1KMQA

Crystal structure of a constitutively activated rhoa mutant (q63l)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
177
structure length
177
Chain Sequence
IRKKLVIVGDGACGKTCLLIVNSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGLEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a constitutively activated RhoA mutant (Q63L) at 1.55 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords TRANSFORMING PROTEIN RHOA
total genus 55
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2001-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kmqA00
4MGYR 1JI0A 2HJVA 3B2EA 3D8BA 2K5UA 4A36A 1G3QA 4A0FA 1VG8A 5DI3A 5EXPA 1KGDA 3T06B 5DN6A 3QNUA 3BH7A 4ASUA 1YZUA 3MUFA 1N6HA 1OFUX 4D81A 1GAJA 1Q12A 4W5WA 3EAQA 3PUYA 2OEPA 2ZU6A 4TT3A 5G40A 5GVRA 2ZRLA 1Z0IA 4FINA 2RHDA 3EZFA 1PVOA 4B76A 4E5UA 2IYLD 1ZU4A 4M22A 5B64A 2O8DB 1F6BA 4D2IA 5DI3B 1R0XA 1G4UR 2CHVA 2NO0A 2QG6A 1N5LA 4IFEA 4Q1DA 4Q4HA 2JJ2A 2QP4A 1PZNA 2QSYA 1EK0A 3KXIA 4R9UC 4LPSA 4Q4JA 4KI0A 1U98A 1S1MA 1GZSA 3RRNA 3A4LA 3M4YA 3EZ9A 1I4DD 4UNNA 1DE0A 4Z1MA 2ZYVX 1G4AE 3B8HA 1AA9A 4WZ6A 1DOAA 2GVZC 2ZRBA 2AX4A 4M9SA 2GILA 3EPKA 4DXAA 1KY3A 1E2JA 3AVTA 1CEEA 1Q3TA 4DWJA 2WJJA 4Q4HB 1G8HA 1WE2A 3GPLA 2DFKB 3IQXA 4M8NE 4F93B 2ZI9A 2AFIE 2GWHA 4AURA 4MRVA 4LJ5A 4HB4A 2ZI6A 4NYMQ 5TDHA 3E70C 3W3ZB 3IGFA 1UBCA 3QPVA 1UKVY 5LD2C 4ZDKA 3FMOB 1AIPA 5JBQA 1JALA 3GLHB 4GZLA 4M53A 5LDDC 1G9XA 1ZM4A 4C2UA 1FMLA 2VO1A 5KNDA 1KHTA 4JLDA 2OE2A 2YYZA 3GJ6A 4NONA 2JLYA 3THYA 3C16C 2MMCA 4DSNA 4LGMA 4IDOA 3RABA 1OV4A 3WNCA 5JEDA 4A8JB 3PQCA 5FR1A 1RFLA 2IF2A 2P65A 2WBLC 3UG7A 2D06A 4KBFA 1NY5A 4CRWB 4D82A 1XMVA 2DBYA 1NN0A 1ZNZA 3RLFA 1WXQA 5DHAA 4TYNA 3QG5A 3NEJA 2OBNA 2R62A 2XSZA 2ZYUX 3K0AA 4NZYA 4Q4LA 4M2LA 4TMZA 5JZVA 1AKYA 1G20E 3PJRA 4LRWA 1K6MA 3TE6A 1NF3A 2ZI3A 3G5UA 2VLIA 2BCJQ 3CH4B 3IIJA 2R6FA 4O0MA 3DZ8A 3LO5A 1P2SA 1YRBA 5FTKA 3CRQA 3GLFA 1KI7A 3ZH9B 2OCPA 4CZ2A 2A7QA 4GFDA 3MFYA 5EP4A 1NN5A 1IY0A 2QPOA 3CWQA 5SZKB 3FMIA 3TNFA 4CEIB 1QZXA 4UQOA 1KO1A 1II8A 3VR4A 3MRSA 3AB3A 2XXAA 1DTSA 4LWZA 5HTKA 1D6JA 1E9FA 1H65A 1R8SA 2ZR9A 4LV6A 1BH2A 4IDHA 4URYR 1DG3A 4KYUA 2Q0HA 4PC3A 1US8B 4L9SA 2AXPA 3TW4A 2RMKA 3ZZUA 2ODWA 1JR3A 2W0SA 1KJWA 1P2VA 1MO3A 3U6KA 3OIWA 4TN1A 4HLUA 2OT3B 2WV9A 2IEZA 2DWOA 2ZSDA 2W2VA 4XVRA 4IHQA 1ESNA 2ZAMA 4ITRC 1DEKA 4NBSA 4PO8A 3RDPA 1G7TA 4NU0A 1H8EA 3THXA 3W8NA 2CK3A 3VR3A 4FN5A 4IDPA 1E2MA 4JBYA 3VR2A 3RS7A 1JQJC 3REGA 2QY9A 4PO1A 4AI6A 3A1UA 4WBSA 5DISB 2FSFA 4CEJB 2BM1A 2WJYA 5GJWC 3BRWD 4F38A 4JLBA 2FSIA 4R2IA 4DCUA 2R6GA 5KNBA 1EFHA 4JLKA 3QXXA 2RGDA 3LWNA 4HDCA 5FUVA 2ZRFA 2WIAA 4JKYA 1DAMA 2GZAA 4Q7JB 1G6HA 4D26A 4HLUC 1OFIA 5FUWA 4ZO4A 4G5QA 1N6PA 1VYVA 1EFUA 3W6OA 2VP5A 2A2ZA 1HA3A 4JZKA 4CEJA 2JLSA 1XTJA 2Q6TA 3FMPB 3CX7A 3NHBA 1Z08A 5FOTA 5JSZA 3DHWC 3FTQA 5EP1A 1WRBA 1ZYUA 2JJ2D 2WHXA 3B78A 1JR3E 5JFGA 3TQFA 4AG6A 2A5FA 4EFLA 1XD2B 4FMCF 2DB3A 2O8FA 1TAGA 3Q8XB 5CK4A 2Q9AA 3L8ZA 2HCBA 4P4UA 2QEQA 5E3HA 5F2EA 3M6AA 5EE3A 4C0QC 1JB1A 1NBMA 4RVCA 4OK6A 421PA 5TV2A 2P5SA 3W6NA 1RKBA 1DO2A 1KAGA 3GD7A 1B23P 5AJXA 5ELXA 1D9ZA 2VHUA 4KLZA 1S2MA 3ZIAD 1JR6A 3C8UA 1UADA 1SHZA 1ZD8A 1QRAA 4TMXA 3LY5A 3PVSA 4G3XA 2ZQ5A 4GP7A 2ZRMA 2J9RA 5DGXA 1E6CA 1F2UA 4US1R 4BRWA 1U8YA 4FMBB 4NCNA 3RS5A 4BASA 5AUPB 2V55B 1N6RA 1BYUA 2A78A 3LBNA 4P4SB 3SR0A 4PXAA 4M1TA 1KIMA 3SNHA 3TSWA 3U61B 3CPHA 3FGNA 4ZKDA 4V0NA 2V8OA 3UG6A 2IYQA 5FTNA 3OIVA 2ZYTX 1CKEA 3H84A 3CWZA 4EFNA 3AVOA 2PLFA 3QSYA 3BORA 3V4RA 1E2KA 3BFKA 3O8DA 1FTSA 1XEWY 4K81B 4ARZB 1J70A 3FHCB 5FR2A 1E96A 4V0LA 4BFYA 2RCNA 2QTVB 1CJVC 1KI3A 1ONBA 3JZMA 3T1VA 1N3BA 2N46A 1E79A 1UJ2A 4LJYA 4BE7B 1XTQA 3AV0B 4YDSA 1RVDA 1W4BA 1AQYA 1G21E 1KOFA 2PLRA 5AUNB 2ZRAA 3RSLA 3SYLA 4MRSA 2HDNB 4Z54A 1L2TA 2QT0A 5SZHB 2Z4RA 2ZRHA 4ZDWA 2C2HA 2V9PA 4R71A 5JS8A 4JT4A 2A3RA 2J3EA 3K0SA 3E5HA 2G6BA 1ZC3A 2GKSA 2ZYWX 1E2DA 4XTRA 2FOLA 4P3YA 1VG1A 1EFRD 2VP9A 4IDNA 4QNRA 1WP9A 3B7GA 3WYGA 5JJKA 2FSGA 2VHTA 2F6RA 1Z07A 1IN8A 1G17A 2ONJA 1G7CA 1KO4A 2WJGA 2KBFA 5KO2A 2D62A 2HXSA 1AZTA 2OO7A 4HUQB 4NYIQ 1II9A 5FOWA 3T5GA 1XCMA 4PFSA 2OSBA 4MQBA 2GXAA 4A92A 3AVUA 4PPNA 1XJ0A 2V6JA 1WCV1 5L3SB 3CZPA 1ZC4A 3FE2A 2WWGA 2OUKA 3W5JA 4P32A 5FPHA 4B3BA 1V5WA 1DAGA 1GVNB 2FFBA 1U9IC 2VYFA 1CR4A 4XSGA 3ND9A 2XOKD 3QKUA 4LJAA 3QBTA 1AGRA 1VTKA 2FN4A 1Z6AA 3ZZTA 4GL2A 1T5IA 1T3SA 4LSGA 4PC7A 5IRCD 2IS4A 4KCGA 5AJYA 2ZXUA 1X6VA 4FXPA 4DLSA 1OHHD 1KO7A 3A37A 5E7IA 5FOXA 3ZJYA 5L3SA 3CO5A 1LS1A 3U3MA 2I3BA 1FOEB 1VYTA 2CL6X 1Z83A 2LWIA 3IO5A 4WOPA 1CBUA 3THXB 3ADKA 4LYHA 4M1KA 3ZVLA 3KJHA 2CLCX 2J41A 3ECCA 4O2RA 1JJVA 2REXB 5DYIA 3T12A 3ZVRA 3KJEA 3W90A 1E0JA 1NI3A 3H2YA 1ZINA 1ZD9A 1FNNA 2GCOA 4XVQA 5D3MA 4TMVA 1W5TA 4M1MA 1G7RA 1CR0A 1GSIA 3I8SA 2REBA 1I4TD 5EE5B 1XMIA 1JEEA 1W36B 3SFZA 2AWOA 3QEOA 5JHHB 3CPEA 5H8WA 4GNKA 3RNLA 1GRNA 2EU8A 1DG1G 1UF9A 2RGNA 3H4MA 4LC0A 3X1XA 2PH1A 4PO9A 1DAHA 4EPWA 2ZTSA 121PA 4H1VA 3JZAA 4NPHA 3BJIC 2A9KA 2E9SA 4IXNA 1E79D 3QXCA 4JIMA 5CB6A 2JJ1D 2VHQA 2XXAB 3LAWA 1GIAA 3HWSA 3VR1A 1XNJA 3OAAA 3S1AA 3P1JA 4QJ3A 2KWIA 1XZPA 1E2FA 1GUAA 3WMEA 4U02A 4JL6A 2XNDA 5C1BA 4EQ6B 3W5IA 2GF9A 1R0WA 4E07A 2IUSA 1OH5A 4BFVA 1D5CA 4TQUS 1YR7A 1FMJA 2AL7A 3K9HA 1OKKA 1Q1QA 3TUIC 3LFUA 4OQNA 4HAYA 1AN0A 2C9CA 4X8HA 3DDCA 3VNVA 1IN6A 4Q03A 5P21A 1NMXA 1GTVA 2ZJYA 2A30A 4NDZA 3L0OA 4MRRA 1EGAA 5F9FA 2GBLA 2ZJZA 3OEEA 1GL9B 1IN7A 1T6NA 1OFTA 3IO3A 4QM7A 5FL3A 4XOIA 3CONA 1YHNA 1XMSA 3FHTA 2JJ8A 1U0HC 1NKTA 2GEDA 4E03A 2XGJA 1UEIA 4TMWA 4Q1BA 1TQ6A 2ZSBA 4LC1A 2GAAA 2F55A 2QORA 5BW8A 2XX3A 2DFLA 2C77A 3GFPA 4URZR 4DLVA 4A15A 4JS0A 5JRZA 4PAMA 4TL9A 1T0JB 5CJ2A 4QRHA 3WRXC 3HU3A 4YXWA 3LW8A 3SQXA 4U00A 1GG2A 1FX0B 4Q7KA 4OK3A 3RAPR 4QHSA 2QE7A 1VIAA 2VBCA 1G3IA 4V0KA 2O8CA 1A7JA 3WY9A 5TY0A 1SVLA 4OYHA 1E2LA 1H8HD 4KFSA 5IF9A 3IEVA 1VCIA 1DAIA 2WVJA 5DIFA 4I1SA 5AUOB 5FPSA 2O8FB 3NIBA 5AUQA 2ZR7A 2RKOA 4AYWA 3VU9B 5F9HA 2DY1A 2RB4A 2WOOA 5G41A 1NLYA 3RANA 4Q4AA 1JPJA 1IQPA 3L8YA 4KLNA 3QE0A 4Q9KA 2FNAA 5JS7A 1J90A 3MJRA 3U7EB 3GMTA 1SXJD 2P0EA 2GK7A 5CM9C 3TW8B 1F5NA 1SKYB 3LVQE 4NCJA 5J4YA 1D2MA 1QDEA 1TL7C 3K70D 3EPLA 2GXQA 3KJGA 4WW0A 4LY6A 4JT2A 4I4LA 4G5RA 4WXRA 4NH0A 2FH5B 2ONKA 2QE7D 5LD2B 3R9IA 4B33A 1JXMA 2BEKA 3P32A 3FOZA 2ZJBA 2Q21A 4D4KA 1DADA 4A8JA 4R7ZA 3EIHA 2YOFA 3MJHA 3CW2A 2V7QA 5JLJA 3AGPA 2QSZA 3K1JA 1TEVA 4PSKA 2VA8A 3SJAA 1Z0JA 2QT1A 3TLXA 3M1IA 1ZAKA 4AD8A 2QMUA 3E2IA 2PCLA 3BBPA 3WMGA 4BWYA 1OIXA 1HUQA 4UNPA 4X8OA 1IM2A 3TR5A 5DO9A 2H57A 3OESA 1MKYA 3L2OB 4HAVA 1N5JA 3FFAA 2W2TA 4LJ9A 3AVXA 1P9RA 1QG2A 5AJVB 4BEJA 2FPKA 1UBFA 3MWLA 3SI7A 4LHWA 1SVMA 5HCNA 4NYIR 2ORWA 1Z2CA 1W0KA 4TLBA 2BC9A 2CE2X 2J0UA 2EYQA 1QVAA 1NIJA 4FD2A 3SDZA 2CHGA 5J4LA 3KQLA 1II8B 1U94A 3TK1A 4GP6A 3AKCA 3NDBB 2IYTA 1OJLA 2IYUA 2RGXA 4HZUA 1GWNA 2C9OA 1DAFA 1ZNYA 3GFTA 4FCWA 4JBXA 3CRVA 5FTJA 1XEWX 1I2DA 4M1SA 1HY3A 4CEHB 1KMHA 3A36A 2ZUBA 3OF5A 1ETUA 4UXHA 3C14C 1W5SA 5BN5A 4Q47A 1W46A 1ELOA 1TUIA 3FKSA 4KODA 4RD2A 3DKPA 1WQ1R 2FDCA 5GJVC 2G0NA 2Z0MA 2Q3HA 3CZQA 4OQFA 4LBZA 4DSUA 1XXHA 4Q9HA 5KYKA 4HZUB 3QY0A 5HKKA 3LH5A 4QNMA 3OE7D 1OYYA 2H92A 1KSHA 4ERNA 5KDLA 4ABYA 2VQSA 4TL8A 1XB2A 3AP3A 1E2NA 2ERXA 1TADA 4BGDA 1IXZA 4B47A 4ZIRA 1F60A 2RGCA 2F1RA 5JWRA 4W9MC 1GILA 1FTNA 2CK3D 2Z5FA 4NE2A 4PC6A 4LI0A 1KDRA 4MDEA 2PJRA 3RWOA 4PZYA 5EZ6B 4DDVA 3LBHA 3C5HA 3SBDA 3KDSE 1ZVQA 4I1OA 1FNMA 3R8FA 2ZPTX 3MWKA 2KB0A 4BZXA 2YJTD 5HCIA 1YZNA 4B75A 3PG5A 3OFNA 1KKMA 3TJZA 1R8QA 4OQXA 4B2IA 2FEOA 2F7SA 3GLHE 3FFBA 3P4XA 2XZPA 3H86A 2GETA 4IKEA 2EFHB 1XP8A 4W7SA 2OCYC 4HSEA 2WMOB 3OFND 2RAPA 1XD9A 2CLSA 4NP6A 621PA 1EFCA 3UKDA 1JR3D 4B3CA 3NXSA 2VSFA 4QJ5A 2VHCA 4TT3D 4TWZA 1SVWA 3WXMA 3QKSA 2B21A 2B8WA 3HDTA 2NG1A 3AUXA 3O8RA 3I61A 1YZLA 4BPBA 1Z29A 3DEFA 2ZM5A 1Q3HA 3QEJA 3HU2A 3NC1C 1FP6A 3IKJA 2FE4A 2BJVA 2FFQA 5JWOA 1NBME 1YVDA 2XTMA 3X2SA 4CIDA 5SZIA 3LDAA 4RZ2A 1F2UB 2IUTA 5K8TA 2EYUA 1E3MA 1RYFA 2YC2C 4DB2A 4C2TA 1E2GA 4M4SA 3AVQA 3ZGXA 3SU8A 1KI6B 3R9WA 3MMPA 2JA1A 4PC2A 4RY2A 3GQBA 2NO9A 1CR2A 4PC1A 2GEVA 2XSZD 3CR8A 4B43A 3CF0A 1F2TB 3RC3A 1D9XA 2O0HA 3BB1A 1XMJA 4L8GA 2N1BA 1ZNWA 5H70A 3TR0A 4O3MA 3EASA 3IUYA 2QRNA 2QA5A 5KDDA 4OI4A 2W6JD 5C18A 1GL7A 1XBTA 1PLJA 2FZLA 3I92A 2ZIAA 1GRRA 1RRFA 3DMNA 4IVPA 3V9PA 3NBXX 3QKRA 4MYTA 1F2TA 1E2QA 1NN3A 1XEFA 2BDTA 1TU4A 3AVPA 1E2HA 2IHYA 3EW9A 4DLUA 4RFSA 3L0IB 4KVGA 1R2QA 5CLQA 4Z1MD 5BXQC 2H17A 2OZEA 3U7FB 4RFVA 1FFHA 2R6DA 1XDBA 2R6CA 3LQQA 1KNQA 4G0NA 5TVKA 3PR1A 1HEIA 1W1WA 2R65A 1ZRHA 5C4GB 1C4OA 4YQFA 1NRJB 1IXRC 3U7HB 4UJ5A 4K8OA 3QVUA 3AVVA 3GLGB 4RKFA 1HQCA 5F98A 1EWRA 3CF6R 2EFDB 4Q1AA 4ACAA 3BGWA 3GLIE 5KDOA 3WYAA 2P5TB 4MKGA 3WYFA 3WP1B 2O8BA 5DN6D 1QG4A 3MGCA 4D25A 3W34A 1E32A 2ERYA 3QXSA 3ZIAA 2C98A 1RYHA 4OJKA 1HQYE 4GPTA 5KSOA 4DCTA 4GOJA 3MWYW 5IHPA 5IK2D 3P4YA 1NBMD 2VIIA 1KZ7B 1OB5A 2BBSA 2O5VA 4QGGA 2PL3A 4V0MA 2IYXA 1RW4A 1SXJE 4Q19A 4DIDA 4LJ6A 2YNMA 3B85A 3VR5A 3PUWA 4ON9A 4AK9A 1II0A 5AK0A 1W0JD 2ZS9A 2EFCB 1GDDA 2YWFA 4PSVA 5DLQC 3TAUA 4XWAA 5EQTA 1Y63A 3OHMA 4PQYA 3D31A 3QF4B 2NZJA 3TAHA 3VTKA 3WHLA 1FUKA 4JMPA 1NVUQ 3KKPA 4OKSA 3C4JA 2AKAB 2GBLC 4A82A 4PZLA 5LPNA 2DPXA 3BERA 5AR1A 2IEYA 1NL3A 3GJ4A 1LW7A 2HJGA 1VECA 2V4ZA 1KK3A 3NH9A 3GJ0A 4KXFB 3PEWA 2WAYA 4D4MA 4DDTA 2NO7A 2J59A 1KK1A 3F5FA 4RJLA 5LB4A 3SZRA 4FMCB 3CRMA 4EDHA 3F3YA 4E22A 4WVFA 1IJEA 2AK2A 3AKYA 1VDZA 5FBRB 4LYFA 5B2ZA 5GADl 2V1UA 2CBZA 2PX3A 2QAGC 1TNDA 4Q9LA 2J0UB 1FZQA 1XX6A 2Z43A 5KHOC 1IONA 4DHEA 1OKKD 1SULA 3FYHA 1CJTC 2WWXA 1QHYA 3U44B 2ZU0C 4W5JA 2QZ4A 3NC0C 1Z2AA 3FKSD 3I72A 3VNUA 2C5LA 2N42A 1ZM7A 3FMFA 1F3OA 4B35A 2GXUA 5E7JA 3THWA 2J7KA 1Q21A 2WIBA 4LK2A 5JSZB 2BJWA 1HT1E 1WMSA 2WAXA 1Q22A 2WKQA 3AF4A 3REFA 1QHIA 1HYQA 3H1TA 4PPFA 4S35A 1P6XA 1KI4A 2E1RA 1L7VC 1OXVA 2IBMA 4LJ7A 2HCJB 1N5KA 2PMKA 1X1RA 2IHBA 1XD2A 5EUMA 1DPFA 3UMSA 3W8RA 2YV5A 4LCBA 2F43A 4ZDIA 3TGPA 4GRAA 4TMTA 1TTTA 4AKGA 1P3JA 5AJWA 4TLEA 4G5SA 1FQJA 4KSCA 4TZ6A 3ZVNA 1E0KA 1M7BA 3CRRA 3IIKA 1E1QA 4TYYA 4A0RA 2JEOA 1KMQA 1CRQA 2P6UA 4HZIA 4PTLA 2O0JA 4DLXA 4KO8A 1MO4A 3PUVA 3C41J 2GDJA 4YMWA 2BEJA 1AKEA 5DSZA 4ZI3A 1A4RA 3DZDA 4CGZA 1R5OA 4JLPA 2WTUA 1S1CA 3BS4A 2D74A 1OIVA 4BZPA 3ZLJA 3B1YA 5HZKA 2IYRA 1G8YA 4GMXA 3LXXA 1KYIA 1P5ZB 3Q7PA 3U2QA 4DKXA 1GNRA 2OILA 2BV3A 2ZREA 3X1DA 4JYBA 2WMNB 3KX2A 2FPLA 3UWOA 1XU4A 5K8LA 4IDQA 2QUZA 5TXGA 1MO6A 1U9IA 2XJ4A 4NHOA 5EE1A 2O8EA 3TVTA 1E99A 1SZPA 2W58A 3PUXA 4B3DA 4C7OA 3QBVA 3LBIA 1P61B 3LNCA 4JLOA 1VG9B 5A0FA 5CDFE 1RPZA 2D7CA 2VP2A 3ICQB 5FPTA 1Q20A 2AR7A 3A1SA 1LV7A 2MMGA 2OLKA 1UM8A 1XEXB 1M6NA 3KXLA 3PXGA 5JHGB 2GEUA 1CULC 3FDIA 3OZXA 2RHMA 4MRNA 2ZRJA 4PANA 4PQFA 4CEIA 4C0KA 4HLCA 4LX0A 3AKDA 2WJHA 1Z6GA 4GT1A 4TMKA 4IFBA 1CS4C 4AWXA 2X77A 5FFMA 1GNPA 4POAA 1J8MF 2WWFA 2LKDA 3B60A 3ETLA 1R4AA 1XCGB 2D4HA 2XNSA 1G8FA 3GJ8A 2JASA 3KXKA 1R7RA 4HUQA 4JLJA 2NO1A 4NMMA 4TL6A 4UXJA 4B32A 4JL5A 4BFSA 2BVNA 5CIQA 3DO6A 4BLSA 2B6HA 4JVNA 4LBWA 4A2PA 4BEBA 3ZD7A 1A2BA 1W48A 2QTHA 2UZ3A 3B82A 3IIMA 4NYJR 4ZDJA 5G53C 5HE9A 3EG5A 2D2FA 3TRFA 4MGZR 3EX7C 1Z06A 3NHAA 4GSYA 4LHZA 1UKEA 2OBLA 1CTQA 4CT4B 1GOTA 1T9HA 2IYSA 4OHWA 2JCSA 4I1VA 5J40A 4Y0AA 1D8TA 3FB4A 1NLZA 2ZSFA 4BFUA 2VF8A 4TTPA 4JLAA 1YRAA 1KTVA 5IDVA 2GZHA 4MYUA 3EPHA 1E1RA 1JQLB 3PCRB 2JAQA 1YR8A 2Q3MA 2IL1A 4L5BA 1SKQA 5CLLA 4BLQA 1OH8A 2ASEA 2A5YB 1P72A 1TF7A 2ZJOA 2ZJ8A 2IYZA 2PEZA 1YJ5A 2YWHA 4LHXA 2VH5R 3MLEA 1EG7A 2CVFA 3CRW1 2OHFA 3EARA 5D3MB 5C46F 4F92B 2G0TA 2VP6A 1AK2A 5JJIA 2NQ2C 4F7WA 1MR3F 1RJ9B 4Z51A 4TZ0A 3VAAA 2G77B 1P73A 2X2EA 1C1YA 4JSTA 4RZUA 2JJ1A 3K09A 3SE0A 3FKQA 2EFGA 2IA5A 4XD7D 1Q57A 2BKEA 2JLXA 1LY1A 3UK6A 2MSDB 2XOKA 3QENA 4A9AA 3BXZA 2JIZA 2HYIC 1M7GA 4MKHA 3RWMB 4XWOA 1X8KA 1BYIA 1YZTA 4G01B 2IT1A 2AFHE 1OXXK 4TLCA 5G3ZA 2QAJA 3BK7A 2WJIA 2SHKA 4QHTA 8OHMA 5KNCA 3WBJA 4B3GA 4DT1A 3QF4A 3LLUA 2IK8A 4IXMA 3LD9A 4HATA 5DNYB 4RD6A 3ICEA 1IOZA 1P7CA 2WSMA 4ZCMA 2MSCB 3AM1A 4JJZA 1M1YE 1G5RA 4HDQB 2JLZA 4EKDA 1ZM9A 3MSXA 4B34A 1E94E 3GCGA 3AF3A 3OAAD 2QPAA 3B1WA 2IYWA 2VTKA 3IPXA 1NIPA 2YC4C 3GJ7A 4GZMA 4V0ME 4ZKEA 2DWQA 2ODEA 2ZITA 3SN6A 4KSBA 2IS6A 4IVRA 1IN4A 3I4LA 3VX3A 2AD5A 1HH4A 3AVWA 4HI0E 1WBDA 3QIAA 1XPRA 3EA0A 2CXXA 1AS2A 1ZP6A 4P33A 2EQBA 1HE8B 2RGEA 2ZUCA 4O25A 4F4JA 2X2FA 2XAUA 2VP0A 3SJCA 2CEAA 1Q1EA 5KSYA 3AEZA 1NP6A 4YC7A 1SHKA 3OEHD 1TQ2A 4MH0R 4X8MA 4DCVA 1E9EA 3GLIA 1PUIA 2ANBA 1A5TA 1VCNA 4DLYA 3TVDA 4NYJQ 1HURA 2OXCA 5FPKA 5FBVB 5FTLA 4AY2A 3A8TA 4RD3A 1NY6A 4A2QA 2HLDD 3U4QB 1KJZA 4IVQA 2WOJA 1NLFA 2C96A 4RCYA 4BQSA 1NG1A 4D0LB 2ATXA 3LV8A 3N2IA 3B13B 1NSTA 4RD4A 5B57C 3HJNA 3GJXC 4Z8YA 5AJZA 4AG5A 3RS0A 4US2R 4PSAA 2XZOA 1FP7A 2QQEA 4JLNA 3QG1A 4IOMA 4OJQA 3RC8A 4Q4AB 3Q5EA 2PEYA 3ONWA 4KFRA 4DIEA 5DYGA 4L9WA 1TUEA 3C15C 1U99A 3NDPA 4OK5A 3QKRB 4XD7A 3DPUA 3AGQA 4XSHA 5EXXA 1YU9A 4KVAA 1OXTA 4QGAA 1KJYA 4PAOA 2VHJA 2IX3A 1E9AA 1E1QD 5A5GA 3Q9LA 4KFTA 1S8FA 3JVVA 1G8PA 2JGNA 4C0AC 3RYTC 4GDFA 5FOUA 1YZQA 2IC5A 4MKFA 2ZR0A 4XH9B 3IDQA 5TB5A 3F8TA 3CNLA 3GEEA 1DAEA 4IOKA 4UXIA 3BH6A 4MKIA 3RRYA 4OI1A 4EPRA 1R6BX 5FBLB 4PR0A 1XTIA 3QKTA 4C9BA 2G83A 2YHSA 1CRPA 4JL8A 4QBGB 3PFIA 4CVNA 1E2PA 2G9NA 2C8VA 3AQ4A 4JVMA 3WBKA 4O2LA 4TSFA 1R0ZA 1CJKC 4DJTA 1C9KA 2ANCA 2IYVA 2QNRA 1RRCA 3KB1A 2F9LA 1T3LA 1YE8A 2J5XA 2QM7A 2W6ID 1OHHA 2ZI5A 1P60A 5J4KA 4TL7A 4OQLA 2CHQA 4MGIR 1LNZA 3U6BA 3DL0A 2CCJA 2QP3A 1MV5A 1QHHB 3VHXA 4A2WA 1U0JA 4F4IA 3QF7A 3RS2A 3S1AB 2QAGB 4QGHA 2VP4A 4L4UA 1HTWA 1BS1A 2OXRA 1UDXA 1OE0A 4BLOA 5FL7A 3IEUA 3LA6A 3PEVA 2PT7A 1KMHB 1G18A 3PIRA 5BQ5A 5HZHA 4MA4A 1COWA 3U60B 3H0KA 3KJIA 4DCNA 3B1ZA 3ZQJA 2ZS7A 1Q1BA 1G64A 2WSSA 4EAQA 2GAOA 1J8YF 2C03A 4JKIA 2H1LA 3CNOA 3EWSA 3AP1A 5JCZA 1WB9A 1TX4B 2ZRGA 1BOFA 1I4LD 3I1FA 2XEXA 4JVSB 3U3RA 1JJ7A 1UKYA 5CYOA 1DVRA 4ZIRB 1AM4D 2WJVA 2WZQA 1T3HA 2GJ9A 4LPKA 4TYQA 3EPJA 2EVWX 1P2TA 2ZE8A 1S3GA 2JLUA 4PPGA 1N25A 3O8CA 4QKQA 2JDID 4TLDA 2UZIR 1L4UA 1OSNA 3A1TA 2PT5A 4RKEA 1IXSB 4XVUA 5JRJA 5CJPA 2RGGA 2H5EA 1P9NA 5TARA 3CX8A 5L3QA 1Z0AA 1QF9A 2YVUA 1TQDA 1LS6A 2QL6A 2GZDA 2LKCA 4V02A 1NMZA 1XD8A 4GBMA 1N6NA 4AKHA 5TMPA 2NO6A 5DHFA 2ECKA 3K9GA 4CYMA 1XTKA 1W4CA 4UKDA 4A6XA 2J1LA 3I8XA 1IY2A 2DYKA 1ZNXA 2AHOA 4FCTA 3V4FA 2D3WA 2QI9C 2QPTA 3IILA 5KU1A 2JLQA 3HU1A 4I99A 5CK5A 3U4QA 3OEED 4Q9IA 2ZVQX 1P4SA 4EQ6A 1KDOA 5CITA 3MWJA 1QHGA 3A4MA 1HE1C 2GCPA 3KKNA 1XPOA 1VHTA 2C78A 3EIEA 4URUR 4NKRA 3U3JA 4MRPA 1FQKA 2V1XA 1TF2A 4LV8B 1NNEA 5LBIA 2J7PA 3A6PC 1RE0A 4I81A 5L3VA 1Q1ZA 2WWIA 2P6RA 2HF8A 2NPFA 4DT1B 2ZAOA 2DR3A 1KKLA 4EIWA 1V43A 1T4GA 2W6JA 4EJSA 3Q5DA 2OG2A 1EFTA 1UPTA 3G82C 3KB2A 3QI2A 1CIPA 4HAZA 3T1OA 2PMDA 3SJZA 2ZSEA 4KHZA 3KTAA 1XJQA 4BUJA 3R7WB 1N6OA 1MH1A 1HT2E 3QQ5A 1JECA 2FSHA 2ZJ5A 4D80A 2F9MA 2O8EB 2VL7A 1E9SA 4NYMR 1E2EA 2J87A 5FBWB 4QBHA 3PEUA 4M1WA 3SOPA 3HPRA 1N5IA 1RRGA 3ZD6A 4X8LA 2ZE6A 2ZI4A 1U8AA 3D3QA 1A82A 1IY1A 1YZGA 2FG5A 4ACBA 3O47A 4R98A 1VKJA 4M21A 1ODFA 5FUYA 2IWRA 2RGNC 1FL9A 1Z22A 4RZ3A 1GKIA 4DRZA 1DAKA 5EP3A 3K0AB 4HB3A 4F91B 1LFDB 2PZFA 3HP1A 1E2IA 3WMFA 1U0LA 1G5PA 4B73A 1NJFA 2VF7A 3AF2A 3RS3A 4B2LA 1KI1A 4HYYA 4JSYA 4YXWD 1W4RA 5CB8A 4MUBA 1AZSC 5ANRB 3G0HA 3Q3JB 4DUGD 4A1FA 2FF7A 1R5BA 2IW3A 4MITA 4NCHA 1S96A 1NVVQ 1ESMA 4KYIB 4LYAA 4Q4JB 5HE8A 2JDIA 2W2XA 4DDWA 4OI2A 4B74A 2IWHA 3ZS9A 1U8ZA 2BMEA 3A4NA 1EESA 4B3FX 1KO8A 4B2PA 1MOZA 4B3XA 1O3YA 1OLOA 1KI8A 1XXHB 5CYPA 3AKEA 3U3KA 2R9VA 4FCVA 3SBEA 3K9NA 1US8A 3VKWA 1DARA 4A8JC 2Q9CA 4OQMA 4HUTA 2CJWA 2OAQ1 2R44A 3RVBA 4WIAA 4B71A 3VFDA 4RZXA 3TUZC 2IXEA 1LB1B 4DDUA 3K8YA 4PZZA 3GLHA 1W36D 1K8RA 2PCJA 1ZMXA 3B1VA 2CMKA 5H1YA 1W7AA 2JLWA 1CXZA 4D0GA 1COWD 4EPXA 4QJ4A 5BYJA 4PPQA 5M04A 3THYB 3FVQA 3OE7A 2PX0A 5FL7D 2AD1A 1E0AA 4N1AA 3UANA 1DELA 1AS3A 1PLKA 1Z5ZA 1ZUIA 1UFQA 4MYHA 3VHLB 3VQTA 3B9PA 2ZJAA 2C04A 2PZGA 1EFRA 2BCGY 4TLAA 4M9QA 2F1IA 4PX9A 4DCSA 5JCPA 221PA 3MG9A 4BFTA 4WZBE 4QBIA 2C9YA 4JBWA 5L3QB 4AKIA 3B9QA 4GI7A 1NMYA 4IRUB 1G8GA 1KO5A 4IOLA 1T0HB 3NTUA 4RD1A 3KFXA 1E9DA 1MT0A 4KFUA 2OAP1 3T5DA 5KTYA 3K0CC 1ANKA 1A2KC 2AN9A 3K09C 1QBKC 3QOFA 1E4VA 1E4YA 4I1UA 5E95A 3ADDA 4Q48A 4TTQA 5C2JB 3ASYA 3IBYA 2NPIA 3RRZA 1OW3B 2EWVA 2XJ9A 4PHTA 4Q02A 1SVOA 4BFXA 1G3MA 1CJMA 2W0MA 2ZE5A 1W47A 1JNYA 1KI9A 3NKVA 1P62B 2KE5A 2AKYA 4A0GA 5EUQB 2QU8A 2V6IA 2D7DA 1F48A 1XJCA 2WM9B 3Q72A 3ZS8A 4DUGA 1XWIA 4QXAA 3ND8A 1LTQA 1D2NA 1SVKA 3KUDA 1TU3A 2YZ2A 1OXUA 1Z6XA 4JLVA 5E4FA 3L43A 3UATA 5C4MA 5F3WB 4P4SA 3SHFA 3GLFE 2ZJ2A 5JEEA 1VMAA 1UBEA 5JECA 3SQWA 1G6OA 1O87A 3EC2A 4EJSB 3KZ1E 3RSOA 4CW7A 4CF7A 3K70C 1X3SA 3LX5A 4OHZA 3CKLA 3E1SA 5GVSA 4EUNA 2ZSAA 4C0LA 5EE9A 3WRYC 4PHHA 4HAUA 3KTAB 3CB4A 2H7VA 1HV8A 2OBMA 1G1MA 4S2EA 2CL0X 3VX4A 1QHNA 4Q01A 3EA5A 3QJYA 2QQ0A 3A58B 2FGJA 1SKYE 4Q66C 1ZU5A 4EPVA 4Q7MB 1N0WA 5HKKD 1W44A 1IAQA 2TMKA 3DKVA 2GJ8A 1YZKA 1VCOA 4H9GA 5KSPA 4LJ4A 2R2AA 2XB2A 2BMJA 2Z6VA 2OM2A 2B7CA 4D6PA 1Z0DA 2FFHA 2ZANA 1EX6A 2G3YA 2LCFA 1H8HA 3BWDD 3L0SA 3EZ6A 3NEYA 1J2JA 1PJRA 5EP2A 1KAOA 5J4VA 3TIFA 4N0EA 3ZVMA 4LJ8A 4TQ9A 5DH9A 1E9CA 3I3SR 4DBLC 1M7HA 1U2RA 2C99A 3B1XA 4L15A 3P26A 1YKSA 2JIZD 4KAXA 1KI6A 1NSFA 4D4LA 1G5TA 1AS0A 1S9DA 3T15A 4BZQA 1KI2A 4AKEA 2O8CB 2RGAA 1G3RA 4A6PA 2BBWA 1ZIPA 2QMEA 4DEXA 2ZVPX 4QFMA 1GM5A 2OCAA 5HR5A 2UKDA 4HLDA 2IYYA 1M2OB 5BN3A 5J47A 2OFWA 3KL4A 3VU9A 2P67A 1IJFA 3W9YA 3J81k 1G16A 3L82B 4HAXA 1M8PA 1NVVR 2CVHA 1OIWA 2GVDC 1N6LA 3HR8A 4FWTA 4BFWA 4A4DA 2ODNA 2ZI7A 1IN5A 3IBGA 4DLZA 2CJWB 2WWHA 1XTRA 1Q0UA 5GJBA 3GEIA 2IF0A 1UBGA 1NVXQ 5L3RA 4B6FA 1E1RD 3EZ2A 2V54A 2FEMA 3FWYA 4FW9A 1UEJA 5EJEA 2MSEB 2H16A 4C3ZA 2UVQA 1GP2A 1KK2A 3CF2A 1U90A 3BAFA 2NZ8A 1X1SA 3D7MA 3LVRE 4LYJA 5KUTA 2ODBA 2HYDA 4TTRA 3SFVA 2B92A 3ZQ6A 2REOA 3PENA 1UDWA 4Q9JA 4L16A 2BHRA 3SEAA 4AIIA 4QBFA 3KQKA 3U5ZB 2QP9X 3AP2A 3GLGA 2AWNA 1TQ4A 3NVAA 3B5JA 4KU4A 5K8IA 3IQWA 3NBYC 4P31A 4JLMA 4V03A 3IPYA 2ZE7A 3ADCA 3LQRA 3CX6A 4OHXA 4QC2A 4AYTA 2QBYB 2PZEA 2O8BB 3TSZA 1JPNA 3L0PA 2QAGA 2BWJA 1Z3IX 4N0DA 1WBBA 2FWRA 3BOSA 4ESHA 4C0JA 1AJEA 2QM8A 3QPWA 2BMDA 2ZUDA 1JEDA 4B44A 4F4CA 2BMFA 3IHWA 4BLTA 4DSTA 3BH0A 3V00A 1W36C 4P4TA 3JVUA 1XTSA 2GCNA 2HF9A 2HV8A 1W4AA 4ZPXA 1U81A 1XZQA 5FOSA 3IHLA 2OV2A 3BB4A 1MABB 2ZS8A 1XRJA 1VPLA 1YR6A 3AH8A 4CEHA 4LHYA 1GKUB 2OCBA 4OBEA 1E69A 2A5JA 3LW7A 1Z0FA 3AF1A 3ADBA 1EWQA 2W00A 4IJMA 1KK0A 1R10A 2EWWA 4MYCA 2WSSD 4UJ3A 1JBKA 1G3UA 4LV5B 5J4HA 1JAIA 1B0UA 4R2HA 3W6PA 4MGKR 1J99A 4N3NA 4JJKA 2F1JA 2IUUA 2J0SA 5B30A 2HT6A 2FMXA 1ZCAA 2A5DA 1Z63A 1NKSA 1J7KA 1LF5A 1R0YA 3K53A 4DLWA 2QRZA 4QHYA 3AF0A 1CJUC 2GCOB 3DOFA 4HB0A 3TMKA 3DVLA 3C7KA 5KPDA 3GJ5A 1A1VA 1Z6YA 4PHGA 2I1QA 2YWEA 2DFNA 4FMDF 1NVWQ 3BFVA 5FI1B 4YMTA 5KPJA 5FI0B 2XZLA 2JLVA 5JMTA 4C7OB 1DBSA 4WZAE 4FIDA 3KKMA 3RS4A 4TYPA 5FBQB 1OH7A 2OLJA 3THWB 3EZ7A 1FX0A 4BLRA 2P6NA 3C5CA 3SYKA 4ZCLA 1K5DA 2Z4SA 4TSFD 3X1WA 2F43B 3QKSB 5H68A 2G1KA 1MRNA 2BKUA 2GXSA 2OFOA 2CDNA 3PEYA 3RRMA 2OFXA 1DO0A 3O8BA 721PA 3GJ3A 1PLLA 2YWGA 3TKLA 3T35A 4EJSC 1Z28A 2WICA 1GKYA 1X86B 4GOXA 1G41A 3K9LA 2GK6A 3WHKA 2KSQA 2GJAA 4RFSB 1ZD1A 1AGPA 4EPTA 4ILEA 4AC9A 1W49A 2E87A 2PJZA 3CLVA 2YKGA 1ZJ6A 4Y0VA 4FMDB 3P20A 1OH6A 3FPAA 5IT5A 1KNXA 3SJBA 3U7GA 3I5XA 2ZRKA 1OXSC 5HPYB 4LUCA 1Q44A 5DE3A 5CDFA 2JATA 3HYTA 5L8VA 1YQTA 2QN6A 2ZRPA 3MAAC 2XTNA 2I4IA 3KUCA 2ZRCA 3QUSA 1SXJC 1D2EA 4G5GA 2FGKA 2ATVA 1E9RA 3M0EA 1E9BA 1WDTA 1G291 2G88A 1ZCBA 4JYCA 3R9XA 3CH5A 3K0CA 2V7QD 4XTCS 2P3SA 4QL3A 4DZZA 4C4PA 1M34E 2QMOA 5UKDA 2IXFA 1FPMA 3QVVA 5FUXA 2WWYA 4XIGS 3SHWA 1S0UA 1ZBDA 2VEDA 4BLPA 5JJLA 1OFHA 2GNOA 3KKOA 3UMFA 1SVSA 1XF9A 4UNSA 4GMDA 4OHVA 5EZ5A 4ASUD 2DHRA 3TH5A 4IEIA 1NN1A 2CL7X 1KSFX 2HUPA 3KKQA 1BO6A 1IBRA 2RH5A 3BC1A 3OEHA 4KBGA 3K0FB 1AQUA 1OPXA 4II7A 1W2GA 1CLUA 2ZRNA 3VMFA 5GJCA 1PUJA 1R5NA 2HEIA 2EW1A 1FW6A 4MDFA 2VSOA 1S9HA 4URVR 4NL4H 1G19A 2IXGA 2FZ4A 5FTMA 1T91A 4EFMA 4QGFA 4M9ZA 1GRQA 2BBTA 4YMSA 4UNQA 5KOYA 821PA 4K46A 3MD0A 1WA5A 3OIUA 2QROA 2R8RA 4Z8XA 2V3CC 2DFTA 3EC1A 1VHLA 3QXHA 4BRUA 4Q7LA 4Q00A 3GP8A 3CUEF 4PQRA 4EPYA 5EE0A 3T1QA 4B6EA 2IS1A 4DSOA 1MO5A 4LDJA 2KBEA 2GTPA 2NMVA 2J0QA 5DI9A 5BYKA 3DMDA 1CF4A 3BFXA 2QGNA 4HB2A 1N2CE 1X8LA 1L8QA 3QXJA 3R8CA 3DM9B 2WPDA 1TPZA 2CLDX 2GJSA 4NCKA 4Q18A 3VR6A 5BWMA 2NTYC 1M74A 2Y8EA 4GOKA 1E98A 3TSOA 1RRPA 3CIOA 2P2LA 1VG0B 5CIWA 2J0VA 4J0QA 5SZJA 1W2HA 2QMHA 3LLMA 2G1JA 2X1VA 4OI0A 3OIYA 4DEYA 2QBYA 3CR7A 2ORVA 1ZUNB 2X8AA 4OHYA 4Q21A 3GLIB 2Z83A 1VIYA 1L4YA 4WA7A 1GFIA 4A0HA 2ZEJA 3EWAA 1VYUA 2D2EA 1XFAA 4LBVA 4HAWA 1ZM2A 3CNNA 3BD9A 1OT3A 3LX8A 2B7BA 2I1VB 3CM0A 2XB4A 3I32A 3PV0A 2OESA 1CP2A 3I73A 4HEJA 1K5GA 2GESA 3UMRA 3U44A 3LXRA 4QOSA 1W0JA 4C0HA 3T61A 3AUYA 2W6IA 4NTZA 1G7SA 3NG1A 1RIFA 3N5CA 4G5OA 2GF0A 4CDGA 1EXMA 2EFEB 1EX7A 1T8UA 4URWR 2GRJA 4LBYA 3KQHA 3AVYA 3T34A 2F3TA 2NGRA 4M1OA 4M0LA 1S3SA 2R6AA 3ASZA 3SC3A 4MUAA 5CM8B 1JAHA 3UWKA 1Z8FA 3NWJA 2CCGA 5BN4A 1UAAA 3GLGE 2F1HA 2YINC 3GEHA 2FJUA 4URXR 3HPQA 2BBOA 3UIEA 3TUJC 4H1UA 1TMKA 521PA 4YLGA 3A1VA 1KDTA 3SYNA 1H8ED 4W5HA 4D0NA 2VRWA 2O0KA 2HLDA 1QHSA 3BB3A 3X1YA 1X8JA 1KSGA 2BOVA 1N6IA 2HXYA 2KJQA 3HYRA 4ARZA 1Z6TA 5FOVA 1JXOA 4FI3C 4ESVA 2CCKA 2XNDD 2FFAA 4HLQB 4ZI2A 3UPUA 1KY2A 2PBRA 4ZCIA 3DOEA 3WP0A 2AXNA 3KFVA 5G3YA 1BMFD 1NJGA 4KV9A 4PAQA 1KDPA 2GA8A 3VKHA 3BIFA 4IEEA 1N6KA 3A1WA 3BE4A 2IS2A 4QG7A 4IW3B 2O8DA 3WNBA 2BIFA 1N0VC 2NIPA 2Q9BA 4G1UC 1T5LA 1QHXA 3D6TB 3GLFB 4DVGA 1UKZA 4C0SA 4DB4A 3TBKA 2CE7A 2WPDD 1P75A 1Z47A 1N0UA 3TQCA 2GHIA 1NG9A 2O52A 1KZGB 4Q1FA 1S4QA 1ZIOA 4BECA 1CR1A 2WKPA 1FUUA 2FPMA 2J46A 3X1ZA 1QHHA 1ZW6A 2X19A 3K0EA 5B58C 1OB2A 4Q1EA 4AYXA 1PV4A 1Y3AA 1XPUA 1OYWA 2DCUA 4XWKA 3PUZA 1TEXA 4YONB 2FU5C 3K0FA 4LZZA 5EXTA 1XEXA 3I5YA 3EXAA 3NH6A 3W3AA 1SQ5A 1I2MA 4LOAA 3R20A 1SGWA 4JVLA 3NBZC 3Q85A 5FH9A 3RHFA 1E0SA 4D4JA 3QPUA 1W0KD 1Z0KA 3SS8A 2L0XA 4FWIB 4NCIA 2CNWA 2H8KA 4DC9A 4YMVA 2W83A 2J45A 2QGZA 2WKRA 3WNDA 3CPJB 3MCAA 3VKGA 2F3RA 2YOHA 4WAUA 2ZROA 2DWPA 5AWFC 1SVIA 2YOGA 3P27A 1LF0A 5FPYA 5IK2A 2J7PD 5K8UA 2WWWA 2KI5A 2FA9A 3LRPA 3N2EA 2QTFA 3Q7QA 1KSJA 3KQUA 4BFZA 4TQAA 5D3QA 1ZUHA 4UNRA 1BMFA 2NOAA 4LHVA 2HT1A 3U3OA 1CU1A 3UXMA 2VPPA 3CBQA 4QM6A 4TYWA 1RC8A 1QVRA 3N70A 4IOJA 5JWHA 3T1TA 3THOA 2XTZA 2A5GA 2JLRA 2QENA 4U5XA 6Q21A 4RCZA 4M1YA 1YR9A 4PHFA 1TF5A 1XCPA 2ORIA 2AK3A 1OF1A 2FX3A 4CT5A 3EIQA 1MRSA 5JI2E 4U7DA 5A4JA 1T8TA 3DM5A 4M9XA 4P0TA 4YMUA 3NBFA 2Q3FA 3F0TA 4XJXA 1WF3A 3HR7A 1SXJA 2ZETA 2C95A 4HDOB 2B8TA 3ZZ0A 1MABA 1VCMA 4ZV4A 1GL6A 4C0BA 3I62A 1RJ9A 1XXHE 1IHUA 3FHOA 4B48A 4V0OA 3KQNA 4OL0A 4DLRA 1P9WA 4E09A 1GNQA 4DLTA 1RZ3A 2FV8A 1SXJB 1BKDR 4KITB 2XITA 2GJKA 1DS6A 1GITA 4RD0A 5JI3E 4WXPA 3K70B 2CNWD 2RGBA 3GFOA 4Q5IA 2ZRDA 5J5CA 1BIFA 2VSXA 3PITA 5LB2A 4RSGA 4YDHB 3R7WA 1P2UA 4C30A 3ZDQA 3B6EA 2ZRIA 2H18A 1ZM3A 4Q1CA 5EXSA 5E7MA 3ZYCA 4US0R 5KSZA 1LVGA 2BM0A 4KJZA
chains in the Genus database with same CATH superfamily
1BEZA 1L5WA 1JI0A 1T2DA 2Q2QA 2RBEA 2VTEA 3MS7A 2IYFA 3AM4A 4RKWA 1P0CA 2NSJA 1O94A 2AXQA 2GN6A 3H9QA 3PFBA 4IDFA 3QX7A 3BH7A 4K9SA 2P5YA 3MUFA 4LSWA 3ABRB 5HWSA 1OFUX 3OUZA 1OH8A 3SP1A 3NJ4A 3QVOA 1U0FA 4IWXA 1HDOA 4W5WA 3EAQA 4FOSA 2ZU6A 4TT3A 5DIZA 1MXHA 2E4XA 5GVRA 3O1JC 1SCUA 1Z0IA 4H77A 1NVGA 1QB8A 5A06A 3NMUF 2VTDA 1PVOA 1N1MA 2BRUC 3UPDA 5KS2A 4M22A 1M1YA 1F6BA 3LGSA 5C34B 1RWNA 4L73A 4EDFA 2NO0A 1YL5A 4IFEA 3FIUA 3V4SA 4K86A 2QP4A 4EG8A 4EY8A 1PZNA 1E5LA 1OX6A 1X15A 1GGVA 2QSYA 3KXIA 3U7IA 1PAUA 4OXKA 4OYYA 3Q5GA 2ZIVB 1S1MA 2PA0A 3RRNA 2ZCJA 4N5IX 4X5OA 1MJGM 2W4QA 2X1HA 1CW2B 1DEXA 3DZBA 1M33A 1AA9A 5JAHA 4M9SA 3QFHA 1GRCA 3DNPA 3T38A 3DE0X 3DKKA 4WCVA 1BG6A 3CLTD 5IW8A 3HGMA 4DQUA 2FW0A 1WE2A 2EP7A 5DLYA 2QDKA 2AB0A 5F5XA 3RGWS 2PRSA 1OYVA 4OHPA 4LJ5A 3DE2X 5IH7A 1IG3A 4RSMA 2ZI6A 4YQEA 1IDN1 2V7VA 3G8YA 3W3ZB 2XUQA 3IGFA 2HWYA 3MCTA 2QTZA 1VFNA 3SX2A 1L7OA 4DPKA 1JALA 3PVCA 4RVUA 1W59A 3CLTC 1IBLB 1FMLA 2FQ1A 2PVCA 3CE6A 4EB6A 3DNMA 2CLOB 1FSPA 2BFWA 3AIIA 1PDVA 1E89A 4NONA 3VR3D 3V2UA 5ALEA 4F2WA 3MZ0A 3TOZA 4BCBA 1GCIA 2J33A 1YDGA 3C43A 4A8JB 1JHXA 2B82A 2VQ3A 2P9TA 3D8NA 3KP1A 2OD9A 2IF2A 4HDSB 3UG7A 3UJ9A 2D06A 2PT9A 2ZP1A 1XMVA 1HSZA 1NXWA 1YNOA 2DBYA 2IPMA 3CEJA 4ZYTA 5HUQA 3AEKA 4TYNA 3QG5A 2GI4A 2XF8A 2OBNA 2R62A 2XSZA 4NPCA 4HGNA 4TMZA 4RPKA 1Q11A 1Z8HA 2RK3A 3TE6A 1SOMA 4EW6A 5C51B 3CGGA 1U7UA 5FWYA 2BFMA 1FJHA 2FN8A 3QU9A 2K7FA 3LO5A 1JAYA 1YRBA 4TZTA 4CMGA 3BSYA 4AM8A 4LAFA 1OZFA 3EXFA 4M86A 1IY9A 3ET5A 2IOHA 1Q3KA 2R7AA 3R5TA 5SZKB 3T0GA 2C4VA 4QDJA 1WSAA 4M83A 3GY0A 2IKSA 3RIXA 3EHDA 3GV0A 4L0MA 3QPCA 3U4MA 3IDZA 3BHJA 3KYBA 3ZCTA 3FCAA 4G81A 1JLLB 5K3FA 5DCYA 2W8BA 1V5IA 1DG3A 2KX7A 2NV2B 2QRVB 4PC3A 1NATA 1YZYA 2IY9A 4KNWA 2I65A 4L9SA 4AZ3A 1P5JA 1LVHA 3WLHA 1FTWA 3LX6A 3GT0A 1Z4QA 2QVZX 4GG1A 1MO3A 4MP8A 5KQGA 3C4VA 1KY4A 2UZ1A 2W2VA 1A9QA 4NBSA 1W30A 4XFJA 1KRWA 3O7WA 4WK2B 5COBA 2AG1A 1NQOA 4IJUA 1H8EA 3W8NA 4K6KA 4EBBA 1O96A 4FN5A 1C7JA 1ZXBA 1X1TA 2GD0A 1TT5A 3PFNA 3VR3A 3S7ZA 2XUOA 2Q8PA 2H5JA 4BB9A 4ZAVA 4C7XA 3QFFA 3GJRA 3KWLA 4TRNA 2VBFA 4UE2A 4AI6A 3CW9A 4KDRA 4LFCB 1T4MA 2TSYB 4RMIA 2IHUA 5CVUA 3MS2A 3BRWD 2G06A 4JLBA 2G36A 4DCUA 4BRZA 4PYKA 2PZJA 1OPRA 2JCXA 2JFHA 4PZUA 5TQ0B 3QXXA 4NABA 1VLQA 1OLXB 1VI6A 5FUVA 2WIAA 2YVKA 3F4BA 1U4NA 2BZ0A 3M7IA 3GGDA 1SXIA 4YAWA 5FLXA 1UBSB 4HGOA 1VYVA 2D13A 4LNUA 4ZCTA 2YXPX 3KRTA 3W6OA 4JZKA 3LMKA 4ND1A 3CG4A 1Z08A 1DOZA 3NPMA 1ODCA 3IEMA 2OGTA 1WRBA 1A5AB 4IRMA 2R8EA 2YY6A 2B0JA 5HRUA 3B78A 4JJ7A 1EIWA 1YB6A 2H4ZA 1BEEA 1M34B 2YJZA 4EFLA 1GKLA 1XD2B 3BDIA 4FMCF 1U2GA 4OQPA 3HJRA 5CK4A 2Q9AA 3SWWA 3OQIA 1ZL2A 2CDAA 3PT5A 4TLLB 1RCFA 2QEQA 4MV3A 4X61A 5F2EA 3M6AA 3WDSA 1TFRA 3IKMB 1JB1A 3GFVA 4V39A 2ZWAA 2P5SA 3IUQA 2XYHA 4MR8A 1TM3E 1ODJA 1XZBA 3GD7A 1PR4A 4X7MA 2FWBA 2VHUA 1JR6A 1C7ZA 2H4FA 1QSGA 3HHEA 3VC7A 1KXJA 4MA0A 1ZD8A 1A9PA 2XTAA 5AHKA 3CUTA 1WV1A 5DMXA 4L5YA 2BD0A 4G3XA 2ZQ5A 4GP7A 2ZRMA 3FNEA 4M8KA 5TQ2A 1QUFA 1Z6PA 2FR8C 3HMKA 4HDNA 1TLFA 4QOFA 4JJFA 1NRWA 3J81A 2Z1DA 4FMBB 3RS5A 3OA0A 1N57A 3LBNA 4R8RA 4P4SB 4DNXA 5BUQA 5A0TA 4M1TA 1NYRA 2BGJA 3SNHA 4G6ZA 1JKJA 3UA4A 4OX9Y 3RT9A 4ZKDA 1A88A 2V8OA 3VZDA 5IT9A 3OQNA 3R6WA 2D5CA 4EFNA 4WKBA 4E4YA 3O8DA 5K6AC 3RT7A 1DC8A 3FHCB 4H27A 5FAXA 5FR2A 1E96A 4ZHQB 3AL0C 2RCNA 1CJVC 2I4TA 3I9KA 2OCGA 2ODAA 4DDKA 4ER3A 1RVDA 4OFZA 3B53X 1G21E 1KOFA 3RKUA 1EXVA 2ZRAA 3RSLA 5I4CA 5E0KB 2HPVA 3HWRA 5AH0A 1L2TA 4L28A 2ZKIA 3UAWA 4L07A 1Y6JA 3KDPA 3BQNB 3BD6A 1ZMTA 4ZVUA 1I9GA 2Z08A 3E5HA 3FSGA 3L7LA 5GWXA 3K0SA 1SXQA 2FI1A 1V26A 5LWQA 3HA2A 1EP1B 2R60A 5IKPA 1GPKA 2Z95A 2VP9A 4HF7A 4YRAA 1SC9A 3GZNB 2A59A 4MVJA 2ONJA 3WR5A 2NZYA 1KO4A 3B2QA 4G89A 4R6WA 1ZOIA 3RVNA 3TIXB 4CMKA 2QZJA 1XZEA 2X0EA 2FEPA 1II9A 5CNJA 4HRYA 1X87A 2IY8A 3OX1A 1HE2A 1ZRSA 3JQ6A 1NE2A 3MUNA 2DU8A 4RUKA 1ZGHA 2VF2A 4A92A 2EJTA 1XJ0A 2V6JA 3D3KA 3CZPA 4TV9B 5JAOA 5JH7A 2WWGA 5L3SB 2Q3CA 1XFDA 2OUKA 4KLCA 4G25A 5EZYB 1ATIA 1KAQA 1V5WA 2ZLBA 5ALHA 4JGBA 1U9IC 4ZEWA 4ZT5A 2VYFA 1CR4A 1W1IA 2H9AA 1YMQA 4XSGA 4YN3A 3UXEA 4TTSA 3RAFC 5J59A 1UMBB 2C88A 3QBTA 4J3NA 4XARA 1QGAA 3UJ3X 4GI1A 4YRQA 5IRCD 3DSRA 2A84A 1HK7A 3LC7O 4FXPA 4X44A 4DLSA 2O3JA 3M5CA 4C3OB 2AS0A 1QVVA 1LS1A 2RHBA 3U3MA 3GN2A 3C3WA 1FOEB 2P62A 2PHZA 3T7DA 4O4LB 1Z83A 3AY7A 3IO5A 4WOPA 4D02A 3L1IA 1BE1A 2QTNA 2YR0A 4O2BA 3I1YA 3RO7A 3RVPA 4D9FA 3GJZA 1W5FA 4UZFA 1JJVA 1U04A 4NU5A 4AXBA 5DYIA 4E2YA 2WF9A 4MWGA 2R1TB 3KJEA 4ZV9A 3R7DA 3W90A 4RE6A 5CG2A 1TM4E 1NI3A 3H2YA 4MWZA 1XLTA 2B4KA 4ZRNA 3BEDA 5P8WA 1L7AA 3QFRA 1W5TA 2OXIA 1RJWA 1EE2A 4NEQA 5AOCA 1UK8A 2IP1A 1EFDN 4NJEB 3BHIA 2O2ZA 5G4LA 3V8RA 3W7BA 4DWVA 3A9TA 2WU8A 3O4IA 2O5RA 2Y0EA 4HQ0A 2HO4A 3CPEA 4ENQA 2HHJA 4XRGA 4YT5A 4Z0PA 4DV4B 2C2GA 2EU8A 3DDUA 5C5EA 3I76A 2AQIA 1O95A 5AI6A 1P2BA 4PO9A 1V7PC 1P6QA 1FS5A 2G9ZA 3NYQA 1DFGA 3B2NA 2CV2A 2J8ZA 1KBZA 2RH9B 4NPHA 4DW8A 2FSVA 2A9KA 5I7OA 1X7HA 3K8QA 1KE2A 5JXGA 1YDEA 4CM1A 2XIJA 3GH1A 3E15A 3N2KA 2AOUA 3MOGA 2XXAB 4H3VA 1B41A 2VQ6A 2X42A 4K2AA 1DKLA 2B8EA 3E58A 3RREA 1CEYA 2KWIA 1Q95A 4NH4A 2GFQA 3QW2A 1FIUA 1T35A 1ULHA 1J42A 2QRLA 1UWLA 2FPIB 4PSDA 1BHJA 3WMEA 5C1BA 1NURA 2HK6A 3ASUA 2J30A 2JFNA 5ENDA 3W9SA 5BW5A 2E55A 2IUSA 1OH5A 3QWBA 4IG4A 4BFVA 3KKZA 4YRBA 2UU9B 1JFVA 5HK8A 1FMJA 2AL7A 4JR2A 2ORYA 5CXSA 3VDMA 1Q1QA 1JKFA 1U0GA 2BSAA 4G8JA 3G8DA 3LFUA 1NLUA 1Z82A 2C2BA 4HAYA 3WGYA 2ATEA 1HNNA 2C9CA 2TMDA 2ZYDA 3RYFB 1DUSA 1WKCA 1IN6A 4IXTA 1P1CA 3S0JA 2ZJYA 2A30A 5CXQA 4HNSA 2KS6A 4XGIA 4AZTA 5K3OA 3A9RA 1E5QA 1I6MA 1RPTA 2ZJZA 3OEEA 3B3AA 3GAFA 4RF4A 5E6SB 3UUGA 4BQOA 4GKBA 4DXHA 3H97A 4QM7A 3NGLA 4J16C 8LDHA 3I9V1 4AF6A 1DEAA 4UU0A 1IK4A 1YI8A 4LXYA 4CU2A 4YAKA 1VPWA 2GEDA 3FHTA 2WYOA 1K92A 4KXYA 2X40A 1YB5A 2GPAA 2ZSBA 5JU6A 2GAAA 4KVZA 4Z7OB 4GICA 2VDJA 5IN5A 2QORA 3FETA 2HBQA 3JYHA 4LTNA 3VJKA 3EWNA 5CNIA 1GQSA 2O7VA 2Q2WA 4JJEA 2MYTA 5H3CA 3REQB 3DDHA 2DFLA 2C77A 2JFWA 2JJQA 4AJNA 1RZUA 2C58A 4DG5A 4N7BA 1GQFA 4GXQA 3FBTA 3WRXC 3KYDB 3LPDA 3EBOA 1JAZA 1XZMA 3H8VA 1Q50A 5IUJC 1VIAA 4V0KA 4CFYA 4RTMA 1RCUA 4F46A 2XLBA 1XNHA 5TY0A 4OYHA 4MVJH 3ERCA 4GZ6A 2NXJA 2WVJA 5AUOB 2O8FB 2IHJA 3ORYA 2BP7B 1YB2A 3VU9B 2RB4A 1B15A 4Q4AA 5LMCA 1I51A 2WHRA 5KYUB 3HUUA 4NCXA 1AXGA 1IQPA 1VJCA 3QE0A 1BXKA 3TXXA 1HX7A 1SXJD 3ZIDA 4OUKX 3OCWA 5JPCA 3DGFC 4XCQA 5CM9C 2PD4A 3F6RA 1TD9A 1VIVA 5AHXA 4HRVA 3QLUA 1QDEA 5E3IA 4B79A 4H1HA 5K3AA 3KV3O 1D2RA 1HDYA 4X3CA 4HDMA 3KT6A 2A14A 3MHTA 3I09A 2WSIA 1JHYA 1F8FA 1FA9A 2AZTA 4N3BA 4NH0A 1MMFB 2VSQA 2FPPB 2ONKA 3F98A 2BR4A 3KCQA 1MIHA 1GU7A 1T10A 1FS6A 2FHSA 2J6HA 3FDZA 4MB0A 4E30A 3E84A 4UTRA 1F4VA 5CDTA 3ZGOA 2IBSA 1KETA 2ZJBA 4D4KA 5HM6A 3FOZA 4G0VA 4R7ZA 2P90A 1NI4A 5EG5A 3IS3A 4H4DA 2X3FA 1RVV1 2AOXA 1I1OA 1TEVA 4PSKA 5KNLA 3GDFA 2H65A 2QT1A 3FWPA 3HB0A 2VUIB 1PNTA 1RAHA 2P77A 3KALA 4J0JA 4MAMA 2NZXA 3E2IA 1LPBB 3I12A 4UNPA 2AE1A 3M5PA 3RHTA 5CD1A 3FYCA 3T9CA 2EZ4A 2NV6A 3CT6A 4QVKA 5KTNA 4JWTA 2QPLA 3EDCA 3LLCA 4OB6A 1E1LA 1P9RA 5AJVB 2DKFA 2FPKA 4BEJA 3MWLA 5HG0A 2CFSA 3SI7A 3HXOA 3A6FA 1NFQA 2HFKA 3L92A 1FXWA 4NFSA 2RBGA 4DA7A 4E2FA 1ZH6A 3OQJA 5FWNA 3T0IA 4BZZA 2ZIFA 4RK1A 3TTUA 4TLBA 4JOSA 4BIMA 4CMCA 2J0UA 4D97A 5JD4A 5K0TA 4FD2A 4PZEA 3G5MA 2HW8A 1M1XB 5K3EA 3GZTB 1VLJA 4TSRA 3HDQA 3TK1A 4DJ5X 2DJ5A 2YUIA 3PU6A 3AEQA 3ZE9A 4QECA 5KC9A 4HZUA 5LIRA 1BWRA 3I04M 1GZ6A 1GWNA 1NQ5A 1U2ZA 3OZVA 3T3HA 3LBYA 2XZTA 1V1MA 1XEWX 5AXBA 3SHQA 2B4YA 1HY3A 4XM2A 1KF0A 1UIMA 2Q1TA 2ZUBA 3BT7A 1OJ7A 4QYWA 3HKCA 2PSFA 3M9WA 2O50A 1W5SA 3C14C 4Q47A 1SHUX 1ZD5A 4RJJA 1Y3HA 4KODA 5KJ1A 4X3OA 1RAEA 3NWOA 1D07A 2Z0MA 4YB8A 4ZT7A 5NULA 4AIRA 4YT2A 4CCWA 4LBZA 1FX1A 5REQA 2NUPA 5FHQA 4BQIA 3NV7A 3LH5A 3ZK9A 1W88A 2H92A 3OE7D 1KSHA 1RLJA 2XCTB 3CZRA 3AWDA 1PT9A 2VQSA 4YV7A 3V7UA 3GARA 3AP3A 3N39C 1E2NA 4U7WA 3PNBA 1IXZA 4PFKA 3H2HA 1B8PA 5HBGA 1JBQA 2RGCA 3FPFA 5M3BA 4P3KA 4ZIRA 3QITA 1GILA 1FTNA 2QX9A 2Z9BA 4DMKA 5CB4A 4LI0A 1VJRA 3LUDA 5C4IA 5HEKA 3RWOA 3KFLA 1GPJA 2RFLA 1CUXA 2FSUA 3SBDA 4D44A 3FSJX 4AY6A 1ZVQA 4I1OA 2LBPA 4C89A 1DIBA 1FNMA 5CDSA 2ZPTX 2Y1WA 1JG7A 3R7NA 3R8FA 2YJTD 3GUZA 1P3DA 4CXMA 4RMHA 2EZ8A 2RBKA 1R8QA 4ND5A 3FFTA 2EOAA 4PU0A 1C29B 4L4RA 1T5SA 1XKXA 3PKJA 5JSFA 5LP6A 1SG9A 2WMOB 2VYNA 4MUFA 3UJ6A 1XD9A 3H5IA 4INPA 4XPIA 4QUHA 4BQNA 3RBXA 4CF3A 2XUFA 3BFPA 3L1UA 1ZN7A 3MRVA 4OA8A 5I9BA 2VSFA 2G72A 1QGYA 2UVPB 1A7UA 2VHCA 3DOCA 1BGVA 2G5CA 4QJ5A 3K72B 4BWGA 3WQRA 5KVCA 1SVWA 2Y4NA 1DCFA 3ZDZB 5EC8A 2B8WA 2FE1A 4ALKA 2DERA 1LA2A 4NQZA 3QWAA 4BPBA 3EJ6A 1SUPA 3QMPA 4HS9A 4R1NA 4OLAA 4EZEA 1Q5PA 1RU3A 4KIUA 3L4BA 1BHSA 3HU2A 3F5DA 1GPMA 3DONA 1WU8A 4OAPA 4PGHA 2AF4C 3K92A 4L6CA 4LF5B 1YCGA 3MJSA 3OJFA 4X97A 5SZIA 3X2SA 1QCYA 1KGSA 1UIRA 1X94A 1LC0A 5K8TA 2IUTA 1CZUA 2EYUA 3DEAA 2ZUUA 1KEKA 4P6VF 1C81A 4DB2A 2B1QA 1X42A 3L6RA 2W2PA 1KI6B 1NXVA 1G59A 1X7WA 3UHFA 4TZKA 4J16A 2Q3DA 1DU4A 1EB8A 1SCNE 2B4AA 3ETHA 2NO9A 1CR2A 3DT9A 2GEVA 4D8YA 3NBKA 3RC3A 2GLUA 4XA8A 4ESOA 1R0BA 2O0HA 3BB1A 3TLGB 3E27A 4KIJA 3R0VA 4MUXA 3B5IA 4WN9B 4O3MA 4RENA 1L5VA 3CH6A 4TRMA 1U8TA 5JLAA 1TE2A 2QA5A 4KJXA 2QX4A 4U7FA 3EDRA 4UM8B 4F04A 1DZ3A 1GL7A 1XBTA 1VBNA 2QF7A 1T0UA 3G8CA 1FRZA 3NCHA 4HNGA 2ZIAA 1GT91 3DHNA 1XG5A 5BSUA 3VKUA 4LECA 5BRJA 3DMNA 3OPYB 3GFFA 3DXXA 4I55A 4MROA 3V9PA 3IA2A 4FQ7A 3V7FA 1F2TA 1YH3A 1RYBA 3G5LA 1SOWA 5FNVA 2BDTA 2D3TA 3AU8A 3W9BA 5EHQA 3WLRA 2FMTA 3FNBA 3ANXA 4DLUA 1JIIA 4JP2A 1A95A 4RFSA 1SBQA 3SX4A 2PLAA 1EFPB 3W8EA 4ZGWA 2X8JA 2XNKA 3VV3A 3U7FB 2PM8A 1JSCA 1XDBA 1XIVA 2B78A 4D1YA 5LLTA 4HCJA 5TVKA 4BMDA 4IJWA 3QOWA 5CBPB 1PZGA 1MV8A 3EQ8A 5C4GB 3R0IA 2M32A 4ZVMA 1KR2A 4REMA 4H6VA 3PNYA 1NRJB 1SWVA 3HZHA 4ONEA 4UJ5A 4GEKA 3BJZA 3ZGNA 3SBXA 3E2MA 2Z58A 1X9HA 1SD2A 2WT4A 1QHEA 4YAGA 1BVYF 1EWRA 4FYKA 4W9RA 3B51X 4R8SA 4Q1AA 2NTNA 2X8BA 3LGAA 2NXWA 4MXDA 3WYAA 4DLKA 3DDWA 5FX2A 4A8HA 1KS9A 1GPUA 3SQLA 3TQQA 3M3HA 1LDMA 1VM6A 3CLUD 5DN6D 1ORIA 1QG4A 1ZCJA 5KYYB 4ZODA 4F71A 3W34A 4E15A 5KYXA 3RSSA 3D2CA 1D6NA 4OHOA 3QXSA 4RK6A 2C98A 2O23A 3M4ZA 1RYHA 5DEIA 5EZQA 3UFBA 1TO1E 3V48A 4E2ZA 3F1LA 1NU8A 3GVCA 4P36A 3IR7A 4BOYA 3OUUA 3IA7A 4P5DA 1UPAA 3E9QA 3KOWA 5TRTA 2C5EA 2PL3A 2VYVD 1XVUA 3T5PA 2VFAA 3IAEA 4CKCA 2WI8A 3P0IA 1B0ZA 4F1KA 1OFVA 2Q4EA 2R6R1 4QSHA 4P80A 3IBFA 1KJNA 3D2BA 3I04A 3LP8A 1KDYA 1ZWKA 5LYJB 2V6FA 1BVUA 4JGGA 3KELA 1QFZA 3JYLA 3NHSA 2ZS9A 3OCJA 3T3IA 1GDDA 1EJ0A 4PSVA 5ALDA 4K9RA 3EE6A 2I87A 2NU9B 5INTA 3D31A 3QF4B 1PJ8A 2IEAA 2NZJA 4FLEA 3TAHA 5EGNA 4JMPA 2WB2A 3VU3A 3K4HA 3MGBA 2OC9A 2Z4TA 1NVUQ 2SKEA 2ZXEA 4OKSA 3C4JA 1EVJA 4AZ0B 3BERA 5AR1A 1ORRA 3HSKA 2IVZA 1AZWA 2QS9A 4YJHA 4M3NA 4MMYB 1KK3A 4RVFA 2DFDA 4BGEA 2WAYA 3GLUA 4D4MA 2Y92A 2J59A 1J9EA 3DGEC 4UAUA 4D6YA 3H9BA 2JZOA 3SZRA 3K31A 4FMCB 3CRMA 4JX9A 4TQGA 3F3YA 2DX7A 4Y6RA 4E22A 1T6ZA 4WVFA 3E1KA 1I01A 1KOJA 5AVSA 3PGA1 4H3HB 4O59O 3ZI0A 1VDZA 3A2MA 5FBRB 2GBPA 3GCDA 4MPJA 5E8JA 2VYCA 1HFKA 4QUIA 3C2QA 1FSFA 2HTEA 5BSTA 4EM6A 3G7NA 4PS0A 1FRQA 2P9BA 2PX3A 3NWPA 3OM8A 4Q9LA 2QQFA 5AO9A 1O97C 1RWPA 4YJDA 4F8JA 1FZQA 5C7IO 5JAQA 2D1FA 1Q0ZA 1OKKD 1SULA 2QJRA 2VSYA 5GP1A 4C76A 4ZXFA 3FYHA 5KYVA 2ZU0C 3VA7A 1T9KA 1UKCA 1ZI6A 3NC0C 3OE5A 9MHTA 4QU9A 5AOVA 2XHEA 2QN1A 3FMFA 1MX3A 2FPXA 1BRTA 2K6GA 4P4NA 4OBXA 3HJBA 3T5CA 2GK4A 1K9SA 1G5FA 4NIMA 5JSZB 2L42A 2WAXA 2WKQA 3AF4A 3QX8A 1QHIA 5EJ9A 4LWOA 5BVGA 1YRLA 1E6WA 2XB6A 2XGMA 4J9UE 4NNOA 5HTOA 2PXXA 1WCIA 1N7IA 1L7VC 2E1RA 3SNKA 3W2FA 1KYZA 1CY7A 1KA9H 1ODSA 2IHBA 3M1YA 3W8RA 3GCWA 1F38A 1Z38A 2BHTA 4HJXA 2F43A 4YFYA 3ROEA 3HXKA 1B8UA 4BBAA 1CJCA 2R3SA 1WP4A 4G9EA 4J3FA 4TMTA 1B3RA 3PRKE 3P5BA 4JI2B 4PNPA 1R8YA 3OWOA 3C5EA 4MVJI 1TDJA 2I80A 2Q29A 1VLLA 2FXVA 3GR6A 3IIKA 4KEAA 4YWJA 5FA5A 4TYYA 4EMBA 2GHQA 3HABA 1KMQA 2P79A 4EG3A 1PBNA 5JNUA 2CXOA 3LDUA 5TMEA 3G0DA 4Y2PA 2HA7A 1RBYA 2X8WA 4KO8A 3M2PA 1JPUA 3JU3A 1U80A 2NM0A 3C41J 1CQIB 3PQ5A 4FTWA 4J9VA 4LZWA 2X58A 4MMZB 2C7VA 2NXNA 5E1OA 2G8NA 1KVUA 1OIVA 3ZLJA 4Z4EA 1VLHA 1ZJYA 4MGHA 4LVOA 1OC4A 4NDNE 5E2AA 2CF6A 1P5ZB 3Q7PA 1UQRA 4YCLA 1GNRA 3PLRA 2XDAA 3GGCA 3NORA 2A4KA 4KQMA 2OILA 1EFKA 3JD2A 2WMNB 1LBSA 3K3PA 1U2DA 3QLTA 2J09A 3DT8A 4RPGA 5HJ7A 1V25A 5E9WA 1XU4A 3KWJA 4K9MA 4IQ4A 4X20A 4BU1A 1YRQA 4KO2S 1Q1GA 2HUNA 5KNDD 3RJ5A 1VSTA 3U4IA 2RI1A 4Y6PA 3I1IA 4YCMA 2W11A 2QU7A 2V9ZA 1BN6A 4B3DA 1NI5A 2CV1A 2E85A 2ZYRA 4JLOA 1XLVA 3LNCA 3VKFA 2CYAA 1DKNA 5EPEA 5CDFE 1KFEB 1REQA 2D7CA 2C7GA 2LP4Y 3O4RA 3HR4A 1TB4A 3MN1A 3USCS 4AUEA 2AR7A 3P94A 2LE0A 2FPWA 1ZI8A 1XHFA 2MMGA 4CLEA 2EF1A 1WMEA 2QTBA 1D1PA 2BLLA 4IS2A 4Y6GB 1XL1A 3PXGA 4ENRA 3IV9A 5EJ7A 3FDIA 3OZXA 4YRKA 4XIYA 2VF4X 4WX2B 1BJRE 3ND7A 2ZRJA 3U5TA 2ZZNA 3BM5A 4WNCA 4GT1A 3JQ7A 2Y2VA 3QW4B 4IFBA 3OX2A 4KWTA 1F20A 3GNQA 1HETA 4RH0A 4UEQA 1Q7GA 1WVGA 4FX2A 1KY5A 1PS8A 1NQAO 2W42A 1H9AA 1JQDA 5A5DA 1M2JA 3V6MA 3OIGA 5KNBA 3IULA 2D4HA 2XNSA 1G8FA 3DB2A 3GJ8A 3QWIA 4N6GA 4EB3A 5BPHA 3HC7A 3R5HA 3GH3A 1F51E 4MLZA 4YAJA 5CIQA 3TLYA 1GFZA 3M8KA 4BLSA 4QEDA 1FDRA 4A2PA 2YWRA 3ZD7A 1LPSA 3B82A 5C35A 4OLBA 2FDXA 3OQBA 1B3BA 4W8OA 1K98A 2F3SA 1POXA 2D2FA 3TRFA 1PFUA 1WBJB 2CFOA 2FHPA 2FQQA 4XYLA 2RGUA 3OKPA 1BFKA 3TTWA 1VRWA 4DCJA 1FFXB 3ZEIA 3C6KA 4G5FA 3NW9A 4OHWA 1G8MA 4I1VA 4AJLA 5BVHB 4PQGA 4ZMRA 2NVOA 3ZLUA 2ZSFA 1J00A 2DUNA 1NJ8A 3L9WA 1H85A 1I4EB 4EVIA 3DHEA 3L41A 2B36A 3WIUA 2GZHA 5JDIC 4MYUA 1FMCA 5AMXA 1E1RA 3EPHA 3SJUA 4EI7A 2F1OA 4JDPA 4L5BA 2P2YA 4DRYA 2K7ZA 2A5YB 1LV8A 4MHOA 5B2EA 2FPGB 1OREA 1YJ5A 4DQXA 4BATA 1FRFS 1KH1A 4MCIA 4B40A 1LUAA 1XMOB 3NYRA 4IIJA 1W85B 1EQAA 4PBTA 4RVOA 4ND6A 2FMKA 3MLEA 3QFCA 4JC0A 3ZIUA 4UUOA 2OHFA 4X84A 5D3MB 1Q77A 5C46F 3G2MA 1LBHA 3UMBA 2RE8A 3GPCA 1Q1AA 3UV3A 1CEEA 3JSXA 4F7WA 1RJ9B 1N8TA 3GLRA 3RD5A 5EMNA 3UWSA 2I7TA 1P73A 1YUNA 2AFRA 4QXMA 3SE0A 5CLJA 1DTEA 1PW7A 5CH5A 4KQXA 3LCVB 5IKMA 5JFTA 1PG2A 2JLXA 1LY1A 1KOGA 3GVXA 3UUWA 8ABPA 4DG8A 1MD9A 1PWXA 5FAKA 4QJIA 2FSSA 3QENA 1XQVA 4YDRA 1S2GA 3TSAA 4L2IB 2HYIC 4H0NA 1L3IA 3PGXA 3RWMB 1LBQA 4O6VA 1DQPA 2AMYA 1K3TA 3D3WB 1F3LA 2C61A 3ZK8A 2PFSA 3DXFA 3PGKA 1FYVA 3HQ4O 4HWKA 4KB5A 4P08A 2BTQB 4LGCA 2WU0A 2EKLA 2IT1A 1X7YA 1NFFA 2DUMA 5IAKA 3DPIA 4EGQA 1IPEA 1UT5A 1ADYA 5AI5A 1GPDG 2N47A 2ZVJA 4AX8A 8OHMA 5AVZA 3ILVA 3T3OA 1EP9A 3KZMA 4B3GA 1PFGA 5D3KA 5ECGC 3L0BA 3ZV4A 1YHYA 4HATA 3A6ZA 4YO7A 5K8CA 2M6LA 3CNHA 3AJRA 1ZX1A 1P7CA 2YVLA 1E7SA 3IUEA 1TYEB 3SF8B 4ZCMA 3V8PA 5B1YA 1G5RA 4MWBA 4AJPA 3U37A 1ZO8A 4ZFNA 5FP0A 4OATA 4EKDA 1ZM9A 4B34A 1E94E 2YBDA 1U7WA 5JMPA 3OAAD 1GAWA 2QPAA 4BY9E 2BI4A 1GDTA 3B1WA 3S6JA 1GZ7A 3Q3GE 3QELA 4V0ME 1LLQA 2WF5A 1IHXA 1K0UA 2DWQA 4JIGA 4YCDA 1H93A 1SNYA 3SN6A 4KSBA 1UR5A 1XALA 1I3CA 3OZTA 1AHNA 2WC1A 1ZEJA 3F2IA 1AQIA 4RSRA 5I9MA 3SX0A 3AVWA 1MG0A 3LCRA 4FHFA 5A4MS 1WBDA 4RNCA 3D3EA 2CXXA 1ZCFA 1AS2A 1P17A 4MQFB 2EQBA 2XAUA 1Z16A 1CF2O 3FDFA 3B7PA 1D2CA 3ZY6A 2BH2A 2G04A 5KSYA 2VT7A 1NP6A 2XQFA 1SHKA 3AEZA 3KCNA 2ZCUA 4IH4A 6REQA 3L77A 4ZO8A 4TKUB 1O77A 3KTFA 4B4VA 1NFRA 4GLJA 1QIIA 3EGEA 3FOWA 3IQEA 3LZCA 3CJRA 3QE9Y 1FW8A 5FPKA 5FTLA 3B6JA 5T8KA 4AY2A 2QV0A 1GEEA 3D1LA 3FR8A 2DM6A 4ZK2A 2PUFA 1T5BA 1KAHA 4EBFA 3MOIA 1AUPA 3GQBB 3NVMB 1R3UA 3LV8A 3N2IA 1Q2UA 1OAAA 1USWA 2IP4A 3B13B 1GNVA 3F3SA 4K26A 4RQAA 4BEVA 1PEDA 1SURA 2IXDA 1GUDA 1UXHA 2OBBA 4WOCA 3JRXA 5JNWA 3SPXA 4BNWA 1Z75A 2L69A 3RS0A 5CGZA 1FP7A 2QQEA 2ZSKA 4GI5A 2YRFA 4ITUA 1E58A 2BE9A 3W4IA 1W96A 2CHUA 3GQVA 3Q5EA 4Y9SA 1CG6A 3HJHA 2PUTA 2PEYA 1G2QA 1SQFA 2XMPA 3DZJA 4G56A 4YI5A 2X0KA 4KFRA 1MEEA 1O94C 3AY3A 2WNIA 3AJ8A 3FAKA 4DIEA 3RI3A 4CIBA 5LC1A 1U99A 3IEIA 3QKRB 5EXXA 4P7KA 1RTKA 1YU9A 4B76A 2D5LA 1UDAA 3AT1A 4MS1A 4TV8A 5ALXA 3VC2A 3WYNA 2PG3A 2Q2NA 4JBLA 3TZKA 2VG8A 3CZ4A 4BN4A 5GMOA 4MQEB 1OZGA 5AVWA 1H9BA 4BMSA 1M8GA 1T8SA 3I4FA 5A5GA 5EKTA 1ZXXA 4DL9A 2JGMA 1C1DB 5CX1B 4KFTA 1SOVA 2WZDA 4A16A 1S8FA 4HX9A 1G8PA 3N0TA 2NYVA 4GDFA 5FOUA 3G2KA 1C8LA 1YZQA 3DQPA 2IPAB 4MKFA 4JT9A 4XH9B 5CDYA 5ICGA 1L1FA 4N76A 3N0WA 2ZRQA 3C6MA 4IX9A 1DAEA 5F5NA 1B6SA 1U5BB 4D3DA 5AHWA 2I54A 2HF2A 2C7RA 3I5UA 1WZIA 1R6BX 1U0RA 2R48A 4I5GA 5FBLB 3KEQA 2BKVA 1MGOA 3BWEA 4D74A 1QR6A 3ONEA 3IDAA 3X1KA 1XSEA 2YHSA 4G4SP 4JL8A 4ZAYA 3PFIA 2CLHB 3I9V6 5B1HA 4UPEA 3HKDB 2X6TA 1K7SN 2IGTA 3L7DA 5EWJA 2ISQA 4QLAA 3WBKA 4O2LA 5GIOE 4HDKB 1ZVMA 5GGXA 2IYVA 2ANCA 1LLFA 3EDYA 2OOSA 4ZEXA 2I1LA 5KCMA 3CUWA 3VNAA 4B7UA 2Y6UA 2HA2A 1LRLA 1E8MA 1JMVA 1OHHA 1TIKA 3PL1A 3R0XA 2PRIA 3LPLA 4OLJA 1QH1B 5EEGA 5FJJA 2CHQA 1W9MA 2WD8A 4MGIR 3MF4A 3H9CA 1JZTA 3DL0A 5LLSA 1RM5A 2QP3A 1QHHB 3ENNA 4A2WA 1ADGA 4XGRA 3QF7A 4DREA 4F4IA 1XYGA 2QAGB 4QGHA 4V2IA 4H59A 3ESYA 3DOOA 4JBIA 5EMJA 1EVKA 2OXRA 1UDXA 4IDAA 5IX8A 4BLOA 5FL7A 1KWGA 3LA6A 4XGQA 2B2XA 1QVWA 3OI7A 4P84A 2Q1XA 1OA1A 1XVIA 3PEVA 4OP2A 2QY6A 4MA4A 1SBNE 3FBWA 1COWA 4MW5A 3KJIA 4E70A 5MFZA 4NXMB 3ZQJA 2P6OA 4INJA 2REQB 4X62B 4XX0B 2P2GA 3GYGA 1FFSA 5JAMA 4JKIA 3UM9A 2XOXA 4NG4A 2H1LA 2V0CA 1WZUA 2P9FA 3KPWA 3EWSA 1MUUA 1R64A 5BW6B 1AVTA 3PF9A 2EJCA 1ZZEA 3I1FA 5CRIA 2VJBA 4LFBB 1T5OA 4JVSB 1JT9A 2FMFA 1CCWA 1JG4A 3GXOA 4KQHA 1YGPA 2WJVA 2OZLA 2GJ9A 4WSOA 5SY9A 5BOSB 5I4BA 1P2TA 1SU7A 5BSFA 1N0IA 1LJLA 4UUMA 4EG6A 1RLMA 2AEJA 2R2GA 1IMJA 2IHKA 3L49A 5J2TB 1W87A 1X1EA 4MYSA 4ZV7A 3DBHB 4RM2A 4TLDA 1P1RA 3ESZA 2P9QA 5JRJA 4G5HA 4HN4B 1ZH8A 3CX8A 3TI9A 4UU8A 5TIIA 1QF9A 1E1CB 2YVUA 1LS6A 2QL6A 2LKCA 3EAFA 5HFAA 1GTRA 2LIPA 4WDRA 3TFQA 1UXIA 4JC8A 2R4TA 5IDYA 3FPBA 1Q0RA 4Z3DA 3O03A 3TMAA 1NZJA 2BFEB 4AKHA 1ORVA 2NVUA 3MWGA 3KJZA 1CT9A 5FYQA 4BX0A 2ECKA 3YASA 2O0LA 4A3SA 2HKIA 3OZCA 1O6CA 2PMWB 3BCUA 3CCFA 3NHLA 3QM1A 2JLCA 2ODQA 2GPSA 4MV4A 4M0KA 1JVSA 2OCKA 5YASA 3V4FA 3GA7A 3FFXA 4JC5A 4EQ6A 1D0SA 3Q41A 4GXTA 2CXSA 3MOSA 1R6VA 3A4MA 5AKHA 2R751 1G6Q1 2RAUA 1HE1C 16PKA 3KKNA 1A8UA 2ZSIA 3LUPA 3PD1A 4MYDA </