KIK B;  4F8C B;  3KYD D;  4ASW C;  1KOT A;  3H6N A;  3ZKJ C;  1F9J A;  4B95 A;  3HM3 A;  5G55 A;  3LJ3 A;  4FLH A;  1FXT B;  4K7W A;  3WAO A;  2AEH A;  4WWO A;  2CKH B;  3GZN I;  5AZG A;  1WE7 A;  3TMP B;  3ZDM C;  4GU2 A;  2ZEQ A;  3JVZ X;  1OEY J;  2LVO A;  2J0M A;  4BVU C;  4W9L A;  2DYB A;  2G4D B;  2G45 B;  4ICU A;  1ZGU B;  3GOE A;  2O2V B;  2B3A A;  1WXM A;  3ZDT A;  3ZNZ B;  3A4R A;  3DVN U;  3Q3F A;  2N1V A;  3VTW A;  3RYT A;  2GBK A;  2GBM A;  2KNB A;  2D10 A;  4WJP A;  4FJV B;  4GOC A;  4KSK C;  3N32 A;  4JIO U;  1YX6 B;  2NPT A;  2JRH A;  3M95 A;  3PRM B;  4HXD A;  2PEA A;  3N30 A;  4GDK A;  2LRW A;  3APC A;  1P1A A;  1WM2 A;  3PHW B;  2LD9 A;  4ANW A;  2A4Z A;  4IUM B;  1Q5W B;  1WXA A;  5DPT A;  3D32 A;  4AP4 C;  1AAR A;  4RMA A;  2IO2 B;  3PLU A;  4MEM A;  2XK5 A;  3HK0 A;  2IY1 B;  4HJK A;  4IM3 A;  5LLI A;  2KMA A;  4MEL A;  2YLM A;  5AZH A;  3UIO B;  4K1R B;  2PE6 B;  3DBS A;  1TBE A;  3T9L A;  3AUL A;  5D7G A;  3TL5 A;  3QCA A;  4LDT B;  3NHE B;  2WX1 A;  4JQW C;  3ZW3 A;  2KQ7 A;  2MBB B;  3TJP A;  2KVR A;  2LGY A;  3OLM D;  4BFR A;  4BOZ B;  2KO3 A;  2ZNV C;  3P2B A;  1UBI A;  1E5W A;  2MW5 A;  1T0Y A;  2M4N A;  3PS6 A;  4MSQ B;  3W1S A;  3Q3J A;  2FCN A;  1KM7 A;  4ZRK A;  3L08 A;  4E71 A;  1WM3 A;  4ZDV A;  4KZC A;  1P0R A;  2V1Y A;  4IC7 B;  4PYZ A;  2RR9 A;  1ISN A;  1P3Q U;  1WYW B;  2K8B A;  1UZX B;  4GDK B;  3EFU A;  4WJN A;  1XQQ A;  2OJR A;  1TZ1 A;  4GGQ A;  3U30 A;  2N4F A;  2EMS A;  3NOB A;  2G3Q B;  4GMV A;  3VDZ A;  2KK8 A;  4JLC A;  2HD5 B;  3KVF B;  4JL9 A;  2JUO A;  2WX0 A;  2XK5 B;  3KUD B;  3ML8 A;  1WH3 A;  2ZCC A;  1J8C A;  2A5U A;  5J2R A;  2D11 A;  2IO1 B;  3M62 B;  2C7H A;  3QC8 B;  3AXC A;  5D94 A;  1GUA B;  4ICV A;  1UD7 A;  4FA6 A;  2MA9 B;  2MBQ A;  1RLF A;  1U4A A;  2FUH B;  2IBI B;  3IVF A;  4MGY E;  3ML9 A;  3ONS A;  5C1Z A;  2J0J A;  4P7I A;  4PYU A;  4W9F A;  3VQI A;  4AUQ C;  1V5O A;  1ZW7 A;  4OVV A;  2FCM A;  2O6V A;  3DDC B;  4F7Z A;  2FCQ A;  2N9E B;  2REX A;  5J17 A;  2IO0 B;  3HIZ A;  1UH6 A;  3DQV A;  4IWO A;  4W9G A;  2BPS A;  2KWC A;  3L0W B;  1SIF A;  4I6P A;  1GJZ A;  2DYO A;  4MGI E;  2WWZ A;  1H4R A;  1X1M A;  2BKF A;  2CS4 A;  2J7Q B;  3NZS A;  1YD8 U;  4I6L B;  4XZ4 A;  1LM8 B;  2GOW A;  3H1U A;  4PS7 A;  2O2V A;  4W9H A;  2N9P C;  3CMM B;  2MP2 B;  2KJR A;  4AJY B;  4W9J A;  2NCN A;  4BKS A;  2BYV E;  3WA0 A;  1J0G A;  1SE9 A;  2L00 B;  4GDL B;  3QAR A;  4W9K A;  1UEL A;  1RAX A;  5TR5 A;  1C3T A;  1RFA A;  3N3K B;  1WXS A;  3A33 B;  1E90 A;  4B9K A;  5J18 A;  1RRB A;  3H9D A;  3QK0 A;  3RUI B;  4EFO A;  1LFD A;  2C9W B;  1P98 A;  2KTF A;  4PS3 A;  4X57 B;  4AWJ A;  4A3P A;  2C5L C;  1Q0W B;  3HHM A;  1WE6 A;  4LJO B;  2KX3 A;  4K7U A;  4F1S A;  2IYD B;  2LWP A;  4KSL C;  2O6V B;  2QHO A;  3ZUN A;  5C23 A;  2KZR A;  4M8N A;  1TGZ B;  4WJO A;  4BKT A;  1EUV B;  3DCG A;  4YL8 A;  5HKH A;  4WAA A;  4KDI C;  2N7E A;  2BF8 B;  2BYE A;  2HJ8 A;  4NPN A;  4M8M A;  3PRE A;  4LDT D;  4HPL B;  2C60 A;  1SGH A;  5DCN A;  2Z0E B;  1E7U A;  3WAM A;  2JRI B;  4FAD A;  1K8R B;  1WMH B;  3DPD A;  3B1L X;  4EEW A;  1KJT A;  4MSM B;  3ZLZ A;  1GG3 A;  2HE7 A;  2XEW A;  1WJN A;  2ZPY A;  2M17 A;  3U7D A;  4EZK A;  2RD0 A;  2KMC A;  5L95 C;  3AI5 A;  3PLV A;  1S1Q B;  1GC6 A;  4FHJ A;  4GN1 A;  4IM0 A;  4W9D A;  4HLE A;  5DPW A;  4IG7 B;  5KHQ A;  2N9X A;  3CST A;  1OEY A;  3HM6 X;  3WAN A;  3KW5 B;  3L10 B;  2N7D A;  4CYE A;  1VD2 A;  3V61 A;  1A5R A;  4WWN A;  3DBR I;  1OGW A;  2MWS B;  4J6I A;  4W9C A;  5CHV C;  2KJ6 A;  3NZU A;  3ZRC A;  2L0T A;  1WI0 A;  4NY0 A;  5E6O A;  4NAW A;  1V2Y A;  4BBN F;  2WDT B;  2Z59 B;  1IYF A;  1Z2M A;  3DBL I;  4KDL B;  1GC7 A;  2FCS A;  2MBO A;  3APD A;  3EEC A;  1Z5S B;  2KLC A;  1P9D U;  4CO7 A;  3QWZ B;  3UQA A;  2ZNV B;  2LXA A;  4ZRI A;  4E3C A;  3VHT C;  4KVG B;  2LZ6 A;  4I6N B;  3SDL C;  1WIA A;  1WR1 A;  1YX5 B;  2CHZ A;  2PPH A;  3WAP A;  4MDK E;  2PJH A;  2L76 A;  2DZJ A;  2LVP A;  4II3 B;  3DOW A;  3V6C B;  4BOS C;  4DHZ B;  2KFJ A;  5JZE B;  2MP2 A;  4RM9 A;  1YIW A;  5JHB A;  1OQY A;  2K8C A;  2CHW A;  4ANV A;  4URK A;  2CR5 A;  4GDL A;  2LGX A;  2DAJ A;  2LAS A;  4NNJ B;  2I1K A;  3JSV B;  3VXW A;  1VCB A;  2PE9 A;  2IO3 B;  3UGB B;  1V86 A;  5FR6 A;  4A20 A;  4LJP B;  4G3X B;  4HK2 A;  2UYZ B;  3WAL A;  5CHW A;  4NAW B;  4IM2 A;  3RD2 A;  4JGH B;  3JW0 X;  3BY4 B;  1Q1O A;  2KOX A;  2CHX A;  2KN5 A;  3RUL A;  5CTR C;  2O6V D;  4ZYN A;  1QZE A;  5IAA C;  3ENE A;  3S2A A;  4EZL A;  2KTR B;  1WJ4 A;  1WX9 A;  3DVN V;  3DVG X;  3WIM A;  5D6J B;  4WWP A;  3PV1 A;  1H8C A;  5DPR A;  2ZJD A;  1R4N I;  3SHQ A;  3TCA A;  4TQ1 A;  2ZZP B;  3QJZ A;  5L83 A;  3UQB A;  2HTH A;  4B6W A;  2WYQ A;  2JVC A;  1WGD A;  1WGG A;  4DXA B;  4XC2 A;  2NR2 A;  1CMX B; 
#chains in the Genus database with same CATH topology
 4BKS D;  3M63 B;  3J9C A;  4K81 A;  1MG8 A;  4YSX B;  4LNF A;  4BBN C;  1I4G A;  4AOF A;  2WU2 B;  3DHI C;  2JPH A;  2PTL A;  1WXV A;  2W54 A;  2GBR A;  3P42 A;  3A4S C;  2KDE B;  2CU1 A;  1VZ6 A;  1NYR A;  3LDZ E;  2KKC A;  1RYJ A;  1SIJ A;  2HJ1 A;  3ZTC A;  3PGE A;  3IFW B;  2FID A;  1XXG A;  5IOI A;  3A9J A;  3RT3 B;  1WGR A;  4B0E A;  1C4P A;  3APF A;  1V5T A;  4WJQ A;  4N9F 4;  1LQB A;  2KLG A;  1QF6 A;  3AU4 A;  2R2Q A;  1E8Z A;  2Z8L A;  1GB1 A;  3OJ3 A;  4GB9 A;  3EC8 A;  1E8W A;  4DBG A;  1TZO A;  1ZPS A;  3U8Z A;  1V1O A;  5H8Y E;  3RPF C;  2J53 A;  2KT7 A;  3N9Y C;  4HVB A;  2BKR B;  2MX2 A;  5EDS A;  4DWF A;  3EHV A;  2XBB C;  2B76 B;  2KC2 A;  2LUE A;  2J0K A;  2K9X A;  2L05 A;  2NS5 A;  3BK2 A;  4W9E A;  4HWI B;  3DWG C;  3ETR A;  1FNW A;  1NI3 A;  5LXH A;  1WFY A;  3MJW A;  2X8X X;  3P4Q B;  1FNU A;  3DBH I;  2K39 A;  5EE9 A;  2WP9 B;  3H7P A;  2D07 B;  4HCN B;  1NBF C;  4DDI D;  2K6D B;  2KX0 A;  4G0N B;  2RDB C;  4TQ0 A;  3I3T B;  1WZ0 A;  1JWU D;  2IZV B;  2NPT B;  3IHP C;  3L17 A;  2AQ3 B;  2KFK A;  2EMT A;  2DEN B;  1YQ4 B;  1XD3 B;  3MTN B;  3ABV B;  3QAQ A;  3PO0 A;  1LXD A;  4C7Z A;  2ZVN A;  1N63 A;  2W3R A;  3PPA A;  3L16 A;  3B08 A;  2MLB A;  1WX7 A;  3GP7 A;  4XDD A;  4M0W A;  2YEP B;  2KDF B;  2WQY B;  4OVZ A;  4NJ7 A;  2WXM A;  1NVI D;  1N61 A;  1CJE A;  4N6E B;  1L2N A;  5AUI A;  2INP E;  3UIP B;  2DX5 B;  4ZRQ A;  3ZO5 B;  2DAF A;  3UF8 A;  3PSE B;  1FCL A;  2C7M B;  5JXV A;  2K22 A;  1BT0 A;  3ZXV A;  2FNJ B;  2EKE C;  1VR9 A;  2JXX A;  3QA8 A;  2JQR B;  1NDD A;  2KAN A;  4MAC A;  4BZA A;  1JWA D;  1KLV A;  3ZRF A;  2JT4 B;  2KDI A;  1MHX A;  2V3P A;  2GBN A;  4KIK B;  2QMT A;  2WXI A;  4ASW C;  1KOT A;  1MJD A;  3HM3 A;  1FXT B;  4LK0 M;  3GZN I;  1SE4 A;  3TMP B;  3MC0 B;  3JVZ X;  2LVO A;  2J0M A;  4BVU C;  2WDV B;  3T3N A;  2DYB A;  2G4D B;  3ZNZ B;  3Q3F A;  3DVN U;  3KWL A;  2GI9 A;  3H8H A;  2BBC A;  3GE3 C;  4JIO U;  2WXN A;  2JRH A;  3M95 A;  3PRM B;  2N9L A;  3Q8A A;  3PZ8 A;  3APC A;  2K0P A;  2WXJ A;  1FRR A;  2LD9 A;  3AMZ A;  4IUM B;  2CJO A;  3GS2 A;  4AP4 C;  4RMA A;  5LLI A;  2YLM A;  3SR6 A;  4ZHO A;  3DBS A;  3QCA A;  4RH6 A;  3ZW3 A;  2KVR A;  1XLQ A;  2MW5 A;  2JU6 X;  2M4N A;  3L08 A;  3NZ3 A;  4E71 A;  4KGT A;  3EFU A;  3Q8C A;  1C78 A;  4WJN A;  1TZ1 A;  4GGQ A;  4WAF A;  2EMS A;  2XN9 C;  1RFK A;  4JLC A;  2HD5 B;  4DQO C;  4C4V B;  3KUD B;  3EGR A;  2ZCC A;  4MH8 A;  1JWB D;  1GUA B;  4ICV A;  1UD7 A;  4FA6 A;  2D5G A;  2MBQ A;  4RCO A;  3IVF A;  3ML9 A;  3ONS A;  2W82 A;  3NVZ A;  4PYU A;  3AE7 B;  4YSZ B;  4OVV A;  4ARI A;  2FCQ A;  4IWO A;  1ZDV A;  1UWM A;  4IOI E;  2BPS A;  1SXT A;  3NRZ A;  3NUH B;  4XGA B;  1H4R A;  3PZ7 A;  1YD8 U;  3WCQ A;  3H1U A;  2GOW A;  5BYQ A;  2MP2 B;  1C77 A;  2ONQ A;  2WXQ A;  3I57 A;  4W9J A;  2NCN A;  4BKS A;  1JWS D;  1TS3 A;  5TR5 A;  3AEE B;  2MHJ A;  3C8Y A;  5J18 A;  2JZP A;  3N1Z C;  2BB5 A;  1RRB A;  3RUI B;  1Y56 A;  2C9W B;  2C5L C;  2I2Y A;  1Q0W B;  3HHM A;  1WE6 A;  4K7U A;  2HDE A;  4KSL C;  4YTP B;  1FXI A;  2O6V B;  2QHO A;  1FRD A;  1TGZ B;  4WJO A;  1KRH A;  3RMK C;  2VH1 A;  1WXQ A;  4HPL B;  2C60 A;  3E56 A;  1PYW D;  1WMH B;  3B2G A;  3B1L X;  4EEW A;  1TKE A;  3ZLZ A;  1GG3 A;  3AM9 A;  2KYW A;  3VR8 B;  5G5H A;  3RNA C;  2M17 A;  3LYY A;  4KGR A;  1ZXI A;  3AI5 A;  2Q5W D;  5KHQ A;  3CST A;  1YN3 A;  3TEZ A;  3L10 B;  4DXG A;  1FXA A;  1K52 A;  2GLS A;  1VD2 A;  3V61 A;  3NVV A;  2YEP F;  3DBR I;  1L0Y B;  3ZJT A;  2MWS B;  4W9C A;  4J6I A;  1D6E C;  1IYF A;  3DBL I;  4KDL B;  1GC7 A;  4HKQ A;  3APD A;  5EE1 A;  2IGG A;  2KLC A;  2KN4 A;  4KVG B;  4PT5 A;  1KLG D;  1YX5 B;  2R61 A;  2PJH A;  2L76 A;  4II3 B;  3RI7 C;  3ZYY X;  5JHB A;  2CU3 A;  4GDL A;  2DAJ A;  1TT5 B;  4NNJ B;  2IO3 B;  4N58 A;  1VDV A;  1QOB A;  5FR6 A;  4A20 A;  4LJP B;  4G3X B;  2UYZ B;  3KQ4 A;  5CHW A;  4NAW B;  5HI1 A;  3RD2 A;  4JGH B;  2NTS A;  2KOX A;  2CHX A;  5CTR C;  2O6V D;  4EZL A;  4AQ7 A;  2KTR B;  4D2K A;  3WIM A;  3FIL B;  2L83 A;  4GLS C;  5E6J A;  3SHQ A;  1KTK A;  3TCA A;  4LNN A;  4B6W A;  2WYQ A;  4RGO S;  1FPY A;  2E6X A;  4XC2 A;  4N59 A;  3L13 A;  5GMV A;  3W1S C;  4IWP A;  2KD0 A;  4IWQ A;  3AB5 A;  2LGS A;  3VUY A;  3MC9 A;  2WHI A;  3PRZ A;  3SD5 A;  1F52 A;  2BWF A;  1J19 A;  1XT9 B;  3PTF C;  3VTV A;  3Q8F A;  4FXC A;  2LVQ A;  3AEG B;  2KVZ A;  2N1W A;  3ZNG C;  3A9K B;  4O1N A;  4R3D A;  3VH4 B;  3QQ8 B;  5EE0 A;  1MFW A;  1YQB A;  4C7Y A;  4US9 A;  2ZCB A;  1HTQ A;  2YVC A;  1KH0 A;  1WJU A;  5LXI B;  4DHJ B;  1B9R A;  2ZPN A;  1V49 A;  3CSF A;  4OZB A;  2QEJ C;  3DHG C;  1F77 A;  3ZJU A;  2K6Q A;  3I5J C;  3GE8 C;  1XLP A;  4XWW A;  2BS2 B;  1TTN A;  2KHW B;  2MJE A;  4E74 A;  1C4A A;  1I42 A;  2PVO D;  2L0F A;  3W9C B;  5BO4 B;  4MJS B;  1I4Q A;  3AED B;  4TMA B;  1EF1 A;  2MCN B;  2M8S A;  3CF6 E;  4HDQ A;  2JSV X;  4M00 A;  2QIL A;  5E6P A;  3RFZ B;  2JY6 A;  1TJE A;  1I35 A;  2ASQ A;  3Q69 A;  4MM3 A;  2MRP A;  2L1A A;  1EWC A;  3U7Z A;  1NI2 A;  2D2Q A;  2DZI A;  1EM7 A;  4FHK A;  1S3S G;  5IKC M;  4NQK E;  2V3N A;  3X0W A;  1V81 A;  3OJ4 B;  3M3J A;  2BQQ A;  4G11 A;  1R4M B;  3AV8 A;  3AN1 A;  1OTR B;  3IT4 B;  2QCZ A;  4KV2 A;  5FK9 C;  4ANU A;  3MC8 A;  3AEA B;  1T0S C;  2FIF A;  3R66 C;  1FFU A;  3K9O B;  1EO6 A;  2RSU A;  4WQO B;  4RGT A;  2KDB A;  3AH7 A;  2KWU B;  4DHZ E;  3ZQ4 A;  4XE0 A;  4ZRP A;  2JWZ A;  5HFY A;  4DHJ D;  4KIK A;  1F2R C;  4RF1 A;  4CHK A;  3Q8E A;  3ZGZ A;  5C3J B;  3V6E B;  1MG4 A;  1HE8 A;  5IO9 A;  4NAM A;  3VFK A;  3Q8B A;  2KWD A;  3N1X C;  3U4E G;  1IBX B;  4TV3 A;  1QOF A;  4ARC A;  4LCD E;  4RM8 A;  5D2M B;  3TIX A;  3KUC B;  1JCK B;  2L7R A;  2WXR A;  1VZ7 A;  3IBE A;  4YSY B;  3NY5 A;  3KUZ A;  1L5P A;  5FR3 A;  2D3G A;  1YN5 A;  2LGI A;  2DLB A;  1SE2 A;  4F8C B;  1F9J A;  2TSS A;  2BS3 B;  1QQR A;  3WAO A;  1C9F A;  3IT6 B;  4WWO A;  1GAQ B;  1N62 A;  3ZDM C;  4GU2 A;  1OEY J;  3AEF B;  2G45 B;  3GOE A;  1WXM A;  2N1V A;  3VTW A;  1YN4 A;  4FJV B;  4GOC A;  2IPK D;  1WYG A;  4JPS A;  1WM2 A;  2A4Z A;  2NMQ A;  5DPT A;  2AX5 A;  1ACC A;  3NJT A;  2FBW B;  3IAM 1;  4YXD B;  4IM3 A;  5AZH A;  3UIO B;  1TS4 A;  1TBE A;  2QSD A;  3TL5 A;  1T0Q C;  4LDT B;  2LJI A;  2WX1 A;  1V1P B;  3TJP A;  2LHE A;  3OLM D;  4BFR A;  2ZNV C;  1FMA D;  1UBI A;  3PS6 A;  3W1S A;  3Q3J A;  5BMI A;  3EFC A;  1ZOY B;  4KZC A;  3LXF A;  1EU3 A;  1HTO A;  1HA5 A;  2V1Y A;  1P7E A;  2RR9 A;  1ISN A;  3RNB C;  4ZYS A;  4J3O D;  3P4S B;  3U52 E;  3V3X A;  1PGB A;  2BW2 A;  1UF0 A;  3KVF B;  3RNE C;  2XK5 B;  2WXP A;  3ML8 A;  1J8C A;  2WS3 B;  5D94 A;  4UDU C;  2MA9 B;  3Q14 C;  4P7I A;  1J7A A;  4AUQ C;  1V5O A;  1TYG B;  2O6V A;  2N9E B;  2PVG C;  1UH6 A;  3DQV A;  4W9G A;  3L0W B;  3AE1 B;  3W2D A;  2WWZ A;  1F2R I;  2BKF A;  2CS4 A;  4XZ4 A;  2O2V A;  1RM6 C;  2JYT A;  3BVZ A;  1CQV A;  1LO5 D;  2BYV E;  2L00 B;  2LEK A;  3QAR A;  1P7F A;  1RFA A;  3A33 B;  1E90 A;  1L6U A;  2QJL A;  3AE6 B;  1JWM D;  3CWI A;  3RNC C;  3Q3O C;  1P98 A;  4PS3 A;  4AWJ A;  4A3P A;  1F0Z A;  2KX3 A;  1ZUD 2;  4BKT A;  3BVM A;  1EUV B;  1WWT A;  4NPN A;  2BF8 B;  2HJ8 A;  4LDT D;  1OQR A;  2DNF A;  2WXL A;  2Z0E B;  2JRI B;  4FAD A;  4WQM A;  3FKY A;  2HE7 A;  1STE A;  2ZPY A;  1SE3 A;  3U7D A;  4EZK A;  2RD0 A;  2KMC A;  1SEB D;  4P1B C;  2INC C;  3PLV A;  1S1Q B;  4W9D A;  5DPW A;  1TIF A;  3N1Y C;  1FIQ A;  1K53 A;  1DOX A;  2N7D A;  2QDF A;  4B0M A;  4C56 C;  4YTN B;  1OGW A;  3ZRC A;  3NZU A;  4ZHP A;  2L0T A;  1WI0 A;  4NY0 A;  1JRO A;  3BZD B;  4NAW A;  3TUO A;  2FCS A;  1FD6 A;  1Z5S B;  3UQA A;  3VHT C;  3BYY B;  3SDL C;  1E0Z A;  2RDG A;  3V6C B;  2L32 A;  1TY2 A;  4BOS C;  5JZE B;  1E9M A;  3Q3N C;  2K8C A;  2CHW A;  2WXO A;  2CR5 A;  2LAS A;  4AS1 A;  2IGD A;  3VXW A;  3DWM A;  3UGB B;  4A8X C;  4IDI A;  1HQR D;  1Q1O A;  2KN5 A;  4ZYN A;  1GB4 A;  1WJ4 A;  3AEB B;  1XLO A;  3PV1 A;  2ZJD A;  1R4N I;  4LTU A;  3QJZ A;  5L83 A;  5I4D A;  1NEK B;  2JVC A;  1WGG A;  1CMX B;  3AEC B;  4FJY A;  3T8M A;  3H7P B;  1XLN A;  3MJ5 A;  2R2O A;  3FC4 A;  2VH2 A;  2BS4 B;  1G6J A;  1IGD A;  1QKZ A;  2RGF A;  2K3U A;  3PZD A;  4FUL A;  1SJH D;  1E8X A;  1OQQ A;  2IGH A;  2LXC A;  2AQ1 B;  2G4S A;  2WLB A;  3QIJ A;  4ANX A;  2Z0D B;  2KFK B;  1WF9 A;  4DDG D;  2WXK A;  2BVC A;  2LGD A;  2SAK A;  2UWQ A;  1V6E A;  1EWY C;  1T6B X;  1L7Y A;  1DOY A;  4EZJ A;  1V8C A;  2X38 A;  5D3D A;  2SEB D;  1WRD B;  2KDM A;  5H92 C;  3KYC D;  3ZNH B;  2I38 A;  4DK5 A;  1I4H A;  4M0W B;  1KLU D;  2K1F A;  2LRU A;  1WZ3 A;  4BKG A;  2WDR B;  4GIV A;  1ZXH A;  4CQN A;  3VTU A;  4LNK A;  4C80 A;  2AL6 A;  4KZ0 A;  3ZNI D;  2KC1 A;  4GXB A;  3JSV A;  4C00 A;  4L1B A;  3K9P B;  1JRU A;  1M94 A;  2V3S A;  1RWS A;  5EE3 A;  5CX3 A;  4TUU A;  2GBJ A;  4EKU A;  1PGA A;  2V4L A;  3A1Q B;  4LLG M;  1D3Z A;  2ON8 A;  2BYF A;  3DBH B;  2E3T A;  5DPS A;  1L0V B;  1YOV B;  5IP4 D;  5AEK B;  2ICI A;  4FJZ A;  1ET6 A;  4ZRJ A;  5BMH A;  1C76 A;  3R2I A;  3VUX A;  3R3M A;  2AWT A;  1DYQ A;  1WGK A;  3VVW B;  4USA A;  1Y8R C;  2C7N B;  3LB8 C;  3R7R A;  2M0X A;  5JHA A;  3PVL A;  2VRR B;  2L3Z A;  2G9H D;  2Y5B B;  1I4P A;  5JH5 C;  3MFG A;  1T3Q A;  2PLP A;  4MGK E;  4MGZ E;  3MHS D;  2V4I B;  4IKG A;  2AL3 A;  2KJH B;  1C1Y B;  1KFY B;  4W9I A;  1I4R A;  3BVG A;  4K3B A;  4BAX A;  1N5X A;  2I1J A;  5E6N A;  3RNG C;  4HDO A;  1UBQ A;  2D3C A;  1L4D B;  1V9J A;  2MJ3 A;  3BK1 A;  2M56 B;  3BII D;  4P16 A;  4NJ6 A;  2FUG 1;  2RMM A;  3R8B A;  2J42 A;  4XDC A;  3V60 A;  1GNU A;  5CHF A;  2LJ5 A;  4RF0 A;  3UIN B;  2MEK A;  3SFE B;  2NBW B;  3VUW A;  3RZW C;  1WGY A;  3EUB 2;  3SU8 X;  2W3S A;  4EUT A;  4K7S A;  2L8J A;  4MT5 A;  2MBH A;  4PS8 A;  3H6N A;  3GZN B;  4JWS C;  4FLH A;  4WIP A;  2CKH B;  4ZOH C;  3URY A;  1WE7 A;  2ZEQ A;  2WXH A;  2N0S B;  4ICU A;  3KWV A;  1ZGU B;  3ZDT A;  2GBK A;  2KNB A;  2D10 A;  3BYT B;  1OFF A;  1BUI C;  3N32 A;  1YX6 B;  2IDY A;  2INN E;  2NPT A;  4HXD A;  1AN8 A;  1NEN B;  2LRW A;  1UWX A;  1JAL A;  3IAS 1;  1P1A A;  3P63 A;  3VR9 B;  4H2A A;  1F1H A;  3D32 A;  1AAR A;  2IO2 B;  2VZK B;  1E7P B;  2XK5 A;  2IY1 B;  2Y3A A;  4MEL A;  1JQ4 A;  4NZL B;  4K1R B;  3AUL A;  5D7G A;  3NHE B;  4JQW C;  3MP9 A;  2LGY A;  4BOZ B;  1E5W A;  1VRA B;  1L4Z B;  1KM7 A;  4ZRK A;  1WM3 A;  4ZDV A;  1P0R A;  2K8B A;  4GDK B;  1XQQ A;  4XYC A;  2PMV A;  4PK1 A;  1HXY D;  1ET9 A;  3U30 A;  3AE5 B;  2G3Q B;  4GMV A;  2KK8 A;  2JUO A;  2WX0 A;  3O13 A;  1SBB B;  5J2R A;  3AXC A;  1RLF A;  1L0X B;  1SB3 C;  2J52 A;  4MGY E;  5C1Z A;  4W9F A;  3VQI A;  3HIZ A;  4DXF A;  1UGJ A;  2CJN A;  2KWC A;  1SIF A;  4MGI E;  1X1M A;  3B2F A;  3NZS A;  1LM8 B;  4PS7 A;  2IJ0 A;  4W9H A;  2MH7 A;  2N9P C;  2J4X A;  2KJR A;  1NYQ A;  2BYT A;  1SE9 A;  4GDL B;  4P6V F;  4W9K A;  1UEL A;  2M0A A;  5GXG B;  3H9D A;  3QK0 A;  4EFO A;  1LFD A;  1A70 A;  1HZ6 A;  2WDQ B;  5TSS A;  1QOG A;  2IYD B;  2VZK D;  3ZUN A;  3W5U B;  5C23 A;  4M8N A;  3AE4 B;  3DCG A;  4YL8 A;  1CK1 A;  2N7E A;  1XEE A;  4M8M A;  4OHJ A;  1SGH A;  5DCN A;  2GB1 A;  1E7U A;  3WAM A;  1K8R B;  1FM0 D;  1XF5 L;  2JXT A;  1KJT A;  1I7H A;  2AQ2 B;  1XCQ L;  1WJN A;  1DGJ A;  1UNS A;  3HRD D;  2LFI A;  1GC6 A;  4FHJ A;  4GN1 A;  4IM0 A;  1K51 A;  3P1M A;  1WRI A;  4QAY A;  3WAN A;  3DBR B;  3KW5 B;  4C4V A;  2OED A;  1IGC A;  1A5R A;  3NVY A;  4WWN A;  3ZJV A;  5E6O A;  2MJD A;  3DBL B;  4BBN F;  1Z2M A;  1ZP0 B;  3SFD B;  1ZE3 D;  1P9D U;  3QWZ B;  4REZ A;  1JW9 D;  3NVW A;  2GRI A;  1WR1 A;  3VRA B;  3C19 A;  2PPH A;  4MDK E;  1PFD A;  2DZJ A;  2LVP A;  3DOW A;  4WWM A;  4DHZ B;  2MP2 A;  4RM9 A;  1YIW A;  2JX5 A;  1OQY A;  2WU5 B;  4ANV A;  1TS5 A;  4URK A;  4RFB A;  1YJI A;  2W55 A;  2I1K A;  1VCB A;  2PE9 A;  5C2T B;  3DHH C;  1VJK A;  1AYF A;  4IM2 A;  3RUL A;  2WXG A;  1EU4 A;  1WX9 A;  3DVN V;  2NTT A;  2OJW A;  4WWP A;  4MM3 B;  3I9V 1;  2H89 B;  2HTH A;  1ZDX A;  1WGD A;  3HVZ A;  4DXA B;  2Y5P A;  2LMC A;  2NR2 A;  3ENE A;  2BWE S;  1WMH A;  2K25 A;  2AYO B;  3P4R B;  1DOI A;  5HHD G;  2EKI A;  2MSE D;  2D3B A;  1E7V A;  2BTE A;  3BIN A;  3PT2 B;  4FN2 A;  3AE8 B;  2K8H A;  4WH4 A;  3AU5 A;  4ITK A;  2DZK A;  3W5V B;  3TSS A;  4EOY A;  1QIL A;  4ACF A;  2KWV B;  2NBU A;  2JF5 A;  1GOZ A;  1QLB B;  1PUT A;  3R2T A;  3MHZ A;  4M02 A;  1QOA A;  1IP9 A;  1TKG A;  4G50 A;  2KQS A;  3KLS X;  3W1Y A;  2M1M A;  1TKY A;  3AE2 B;  3IG3 A;  4FBJ B;  1D5M C;  2W9N A;  5BYR A;  1J7C A;  3NS1 A;  1WY8 A;  2MBE A;  1MPE A;  2BT6 A;  3A1Q A;  4NQL B;  1YQ3 B;  1JML A;  2ZW1 A;  1JRP A;  2DHZ A;  1PGX A;  1C79 A;  2DYM A;  4TKN A;  3ZIM A;  4GSW A;  1XCT L;  1LGR A;  3ALB A;  3OAW A;  3C0R B;  1Q10 A;  2FAZ A;  2Y5C A;  4HCP B;  4S0R A;  3RNF C;  4HRO A;  1SSN A;  2JZZ A;  3R7Q A;  3PHX B;  1VZ8 A;  3A9J B;  3VRB B;  2MQJ A;  1ZKH A;  2KTR A;  4II2 B;  1FEH A;  4S17 A;  3RCZ A;  2OOB B;  4MH0 E;  3FIL A;  3KH0 A;  4OVU A;  4A90 A;  5D3I B;  1YNT E;  2PIA A;  1N60 A;  1WGH A;  3ZTD A;  2WXF A;  4KKJ A;  2FE8 A;  4AJW A;  4RGM A;  2GMI C;  1D5Z C;  4HPM B;  3B0A A;  4Q2J A;  2D3A A;  5KHO A;  3RZF A;  2LI5 A;  3GB1 A;  5IA7 A;  1YMH E;  1R4M I;  1SJE D;  1WSP A;  3UI3 A;  3B9J A;  1IPG A;  3ECI A;  3QHT A;  2WNM A;  2IY0 B;  3DVG Y;  4A3O A;  1V80 A;  3A9K A;  1PDX A;  2BGF A;  1PQS A;  1WR6 E;  4US8 A;  1WX8 A;  1UGM A;  2N9K A;  1ENF A;  2PW9 A;  3L54 A;  3QX1 A;  2KAJ A;  3Q6B A;  3TBL D;  4HKZ E;  1N5W A;  1EF5 A;  4RGN A;  1TY0 A;  3NS8 A;  3V62 A;  2ZVO A;  3H7S A;  4JWU C;  1YJJ A;  2KXJ A;  5G2N A;  5G5G A;  2QC8 A;  1WJ6 A;  1D4B A;  3O65 B;  3P4P B;  4KGS A;  1B1Z A;  4L23 A;  2EEL A;  3VH3 B;  2PKO A;  5FKA C;  3PRP B;  3VAW A;  1YJ1 A;  2NBV B;  3ZVV A;  4OW0 A;  2NVU I;  4IW0 A;  3JYU A;  4JE3 B;  4YT0 B;  4MJS A;  1J7B A;  3X23 A;  4HRS A;  4XX5 A;  5HG2 A;  1BXT A;  1AWD A;  4OZC A;  2RPQ A;  5AZF A;  2JZ3 B;  2DBY A;  2V9H A;  1E8Y A;  3ZXR A;  2DZM A;  1MI0 A;  3KYD D;  3ZKJ C;  4B95 A;  5G55 A;  3LJ3 A;  4K7W A;  1MHH E;  2AEH A;  5AZG A;  1HZ5 A;  4W9L A;  1UUP A;  2O2V B;  2B3A A;  1D5X C;  1IUE A;  3A4R A;  3RYT A;  2HTM E;  2GBM A;  4K3C A;  4P1C C;  4WJP A;  1ROE A;  1M4V A;  4KSK C;  2LHD A;  1AW7 A;  3IXS A;  2V0G A;  3V05 A;  3FAH A;  2PEA A;  3AE3 B;  3N30 A;  4GDK A;  1KF6 B;  3PHW B;  4ANW A;  2WGS A;  1Q5W B;  1WXA A;  3PLU A;  4KX6 B;  4MEM A;  4XWT A;  3HK0 A;  4HJK A;  2KMA A;  2PE6 B;  3TEX A;  3T9L A;  2JWU A;  2KQ7 A;  1MVK A;  2MBB B;  4LNI A;  4A9A A;  2KO3 A;  3P2B A;  4OZA A;  4MSQ B;  1T0Y A;  2FCN A;  2M19 A;  4IC7 B;  4PYZ A;  2UU7 A;  1WYW B;  1P3Q U;  4YWG G;  3RN9 C;  1UZX B;  1ESF A;  2K5P A;  2OJR A;  2N4F A;  3NOB A;  1IBX A;  4HJG E;  3VDZ A;  4JL9 A;  1WH3 A;  2A5U A;  2D11 A;  2IO1 B;  3M62 B;  2C7H A;  3QC8 B;  4NJC A;  4A6Q A;  1U4A A;  2FUH B;  2IBI B;  2J0J A;  1CZP A;  4KKI A;  3E9S A;  1ZW7 A;  2FCM A;  3DDC B;  4F7Z A;  1E6E B;  2REX A;  1QT9 A;  5J17 A;  2IO0 B;  5BMG A;  4I6P A;  1GJZ A;  2DWQ A;  2DYO A;  2KQ4 X;  4I6L B;  2J7Q B;  2KMM A;  3AE9 B;  3TEY A;  3CMM B;  4AJY B;  3WA0 A;  1J0G A;  3SEB A;  1RAX A;  2XNA C;  5IN7 A;  1C3T A;  3N3K B;  1WXS A;  4B9K A;  1T5X D;  4L2Y A;  2KTF A;  4X57 B;  4LJO B;  4F1S A;  2BB6 A;  2LWP A;  5BYS A;  2KZR A;  1TS2 A;  5HKH A;  3EA6 A;  4WAA A;  2G1E A;  4KDI C;  3BWU D;  2BYE A;  1L6V A;  3PRE A;  1N6Z A;  2ACZ B;  1C4C A;  2L52 A;  1XO3 A;  4LNO A;  1V1P A;  1E10 A;  5LNK 1;  3DPD A;  4MSM B;  2XEW A;  1T0R C;  3Q2A C;  3TEW A;  4WUR A;  1VLB A;  2IND C;  2LUM A;  5L95 C;  4RNA A;  4A55 A;  4HLE A;  1I4X A;  4IG7 B;  2N9X A;  1FO4 A;  3Q3M C;  3L4P A;  4HEA 1;  3OWE B;  1OEY A;  3HM6 X;  3NG0 A;  5AUK A;  4CYE A;  5CHV C;  2KJ6 A;  1K50 A;  4TSS A;  1V2Y A;  1V97 A;  2WDT B;  2Z59 B;  1R7S A;  2MBO A;  3EEC A;  5T8I A;  4CO7 A;  2QIE B;  2ZNV B;  2LXA A;  4ZRI A;  4E3C A;  2LZ6 A;  2N7J A;  3CIR B;  4I6N B;  2ZW0 A;  1WIA A;  2CHZ A;  3WAP A;  2H88 B;  2KAC A;  3HVD A;  4YTM B;  2KFJ A;  1BML C;  2RPV A;  2RDH A;  1HEZ E;  2OHF A;  2LGX A;  3JSV B;  1V86 A;  5MPO A;  4HK2 A;  3WAL A;  3OG5 A;  1SF0 A;  2JYE A;  3JW0 X;  3BY4 B;  4EE2 A;  1QZE A;  5IAA C;  4M01 A;  3S2A A;  1FNV A;  1FFV A;  1R4N B;  3T3O A;  3HUI A;  3DVG X;  5D6J B;  3I63 C;  1H8C A;  4JX1 C;  4HPP A;  5DPR A;  1FCC C;  4TQ1 A;  2ZZP B;  3U2S C;  1GPX A;  3UQB A;  3N20 C; 
#chains in the Genus database with same CATH homology
 2BWE S;  1WMH A;  4FJY A;  2K25 A;  2AYO B;  3T8M A;  3H7P B;  4BKS D;  2R2O A;  3L13 A;  3M63 B;  5GMV A;  3W1S C;  4K81 A;  1MG8 A;  4IWP A;  2KD0 A;  4IWQ A;  2MSE D;  1G6J A;  2RGF A;  1E7V A;  3BIN A;  3VUY A;  4BBN C;  3PT2 B;  4FN2 A;  2K8H A;  3PRZ A;  3PZD A;  3AU5 A;  4FUL A;  4AOF A;  2DZK A;  1E8X A;  2LXC A;  2G4S A;  3QIJ A;  3SD5 A;  4ANX A;  2BWF A;  2Z0D B;  4EOY A;  2KFK B;  1J19 A;  1WF9 A;  2KWV B;  1XT9 B;  2JPH A;  1WXV A;  3PTF C;  2NBU A;  4DDG D;  2JF5 A;  2GBR A;  3VTV A;  3A4S C;  2LGD A;  2KDE B;  2LVQ A;  2UWQ A;  1V6E A;  2N1W A;  2CU1 A;  3ZNG C;  1IP9 A;  3A9K B;  3LDZ E;  2KKC A;  3ZTC A;  1L7Y A;  4G50 A;  2KQS A;  3PGE A;  3IFW B;  2FID A;  3RT3 B;  3A9J A;  3W1Y A;  2M1M A;  4EZJ A;  3IG3 A;  3VH4 B;  1WGR A;  4FBJ B;  1WRD B;  3QQ8 B;  2W9N A;  1YQB A;  3APF A;  3KYC D;  3ZNH B;  4DK5 A;  1WY8 A;  1V5T A;  2MBE A;  2ZCB A;  4WJQ A;  4M0W B;  2YVC A;  3A1Q A;  1LQB A;  4N9F 4;  4NQL B;  1WJU A;  2K1F A;  2LRU A;  4DHJ B;  5LXI B;  2KLG A;  1WZ3 A;  3AU4 A;  2ZPN A;  1V49 A;  2R2Q A;  1E8Z A;  2DHZ A;  3OJ3 A;  3CSF A;  4GB9 A;  2DYM A;  4BKG A;  3EC8 A;  4TKN A;  3ZIM A;  4GSW A;  1E8W A;  4GIV A;  2K6Q A;  3ALB A;  3OAW A;  3C0R B;  4DBG A;  3VTU A;  3U8Z A;  1TTN A;  2KHW B;  2AL6 A;  4KZ0 A;  2FAZ A;  3ZNI D;  4E74 A;  4HCP B;  2KC1 A;  4GXB A;  3JSV A;  2JZZ A;  3R7Q A;  1I42 A;  4HVB A;  3PHX B;  2BKR B;  2MX2 A;  2L0F A;  3K9P B;  1JRU A;  5BO4 B;  4MJS B;  5EDS A;  3A9J B;  1M94 A;  2V3S A;  4DWF A;  1EF1 A;  2MCN B;  2M8S A;  1ZKH A;  2MQJ A;  2XBB C;  3CF6 E;  3EHV A;  4HDQ A;  5CX3 A;  4TUU A;  2KC2 A;  2KTR A;  2LUE A;  2GBJ A;  2J0K A;  4II2 B;  5E6P A;  4EKU A;  2L05 A;  2JY6 A;  2NS5 A;  2OOB B;  2V4L A;  4W9E A;  3A1Q B;  4HWI B;  4MH0 E;  3RCZ A;  1D3Z A;  3KH0 A;  4OVU A;  5LXH A;  2BYF A;  1WFY A;  1I35 A;  2ASQ A;  4MM3 A;  5DPS A;  3MJW A;  1WGH A;  3ZTD A;  2MRP A;  5AEK B;  4AJW A;  3DBH I;  2K39 A;  2GMI C;  1NI2 A;  4FJZ A;  2D2Q A;  2DZI A;  3H7P A;  4HPM B;  4ZRJ A;  3B0A A;  4FHK A;  2D07 B;  4HCN B;  1NBF C;  1S3S G;  4DDI D;  2K6D B;  3VUX A;  4NQK E;  5KHO A;  3X0W A;  1V81 A;  3R3M A;  2KX0 A;  2AWT A;  3OJ4 B;  4G0N B;  3M3J A;  3RZF A;  4G11 A;  3VVW B;  2LI5 A;  5IA7 A;  4TQ0 A;  1OTR B;  1Y8R C;  2C7N B;  3I3T B;  1WZ0 A;  2IZV B;  2NPT B;  3IHP C;  3L17 A;  4KV2 A;  1R4M I;  3R7R A;  2M0X A;  2KFK A;  5JHA A;  2EMT A;  4ANU A;  3PVL A;  2VRR B;  1IPG A;  2DEN B;  2L3Z A;  3ECI A;  2Y5B B;  1XD3 B;  3QHT A;  5JH5 C;  2FIF A;  3MTN B;  3R66 C;  3QAQ A;  1LXD A;  4MGK E;  2IY0 B;  3DVG Y;  4A3O A;  3K9O B;  1EO6 A;  1V80 A;  2RSU A;  2ZVN A;  3A9K A;  3MHS D;  4MGZ E;  4WQO B;  2KDB A;  2BGF A;  1PQS A;  1WR6 E;  3PPA A;  2KWU B;  2AL3 A;  2KJH B;  1C1Y B;  3L16 A;  4W9I A;  3B08 A;  4DHZ E;  1WX8 A;  1UGM A;  2MLB A;  1WX7 A;  2JWZ A;  3L54 A;  3QX1 A;  4DHJ D;  2I1J A;  4KIK A;  3TBL D;  2KDF B;  5E6N A;  4CHK A;  4NJ7 A;  4HDO A;  1EF5 A;  1UBQ A;  3NS8 A;  3V62 A;  1V9J A;  1L2N A;  2ZVO A;  3H7S A;  3UIP B;  2DX5 B;  3V6E B;  2KXJ A;  5G2N A;  1HE8 A;  3ZO5 B;  4NJ6 A;  3VFK A;  1WJ6 A;  2DAF A;  3O65 B;  3UF8 A;  4TV3 A;  3PSE B;  2C7M B;  3VH3 B;  4LCD E;  4RM8 A;  3V60 A;  5D2M B;  3TIX A;  3KUC B;  3PRP B;  1GNU A;  3VAW A;  1BT0 A;  1YJ1 A;  2NBV B;  3ZVV A;  2L7R A;  2NVU I;  5CHF A;  2LJ5 A;  2FNJ B;  3IBE A;  2EKE C;  3JYU A;  3NY5 A;  3KUZ A;  3QA8 A;  2JXX A;  4IW0 A;  4MJS A;  3UIN B;  3X23 A;  1NDD A;  2KAN A;  2D3G A;  2NBW B;  3RZW C;  3VUW A;  1WGY A;  4XX5 A;  1KLV A;  3ZRF A;  2RPQ A;  5AZF A;  2JZ3 B;  2JT4 B;  3SU8 X;  2KDI A;  4EUT A;  4K7S A;  2L8J A;  1E8Y A;  2MBH A;  2GBN A;  4PS8 A;  2DZM A;  4KIK B;  4F8C B;  3KYD D;  4ASW C;  1KOT A;  3H6N A;  3ZKJ C;  1F9J A;  4B95 A;  3HM3 A;  5G55 A;  3LJ3 A;  4FLH A;  1FXT B;  4K7W A;  3WAO A;  2AEH A;  4WWO A;  2CKH B;  3GZN I;  5AZG A;  1WE7 A;  3TMP B;  3ZDM C;  4GU2 A;  2ZEQ A;  3JVZ X;  1OEY J;  2LVO A;  2J0M A;  4BVU C;  4W9L A;  2DYB A;  2G4D B;  2G45 B;  4ICU A;  1ZGU B;  3GOE A;  2O2V B;  2B3A A;  1WXM A;  3ZDT A;  3ZNZ B;  3A4R A;  3DVN U;  3Q3F A;  2N1V A;  3VTW A;  3RYT A;  2GBK A;  2GBM A;  2KNB A;  2D10 A;  4WJP A;  4FJV B;  4GOC A;  4KSK C;  3N32 A;  4JIO U;  1YX6 B;  2NPT A;  2JRH A;  3M95 A;  3PRM B;  4HXD A;  2PEA A;  3N30 A;  4GDK A;  2LRW A;  3APC A;  1P1A A;  1WM2 A;  3PHW B;  2LD9 A;  4ANW A;  2A4Z A;  4IUM B;  1Q5W B;  1WXA A;  5DPT A;  3D32 A;  4AP4 C;  1AAR A;  4RMA A;  2IO2 B;  3PLU A;  4MEM A;  2XK5 A;  3HK0 A;  2IY1 B;  4HJK A;  4IM3 A;  5LLI A;  2KMA A;  4MEL A;  2YLM A;  5AZH A;  3UIO B;  4K1R B;  2PE6 B;  3DBS A;  1TBE A;  3T9L A;  3AUL A;  5D7G A;  3TL5 A;  3QCA A;  4LDT B;  3NHE B;  2WX1 A;  4JQW C;  3ZW3 A;  2KQ7 A;  2MBB B;  3TJP A;  2KVR A;  2LGY A;  3OLM D;  4BFR A;  4BOZ B;  2KO3 A;  2ZNV C;  3P2B A;  1UBI A;  1E5W A;  2MW5 A;  1T0Y A;  2M4N A;  3PS6 A;  4MSQ B;  3W1S A;  3Q3J A;  2FCN A;  1KM7 A;  4ZRK A;  3L08 A;  4E71 A;  1WM3 A;  4ZDV A;  4KZC A;  1P0R A;  2V1Y A;  4IC7 B;  4PYZ A;  2RR9 A;  1ISN A;  1P3Q U;  1WYW B;  2K8B A;  1UZX B;  4GDK B;  3EFU A;  4WJN A;  1XQQ A;  2OJR A;  1TZ1 A;  4GGQ A;  3U30 A;  2N4F A;  2EMS A;  3NOB A;  2G3Q B;  4GMV A;  3VDZ A;  2KK8 A;  4JLC A;  2HD5 B;  3KVF B;  4JL9 A;  2JUO A;  2WX0 A;  2XK5 B;  3KUD B;  3ML8 A;  1WH3 A;  2ZCC A;  1J8C A;  2A5U A;  5J2R A;  2D11 A;  2IO1 B;  3M62 B;  2C7H A;  3QC8 B;  3AXC A;  5D94 A;  1GUA B;  4ICV A;  1UD7 A;  4FA6 A;  2MA9 B;  2MBQ A;  1RLF A;  1U4A A;  2FUH B;  2IBI B;  3IVF A;  4MGY E;  3ML9 A;  3ONS A;  5C1Z A;  2J0J A;  4P7I A;  4PYU A;  4W9F A;  3VQI A;  4AUQ C;  1V5O A;  1ZW7 A;  4OVV A;  2FCM A;  2O6V A;  3DDC B;  4F7Z A;  2FCQ A;  2N9E B;  2REX A;  5J17 A;  2IO0 B;  3HIZ A;  1UH6 A;  3DQV A;  4IWO A;  4W9G A;  2BPS A;  2KWC A;  3L0W B;  1SIF A;  4I6P A;  1GJZ A;  2DYO A;  4MGI E;  2WWZ A;  1H4R A;  1X1M A;  2BKF A;  2CS4 A;  2J7Q B;  3NZS A;  1YD8 U;  4I6L B;  4XZ4 A;  1LM8 B;  2GOW A;  3H1U A;  4PS7 A;  2O2V A;  4W9H A;  2N9P C;  3CMM B;  2MP2 B;  2KJR A;  4AJY B;  4W9J A;  2NCN A;  4BKS A;  2BYV E;  3WA0 A;  1J0G A;  1SE9 A;  2L00 B;  4GDL B;  3QAR A;  4W9K A;  1UEL A;  1RAX A;  5TR5 A;  1C3T A;  1RFA A;  3N3K B;  1WXS A;  3A33 B;  1E90 A;  4B9K A;  5J18 A;  1RRB A;  3H9D A;  3QK0 A;  3RUI B;  4EFO A;  1LFD A;  2C9W B;  1P98 A;  2KTF A;  4PS3 A;  4X57 B;  4AWJ A;  4A3P A;  2C5L C;  1Q0W B;  3HHM A;  1WE6 A;  4LJO B;  2KX3 A;  4K7U A;  4F1S A;  2IYD B;  2LWP A;  4KSL C;  2O6V B;  2QHO A;  3ZUN A;  5C23 A;  2KZR A;  4M8N A;  1TGZ B;  4WJO A;  4BKT A;  1EUV B;  3DCG A;  4YL8 A;  5HKH A;  4WAA A;  4KDI C;  2N7E A;  2BF8 B;  2BYE A;  2HJ8 A;  4NPN A;  4M8M A;  3PRE A;  4LDT D;  4HPL B;  2C60 A;  1SGH A;  5DCN A;  2Z0E B;  1E7U A;  3WAM A;  2JRI B;  4FAD A;  1K8R B;  1WMH B;  3DPD A;  3B1L X;  4EEW A;  1KJT A;  4MSM B;  3ZLZ A;  1GG3 A;  2HE7 A;  2XEW A;  1WJN A;  2ZPY A;  2M17 A;  3U7D A;  4EZK A;  2RD0 A;  2KMC A;  5L95 C;  3AI5 A;  3PLV A;  1S1Q B;  1GC6 A;  4FHJ A;  4GN1 A;  4IM0 A;  4W9D A;  4HLE A;  5DPW A;  4IG7 B;  5KHQ A;  2N9X A;  3CST A;  1OEY A;  3HM6 X;  3WAN A;  3KW5 B;  3L10 B;  2N7D A;  4CYE A;  1VD2 A;  3V61 A;  1A5R A;  4WWN A;  3DBR I;  1OGW A;  2MWS B;  4J6I A;  4W9C A;  5CHV C;  2KJ6 A;  3NZU A;  3ZRC A;  2L0T A;  1WI0 A;  4NY0 A;  5E6O A;  4NAW A;  1V2Y A;  4BBN F;  2WDT B;  2Z59 B;  1IYF A;  1Z2M A;  3DBL I;  4KDL B;  1GC7 A;  2FCS A;  2MBO A;  3APD A;  3EEC A;  1Z5S B;  2KLC A;  1P9D U;  4CO7 A;  3QWZ B;  3UQA A;  2ZNV B;  2LXA A;  4ZRI A;  4E3C A;  3VHT C;  4KVG B;  2LZ6 A;  4I6N B;  3SDL C;  1WIA A;  1WR1 A;  1YX5 B;  2CHZ A;  2PPH A;  3WAP A;  4MDK E;  2PJH A;  2L76 A;  2DZJ A;  2LVP A;  4II3 B;  3DOW A;  3V6C B;  4BOS C;  4DHZ B;  2KFJ A;  5JZE B;  2MP2 A;  4RM9 A;  1YIW A;  5JHB A;  1OQY A;  2K8C A;  2CHW A;  4ANV A;  4URK A;  2CR5 A;  4GDL A;  2LGX A;  2DAJ A;  2LAS A;  4NNJ B;  2I1K A;  3JSV B;  3VXW A;  1VCB A;  2PE9 A;  2IO3 B;  3UGB B;  1V86 A;  5FR6 A;  4A20 A;  4LJP B;  4G3X B;  4HK2 A;  2UYZ B;  3WAL A;  5CHW A;  4NAW B;  4IM2 A;  3RD2 A;  4JGH B;  3JW0 X;  3BY4 B;  1Q1O A;  2KOX A;  2CHX A;  2KN5 A;  3RUL A;  5CTR C;  2O6V D;  4ZYN A;  1QZE A;  5IAA C;  3ENE A;  3S2A A;  4EZL A;  2KTR B;  1WJ4 A;  1WX9 A;  3DVN V;  3DVG X;  3WIM A;  5D6J B;  4WWP A;  3PV1 A;  1H8C A;  5DPR A;  2ZJD A;  1R4N I;  3SHQ A;  3TCA A;  4TQ1 A;  2ZZP B;  3QJZ A;  5L83 A;  3UQB A;  2HTH A;  4B6W A;  2WYQ A;  2JVC A;  1WGD A;  1WGG A;  4DXA B;  4XC2 A;  2NR2 A;  1CMX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...