1KMQA

Crystal structure of a constitutively activated rhoa mutant (q63l)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
177
structure length
177
Chain Sequence
IRKKLVIVGDGACGKTCLLIVNSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGLEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a constitutively activated RhoA mutant (Q63L) at 1.55 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords TRANSFORMING PROTEIN RHOA
total genus 55
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2001-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kmqA00
4DCTA 4ZIRA 3TSZA 4II7A 4TTRA 1Z3IX 4EPVA 5E7MA 3WBKA 2QPOA 4H1UA 5JWHA 3VR4A 1M2OB 5BYKA 1E32A 1N25A 2AK2A 4BLRA 2OCYC 2IEYA 1YZTA 1W36C 2VIIA 3UKDA 1H65A 4JSTA 3PEUA 2P3SA 2VTKA 4CVNA 2C78A 3RS4A 3NXSA 4HSEA 3HR7A 3IBYA 4IFEA 3OAAD 2FMXA 1KNQA 2ZRDA 3R9WA 3S1AA 2ZE8A 1YU9A 4NP6A 4G3XA 4JLMA 3TQCA 3WNCA 4W5HA 4ZDJA 1X86B 4B74A 1MRNA 3B1XA 3GJ8A 3QOFA 1KI8A 2IYRA 1TAGA 3E1SA 4PSAA 221PA 1DS6A 5G53C 4GI7A 4HDQB 3TR0A 1N5IA 1IHUA 3HJNA 3MCAA 5FTKA 1BYIA 2JEOA 1OLOA 2MMGA 4HUQA 3ICEA 1SXJE 1NMXA 2WJGA 4TSFD 1SHKA 3ADDA 1DADA 1US8A 3I61A 2A30A 4OBEA 3RC8A 3QXCA 5BQ5A 2GJKA 2CNWD 3EIEA 1IN4A 2Q9AA 3AB3A 3FMOB 3X2SA 3SYLA 1EXMA 2E9SA 4XIGS 4A2QA 1GFIA 4TQAA 3VR2A 1KJZA 5FOSA 3WYAA 2ZJAA 3OF5A 4JVMA 2WV9A 4B6EA 2QT0A 4D4KA 3QNUA 3IO3A 5A0FA 2XXAB 1NN3A 1PLLA 3D6TB 4TYQA 1E1QD 3TMKA 1G8FA 1J8YF 3THOA 1LF0A 2L0XA 3K0FA 3QF4B 3GFTA 1E79D 2BJWA 3Q9LA 3SN6A 1W0JD 4DT1A 2REOA 1ZCAA 3OEED 2JIZD 3EZ6A 1HY3A 2D7CA 1SXJA 4AURA 5EUMA 3T35A 2IYLD 1CRQA 4Q02A 2FEOA 1XXHE 2R6GA 2QBYA 1GM5A 2BEKA 1FMLA 1H8EA 3T34A 4FN5A 5BN4A 3IGFA 4FI3C 1W4CA 2YOHA 4PAQA 4PAMA 3U7EB 4A92A 4I1OA 1OW3B 1GG2A 1X6VA 1YHNA 4BECA 5CK5A 2C2HA 5TB5A 2Z0MA 1KSJA 2ZR0A 5CM9C 4HZUB 4PXAA 4BZPA 2FPKA 4HEJA 4KI0A 1P61B 4D0NA 2GK6A 3LO5A 2KBFA 4MUBA 3UATA 1CIPA 4WBSA 4RFVA 1XJ0A 1E4YA 4M9SA 5P21A 4CEJB 2R65A 2XSZA 5EE0A 4HLUA 1CULC 4D4MA 4OHXA 1Z07A 4RJLA 3GJ7A 3T5DA 3AVXA 2OSBA 3B85A 1GL9B 4E09A 2KI5A 2FSFA 4JBYA 1KSHA 1SHZA 2ODNA 4LJ4A 3A1WA 4N1AA 4XSGA 3MAAC 2ZYUX 4FMCF 3QKRA 2F3TA 1W49A 1NLYA 1E2KA 1BIFA 4PO8A 2OFOA 5DNYB 1D2EA 2IYYA 4BFYA 3EIQA 3IQXA 4V0KA 5B2ZA 1F48A 1G3MA 4PC2A 3QXXA 2PJRA 1IN8A 1X1SA 4YQFA 4TYYA 1HTWA 2RGDA 4MYUA 2R6CA 2GJ8A 2CHQA 4Q5IA 4M53A 3QF7A 4YONB 2XNSA 3RC3A 1XXHB 2R2AA 3BH6A 3O8DA 4MITA 4DLUA 4NONA 4GOKA 2VF7A 2C77A 1LFDB 1IY2A 3AH8A 4Q47A 5EE5B 5C4MA 4JZKA 4HAZA 2BM1A 1VCIA 1YVDA 4OYHA 4BLTA 4POAA 4A82A 4TSFA 3UXMA 4KV9A 5JEDA 3T1VA 4EPRA 5J4HA 3B82A 1RIFA 5C1BA 3UMSA 4US2R 2HXYA 4M1WA 5KOYA 5FOXA 3U44A 1T0JB 1SZPA 3VAAA 2GEUA 1LS6A 3KFXA 1YR8A 3W5IA 2EWVA 4TZ6A 2F9LA 4QBHA 2VSXA 4A36A 3BFKA 4URZR 4CT5A 3EPKA 3V4RA 5FPTA 2W2VA 3WP1B 4QJ4A 1EFHA 3K9LA 1Z0AA 5LB4A 3BFXA 1Y3AA 3NH9A 2O0KA 1AS2A 2QQEA 2B7BA 1P6XA 1W4AA 2F9MA 3W3ZB 2VHUA 4HLQB 3GLFE 1R0XA 2XTMA 4ZIRB 3AVPA 3Q8XB 1JPNA 2WJIA 3LAWA 3WXMA 3QKTA 2DFKB 621PA 3AQ4A 4TT3A 4D4LA 4AWXA 1KAOA 3A1VA 4HZIA 4BFVA 1TQ4A 1Z06A 3U2QA 2CK3D 2DBYA 2N46A 4UNQA 5J47A 2R44A 4X8LA 1XTQA 1GRNA 1PV4A 2O8DB 2CLCX 4M8NE 4LBYA 4QJ5A 2PZEA 5EZ6B 2GBLA 3ZD7A 3A1SA 4UXIA 2CE7A 3WRYC 4B3FX 2GK7A 5AJYA 4LC0A 1I4TD 2MSEB 3RLFA 2ZVQX 1NMZA 3CF6R 5SZHB 4D4JA 4GFDA 2D06A 2VF8A 5G40A 2Q3MA 1GNPA 4L9WA 4E07A 2O5VA 5L3QB 1W1WA 4PR0A 1UF9A 1CKEA 5LD2C 3DPUA 4TMZA 4BQSA 2IYXA 2P5TB 2O8DA 3HU3A 3LW7A 3I72A 4TL6A 4C4PA 2NMVA 1TEVA 1IBRA 1O3YA 3B60A 3VR1A 4Q9JA 4YDHB 4JLJA 3QE0A 3KXKA 5CIQA 2AL7A 1XU4A 3LBNA 5DHFA 4IDQA 4IRUB 3SHFA 4C0AC 2J0VA 1XZQA 4LPKA 1OFTA 5HTKA 1XP8A 4FMBB 4BE7B 1KK1A 4NH0A 2V4ZA 4MKGA 2UZ3A 4IEIA 1VCOA 1XB2A 3B1WA 1XZPA 2H16A 3EWAA 1OFHA 4NYIQ 1FP6A 2CVHA 5AK0A 1R5BA 3RRYA 4CYMA 1UM8A 3IHLA 1ZM4A 1L7VC 5GVRA 3FGNA 1F3OA 2F7SA 4JJKA 4UXHA 4US0R 3CO5A 2N42A 1DPFA 1VIYA 3CWQA 3L8YA 1OH6A 1D2NA 2BV3A 4PC6A 2ZROA 3VKWA 4Y0AA 3CR7A 3UG6A 2ANBA 1YZNA 1QBKC 1ZM7A 5F2EA 3CLVA 2GCNA 3NIBA 2OCBA 5SZIA 1NVXQ 4RD0A 4BWYA 2OAP1 4JBWA 4QNRA 2RAPA 2W0MA 2WJJA 2ZJ5A 4MGZR 5JEEA 4M1MA 5AR1A 1CJKC 2RCNA 2ZR9A 3MGCA 4LBVA 1JJ7A 1KAGA 2R6DA 3A1TA 2XZLA 2WICA 4GP7A 4ILEA 2DWPA 4DDTA 3PUYA 4GL2A 3CH5A 3Q85A 5G41A 5JSZB 2ZVPX 1VG8A 2WOOA 5G3ZA 3B78A 3CB4A 5CJ2A 2Z4RA 2BCJQ 2KJQA 3WNBA 3X1XA 3PITA 4EQ6B 1JXOA 4URYR 4QM7A 3HU2A 1E9AA 2ZRBA 3AKEA 2JLUA 5CJPA 1BMFA 3LFUA 4NKRA 2ZI4A 3N5CA 1AK2A 4YMUA 5J4KA 2O8CA 3EPJA 1DTSA 2YNMA 4FMDF 2D3WA 1Z6TA 1OV4A 2R6AA 4R98A 4TMTA 2P5SA 4JSYA 1Z0JA 3TAHA 1ZNYA 1L8QA 3M1IA 3TW4A 1WBBA 1J90A 1RJ9A 4DIDA 4EPYA 3THXB 2ZRCA 4DKXA 1CS4C 2XX3A 3EIHA 3Q7QA 5DHAA 3NVAA 4AG6A 4HLUC 4F92B 1FNNA 3C5HA 4ZCIA 2OUKA 1EX7A 3PUXA 3TGPA 2QT1A 3CX6A 3X1YA 1U81A 2ZR7A 3O8BA 1X8KA 1OFIA 2OCPA 4PQYA 1U8ZA 4PHFA 1ZRHA 4DSUA 3U60B 3IILA 4HAWA 2V55B 4B35A 5BYJA 3A36A 2OEPA 3RSOA 2XB2A 1DAHA 3FFAA 2V3CC 1E2FA 2IBMA 1G5TA 3MRSA 2O0JA 3QG5A 5JMTA 4B71A 3FB4A 2YC2C 4OK5A 2ZYTX 2IHYA 2YOFA 3K70C 1WB9A 5ANRB 3P1JA 1NIJA 2ZETA 3B6EA 4HDOB 2GTPA 4KVGA 5DI9A 1BS1A 3QVVA 1KJWA 4Q1BA 3TLXA 3MSXA 5C18A 3TW8B 1E3MA 1N6HA 2VEDA 4WXPA 5FI1B 1GILA 1G7SA 1MABB 2IS2A 1XPRA 4WZAE 1OE0A 1E9CA 4JLBA 5HZHA 1N6RA 1KO4A 2ZU6A 3ETLA 1G18A 5FTLA 2JATA 4U00A 4ZI2A 4Q9KA 1IJEA 1WCV1 3CX7A 2QSYA 5EQTA 3TIFA 2FX3A 2W6JA 3KKPA 3PEYA 2QORA 4KYIB 4NYJQ 2C8VA 3NEJA 3TSWA 4AKIA 1S8FA 4DUGD 4IEEA 4OHWA 2ZE5A 5GJCA 1SXJC 1N6NA 3AEZA 4LK2A 5GVSA 3K0FB 1XJCA 1TQDA 4IOLA 2O8EA 4DXAA 5EP3A 1E2JA 2ASEA 3OZXA 2JJ1D 3HPQA 1N5JA 2VBCA 1TPZA 4NYJR 4OHVA 1CJUC 5JSZA 1VYTA 1OB5A 4TQ9A 2ANCA 2W2XA 4ZKDA 4D0GA 1YRAA 4FXPA 1U99A 2ORWA 2BKUA 2J45A 4BFXA 4U7DA 4EQ6A 1Z83A 1AIPA 2AN9A 5FL3A 1NJGA 2HV8A 2QROA 2J0SA 1D8TA 3K70B 1NMYA 4HUQB 3UANA 3UK6A 4A8JA 3BERA 4IDHA 1DAEA 1CTQA 2W58A 2V7QD 4ZDKA 1ELOA 4HZUA 3EPLA 5CDFA 2PMKA 1NBMD 1X8LA 3MWJA 1QHSA 1R5NA 1NN1A 2XTNA 2AWOA 2ZRKA 4GMDA 2Q3FA 2P6UA 2VA8A 3CF2A 1EWQA 2ZSAA 5L3SA 1NG1A 2DFTA 4LV6A 4PX9A 1OXSC 2LKCA 5KDLA 2OZEA 1KMHB 3GQBA 2F43B 4A6XA 1A2BA 1KI9A 1TADA 3W9YA 1R8SA 2C9CA 2G1JA 3JZAA 5TARA 2IL1A 5CB8A 4G5QA 4D26A 1JEDA 1SKYE 5L3VA 1ANKA 3DEFA 1YRBA 3HP1A 1S3SA 1EFRA 5A4JA 1YKSA 3CWZA 3QKRB 3UIEA 1VPLA 2QEQA 3W6PA 4A6PA 1Q3HA 3K53A 4LJYA 5EUQB 1F2TA 2YVUA 2QNRA 1GITA 2GVDC 4Q01A 2NPIA 2RB4A 3I8XA 5TMPA 2IUTA 2JJ2D 1SQ5A 1P9NA 1XRJA 4B3XA 5LB2A 4NU0A 1TL7C 4CZ2A 1HQYE 4AKEA 5JJIA 4BGDA 1YZGA 3EPHA 4FINA 1KJYA 2GZAA 1V43A 1QHGA 2CL0X 4Q4AA 5JCZA 4CEJA 4M9QA 5K8TA 2SHKA 4AIIA 2VP0A 3CONA 2QAGC 1NBMA 2HEIA 3FHOA 3PIRA 2ZSFA 3IPXA 4TL9A 1AS0A 1UEIA 3QIAA 5CLLA 1Q1EA 1AJEA 1C4OA 1E79A 1FQKA 1DBSA 1RRGA 3RRMA 3RDPA 2GJ9A 1W5TA 1DG1G 2DFLA 3GCGA 2BBTA 3PQCA 1P2TA 4DCUA 2R6FA 3B9PA 4LYHA 3L0SA 1SULA 2WKQA 4F4CA 2WPDD 3VX4A 1ONBA 3FVQA 2PZGA 4QOSA 3ZQJA 1N0WA 3GLHB 1NP6A 4LSGA 2ZUDA 3VTKA 1N3BA 5D3QA 4Z51A 2GAAA 2PMDA 2DWOA 4LX0A 5HE9A 4OHYA 3V9PA 2G1KA 1II0A 2LKDA 3WNDA 4DJTA 3TVDA 1ZM9A 2WIBA 3G82C 4P0TA 5SZJA 3U6BA 3V4FA 1RPZA 5K8UA 1KK3A 3CUEF 1Z22A 2ZIAA 3KKOA 1VYUA 2ZM5A 1GVNB 2F3RA 3SR0A 4D0LB 2OAQ1 4BLOA 3DM9B 3GFPA 2PX3A 4B2IA 3RRNA 1TUEA 4Y0VA 4EJSA 4C2TA 4ERNA 3MMPA 1E2EA 4RCZA 2OILA 3QF4A 5KU1A 1K8RA 3REGA 1ZAKA 3ZD6A 2HJGA 5UKDA 3UMFA 3B1YA 3AF2A 3D31A 2XNDA 3RWMB 5EJEA 5E7IA 2IYVA 3GLHA 2XXAA 5FPSA 3O47A 1TU4A 1GNQA 2C99A 1T3LA 4WZBE 1KMHA 5JBQA 2ZRGA 4ESVA 1I2DA 3R9IA 3AP2A 2QRNA 3AVYA 4OK3A 3CX8A 5CLQA 3QXHA 2VP4A 2RH5A 5J40A 3QEJA 3FMIA 5AJXA 2YKGA 2WVJA 1NRJB 1JR6A 4BASA 1L2TA 5EXSA 1GL6A 4A8JC 5KNBA 1KO7A 1Z0KA 4M21A 3R8CA 3LD9A 3T5GA 4CT4B 4RD2A 4D6PA 1RRPA 3BAFA 2X19A 2D62A 2WKPA 2OCAA 5EXTA 1LTQA 2HLDA 2JJ2A 2GDJA 1S1MA 3I5XA 1J8MF 2JLXA 3U3MA 2D2EA 3ADKA 4O2LA 3QJYA 2O8BB 5F9HA 5JJLA 4FMDB 4MRVA 1GRQA 4BEBA 1E9BA 2VP9A 1NKSA 1RFLA 2CDNA 2WJVA 5BXQC 1CF4A 1ZC4A 3HYTA 1UADA 4FWIB 4O25A 3QUSA 1OF1A 2F55A 4KXFB 1GTVA 3KQUA 1AGPA 2AKYA 1QHNA 3QY0A 4LYFA 1ZM3A 2JA1A 3SC3A 4B3BA 1A82A 1CR0A 1G1MA 3VR6A 1PLJA 4W5JA 1HE1C 3HDTA 2IK8A 1ESMA 3KTAB 4JL5A 4RD3A 3EZFA 1E99A 1GSIA 1MO3A 2QU8A 4WZ6A 4YLGA 1VHLA 1YZUA 4TMVA 3ZLJA 4MRNA 3KQLA 2F1JA 5B58C 2ERXA 4OQXA 2IT1A 3LLUA 4DCVA 4WIAA 3F8TA 2OFWA 4C2UA 1XCGB 1IXZA 2E87A 1DG3A 3RANA 4KFUA 4DIEA 3BS4A 1E9EA 4Q4HA 4KU4A 1G8YA 4RSGA 1WDTA 3C14C 2JLRA 5EXPA 4DT1B 2J87A 3C16C 3EZ2A 5BWMA 2HCBA 1A4RA 4JKIA 5L3RA 2ZJOA 4TL7A 2P2LA 3WY9A 3EW9A 1R6BX 2ZSBA 2HLDD 5EXXA 2B8WA 3GJ5A 3CBQA 5JHHB 1K5DA 3ZGXA 4QHYA 4MQBA 3HYRA 3T12A 3L43A 4M1YA 4LDJA 3AVWA 2JLVA 1G21E 4X8HA 3FKSD 2RGXA 1NLZA 4UJ3A 5JECA 2I1VB 4JYCA 3SFVA 1OXVA 3SDZA 3ZQ6A 3TUZC 2QP3A 5KPJA 3BH7A 2PL3A 4URUR 1DE0A 1JAHA 2BDTA 4PZZA 2G9NA 2QPTA 2W2TA 2HUPA 4JT4A 1ZBDA 3I62A 2O8FA 3N2IA 5SZKB 5KTYA 4JLVA 1W5SA 2ZU0C 5JCPA 2VLIA 2GJSA 3TQFA 1OH5A 2VHJA 2EU8A 3GD7A 2ZRAA 2FSGA 4WOPA 1P5ZB 4AYWA 3QKSB 3CZPA 4ZI3A 1WBDA 5AJZA 4GOXA 4GZLA 1SXJD 1W4RA 1DEKA 1KDRA 5TV2A 5FUVA 3SYNA 2HF8A 1CP2A 1OJLA 3DM5A 4JL6A 2J7KA 4MH0R 1W2HA 2CCGA 2J7PD 2PCLA 2QE7D 5AJVB 3A58B 3BB4A 3HWSA 2ZI5A 3IHWA 1ZNXA 1COWD 2OXCA 3A6PC 1F60A 1HYQA 2ZSEA 2BHRA 3WYFA 5KDDA 4TT3D 2Q6TA 1EFTA 4F7WA 2MSDB 3QBVA 1UDXA 2GBLC 1RRCA 1P75A 1XD8A 2F1IA 2VL7A 1S4QA 4I4LA 2OBNA 4TN1A 2AXNA 3K09A 2O52A 1TQ6A 2R62A 4BPBA 2ZE6A 1SVIA 3T1QA 4NPHA 1GL7A 2GZHA 4O0MA 3WHKA 3CIOA 4NCHA 3K1JA 1TF7A 2ZS7A 2V9PA 5IT5A 2EYQA 2Q0HA 3TAUA 3THXA 4QHTA 1G8PA 4BUJA 5KYKA 3X1WA 2QGZA 2D7DA 3D3QA 3KKQA 3RS7A 4QM6A 4F91B 3I1FA 4G0NA 2DFNA 4U5XA 3RAPR 4F4IA 3GLIB 4NCJA 1T9HA 3F5FA 3UG7A 1NNEA 5BN3A 3PJRA 2NG1A 1NG9A 3SHWA 1M7GA 1W47A 2YWFA 2ZYWX 2QP9X 3AUYA 4PC1A 3RS5A 4TTQA 1XFAA 5EP2A 2ZJ2A 4MYTA 1JI0A 1G291 3NWJA 5H68A 5JS8A 4TMXA 4PFSA 1S3GA 2PT5A 4UXJA 1S9DA 1IJFA 4O3MA 1YR9A 1E1RD 4KBFA 2ZS8A 1KO5A 4IJMA 1XD9A 3E70C 2IWHA 1KK2A 5LBIA 3THYA 2HXSA 3VQTA 1ZUIA 3J81k 1SKYB 3CRMA 4Q9HA 1XPOA 3K0EA 2Q21A 4N3NA 3U3JA 1U8YA 3CRW1 1ZU4A 4N0EA 3OIYA 2YJTD 1XMSA 3SZRA 1GZSA 3QEOA 4BZXA 1XCMA 4PZLA 4LHYA 1YR6A 2J1LA 2Z6VA 3FKSA 5DI3B 4M1TA 3K9NA 3W5JA 4TZ0A 2RKOA 1T91A 1HE8B 2H5EA 1FNMA 2EFGA 3ND8A 1IM2A 3GJXC 2H8KA 4DLTA 2NTYC 2ZAMA 3RYTC 3SE0A 1KKLA 2IC5A 1NJFA 2ZRPA 4JLKA 3SS8A 3IIMA 3B9QA 4L5BA 3NKVA 2ZJ8A 2DCUA 1GIAA 1SVKA 2H7VA 4P4TA 3LWNA 5TXGA 2BKEA 2NO0A 1HURA 4UKDA 1G3QA 4CEIA 2V54A 4MUAA 4R2IA 2PX0A 4Q1EA 1COWA 2HF9A 4NDZA 2IWRA 4EFNA 3QVUA 3RWOA 4IDOA 4DB2A 3E2IA 4TYNA 4B2PA 1F2UA 1U8AA 2RHDA 1ZINA 3IEVA 5DSZA 3Q3JB 5CK4A 2VP6A 3GPLA 2EFDB 4JVLA 2J7PA 2QE7A 1E98A 5FR2A 1LNZA 4M2LA 3EXAA 3ZVMA 2GETA 3K09C 1KY3A 2IF2A 1UBCA 2ONKA 1AGRA 3OFNA 3U4QB 2DHRA 2QENA 3CZQA 4RFSA 3AP3A 5AUPB 2ZRIA 1I4LD 1XTRA 5DO9A 4XSHA 5HCNA 4F93B 3BRWD 4Q1FA 1KDTA 2ZJZA 3L0IB 3REFA 2JGNA 1E2GA 4WW0A 4W7SA 2IS4A 4EPXA 3LBHA 2J0UB 3EC2A 4M4SA 1E4VA 5FBVB 4QG7A 3FWYA 2P6RA 4X8OA 3AKYA 2WAXA 4NYIR 4OK6A 5DIFA 1OIVA 3PR1A 1CJVC 2ZRHA 3EZ9A 3D8BA 1RZ3A 4LRWA 4MRRA 1Q22A 1SKQA 5J4YA 1MR3F 4LYAA 1PUIA 1G16A 4BFZA 3ZYCA 3CRVA 4RZ2A 5FBLB 3L8ZA 1KK0A 2NO7A 1OSNA 3B1ZA 4V0NA 3VHXA 2VSFA 4JYBA 3BIFA 5K8IA 1RVDA 1D5CA 6Q21A 3SJZA 3I8SA 1Q20A 1W0KD 4JLDA 2ERYA 4BFUA 5TDHA 4XD7A 4I99A 3T61A 2AKAB 3QKUA 1LS1A 1ZNZA 2ATXA 3BJIC 1DAMA 5FOTA 1TF5A 5EE1A 1H8HD 1B0UA 4Q1AA 4QBGB 2WZQA 3OIUA 3QG1A 3FOZA 2XEXA 1E69A 2IW3A 3BGWA 2HYIC 2GEVA 1BYUA 3AKDA 2P6NA 3QXSA 4UNRA 2J3EA 3LDAA 1DELA 2FFQA 1UKVY 4XJXA 1E9FA 3BORA 5E7JA 4K8OA 4X8MA 4XVQA 3RVBA 4KFTA 3W6OA 2J46A 4W9MC 1EFUA 3I32A 2EYUA 1G7CA 4Q4JA 1IN5A 2GHIA 4LCBA 3FYHA 1EFRD 2FFBA 3ASYA 3BOSA 3JZMA 1ESNA 2ZPTX 2BCGY 2QTVB 2A5GA 4PTLA 1W0JA 2QQ0A 2WM9B 1L4YA 1E1QA 1KKMA 4P32A 4RY2A 5E95A 3KQNA 1T3HA 1UAAA 3HPRA 3NDPA 1NN0A 2CLDX 3NHAA 4LGMA 3RS3A 1Z08A 1N5LA 1W36B 4IDNA 3BBPA 4GNKA 4LJ6A 1UKYA 3TK1A 1EX6A 3DKVA 5L3QA 1XNJA 3QENA 2GILA 1EESA 2GCPA 4EJSC 4PC3A 4XD7D 3PCRB 4N0DA 2XSZD 4IDPA 4JBXA 2IYQA 4G5RA 1P72A 1Z6XA 3EZ7A 1H8HA 1OYWA 1FZQA 1SGWA 2HDNB 3VMFA 5FFMA 4FCVA 5CITA 3LBIA 1N6KA 4Q9IA 2VSOA 4Z8XA 1DAIA 2PJZA 3IIKA 5J4VA 1XBTA 2QAGB 3OESA 4B47A 5DN6D 2IHBA 2ORVA 5JHGB 1OH7A 4DLWA 1M6NA 1TX4B 1FPMA 4P31A 4JMPA 3ND9A 1MH1A 1T5IA 5GJVC 4HAXA 2ORIA 5DGXA 3T1OA 1II8A 3QXJA 1FMJA 2YINC 2P67A 1F2TB 3TRFA 2FZLA 4DDUA 4LJ9A 1W0KA 2EVWX 1P60A 2QMOA 3NC0C 4M0LA 2OG2A 1MV5A 2VHCA 3OEHA 4V0LA 1M1YE 2YWEA 2WWYA 2C5LA 1IXSB 4Q48A 2Z4SA 4MGYR 3GLGA 1PJRA 1EG7A 3M6AA 1HEIA 1E6CA 4HAVA 1FUUA 4K46A 4C0LA 3EC1A 1O87A 5JJKA 2JJ8A 2UZIR 3WP0A 4HB3A 3U44B 4HAYA 4ZO4A 4V0OA 1YJ5A 2GXQA 3EA5A 1BKDR 5H70A 3PVSA 2ZRJA 4QBIA 3NBYC 1N6IA 2QGNA 3CPHA 4EIWA 4KFSA 1BH2A 4QGFA 3P26A 2RGGA 3P20A 1FQJA 3ZIAD 2CL7X 2HJVA 3OIWA 2CXXA 4PO1A 4LV5B 3QPWA 4PPNA 2IXFA 4P4SA 4PQRA 1ODFA 1XEWY 2WBLC 2H17A 1P9RA 3LLMA 3ZH9B 2WSSA 4DB4A 3THYB 4FD2A 3BWDD 1NVVR 4WA7A 1RE0A 1RYHA 2NQ2C 4MKIA 2BBOA 2MSCB 2YOGA 1VTKA 3CNLA 3DOFA 3H4MA 4DZZA 3KB2A 1OXTA 1GNRA 5J5CA 3T1TA 1TUIA 4JS0A 4AD8A 2JASA 2BBWA 4ZCMA 3IKJA 1Z6AA 2CK3A 4M9ZA 1Q0UA 4Q19A 5CIWA 2VHQA 4Z54A 2PBRA 4DHEA 4JLNA 4LJ8A 2QA5A 4RD6A 5KSPA 4CEHB 3P4XA 4IVPA 1XF9A 1VHTA 4BZQA 2PEYA 2REXB 2XJ4A 1DO2A 1KZ7B 2AX4A 4HDCA 3DHWC 2V8OA 3KQHA 1CRPA 3CH4B 2W0SA 4XH9B 4A1FA 5FR1A 3IO5A 4LHZA 5DN6A 1KIMA 4E22A 1OB2A 4EFLA 421PA 2G6BA 2K5UA 1YR7A 1MO5A 1RW4A 2UKDA 2WAYA 3CNOA 3U5ZB 5FBRB 3ZZUA 2PT7A 3UPUA 5C46F 1ZCBA 5JWOA 4DEYA 4C0BA 3ONWA 2QBYB 4LC1A 5LDDC 3AF0A 4URVR 1JNYA 1R0ZA 3I92A 3VHLB 3A4NA 1T5LA 1XEXB 1E1RA 1MABA 2VPPA 2ZEJA 3NBXX 4V0MA 1XPUA 5FTJA 1R8QA 4XTRA 5JRZA 3AVVA 1VDZA 4RFSB 1E0AA 4IXNA 1GP2A 2YZ2A 4QXAA 3W8NA 2B6HA 3NDBB 3DOEA 1Q1BA 1PVOA 4XWAA 1GRRA 2W6ID 1SVLA 3OAAA 4L15A 2FFAA 3U4QA 5F98A 1OKKA 3GLIA 3GLFB 1P2SA 4OQLA 5BN5A 1L4UA 3LX5A 5FL7D 1XTKA 4UNSA 2OFXA 3Q5DA 3U61B 3ZJYA 4ZV4A 3OEEA 2VRWA 4NE2A 8OHMA 5KSOA 4V02A 3FMPB 4LJ5A 3FE2A 4LJAA 1JQLB 1G3RA 1N0UA 2QP4A 2QUZA 4LHVA 4QBFA 3I3SR 2O0HA 2IF0A 3Q72A 4Q4AB 4B3DA 2ZTSA 3NG1A 2JLQA 4JVSB 1GKIA 2NO1A 1LVGA 4ASUD 3MWKA 4QC2A 3LV8A 3I5YA 4B44A 1T4GA 3LW8A 1ZMXA 1G9XA 3W6NA 5IRCD 1ZW6A 1LF5A 1ETUA 2VQSA 1Q44A 5EE3A 3SFZA 1V5WA 4KYUA 5C4GB 2Q9BA 4HB0A 1S2MA 3KJGA 3CW2A 2RGBA 3GFOA 4NL4H 1G20E 4WVFA 4MGIR 2B8TA 2RGCA 4FW9A 1R10A 2OM2A 1FX0B 4JLAA 3U3KA 2QAJA 3MFYA 4Q1DA 1CR4A 4B75A 1NSTA 3W8RA 2I1QA 4C0QC 1II9A 4C7OA 1OFUX 521PA 4R71A 1NKTA 4OI2A 4RZXA 4ACBA 3TSOA 1NBME 2A5DA 4Q4LA 1G3IA 3DKPA 1ZU5A 1P9WA 1AZTA 4EKDA 5KSZA 4WXRA 3GEIA 1HV8A 1KMQA 3EAQA 5FPHA 4L16A 4KSCA 5AJWA 3FDIA 4IOJA 4QL3A 5HKKD 1UBGA 2D2FA 4NHOA 5DH9A 4AYTA 1TMKA 5L3SB 4G5SA 3I4LA 4V0ME 1ZIPA 2HT6A 2ZANA 3S1AB 2IS1A 1KGDA 3IUYA 3SJAA 1G7RA 3AVOA 3H84A 2ZXUA 4HB2A 1U9IC 2ZAOA 4UJ5A 1G6OA 2ZI9A 2R8RA 3ECCA 1JBKA 1T6NA 3H86A 2H18A 1R7RA 1W7AA 2FE4A 1TTTA 1Q12A 4B34A 4Z8YA 1KHTA 2CBZA 2KE5A 4TQUS 1KO1A 4KSBA 1ZYUA 1XDBA 4TMKA 1KSFX 4MYCA 1VG0B 3GJ0A 3QI2A 5DI3A 3PEWA 3ZZ0A 1JQJC 4OL0A 1XD2A 4TL8A 1GWNA 3EASA 1G4AE 2OBLA 1IY1A 2H57A 2FJUA 2A7QA 3V00A 2FSIA 3PG5A 2NZJA 3SQXA 3AF1A 3RNLA 3QPVA 4DSOA 1KI6A 2IYWA 4AKHA 3H0KA 2W6IA 1M74A 2ZSDA 4CGZA 1QZXA 1OHHA 2O8BA 1YZLA 2GCOB 3BE4A 2IS6A 5L8VA 4EFMA 1E2IA 2OHFA 4PPQA 3C4JA 1KY2A 4M22A 3B2EA 4ARZB 1GKUB 4ON9A 2WJHA 2ZQ5A 4DDWA 4RD4A 1XTSA 1XXHA 4Q00A 4DRZA 3KTAA 1U9IA 2OE2A 3RABA 4YXWD 1E2PA 3SNHA 1U0HC 1M7HA 2EFCB 4BLSA 3RHFA 4RD1A 4KFRA 4DUGA 2GXUA 2PZFA 2C96A 1Z8FA 4HYYA 2BMEA 4LBZA 4NTZA 1Q21A 5BW8A 4YMTA 1JR3A 1DARA 2ZYVX 4H1VA 3U7HB 3H2YA 1F5NA 1UBEA 4S2EA 4MA4A 1P2UA 2OLKA 5E4FA 4OI1A 2E1RA 1KI1A 1Z2CA 3AP1A 5KPDA 3EWSA 4DLVA 3LRPA 4PHHA 1ZUHA 2CL6X 3LXXA 4QNMA 4HLDA 2FGKA 1XTIA 4IOMA 3GLGE 1OYYA 4QJ3A 5AUOB 4IVQA 2G0TA 4GBMA 4Q21A 2BMJA 2Z5FA 4MKHA 3HR8A 4C0JA 3AV0B 5HKKA 1K6MA 4LV8B 1Z0FA 5FOVA 3GMTA 4DCNA 1UJ2A 3SQWA 2A9KA 3FHTA 1FTSA 4MKFA 2ZRLA 2BEJA 1E9RA 2RGEA 1NL3A 2LWIA 4M1SA 1D9ZA 1JJVA 5IK2D 4D82A 1AN0A 1TF2A 1U94A 2BOVA 2QM8A 4IHQA 2GVZC 2ECKA 4CEIB 1D6JA 3BB3A 3C7KA 4EPTA 4QHSA 1XJQA 2NOAA 5FPKA 3ADCA 3IIJA 3OEHD 1VYVA 4HB4A 2DYKA 2ZJBA 4ABYA 3VU9A 2BMFA 2NO6A 2ODEA 1TQ2A 4I1UA 2OT3B 4WAUA 4AY2A 2GF0A 3CM0A 4PSVA 4YXWA 3K70D 1ZNWA 4DSTA 2CJWB 1A5TA 2FPLA 5HE8A 3M0EA 2FEMA 2EWWA 4CF7A 3QQ5A 1Q1ZA 1SVMA 4RVCA 4IW3B 2QTHA 1IN7A 1IONA 4I81A 1W36D 2V1UA 5KO2A 4BRWA 1G4UR 1W4BA 2JDID 4D80A 2CLSA 2W00A 2B7CA 1MO4A 1MKYA 4FCTA 1FFHA 3KX2A 4B43A 3GJ4A 1C9KA 1NN5A 4UNNA 2X1VA 1G64A 5FH9A 3D7MA 5FTMA 4JVNA 4KLNA 1KI3A 2ODWA 1QF9A 1RRFA 1ZUNB 2F1RA 2CVFA 1U2RA 5DYIA 1P2VA 1RKBA 2IYTA 2GA8A 1K5GA 1H8ED 2A5FA 5EP1A 2XAUA 1M8PA 2RGNA 2VP2A 4LPSA 2OV2A 2P65A 4PAOA 1S0UA 4CRWB 3B13B 2XITA 2FV8A 1R0WA 2A5JA 3AUXA 3DL0A 1Z6GA 3W3AA 2DY1A 5JZVA 1LV7A 2PEZA 5AWFC 2Q3HA 4G1UC 4Q4HB 4KHZA 3A4MA 3SOPA 3QSYA 4XWOA 1X3SA 3CKLA 2FDCA 2WPDA 1ZVQA 1YZQA 3T06B 2KWIA 3B8HA 1WF3A 5JLJA 5LD2B 2H1LA 3MG9A 4D25A 1XMJA 2XOKA 1HH4A 1T8TA 1YE8A 3TKLA 1OXXK 1WRBA 2WSSD 1E2LA 2YHSA 1EK0A 2WSMA 1FOEB 3NEYA 3L0OA 4A8JB 2R9VA 3MJRA 1W2GA 1YQTA 3CPJB 3L82B 4Z1MA 5IF9A 3VNVA 1SVWA 2Z43A 1U98A 2XB4A 2WMNB 2NO9A 1II8B 3DO6A 3KXLA 1AKYA 3I73A 3JVVA 4LHXA 1E0KA 2G0NA 3EARA 2BMDA 4NMMA 4Q7JB 3WYGA 1AQYA 5LPNA 1KI7A 4XTCS 3BH0A 2YC4C 4ZDWA 1FX0A 4OQNA 1HA3A 4R7ZA 821PA 2QN6A 1SVOA 2ZRMA 3TBKA 2J0QA 1QHIA 4QKQA 4XVUA 1E2DA 2O8EB 5M04A 4M1KA 4C7OB 2NIPA 5EE9A 2PH1A 2ZI6A 3PUVA 3QKSA 2JLWA 3A37A 5KUTA 4RZUA 3PXGA 1EGAA 3BXZA 4BLPA 1XCPA 3KL4A 4UNPA 2DB3A 2AD5A 4IOKA 4C3ZA 1WXQA 4NCIA 1ZD9A 1DVRA 5JRJA 721PA 2GNOA 1KZGB 1UKEA 3C8UA 2WJYA 1AZSC 1US8B 2P0EA 3AGPA 2OLJA 4PSKA 2IYUA 4Q7MB 1KI4A 3AM1A 3WMFA 1CU1A 3KJHA 2BIFA 2QZ4A 3VU9B 4LUCA 4ARZA 2ZJYA 1E0SA 4Q7LA 2I3BA 2VO1A 2G88A 1KSGA 5B57C 2CMKA 3IQWA 2FA9A 3K9HA 3KJIA 1Q3TA 1BO6A 4A2PA 3L0PA 3PEVA 4JJZA 5DISB 3VR5A 1KDPA 4Q66C 2KSQA 4QGAA 3R8FA 3G0HA 4GSYA 4OI4A 2HT1A 1J2JA 2UVQA 2AWNA 1OKKD 2AD1A 2D74A 3MJHA 2JDIA 2GXAA 2JJ1A 5FL7A 5EP4A 2OBMA 4A0RA 3P32A 1GDDA 5H8WA 2CCJA 4PHTA 3JVUA 4DLYA 3VR3A 4NCNA 4LY6A 1FUKA 5FTNA 1JPJA 3MUFA 4YC7A 2ZE7A 2XZOA 2XJ9A 5J4LA 4RZ3A 3BD9A 3ASZA 4P4UA 3RS2A 4ESHA 1ZIOA 5D3MA 3GJ3A 3C5CA 4NCKA 2GWHA 4JLOA 2J41A 4ASUA 1IXRC 4LZZA 3UWKA 3X1DA 2OO7A 1I4DD 4US1R 2JLZA 4YMWA 1CBUA 4BFTA 3FTQA 5FBWB 4HUTA 1G8GA 3EA0A 3FKQA 3SBEA 4FWTA 3AKCA 3H1TA 5GADl 1G41A 3KKMA 1JAIA 3AGQA 4KODA 1E94E 1UDWA 4FMCB 2X77A 3N2EA 2BC9A 4BFSA 1Q1QA 2IYSA 3R7WB 1N2CE 3W90A 1QVAA 2G3YA 4YMSA 1E0JA 2WWGA 4PO9A 3SU8A 1Z63A 4KCGA 2IUSA 1XMVA 4AI6A 3FHCB 2D4HA 3DMDA 5KDOA 3AF4A 2BVNA 4V03A 3BC1A 1XEFA 3TVTA 4XOIA 1KYIA 1XMIA 1JECA 4J0QA 1MOZA 2HCJB 1OXUA 2ONJA 5B64A 3OFND 1Z5ZA 1IY0A 3OHMA 4RKFA 2ZRFA 2GRJA 2QI9C 4FCWA 2TMKA 5CDFE 2XTZA 3O8CA 4JKYA 4FIDA 2WTUA 4EPWA 2J59A 4YMVA 5GJBA 4DLZA 4PZYA 4NZYA 2BJVA 3LY5A 2MMCA 2V6IA 3FPAA 3PV0A 5CYPA 1R4AA 2F6RA 2HYDA 4MRSA 3RS0A 4ZCLA 4MDFA 4TWZA 2O8FB 1SXJB 3K9GA 4OKSA 4P33A 3LNCA 1ZD8A 4H9GA 1NVUQ 1VG1A 2EFEB 2WWIA 4TLDA 3LVQE 4ZKEA 3BB1A 3KUCA 2ZRNA 2B21A 1SVSA 1CR2A 1KO8A 1NY6A 2G83A 4A0GA 1HT1E 2J0UA 1IN6A 4AYXA 5EZ5A 1N0VC 2RGAA 1T0HB 1JB1A 5AUQA 1CR1A 2CHGA 2FPMA 1MRSA 5IK2A 1Q57A 2LCFA 4TYPA 2W83A 2YYZA 1W44A 3PENA 2VHTA 1OT3A 1I2MA 2AHOA 1NVVQ 1IAQA 1T8UA 4Q1CA 4PC7A 1XEXA 2ZI3A 4R9UC 4EUNA 1F6BA 1FL9A 1DO0A 1FP7A 1P7CA 2VP5A 2WMOB 5DLQC 1LY1A 3C41J 2XZPA 5GJWC 1E2QA 2QAGA 4GDFA 3R20A 3U7GA 2I4IA 2AFHE 5KHOC 2QMEA 3A8TA 2WIAA 4HI0E 4LOAA 3PUWA 1UEJA 2EW1A 4KITB 3GP8A 4M9XA 4A0FA 2QG6A 2H92A 1E2MA 4L8GA 4Q7KA 4K81B 2B92A 5JI2E 3AVTA 2QMHA 3M4YA 3B1VA 1N6PA 1E96A 2C9YA 1VMAA 1GKYA 3E5HA 2AR7A 2RGNC 2XGJA 2CCKA 3GEEA 1EWRA 2ZI7A 2A2ZA 1KTVA 3MD0A 4LJ7A 3AF3A 3DDCA 4URWR 1NVWQ 4DDVA 3N70A 3WBJA 4EDHA 3HU1A 4NBSA 4GT1A 3O8RA 1CXZA 1CJTC 4R2HA 4AG5A 1OPXA 2AXPA 4C0HA 1NLFA 3F3YA 4CEHA 4MRPA 3ZS9A 4CIDA 1OIWA 1KNXA 3OE7D 2FOLA 2GCOA 1G5PA 5JI3E 3WMEA 3GLGB 1IQPA 4DVGA 2YWGA 4Q4JB 1BMFD 1VIAA 2C9OA 4PPFA 4QGHA 3SJCA 1G7TA 3K0CC 4DLXA 1Z0DA 2QRZA 1X1RA 2FWRA 3C15C 3RRZA 4OHZA 4U02A 1FTNA 3NTUA 2FGJA 4GOJA 4A4DA 5AUNB 2F1HA 1Z29A 2ODBA 1QG4A 5CYOA 1N5KA 4PHGA 3T15A 1MO6A 2C03A 3ZIAA 2V1XA 4I1SA 4DCSA 2WWXA 1Z6YA 4HLCA 3TH5A 4S35A 5DYGA 1G5RA 4QFMA 4DC9A 1DAGA 2CJWA 4LBWA 1OH8A 1VKJA 2NPFA 3UWOA 4ACAA 2C95A 2CHVA 3DZ8A 4E5UA 2WOJA 1R2QA 1RYFA 3BK7A 3SYKA 1TNDA 2PCJA 5IDVA 4C30A 5D3MB 3U6KA 3EX7C 4A15A 5TVKA 3BFVA 2C98A 1UPTA 3FMFA 4CDGA 2GAOA 4OQFA 4Z1MD 5HZKA 2REBA 2ZS9A 4QRHA 2W6JD 5DE3A 2A3RA 1TU3A 1LB1B 3EG5A 3F0TA 4YDSA 3DVLA 1UBFA 3IPYA 4TLCA 4ZPXA 1QVRA 4AKGA 2KB0A 4DLRA 1JALA 2GEDA 3VNUA 1M34E 3K0AA 2CNWA 2IEZA 4B6FA 5JWRA 2A5YB 1IOZA 1E2HA 4RKEA 1J70A 1QDEA 4MDEA 1AQUA 3NH6A 1NSFA 3MWLA 4G01B 121PA 5G3YA 4GMXA 1VCMA 1E9DA 1TEXA 2V7QA 3UMRA 3SJBA 4HATA 1U0LA 3PFIA 3VX3A 4M1OA 4C0KA 2IA5A 5A5GA 2N1BA 1XX6A 4QGGA 4O2RA 4ZDIA 1VG9B 5FUYA 1UFQA 4KAXA 3LA6A 2GESA 2BWJA 1PZNA 2GF9A 3U3RA 3GLIE 5E3HA 1XD2B 1HUQA 4KO8A 2IYZA 5K8LA 2WWHA 4BLQA 4MYHA 5CB6A 3LX8A 3K0AB 3WMGA 2X8AA 2Y8EA 2IXEA 4KBGA 1Z28A 4KJZA 5C2JB 4JT2A 4JIMA 3CR8A 1AS3A 3PUZA 1Z0IA 1ZM2A 2QMUA 5HPYB 4OI0A 2DWQA 3TE6A 3P27A 2OESA 2WKRA 4IFBA 4B48A 4GRAA 4TTPA 4CW7A 3GLFA 3KZ1E 2QL6A 2QPAA 2OXRA 1T3SA 3QPUA 4OJKA 1S96A 3THWA 1E9SA 4GP6A 3A1UA 2J9RA 3AVUA 5KNCA 2VH5R 4EAQA 4D2IA 3QBTA 4AC9A 2JLYA 3ZS8A 3OE7A 3MLEA 4P3YA 4E03A 3KFVA 4DBLC 3U3OA 3VFDA 3VKGA 1AA9A 2EQBA 1C1YA 4Q03A 5F3WB 5IHPA 3NC1C 1QHXA 3L2OB 3NBZC 4B76A 5HR5A 2YWHA 2IX3A 1A7JA 1J7KA 1W46A 2YV5A 2FFHA 5FOWA 4IXMA 4A2WA 1JXMA 4DEXA 4TMWA 2QTFA 4Q9LA 3LXRA 1VECA 3MWYW 4XVRA 5KNDA 1PUJA 1KOFA 5FOUA 1UKZA 1RJ9B 4UQOA 1M7BA 4JL8A 2ZREA 2FF7A 4PQFA 3KUDA 4B3GA 1HT2E 3KJEA 4D81A 1WQ1R 5B30A 2ATVA 2PLRA 1AKEA 1G6HA 2Z83A 1CLUA 3A4LA 4LI0A 3KXIA 2DPXA 4JLPA 1QRAA 2VYFA 3IEUA 3WRXC 2NZ8A 5FPYA 3GLHE 4F4JA 1XWIA 1DAKA 1CJMA 1P4SA 4NYMR 4W5WA 4TYWA 4B3CA 1HQCA 1QG2A 3CRRA 5JS7A 4XWKA 4F38A 3FFBA 1N6LA 3SBDA 4BRUA 4C0SA 3KKNA 4KLZA 4OJQA 3IDQA 3ZZTA 4DLSA 1Y63A 3R9XA 5FUWA 1JEEA 1D2MA 1Z47A 3K0CA 4OQMA 1CEEA 3ICQB 3W34A 4RCYA 4G5GA 1B23P 2C04A 3CRQA 3LQRA 2GXSA 1G8HA 2FZ4A 3CPEA 1AM4D 1BOFA 1PLKA 2XNDD 4LHWA 2FNAA 2DR3A 4A9AA 4LWZA 2A78A 4GZMA 4B32A 1U90A 3AVQA 2XOKD 3GJ6A 4BFWA 3ZVLA 3SI7A 5FUXA 2WWFA 1R0YA 1WP9A 3TUJC 1NIPA 3TUIC 4PPGA 3ZDQA 2QSZA 4DSNA 3VKHA 1LW7A 1ZJ6A 1XEWX 3Q7PA 3K8YA 1G3UA 3CF0A 1F2UB 2JAQA 3NBFA 3TNFA 2EFHB 1G17A 2CE2X 4TLBA 2ZITA 3B5JA 2WHXA 3THWB 5FI0B 1P3JA 1ZC3A 1U0JA 2AK3A 2AFIE 1P62B 2V6JA 3Q5EA 4GPTA 2ZUCA 3P4YA 4IKEA 1QHYA 4BEJA 4TLEA 1OHHD 3IBGA 4L9SA 2ZUBA 1N6OA 3LQQA 1DOAA 3G5UA 5ELXA 5FBQB 3U7FB 4I1VA 4ITRC 3K0SA 1W48A 4EJSB 1YZKA 3RSLA 1JR3E 2JLSA 5H1YA 4TLAA 3WHLA 2GJAA 3NHBA 1QHHA 1G19A 1GUAA 1NI3A 1NF3A 1OIXA 1X8JA 2G77B 1ZD1A 3B7GA 2CEAA 4LYJA 2J5XA 1ZP6A 4MGKR 1FW6A 2IXGA 1R5OA 1P73A 3CNNA 3LVRE 1MT0A 2QM7A 1GOTA 4A0HA 4B73A 2QY9A 4URXR 1WMSA 3X1ZA 4B33A 3ZVNA 2GZDA 2KBEA 4NYMQ 5TY0A 2WWWA 1A2KC 3KDSE 3SEAA 3DZDA 3OIVA 4C9BA 1QHHB 2IUUA 4IVRA 5JFGA 1J99A 1E2NA 2NGRA 4P4SB 3GEHA 1XTJA 1WA5A 2X2FA 4B2LA 5CM8B 3KQKA 3R7WA 2GKSA 2BM0A 2JCSA 4PANA 1Z2AA 1KI2A 1RC8A 2RHMA 2BBSA 1NY5A 2FH5B 3DMNA 4AK9A 2PLFA 2FN4A 4DWJA 1S9HA 5HCIA 2Q9CA 1DAFA 3LH5A 5KSYA 2JIZA 4Q18A 2O8CB 2FSHA 1JR3D 2RMKA 4HAUA 1D9XA 2F43A 3ZVRA 2X2EA 4G5OA 5F9FA 3TJZA 1VCNA 1KDOA 2FG5A 3TR5A 4L4UA 2FU5C 1WE2A 1EFCA 1S1CA 4KVAA 3ADBA 1GAJA 3KB1A 1KI6B 1A1VA
chains in the Genus database with same CATH superfamily
4ZIRA 1QYIA 2B3TA 3DTVD 4TTRA 3T3HA 1BHO1 2NSYA 3O4JA 3LP8A 3WI7A 4LY0A 2OCLA 3LGAA 4ZTBA 1Z8DA 4RQAA 5JWHA 1GAQA 1PEKE 4MMZB 1O0BA 1N25A 4BLRA 2OCYC 3Q6MA 5JD6A 2AYYA 2IEYA 2MINB 2PO7A 3NBAA 4UARA 3PX3A 4O02B 3P52A 3M82A 1K97A 1N2IA 1H65A 4O4LA 4O2AA 1Y89A 1VL8A 1XVUA 2P30A 4RIEA 4R84A 4X20B 5AM0A 4AJLA 4CVNA 3I83A 1C3XA 1EM6A 1OZGA 1UEXC 3P0RA 4F6RB 5I4BA 1YU9A 2D5LA 3DMTA 3CISA 1PR3A 5H9WA 1KBZA 2AXEA 3A9RA 4KN8A 4CMKA 3LKBA 4W5HA 4ZDJA 1V7CA 2EQ5A 1MRNA 1I7PA 3ZU6A 1NUQA 4GH5A 3QOFA 4R0NA 1KI8A 2JGAA 4LC9A 4EYGA 1TAGA 5LSAA 1N9KA 221PA 2Z2JA 4BATA 3ON5A 1K7EB 1Q0TA 5EWLA 2FEXA 5YASA 3VHXB 3MCAA 1QP8A 2Q5LA 2DU8A 2PNJA 3NORA 1SXJE 1CZOA 3M5CA 2Q4BA 3ZX5A 5F1KA 1NMXA 3RYCB 4RZSA 4CV3A 4LOKA 2WFAA 5F5LA 2OB2A 4G09A 1CQWA 3AUFA 1A2OA 1DADA 3A3KA 5TR9A 5BQ5A 1ACMA 4G9BA 1Q11A 3G1UA 4PZ0A 3LRTA 4C7BA 5TF0A 1WUKS 3EAGA 3Q2OA 2Q9AA 1THGA 1Q6YA 3B7WA 3X2SA 1EXMA 4Y6SA 1ECCA 2AMYA 2E9SA 1K63A 2FVXA 2DBZA 1WXGA 3AB7A 3AHIA 3K15A 3T9EA 4A2QA 1ORTA 2NZ2A 2WHQA 4K9SA 5FOSA 3RVRA 3ZCSA 2R2GA 3B89A 3WV5A 3IB3A 3HDGA 2D1RA 3QNUA 4JU9A 4RXTA 5A0FA 1PLLA 2ZB8A 4NF2A 3D0QA 3D6TB 1ECFA 4O4IB 2PUBA 2FRXA 1GL3A 4BBAA 2OHGA 1WZEA 3THOA 4BV8A 4RMIA 2L0XA 3V1UA 1EDEA 4WXMA 2RAVA 5IAAA 4RESA 1PZFA 3GFTA 3QF4B 1QDUA 2BJWA 3Q9LA 1W0JD 2BEVA 4FGZA 2J6CA 2OBFA 3SMVA 3DNPA 1HY3A 3F3KA 2WYVA 5ERGB 3TECE 4S05A 5IPFA 4AURA 1OLXB 1N36B 3NANA 1SKUA 4OLBA 3MLAA 3RR2A 4D9CA 2FEOA 1XXHE 3F6YA 5G02A 3SVTA 3HB7A 5AI5A 5C4IA 3M33A 1H8EA 2J67A 3GP3A 3U3XA 5C53B 3VR6D 1OAOC 1Y0BA 2V9ZA 4PAQA 3U7EB 4A92A 1XF1A 1VI5A 2AQ8A 2WNSA 4Z0HO 1BRTA 1JR4A 4LZJA 1KSJA 2J9FA 5FFNA 3CV3A 4P3KA 3VR4D 4HZUB 2ZQYA 1RHUA 2FPKA 2RHLA 4PXAA 4X92A 2ODTX 3HCAA 4LTMA 4LRTB 2GK6A 4TUYB 5BQOA 3BXPA 3JVDA 4MUBA 5CLFA 5TIIA 1FYEA 5TRTA 3KUUA 1QJ4A 3SQNA 1BE1A 3RTBA 3OOYA 5JPIA 4GI2A 1J8VA 2PRSA 4MOWA 4U9IS 2COEA 1L8AA 1VL6A 3GJ7A 3IDAA 3T5DA 1NJ2A 4PAWA 1ZOLA 4XJTA 2O3UA 4HMPA 4YQZA 2DUWA 4OA5A 3IR5A 2KI5A 2FSFA 5JXJA 3ZZ1A 2XCSB 3K5HA 2CXPA 4JWKA 3ZU4A 3C8HA 4ENUA 1F1BA 1ISIA 2ZYUX 2KPOA 4FMCF 1VJCA 2GYUA 1ZUWA 2P9GA 2W5UA 2PZJA 3CRZA 1BIFA 1SB9A 2PX6A 3IQIX 3K2QA 4PO8A 5EQJB 3TPZA 3IJPA 3AXTA 3EIQA 4UFPA 1NOIA 1A27A 3R5FA 4PC2A 2WF7A 2FSSA 2HSJA 4S1WA 4MW4A 1IN8A 5I7AA 4MI1A 3ZGYA 2I2XB 4B3TB 1YZFA 2RGDA 2B4RO 2VUTA 1STOA 5AQ1A 4PCVA 2GJ8A 1JIKA 3TZCA 2GAFA 3N0WA 3UYKA 4YONB 1YF3A 4YUZA 1E3EA 2WILA 4EH1A 1XXHB 2BJHA 2VTBA 3O8DA 3L7AA 4D74A 4HNGA 1WKCA 2P9QA 4GOKA 3E7WA 4GX2A 1M2FA 4CCAA 1YB1A 1IY2A 3F46A 4CF5A 1LQ2A 4JZKA 1BEUB 5F51A 1WZNA 1P4HA 4OYHA 4IDAA 3H16A 1E3IA 4TSFA 4JQCA 1JIIA 4ZZIA 2ZZNA 3HVIA 5KHLB 4BE4A 3T1VA 3HMKA 2HHJA 3I6QA 4YA6A 2CEKA 3UMSA 3DJYA 5IDXA 2HXYA 4F2DA 1L6IA 2XPCA 4M0DA 1ZCJA 4NU5A 1BH6A 3DHEA 3N2KA 1KXZA 3LZDA 3SBXA 1YR8A 4M98A 3CEMA 4IJWA 3PC8C 2F9LA 1TYAE 3DAPA 4PYMA 1DTWA 1WXDA 4A36A 4PYQA 3S27A 4CT5A 3V4RA 2EZ4A 3OPYB 1JHDA 3WLRA 3C7AA 3WP1B 4QTXA 1EFHA 4E33A 2G4VA 1GZ3A 5CCBA 1Y3AA 4UMDA 5KJFA 5J2TB 4HY3A 1TFRA 3Q8WA 3ITEA 2PVPA 5HM8A 1EUYA 2OORA 2BT4A 2QXUA 1V6SA 1GYRA 2QTLA 4IIBA 4XSVA 5FBZA 4F9TA 3JQGA 2E6KA 4ZIRB 3QVWA 4QWMA 3RODA 5IH7A 3LAWA 1R00A 2V7XA 3EDMA 3S2SA 1P1FA 4MP3A 4PTYA 2A4KA 3RS9A 4FOPA 1KZ6A 1TFUA 4ZAWA 4D4LA 1CUVA 1KAOA 1PJSA 1I32A 2JFXA 4OV6B 1NVTA 3GNLA 4WGFA 1Z33A 4RETA 5EZSA 4R4JA 3QHPA 3G13A 4DLLA 4N76A 4CG1A 2QL9A 1C80A 3CUTA 2AN5A 3B6KA 1LEHA 3DAOA 1FNCA 3FTPA 4UNQA 5J47A 2XGGA 2R44A 2CXRA 1XTQA 4L4SA 4RZIA 3C4VA 3SXPA 1PV4A 4M8NE 3ZD7A 3JYHA 2XRZA 2GBLA 3OETA 4UU8A 2VDNB 5ULLA 4ESEA 1J0XO 2CE7A 1H2BA 2GPWA 1MPXA 4B3FX 4LC0A 1I4TD 3DV9A 2ONZA 3NP7A 2YYAA 4H7KA 1W94A 1ZJJA 4D4JA 2LGJA 4K3UA 3O8QA 4U1RA 5HNKA 1KETA 5JNTA 5ALQA 3NOXA 1MT3A 2BGKA 1GFZA 1F0PA 1GNPA 1Y4SA 2VNJA 1NU6A 3O1IC 1FVOA 4LZNA 3RKSA 1OGJA 1UF9A 2FSUA 2NZWA 5LD2C 4AG5A 4K6KA 3IESA 4X00A 4KVZA 3HFSA 2IYXA 3MPUA 2XQJA 2WFLB 4KOEC 3LW7A 4X1OA 2CUTA 3UZUA 3M81A 2O48X 4HWTA 2IBTA 1EVEA 4NV0A 4MV1A 4OM8A 1TEVA 4P5DA 1B8NA 4AS2A 2D5IA 2J07A 1O3YA 3U19A 4MO2A 1JT2A 4YDHB 4JLJA 3QE0A 5F3DA 1MB3A 1U0BB 2ZUUA 1ZL0A 3L7MA 3MNFA 2AL7A 1XU4A 3KOYA 3HB5X 3LBNA 5CT6A 4C0AC 2ZIGA 1P5FA 4MTLA 4LPKA 1OFTA 2GZ1A 3MMSA 1KJQA 1XP8A 1E1LA 2VRNA 1SBNE 2C2XA 4LWPA 5DASA 4W6ZA 4K6OA 3BMOA 3W3AD 1XB2A 1HRDA 2YIMA 4JLWA 2JEYA 2VZEA 4CIAA 3B1WA 1XZPA 1R4ZA 3LX6A 3M6UA 3NALA 4KMRA 3RRXA 4LSMA 1RXYA 1WSAA 1MQ9A 3IHLA 3DE2X 5FADA 1YA6A 3D5QA 5K4GA 5K3DA 4BB6A 3ZJVA 2EBUA 1UDRA 1IBMB 3IOYA 3GT0A 4RH1A 2F7SA 4TWRA 2QTNA 4JR2A 3E05A 4IV0A 4UXHA 3K16A 4DV4B 2VAMA 3AZQA 4YT5A 1ECPA 3RVLA 1DRJA 1E7QA 1QOZA 1DPFA 1FDOA 4G26A 5JAIA 2OUIA 1OI3A 1SEPA 3CR7A 3IUEA 1YZNA 2XODA 2PVSA 4JB0A 3K8OE 1PX2A 2HZBA 3AY0A 4GPBA 5ALTA 5F2EA 3T38A 5LBUA 3BHIA 1NVXQ 4PHCA 4RIGA 3VSCA 1H2HA 4QNRA 2RAPA 5DIZA 2H08A 4HDRA 1NWHA 4O4LF 2W2MA 1M6EX 4TXLA 2DLCX 3HSYA 1CJKC 2R5WA 4PGFA 1VA5A 1JHRA 5LLSA 1BJRE 1JJ7A 1Y8CA 3CUVA 4D3YA 2XZLA 4NZPA 3D6NB 4RSMA 3PVZA 1T9GS 2DWPA 2F9FA 3BCHA 4QO7A 4C3UA 4QT4A 2BTEA 1EIZA 3CH5A 4BCDA 3CLTC 1VG8A 2XBLA 3CUUA 2GM9A 5G3ZA 3R0VA 5LZ2A 1GVHA 2G0AA 3CB4A 3S81A 4PFJA 1ZR4A 4M0PA 1ZXXA 4QLOA 2BCJQ 2KJQA 2PSEA 3X1XA 3PITA 1RTTA 1O94D 4F5ZA 1U7UA 2IYAA 4C78A 1DCTA 2ZBUA 1Y9ZA 5CJPA 3LFUA 1J7JA 2D3TA 3T7IA 5J4KA 2XRYA 2IIPA 4UU1A 4XB2A 3HDHA 1MVNA 4BFCA 1F0YA 4J4BA 1PL8A 4YUYA 2XD9A 3LQYA 4G1VA 4I5FA 1PVDA 2R6AA 1VSVA 4TMTA 3BF8A 5T4HA 2R96A 2AG5A 4Q5IA 3M6MD 1ISJA 4JSYA 4ZCSA 3JTMA 1L8QA 1WBBA 4NIMA 1BW9B 2J8ZA 4U2EA 1NMEA 3A9TA 1P5JA 2X23A 2ZRCA 3OJ0A 3KK0A 1CS4C 2YIDA 4FFVA 3T5AA 1MCZA 2DH5A 1NYRA 3MERA 4LNHA 2BI4A 4OG2A 4AG6A 3LDFA 5EKUA 4YJFA 2OUKA 4KBYA 3PUXA 1U3GA 3TGPA 3X1YA 1U81A 1X8KA 4PQYA 2RHOA 3PGKA 4MARA 1KXJA 1EBUA 3FH0A 2PX4A 2ZSHA 1PDWA 3A1CA 5F9MA 5EPEA 1IQRA 3OD1A 5BYJA 2HBRA 3A36A 3VJLA 3EHEA 3D4NA 3ZHYA 1DAHA 1X7WA 2PLWA 3PRYA 4KPUA 3AL3A 3L5OA 1Z88A 1E2FA 5B3AA 2NSJA 1B26A 4OLJA 3RQIA 3U13A 4ITVA 4B71A 3WIOA 4J9UE 2HREA 5BSVA 5JMTA 1JKJB 3DDSA 2YC2C 1U5CA 3K70C 1CD5A 2IHYA 3KG2A 5F7XA 5G1NA 3PFWO 5IAJA 3TE7A 1O97D 2ENUA 2WIKA 3K2BA 1W19A 2CYAA 4ZGGA 5C18A 1P7VA 3LCMA 2QMQA 4RAQA 2CZGA 5FI1B 3AUKA 1E3MA 1MABB 1W52X 1EAMA 1W8IA 3UJ9A 4ALIA 4BV2A 3QYAA 3IVMA 1VC2A 2YQ5A 1CJSA 2VTDA 2CNDA 1E9CA 3GAAA 4WZAE 4JLBA 4Z0NA 3JTEA 1N6RA 4KO4S 2H29A 4FEEA 2EIHA 4AS3A 1G18A 2VWGA 2CMHA 4LFAB 4U00A 1A8UA 5T64A 1YONA 2WHEA 1P3Y1 5CEFA 4H4DA 3DBOB 3V6MA 1N2CA 1VSUA 2XT6A 1BEZA 1VBFA 3KKPA 4Q82A 4TYMA 3TIFA 2DPHA 3E9RA 1NMQA 1L5GB 3RJTA 4N01A 1EVLA 4IDDA 3TSWA 2JF0A 2WUDA 4CFYA 1UZAA 1WKVA 3MJTA 5KVSA 3M9WA 3QMWA 4JFAA 1MAWA 2C8KA 1N6NA 4YPFA 2Q1WA 1TLTA 2REQB 1VA4A 3SE7A 3V33A 3FNFA 4TN5A 4DXAA 1Y6JA 1E2JA 3N6VA 1VHJA 4TTVA 5EP3A 3FVTA 2UYCA 3FFTA 1JG2A 3NHUA 1SIUA 3OZXA 4I4NA 3D8HA 4YP0A 4QGSA 1TPZA 2L42A 4X20A 4C0HA 1QTRA 1X13A 2G71A 4LOHA 4TQ9A 1UBKS 1PWEA 1GNSA 2XCLA 3UMYA 3PKIA 4IL5A 1RKUA 1U99A 2ORWA 2OV8A 3EQ6A 3OM0A 1UMDA 2AC4A 2XNJA 1NHGA 4FJ2A 4I46A 4EQ6A 5CD1A 4EEZA 1YRQA 5CTAA 4PBSA 3OTWA 2IP2A 2HV8A 1MEEA 4RPGA 3VH3A 4DIOA 4DVJA 5BMVB 3O74A 4NHEA 1XZCA 3UANA 1W9HA 2J33A 1UBNA 2XE8A 3BERA 4IDHA 4IYJA 5K3AA 2W58A 3G68A 2VJCA 2ZSUA 4MUKA 5BR8B 1PK8A 5FPPA 4HTFB 3A3PA 3FUUA 2XF8A 2W70A 2F1KA 3AR6A 4ZVOA 4J1NA 3JQ8B 5LBTA 1R5NA 4HVAA 2XTNA 2ROQA 1NJ1A 2XVAA 3DB1A 4H17A 5IH3A 5L4LA 1KBOA 4GOOD 2Q3FA 5LVAA 2NVWA 2GKGA 1EX9A 1JDVA 3LM8A 1C0KA 1XHLA 1UMBB 2W4IA 2ZSAA 3W5CA 1NG1A 1GPMA 1WZCA 2LKCA 5KDLA 2PT6A 4KE8A 3T3OA 4LY9A 3T3IA 4J0EA 3RFFA 1L5KA 1Z5VA 5LMZA 1FVHA 2D54A 2JHGA 1G8KA 1TADA 3O21A 2JD1A 1Q0HA 3DMFA 4GU5A 5FORA 2IIVA 3HABA 3UHAA 2NX2A 3GEGA 3HUEA 5TX7A 1GSOA 1H1LB 4ROTA 3ZJ5A 4I4CA 5F12A 1TECE 5IULC 4Q24A 5IUNC 1W30A 5IVHA 4RTSA 1EFAA 3ZGZA 3V4OA 4QFCA 3KXPA 2Z2KA 2VKQA 1EFRA 2BELA 3QKRB 1HFKA 5E8RA 3UIEA 2FPRA 1FTQA 1VPLA 1W85A 1V9SA 2VG8A 4BP3A 4YK7A 4A6PA 1ISHA 1Q3HA 1VXOA 1YVRA 2GN8A 4HGYA 2GEKA 2ZB3A 1ICIA 2C2YA 4YJGB 1OU0A 3OM1A 9GPBA 2AMVA 2NPIA 2XE4A 5CVUA 2JK1A 3T1NA 1WD5A 4LYYA 5TMPA 4TOIA 2JJ2D 4B3XA 5HJEA 4JSRA 5IN5A 4RVOA 1PGQA 1D4ZA 3G2QA 1S7GA 4CDRA 4GSLA 3B6ZA 4UBJA 1CERA 4YUVA 5CA1F 1TKCA 2AG0A 3WRYA 3IVGA 2VZLA 4AKEA 2O05A 3PPYA 4LGVA 3EPHA 5JJIA 1KJYA 1BQ4A 1DBPA 4X24A 2ZBVA 2RD2A 5G0VA 2WUGA 2X5NA 4IZIA 5JCZA 5JQGB 4M9QA 2E4WA 2VP0A 2V5VA 3CE9A 3ZDYB 5D2CA 2G6TA 3MIZA 1NURA 1NBMA 3PIRA 3K6SB 2RG7A 2QRPA 1UEIA 2QG4A 5CLLA 3RI3A 3A3YA 1AJEA 4RK7A 2PZAA 4MLZA 1OFUA 1GYQA 1N2CB 4JUDX 1C7EA 2IXTA 3PQCA 2H2IA 3GCGA 3SF0A 2BBTA 4MKXA 4DCUA 2J5QA 3B9PA 6ADHA 3E48A 1SULA 1YIOA 1ZO8A 2C59A 2WKQA 3E7DA 1CK4A 2NUTB 3GUCA 4KE9A 3R7DA 1NP6A 3FWHA 2ADMA 3FI9A 2H5LA 2PMDA 5HE9A 2EX1A 1TZ2A 4W7IA 1UBMS 1ZM9A 1YJ8A 1G55A 2R3SA 5SZJA 5CAEA 1ETHA 5DNCA 1YFKA 3BXGA 3FWPA 8ATCA 3CUEF 4BAGA 2CYBA 3BL5A 1UZMA 3QW4B 4GQBA 3VISA 3DJFA 1IJBA 3L1VA 3RKUA 4HYQA 3E4CA 3PQ5A 3SOZA 1DXHA 3GFPA 3EE6A 2PJUA 4Y0VA 3RW9A 3C39A 4PLWA 3CVXA 4CG0A 1FTGA 3ZK8A 3QFTA 5E9WA 1O7JA 3QF4A 3HSSA 1K8RA 4BN4A 1W6UA 1AGXA 3BWEA 4MS1A 4FN4A 3D2BA 3DTNA 3NWOA 1BA2A 3ORQA 3LWDA 2XNDA 4E0BA 5L7WA 3IDFA 4Z9FA 1F51E 5E7IA 1NX6A 1D04A 2CXNA 4JNCA 2XXAA 1J9GA 1TM2A 3GQVA 4YVFA 1GNQA 4BLUA 1SHUX 1V3UA 3VUEA 4IICA 2QIPA 3O9MA 4DY4A 5AK4A 5JBQA 3MTIA 4ESVA 2NSHA 3R9IA 2G25A 2OD9A 3CX8A 4HQLA 3QXHA 4RE5A 3B20A 3IOBA 1L5HB 2H2HA 5T4BA 2JI7A 3FMIA 1BE6A 1SMKA 2H1RA 3E1KA 3QEJA 2FETA 1JLMA 4DREA 3OICA 1R0SA 3QQPA 4Q3CA 4KAAA 5H16A 3RFVA 2AC2A 2PKQO 1KYWA 3WSVA 2VPIA 2Q28A 3EF3A 4D9HA 2JAHA 3VR2D 1DC8A 4MV5A 1XZEA 4XYEA 4D6PA 3PGXA 1RRPA 3I9NA 4MQ6A 2O7NA 2R68A 1UJBA 4A26A 3IAS1 4OD0A 1EMDA 2WE7A 4ZI7B 3I5XA 2C7GA 3ZNOA 2AIRA 2ZR8A 2D2EA 1EJBA 4O2LA 4DLYA 5CFNA 6YASA 3UV3A 1M8FA 5GM1A 2I2FA 4L3WA 3TL6A 3VR3A 5F9HA 1PTJA 2R4UA 4U0KA 1GRQA 1FU8A 1PWHA 2FSVA 3KOXA 4BEBA 1NKSA 3DEJA 2CDNA 2D8AA 3L7LA 4D4IA 5T7BA 4UBIA 1W87A 3MGKA 3EGOA 3P71T 1BVUA 2Z6UA 4FGKA 4ZQFA 2EKPA 5L9AA 1K3FA 2ODAA 5ESRA 1KQNA 3LK7A 3EVEA 4GBGA 5LN1A 5DU2A 3WK7A 3IP5A 3Q8MA 1TKAA 4NV3A 2OQVA 1ZM3A 2JA1A 4B3BA 4EECA 4PRZA 1CR0A 1G1MA 4A73A 1Q91A 5ILQA 1ZD2P 5EINA 5LL6P 3Q6IA 2COKA 4YP6A 3QUBA 1L5RA 1E99A 4GI1A 1GSIA 5AKLA 4EBFA 3PGMA 3K0BA 3W4IA 2ORED 1WBJB 1F4PA 2F1JA 2C83A 4B4UA 2ZB4A 2ZDQA 3H2JA 4LJKA 3LLUA 4H6WA 3EFOB 2PL9A 3G17A 4RIFA 3VH2A 3ILXA 5KINB 2QXYA 1KFBB 1OI7A 1XCGB 2IEDA 2C5SA 2AUTA 2FLVA 4YIKA 2ZJ7A 3O92A 5D7BA 1DCMA 1IB0A 4JYZA 1R50A 3O7WA 1URPA 2EJTA 3D64A 3GDHA 1TZJA 1ZH4A 2XUIA 4EL0A 4KU4A 2H1FA 2O2YA 1GLVA 1KR2A 3UUWA 2R4QA 4DT1B 2Q45A 3OFJA 3UYLA 3PZBA 1YRHA 1WNFA 1A4RA 4NU8X 4FFBA 4I5DA 5HK8A 3MSCA 1ABEA 3RJZA 2P2LA 1TYEB 3WY9A 4F4DA 5A04A 5DNUA 4HVCA 2VK8A 1MFPA 1QANA 2I3ZA 3K1ZA 3S8EA 3ZQKA 2BEUB 1VJ1A 3E03A 3ELUA 4KQFA 4QYIB 1LDEA 1Y8ZA 3GJ5A 5LMCA 4BNDA 3CBQA 3G23A 1S8OA 1Y98A 3ZOZA 4IHJA 4NEQA 1LCIA 4XFDA 5C80A 1CF2O 3T12A 3L43A 4I0WB 3TB4A 3WWCA 4RPHA 3D6AA 4F21A 2X0RA 4LDJA 3AVWA 3FKSD 1PR9A 4IHAA 5JECA 4HWRA 1FFSA 2I1VB 5LQNA 1SCQA 3PBKA 5EHZA 3D1LA 3ZHRA 2I33A 1FMCA 4FYWA 4BGEA 2QP3A 3H9QA 3R1IA 1PR5A 4V2IA 3ZHXA 1R4MB 1H2XA 3QEMB 5B4UA 1DE0A 1GPUA 3W9UA 1JAHA 2R8BA 2G9NA 1LA2A 4RHYA 3GRRA 3QFFA 2VS1A 1APBA 1EIWA 3I62A 2AA3A 4R16A 5C8YA 4RTQA 2PAFA 2UYYA 2ZU0C 3FWNA 3N6RA 4BJ5A 3QM1A 4B9AA 2GZRA 3GNTA 3TQFA 1MB0A 2X5OA 3FZYA 2ZRAA 1MEOA 3LBYA 1ZK4A 3V1MA 3EODA 3QKSB 1O6BA 4LDNA 2V45A 1D1PA 4QUDA 1USKA 2PK3A 2QL5A 1QPBA 2ES4A 1ZJ4A 4WXHA 1KDVA 4TVSA 1K7CA 3CVWA 4R3WA 1SXJD 3PDJA 4KQ1A 1KDRA 5DLYA 3VH4A 4HGQA 5TV2A 3PNKA 4DADA 4LGYA 2FG7C 2OCIA 4JUCA 4JXZA 4B6OA 5DHQA 4JL6A 4X66B 2J7KA 1PNTA 2CCGA 1JJAA 3UMJA 1Z7BA 1U3CA 4BGIA 2L82A 2NXWA 5ICMA 3IOEA 3HWSA 2BGWA 1M8GA 1FLAA 1QWSA 2PYDA 1XQVA 2AX3A 2R66A 3FNQA 2M1XA 4DM3A 2Q6TA 3PC3A 4F6RA 4FGLA 1D1SA 1BZYA 4KN9S 1V11B 3DEAA 3ABZA 1BCSA 2P2GA 3RYHA 2E5WA 2E4VA 2IYFA 4EITA 4F4UA 2JAPA 2NAFA 3LBFA 4TN1A 4CFZA 2NM0A 3NKLA 4L3VA 2ZE6A 1JTEA 4D3FA 1P4RA 3CIOA 3DL2A 3ENWA 4NCHA 1TF7A 2ZS7A 2V9PA 4OQZA 4W63A 4YHBA 2GFHA 3WXBA 2VHEA 4M0FA 3PJGA 4L6AA 5J2TF 1WCIB 4AJEA 3ZDBA 3GF4A 2GM4A 3CEAA 4DV3B 1C1XA 3FSGD 2HDHA 1NC1A 3KR2A 3D3QA 3ILVA 4P7BA 1Y4DE 3KKQA 3DAFA 1BSVA 1V2GA 1CS0B 3VC3A 1ZXLA 2XNKA 2V6BA 3FAZA 1VPEA 3GLIB 3I9MA 1RXIA 7REQB 3QWIA 3R3YA 1NNEA 2M1ZA 2RKWA 1JT9A 2NG1A 2FPIB 2Y1DA 1B2RA 1K3TA 2HL6A 2ZYWX 4ES6A 2QD3A 4Z5XA 5CLJA 4PS0A 3EG9B 3HJUA 2Q7OE 4GF5A 4AO6A 1A4XA 4F5EA 4KC0A 5KOIA 1XFAA 3Q1LA 3TSYA 4MUMA 4DIMA 2KM1A 1JI0A 1PSZA 3OCVA 4MYTA 3DAGA 4U2BA 4TLLB 5LP6B 3OZRA 1S3GA 2WT4A 4UXJA 3BXEA 1IJFA 4O3MA 1RMYA 4J0IA 4E3ZA 4QAQA 4X65B 4KBFA 4ZVRA 1RRKA 4XQEA 1T8YA 4IJMA 4JT8A 1Q7GA 4WADA 1KK2A 3WHPA 1P3DA 2H8GA 1H5QA 1XPJA 2HXSA 4M1ZA 4XCXA 1A5BB 3JAWA 1J8QA 3QEMA 3CRMA 4Q9HA 2AR9A 1ZSYA 2UYGA 1K6EA 4LX8A 2PYIA 3RG2A 1PJTA 1U8YA 3CRW1 4BTLA 4CFSA 3EQZA 2W42A 3F7OA 4AZSA 1UBJS 1W93A 1YQDA 2WKSA 4QE3A 5BT9A 1U2GA 3T41A 1XCMA 4E94A 4LHYA 2FPXA 2A84A 2J1LA 2Z6VA 3FKSA 3HNRA 3K9NA 5EMHA 3RO7A 2YXDA 3W8DA 1OA0A 1PD1A 2RKOA 1HE8B 1KAEA 2EFGA 4RORA 3IXLA 2VDJA 3RJ5A 1RADA 3BA1A 4ZQCB 4DG9A 3B2QA 2EW2A 3SE0A 2VXBA 1KKLA 5KWSA 2P35A 3QZUA 3VPFA 3GLSA 3H11A 2QZ9A 1XVAA 1W9MA 2E37A 3A25A 3BDVA 5FNZA 2OGSA 3NNSA 4JC0A 1M0EA 1EFKA 2XXBA 3KZCA 2C42A 5CFQA 1SVKA 1Y1TA 3LWNA 1EJ2A 1DKLA 2OHJA 2FUG1 4WSOA 5IDWA 2BKEA 2NO0A 4B09A 3O8NA 1PQWA 4N40A 4M9CA 2PX0A 2V9CA 4YJFB 4E5MA 3QVUA 3RWOA 1DUVG 4IDOA 2GZSA 4L0CA 5C31A 5LOVB 3E2IA 4TYNA 1ZINA 2FKNA 1U4SA 2NAPA 4MHSA 1LBSA 4BVJA 4JVLA 2J7PA 1QCCA 1EK6A 2AE2A 5CURA 5FR2A 4FEYA 3G89A 4YRDA 4EVIA 4M2LA 2PMWB 2GETA 2BGGA 2IF2A 1I3MA 1UBCA 4TKUA 3SKXA 3U4QB 2HK6A 3IMEA 3BHNA 3V6LA 1AUOA 1RJEA 1X1QA 2A35A 2FR1A 3G9UA 2EZ8A 5AUPB 2HW8A 4QODA 3H13A 4CCWA 4XSHA 1AY0A 5HCNA 2PQ2A 4JJ8A 3BRWD 3EOBI 4YI3A 3QVMA 3AHJA 1KDTA 1R12A 2JGNA 1H6CA 4I9NA 2X9NA 1YBFA 2HU5A 2J0UB 3R7SA 2O1EA 1L8XA 2PX5A 2GHQA 3KQPA 1E4VA 1ZHHA 4PEVA 1F8UA 3CEJA 2GSWA 3ABSB 3FWYA 4FUQA 4EBBA 1BX1A 2EFYA 3AKYA 2WAXA 3F2IA 4PYLA 3RVMA 1H66A 1WNTA 1U7ZA 5A0VA 1JILA 1Q0RA 3A7DA 1VBKA 3PR1A 1F20A 2ZRHA 4D8VA 4RFLA 4DCGA 5J4YA 4E5NA 1SKQA 4RM3A 3AO0B 1MR3F 3WGNA 4QFBA 5IXYA 1PUIA 1G16A 5CNIA 5IWCA 3ZYCA 3M6LA 4P5PA 4RZ2A 3PLNA 5FBLB 2ZCJA 4OTZA 1OSNA 3B1ZA 3ZDRA 4B3SB 4UM7A 1G4HA 4OMCA 1D5CA 4MQUA 1G21A 3HA7A 3H5AA 3KKZA 1CDEA 4S0ZA 1XROA 3EFOA 1EDZA 4LQDA 4XD7A 2AKAB 3A14A 3MS4A 1S2DA 2GEBA 2P68A 5BWNA 2VFAA 3KSMA 3G2HA 4JX8A 2I55A 2BGNA 3R6DA 1LX7A 3FOBA 2EATA 1YZHA 2XEXA 2IW3A 3ONFA 3SF8A 4D98A 1QQBA 4PSDA 3PNLA 5IZCA 5KTMA 2HYIC 2GEVA 2UDPA 1TU0A 3AKDA 4L1KA 2AW3A 3I42A 5EQDA 4UNRA 1REQA 2FWNA 2WNIA 3JQBA 1MMFB 3FFXA 2FFQA 1UKVY 3FYDA 3N8HA 4X54A 1NUUA 4XJXA 2BEUA 2OV3A 4PX2A 1HDIA 1MHTA 1PS9A 2C97A 3P2EA 4XVQA 4DMMA 4W9MC 1CV2A 1GR0A 1WEHA 2HPZA 2J46A 3GNQA 3HADA 3IODA 1X7YA 3W6OA 1EFUA 3SIPA 1WXHA 2OXEA 4FX2A 1EK1A 4G0YA 1PGNA 1IN5A 4Q4JA 3ZE0B 4KRGA 3AR9A 1DU4A 1EFRD 1H9AA 2YFYA 3CZ4A 3D3JA 3H5VA 4R69A 5CHEA 4IF6A 4L2IB 2DQYA 4TTJA 4HX2A 3CLRC 4PTLA 1CC1S 3NEAA 1UPAA 1MQ8B 1KKMA 4UM5A 5E95A 3M6XA 3QFHA 1J21A 2C3OA 3NDPA 1CETA 1T9BA 3Q0IA 4GXQA 3WMXA 4JOCA 4AO7A 4C5AA 1KZ4A 3WFZA 4EG6A 4LGMA 3GMIA 1V5IA 3UA3A 1HM5A 1TE2A 3OPXA 4NXNB 1E7RA 5L3QA 4YJDA 3K2EA 3GIDA 1VYHA 5ED0A 1BVRA 3H18A 4J16C 4O4HA 4XA8A 5KJ6A 4ZMBA 1GA1A 3ZVKA 4JBXA 2IYQA 5FTWA 4G5RA 2NACA 3WGZA 4CT0A 4D3SA 4DCCA 4JEHA 4ER3A 1Z6XA 2EZUA 4NFYA 2NLOA 4I3FA 4BYGA 1FZQA 3G8AA 1FRFS 5FFMA 5CYGA 1DOZA 3LBIA 1N6KA 4G1EB 3TM5A 2X7JA 1E1DA 2G9VA 2XGMA 3VTFA 1JX6A 3KSBC 4OA8A 3X1MA 3DSRA 3EGDB 4KREA 1M34A 4WA8A 1OH7A 1DAOA 3LP6A 4MS3A 4WLVA 3UAGA 5A9SA 1GU7A 4E88A 1SCKA 4J0KA 3I4CA 2AJBA 3RHTA 4NARA 2ONCA 4HAXA 4XQCA 5DGXA 2R6JA 3T1OA 2D4AA 2ETXA 3NNDA 1MIOB 1Z2OX 4UEQA 5BO5A 1GPAA 4DWVA 4OQYA 1FMJA 2YINC 2QUHA 3DDHA 1YA4A 4G2NA 5AI0A 2OB1A 4H60A 4DDUA 1NW8A 4KO3S 2EVWX 3ONEA 4KQ6A 1QH1B 2QS9A 1BMQA 4M0LA 1ZUD1 3EJWA 3G8DA 1P1IA 5D86A 5DLDA 5BR7A 3P2MA 4BU0A 4J1TC 2QDKA 1WHTA 2DZDA 1ORDA 4Q48A 2BKAA 2Z4SA 4MGYR 3VU0A 1U31A 4LZLA 4U3JA 3GPDG 3M6AA 4IJ5A 1CX9B 1HBJA 1HEIA 1VKOA 1BC5A 5EMLA 5IVIA 2A59A 1WO8A 1Y8RA 4W8HA 4BIMA 4C0LA 4NQRA 1HGXA 1O87A 5C34B 1GSAA 2XMGA 1I9CA 4HB3A 5B1SA 1C1HA 1YJ5A 5E7QA 3PQDA 1BKDR 4G67A 3IQFA 3OOWA 2QHXA 3WNVA 2HAEA 3P9NA 2CXOA 2FHPA 3U4GA 1WPRA 2ZIZA 2A88A 4OXKA 3R24A 4QBIA 4RY0A 4G56A 1G5HA 4EIWA 2Z1DA 3UAZA 3WLOA 5FAXA 3EFBA 1GQRA 2XV1A 2RGGA 3WRVA 3ZE1B 1ZD5A 3JQ9A 3H8JA 4P7JA 5DTIA 1YH3A 5EHIA 2OK7A 1VLHA 3I6IA 4GMKA 3UW3A 2CXXA 3FNIA 3OI7A 1N9ZA 2Y9MB 2IXFA 3B7PA 4P4SA 1T5DX 1UP7A 5NULA 2H17A 3IT3A 1RPAA 1IY8A 5K09A 5L7TA 2PFGA 1BXKA 2JCBA 4TTTS 3QXGA 1NVVR 4I9GA 4WA7A 3ZHOA 1WLYA 3HJTA 1RYHA 2UZ4A 4FDLA 2PQMA 2MSCB 4OMFG 1A72A 1DFGA 1VTKA 5IAEA 1RMTA 3PI7A 2Y76A 4AD8A 2RHBA 3TVYA 4MW2A 3TD2A 2OGWA 2QN1A 4F3YA 4CMCA 3RUEA 4BLWA 3BMXA 4RZHA 3W1VA 1Q0UA 1V8DA 5CIWA 2MYPA 2PL5A 1D5WA 2VHQA 3F6SA 4Z54A 4DHEA 2Q2NA 1LBHA 1JI3A 1QV9A 2GQ0A 2WLSA 3G0DA 3I45A 3JY6A 3L79A 3MWFA 3P4XA 4YRQA 2FR0A 3LKDA 3KQHA 2DFPA 1FX1A 2IU3A 2V8OA 2Y0PA 3E22B 4H7JA 5EPOA 1QPZA 3CH4B 1CDOA 4NJMB 3D1VA 2OYRA 4CN8A 1IULA 4K40A 4ARVA 4DUZB 1O2DA 3IO5A 4LHZA 1PHRA 3KPWA 2VYVA 5LQKA 3RD5A 1OB2A 4EFLA 2K5UA 3S2FA 3TINA 3TLAA 2BMVA 2GLUA 2PU5A 3I52A 4LXXA 2UKDA 3CNOA 3AT1A 4QQKA 3E3AA 4JLUA 5FBRB 1NNI1 4QJBA 3ZZUA 3O38A 4NULA 3OE1A 5DHRA 3U3ZA 5TE9A 5C46F 4TS9A 2GD6A 3ZLUA 4QVIA 4YV0A 3EIUA 3I76A 4KN6A 3AF0A 4MVJG 5AW7A 4A23A 3ZWXA 2A0FA 3A4NA 1BFKA 1EQUA 1XEXB 1MABA 2VPPA 5HFAA 3JD2A 4RMJA 2ATIA 1H42A 3TW8A 3ZKAA 1PFVA 4L50A 5CLQA 4C6HA 3O03A 2RH4A 2BH9A 5ADUS 3IDZA 1RTKA 2CMGA 2YZ2A 5A9SB 3EGWA 4HS9A 3TDKA 4F4HA 3UPUA 2PMCA 3DZIA 4OUDA 1KU6A 1GZDA 3OF3A 5AM1A 4X7PA 1RAFA 3G85A 3WYBA 3OUTA 5F98A 2CNOA 3FNBA 2OWEA 2VPQA 1JFFA 3D4IA 3FG9A 3WWYA 4IIFA 4KPYA 1P6UA 2QSJA 4CKCA 4ECEA 2NTNA 1AC5A 2OFXA 3LL4A 3LCJA 3Q5DA 3UK0A 1YQUA 2I0FA 3OEEA 4NE2A 5AM5A 3WK5A 1QTQA 1PZGA 1IOWA 1Z17A 4ZJYA 3LQFA 2D7JA 3KALA 1V41E 3KQUA 4TLMB 5KNCD 3CUWA 1S3IA 4LHVA 1G3RA 2A0XA 2QP4A 4QBFA 1X7ZA 1X42A 1MZVA 2Q4TA 4PM4A 4WCFC 3TQIA 3Q72A </