1KN4L

Catalytic antibody d2.3 complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
219
structure length
219
Chain Sequence
DIVMTQSPLTLSVTIGQPASISCKSSQSLLYSNGKTYLNWLLQRPGQSPKRLIHLVSKLDSGVPDRITGSGSGTDFTLKISRVEAADLGVYYCVQGTHFPYTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IG ANTIBODY D2.3 (LIGHT CHAIN)
publication title Remarkable remote chiral recognition in a reaction mediated by a catalytic antibody.
pubmed doi rcsb
molecule tags Immune system
total genus 50
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2001-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kn4L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kn4L01
3UO1H 4KK9C 3GMLB 1U8NA 4HJJH 3KYKH 5SV3A 5JIIA 4WWID 4X7TA 5CUSH 3WFEH 1WAAE 2WUCH 3MUY1 2PETA 3O6LL 1LP9A 4XP1H 4WO4D 4P46C 4LSRH 3MGAA 4FZEH 3TVMD 4YXLL 1MUJA 1K4CB 3SDXF 5FUOH 5JXAL 4IMKC 1WF5A 5DQJA 1U3HC 1KB9J 1H8SA 4N1HB 3SKUD 1HXYB 3SY0A 4F57H 1K5NB 2H9GA 1JZ8A 1CN4A 2IFFL 1YY9C 3RUGB 5BOZG 1YPZE 1ZLWK 3QG6B 4H5SB 4DZ8B 1ZHKB 5T5FL 5T1KD 4PGBA 5L2JA 1FH5L 1CXHA 4OI9A 4R9HA 5I9QB 1UB6A 4Y4FD 3S8WA 3G9AB 4LSVL 3VI4E 5I66B 3S37H 4GRWB 1PEZA 3MODL 3IAGC 2NCMA 1G6VK 3RWFA 4Y8AA 3PP3K 5GGUA 2P5WA 1VHPA 4N5ED 1YYMH 5E6IB 2EC8A 3EYSH 4ODXB 3VXMD 2FHBA 4X6EB 1K2DA 1QSED 3QNYB 4JRXE 4PJ7B 4LPXA 4XWGH 4XXDA 5DD0L 4DKFL 4O02H 3GSQB 1R5IA 4NO3A 1JGDB 2WAHA 4X6BA 3O11A 3GSVA 3MLUH 1JPST 4APQC 2V5SA 1QBMH 2VLKB 1J0ZA 4UIMA 1EX0A 4XCEB 3T65B 4Y16A 2O93L 4TSBH 3SQOH 1NCNA 1MHPL 6CGTA 4BFIB 1MJ8L 4I0KA 4RQQB 2XOTA 2J8OA 3D39E 3T0BA 5C0NC 4CBPA 3BD5A 3MLWH 4QRPE 1KBGH 4XTRD 2VJXA 3F5WB 4OQTL 3R4DA 4O9HL 5CCKL 1EEUA 3RDTB 3S6CA 1JI2A 4Q9QH 1JP5A 1OY3B 3UBXA 1MCFA 2VNCA 4LDOB 1CFSB 3IFNL 1Q9LB 3OXSA 2H1PL 3ARFB 1KEMH 4ZFGH 3DIFB 2VKXA 5D7KD 4E41B 1J0HA 1P4IL 4GS7B 3EOTH 4DKEL 1IL1B 5F88B 5JMRA 5GJTL 3D2UD 4LKCB 1G7PA 2IMNA 3GBNH 3SOBL 5DMKB 4D2NA 5JNYA 4KKAD 2BSRB 5IR1A 1ACYH 5I1LB 2AAVA 3QEQB 1KIQA 1MI5E 1TCRA 3DWTA 3VFGH 3BESR 4P57A 1GIGL 1RZJC 3QWRA 1DVFB 1KC5H 4KUZH 3MREB 3BKJL 3H3PL 1P5VA 4PRID 1FFNB 1UM5H 4LIQH 3V6ZA 4BELD 3U4EB 5ESQB 2XY2A 1FO0B 4ZG1A 4RFEB 3LKQA 1XCTA 2ADJB 4WENB 4MHHI 4Q6IC 5HSFA 3MJ7B 1LNUB 4X9FA 1YMHA 3L3IA 5I1CL 5JHDD 2ZG3A 4RGNE 2EDXA 2XZAH 1I1AC 1JF1A 5FYKU 1RQ5A 2DIJA 1TJIL 4CL7A 4NJ9L 4IRSC 3VXUB 2DQEL 4Z7QF 5HHXH 5CBAA 4P5MB 3ULVH 3K2MC 3NFNA 3LV3A 5C08D 5AYUL 2NNAB 5CP7B 3VRLF 1YECH 5T1LA 2NX5D 3MR9A 4GW4B 1MQKL 4NQCB 4NT6B 2DLIA 2CMRH 1P69B 1XCQB 1NGPL 2X4RB 4S1DD 2CIIB 4OGXL 5CZXC 2IAND 1V3KA 5H35B 3RWEA 4RA3A 2MKWA 5DHYB 3B5GA 5A16B 3ZE0E 3OAUL 2D0HA 2FJFA 5C9JB 1D6VL 1UVQA 1KIPA 3UC0L 4X9IA 3PL6D 3OKKA 4G43A 4ZQKA 3IRZA 1C12B 2ZOLB 3UO1L 5D2LA 2EDQA 4HJJL 5DJCB 1WC7A 3KYKL 5CUSL 2APBA 3K3QA 3IDJB 3WFEL 2FO1A 1FAKT 3WN5A 2X9XA 5GXBB 3KPSB 2XRAH 2WUCL 3GBMH 5GS3A 2NZ9D 3ARGC 1XF5B 2CIKA 2CLRB 4NUJB 1NCTA 3QFJD 4LSRL 4FZEL 3C87A 2QEJA 3FT4B 2P24A 3C8HA 5FUOL 3TCLA 1CGTA 1KELH 2FEEL 3MRCB 3O9WB 5MERA 2RJMA 5TH2A 4QRQB 2AJUH 1TLKA 5D7LB 4G9FE 3MV8B 2H8PA 3UAJD 4H8WC 5JW4N 3IAPA 4Z6AT 2VABA 1S7TA 2OTWB 3U7WL 2N1KA 4GRLC 2WBJA 4RX4A 3V95A 3UJTH 1IBGH 1S8DA 1P5UA 4JPIA 4KAQL 5C07A 3VJ6A 3S5LA 3S37L 3PWPB 4MB5A 5ADPH 2UWEB 3EYVA 4LSSH 5ECJE 4M1CD 4RIRB 2ZKHH 1GZPA 3GZKA 4N9OB 4ZFZA 3TA3D 2Q7YA 3H7LA 3HMXA 1EEQA 5LVEA 3SCMC 2AVGA 1IGCH 1YYML 5IMOA 1P84J 4ODBD 2FATH 1I8IB 1ONQA 3ALXA 3R06B 4YDKH 2DI8A 1EHLH 3P9MA 3QJFA 4O02L 3DOSA 3L5XL 4NQSB 2P8MA 1IAIM 1R5VA 1XGUA 5JW3H 3STZA 5MEQA 3L3HA 4HULB 2VXVL 3MLUL 1U92B 4OCMC 2VITA 1RUMH 1ZS8B 1UZ8B 4OKDA 5B39A 1W0WB 1QBML 3QUKB 4BYHA 4U3XA 2JJSA 3D48R 4NN6B 3CVHH 3OKMA 1VFBB 2HWZL 4PJCE 4OZFH 4B0MM 2Q86A 2KQNA 1X44A 1CGWA 5CGYD 1KBGL 1T83A 3KPRB 2CO6B 3LKPA 2KZWA 4I0PB 1U95A 1MHEA 2P8PA 3RWIA 1Y6KR 4FP8H 4LKXB 3DXAD 2E3VA 3A6OA 4NQXB 3RPIA 2APVA 4NPYB 1I8KA 4GW5A 3PHOA 4Z7WB 4HK0B 1CLCA 1MOEA 3CK0H 4MNQB 5F1SA 2X4NA 5HYQB 3VWKD 2QR0B 4WO4C 1U8JB 1KEML 4JY5H 1T1YB 4MNHA 4BQCA 4ZFGL 3W0WE 1RK0A 1YUHB 4MA7H 2SEBA 3MNWB 3EOTL 3L9RB 3UTPE 1UKQA 4XRCB 5DWUH 1MHHA 5DS8B 2DQJL 4CU6A 1WFNA 1FYHB 4LMQI 4LRIC 2MOVA 3Q6FB 3DARA 5HGHB 3VFGL 1NH6A 1E4XL 4LIQE 4WGVB 4NUJA 4QOKB 4AM0B 3WJLC 4KUZL 1B6DA 4OCYH 2LV4A 3BPOC 3MACH 4Y4FC 3WNOA 2P5ED 4OLEA 5KOMC 1UM5L 4LIQL 4YK4C 3SDCD 1CYGA 3H0TB 4G8GE 1FVCA 1XIWB 4JQIH 5KANI 3LN4B 5BRZE 2EZ0D 4J1UB 4OZGF 4N5EC 4YR6A 4KWUA 1A22B 3HE7A 5DRWA 5E2JA 4ZFFB 5CWSA 1P4BH 3KLDA 2XZAL 3V0VA 3VFSB 1HH6A 1A9BA 5JXEA 1FL3B 3ALWA 1WZMA 3ULVE 2IADB 1OARL 4Q58C 5C0EB 5HHXL 5C1MB 4BQ8A 1RZIB 5DHVB 3ULVL 2AJ3B 5F7YC 4HMDA 1KGCE 2FX8H 4J3WA 4P4RB 1LK2A 3DX6B 3LMJH 1N3NA 1YECL 1IGIH 1NUDA 3WIHL 3X13B 3TBVA 1NGXB 2CMRL 1J5OH 3HI5H 1WCBA 1KCLA 5C70A 4OZIE 1YDPB 1EAPA 2VQUA 4J4PA 4XTRC 2DDQH 3DUUA 4X6DA 3BP5A 4R97C 2ICEA 3CSGA 4G6JH 4IM8A 4U1MB 4V2CB 5FO9B 3GKZA 2OL3B 5DRNA 5D1ZB 4KTEH 1BQUA 1A6WH 3BWAB 3LDBB 4R96A 1FZOB 3QQ4A 1KPVB 3NCJH 4G42B 4Y2DD 2EIEA 3GBML 3J8F7 4D9RD 3DX9A 1IEHA 2BVYA 4PY8J 1G9EA 1WICA 5DJXB 5FKPB 2Z8RA 5HGBB 5C7XH 4N68A 1MFBH 3HFMH 4NNXA 3CXHJ 1KELL 3P9LA 4WGWB 1H9VA 4X99A 4KKAC 3QA3A 2AJUL 1CDCA 1FG9C 4IJ3B 4XXCC 4J3SA 3IETA 2NW3B 5ELIA 3S37X 3I50H 3DTXA 1NJ9A 3BRDA 1BVLB 3OB0K 1WIPA 1S5HB 2APTA 2DTMH 1H3TA 4K3EH 2BSSA 3UJTL 1IBGL 2GCYB 4I18A 2NW2B 2WUBH 4NQEA 1PX3A 1RD6A 3T4YB 5IEKA 4RMTA 4NQDA 4PJGE 2DWEA 3QISA 3MCKA 1R3JA 2F58H 3HG1E 1MHCB 1ZHLA 3MXVH 4IRJB 1TPXB 2XNAA 4XWOD 3BAEH 3BI9X 3QYCA 1IGCL 4AMKL 5EU3A 4U0QB 1IAII 5K93A 1RURL 2FATL 4WW2B 3QRFM 3QDMB 1EV2E 1EHLL 3F58H 4NOFA 3BGFB 4HQQH 5HPMA 4R4BB 5JW4M 4X83A 5JW3L 1G0YR 3NPZB 2IAMD 4QRTB 2YN5A 4PRHA 3C5JA 5EBGA 1NDGB 4UILH 5TGBA 4S1DC 4M3KB 1OGTA 4P46B 3RWJA 2WP3O 3CVHL 3HHRB 5IFJB 1OW0C 3DURA 5B8CB 3SE3C 4GSDH 2FBOJ 5I73C 5L2KE 4K3JH 5DMGD 3BJ91 3SGJA 4I8DA 1FRGH 4OCWH 3WIFB 3FO0L 3TBWB 4CVXA 2YR3A 2BVQA 2ENSA 1TJGH 3PL6C 4U1JA 5F6IB 3U4BH 1CG9B 4PRDA 4DJMA 5E9DA 4FP8L 5E0QA 1BAFL 5B38B 1TETH 1OD9A 5D71H 4GMTH 2K7QA 4HAGA 4L4TE 2NZ9C 4P2QB 3RIFK 1KPRA 3IF1B 4MNGA 1NEZB 1QNZH 1DBKH 2E8ZA 4MA7L 3WJJC 3KPMB 2DBJA 3L7EB 5EOTB 2X4OA 1C1EH 5DWUL 3QR2A 3EDDA 4XHJD 2D7OA 4HKBA 1P2CB 4N0FB 4POYA 5FECB 4CVZB 2YZ8A 4AY0A 1FFRA 3UAJC 2R8SH 3EBAA 2HVKB 2DQGH 4MSWB 2GTZA 2DQTH 4WNQA 4YNYB 32C2B 2I9LA 5E4EC 2D7NA 4QRRD 5FKPA 4F7PB 4XGZA 4OCYL 5F9WB 2JB5L 4JN1L 3MACL 3HCVA 3B43A 3ME0A 2M2DA 2CLZB 3MV7E 4EDXB 4K71B 5IWLC 4M1CC 4JQIL 5SV4A 5KSBB 1MLBA 4TUJA 3WHXA 2BXYA 3CH1A 5HJ3A 4GW1A 2OI9B 3TM6A 3WS6C 1P4BL 1G0XA 3ZE1F 4YHZL 3CUPA 5C8JA 5IB4A 1JPGB 2ZUWA 3SO5A 1KACB 4HJ0D 5I0ZA 4G80A 4R6UA 3LZFH 4WHDA 1AKJD 4UV7H 5SX5K 3RRQA 1QSZA 4M9PA 2XN9E 4BUHA 5E7BA 2YD9A 3GMQA 9CGTA 3FFCA 3FQUA 2DI9A 2F19H 1VFMA 1D9KC 2R4SL 4RBPH 5C0DA 3N1QC 2FX8L 4FTVD 4OIAA 5C09B 3LMJL 3VG0H 5AAWA 4LCYB 1IGIL 1VKXB 1J5OL 4RA0C 3UTPD 4PP1D 1IEBB 2FZ3B 3HI5L 2NY5H 3KNBB 4IS6A 4WW2A 2X4PB 4ALAH 5GGSY 1D7FA 5I8OL 5CGYC 2BOCA 5C0AA 4KH2A 2E7LC 1UCBH 5IVOA 1MCNA 4UIKH 1KJVA 1VEOA 4YC2C 1VDGA 4QRTA 4HFWA 2JIXD 2MQCA 3HZMA 5FYJU 1ES0B 5J3HD 4HK3N 2NLJA 1A6WL 1U8QA 3PJSB 1RIHH 5I8EB 3LN5B 3VWKC 3NCJL 5BRZD 1U2HA 4MZ3A 5J6HB 5HYSA 4GBXA 2WLZA 4V1DA 5CSBA 3WIFA 2GJ6E 3P2TA 3P4MB 2KKQA 2VQ1A 3Q5TA 1I9JL 4XNMA 1JYVA 5E1AB 3NCMA 5C7XL 2MMXA 4HUWB 1MFBL 1R5WA 5I2IA 2XXCB 3B5HA 4PJEB 4CMHC 2BVTA 1NMBL 3RP1A 4ZYKB 3UTZB 3MFGB 4LAJH 1F4AA 4IRSB 2WINA 1I3UA 2ZUYA 3D9AH 4NUGL 3DV4A 5IIEB 1C5DA 1W8OA 1NPUA 2DTML 4K3EL 1T6VN 3SDCC 5F89B 3LD8B 3TWCL 5KVFH 4QNPF 2WUBL 1Z2KA 3RWGA 2X6MA 3LEVH 3G6JB 4QHLA 1I7RA 2EZ0C 1AQKH 1H0DB 4ONGH 2GSGA 4MA1B 3IKCB 2BMKB 1HQRB 2F58L 1TZIB 3VDBA 1N5AA 1JHTA 3WBDA 3BAEL 1IM9B 3H9SD 3MBXH 3QXUA 4HUNB 3U1SH 1JBJA 3QIBB 4ZO8A 2HLAA 2LVEA 4GMSH 2D03H 2Z35A 4M8QA 4U49A 4HIIB 5BCAA 3QDAA 4EUPA 2HJLB 3F58L 4LCWB 4HQQL 2E7BA 5DHXB 4NC2B 4NC1C 2JE8A 3U0PA 1RZKH 1S9VB 5ESAA 3ILPA 1MCRA 3TV3H 4UILL 5ISZD 4WUUB 5KTEH 3RVVD 2BERA 4LHUB 3K8LA 4NO2A 5D6CB 1CL7H 5IB3A 1R24A 4K3JL 3RUGF 4W70A 3BUYA 1U42A 3FFDA 1FRGL 1AQDA 4OCWL 5IGXH 5I0DA 5F3BB 1P9MA 2CSPA 5HY9B 1K8DB 3IFPB 1BF2A 5DVKA 1MWAB 1IM3A 3BZ4A 2EC9T 3RTQA 1TETL 5T1DH 5D71L 4HIHB 1QZ1A 4XNZC 4GMTL 4Y2DC 4XVJH 5F1IA 3C6LD 1MAJA 3GB7B 5JQHC 4Z7VF 3O4OC 3ZDXF 3VFPB 1QSVA 3DUSB 4ZPVA 1QNZL 1DBKL 1E27B 3CCHB 3O2WH 1N6UA 2VLLA 1X5ZA 4MJIE 1FYTB 5DD1L 2A6KB 1C1EL 4N0UA 3VDCA 1HWHB 4KXZI 5DJ6B 3SO3C 1YC7A 3EFFA 2PW1B 4YHYB 2DQUL 2R8SL 5JO5B 4PJ7F 1JTOA 2DQGL 4GQ9H 2DQTL 5IV2B 2Z31B 5KN5B 2JB6B 4I48B 1NGZB 2XWJB 2DQFB 5FYLD 1VFAB 1WBXA 5IG7A 3A6BH 4PJFB 4MXVE 2AK4A 2DMBA 4CN6A 1CQYA 5CS7A 4FZ8L 5C6TH 3V6OE 2R4RH 4F7MB 1QP1A 4ETQB 3G5XB 1QR1B 1FL5A 2A83B 4XWOC 3VFOA 2DYPB 1UWEL 3TJHD 4PGEA 3L3DB 1IAKB 1ZKAA 1YQVH 1KTDA 2L7UA 3JXAA 5ENWB 5IVXE 3FQRA 4YHLH 4PJBE 3LZFL 3GNMH 4M6NH 4UV7L 1Z5LB 4GAYB 2Q8BH 3NCYP 1FNGB 3QI9A 3CVIL 4R0LC 3L5HA 4JG0H 3B9DA 5EC2B 1NFKA 3STLA 2IAMC 4XPGH 4CGTA 5EIQA 2IEPA 4P23D 2D4FA 1BJ1H 1QFUH 3CFBA 2AEWA 4MWFA 5FM5M 3QFDB 4UU9B 5MI0B 1CFTB 1JNHA 4NKDA 2DM3A 3VG0L 2G5RA 4GJTB 2NY1D 4FHBD 5J4MA 2O61A 5HHOD 1HEZB 1SM3H 2QADD 2NY5L 3N1FC 4OFDA 4L3EA 3RA7H 4Y1AB 2EDNA 5GRWA 5BV7C 5DMGC 3E6HB 3AS0A 4C59B 5DT1L 2BVEA 1T21A 4L4JA 5CMAA 3A6CL 3A67H 1UCBL 4JFDE 4UIKL 2FO4B 3CZFA 4N0CD 2PW2A 5T1KB 3G5ZA 3HPJB 1A4KA 4TNWK 3I6LD 1OPGH 3FB5A 2LVCA 3VWJD 5J6GA 1TENA 5KS9B 4N8VG 3CSBA 1G7HA 4J23A 5I18H 1G7JB 2B1AH 1Q9KA 1CLOH 5DD6A 5FDWA 3FRPG 1O7VA 2AERT 4PJHB 1U8KB 4XHJC 3AXLB 1GH7A 2H2SD 3GO1H 4WI8A 5K33A 4L9DA 1RZGB 4W6YB 1A7NH 5DFWH 1UXSA 4ELMA 4DW2L 2A77H 1F11B 5DK2A 3NPSB 4PGCB 2V2XA 4H26A 1VFUA 3KJ4B 3V4VH 3BKMH 2X7LB 2X89D 3BH8A 1BQSA 2H3NB 4LPVA 3PGDB 5KVFL 4HS6B 5H94B 3LEVL 1N2RB 3PUCA 4R7NA 1AQKL 4ONGL 1GXEA 1MY5A 1WT5C 4X8XA 4FQQB 2E9BA 5CINH 3BH9B 2AW2A 4WCYH 1NGYA 4WI2A 4XCFH 1DUYA 4LFHD 4OZFG 1L7TH 3BIBX 3MBXL 4RMWA 5J1AB 2YEZA 4HJ0C 3U1SL 2A74A 4AZ8A 1IQWH 1SBSH 1S3KH 1IZKA 2D03L 4L8BA 5DEZA 3CLFH 1AGDA 5E2UH 4Y5XC 1T2JA 1BM3H 3K1KC 1AXTH 2NY0B 4Y4HB 4HS3A 4RFNC 3IDXH 4FABH 4GKOA 1RZKL 4AT6B 3W9DA 2Y7QB 3SDDD 5E7FA 4PP1C 3TV3L 5A40E 2GI7A 5KTEL 3PQYB 3HLAA 5FGBA 4PS4L 1S9KC 3ZHDA 1CL7L 3FT2A 3SQBA 3HR6A 1NQBA 4X9HA 5I76B 3C60A 5IGXL 4JGJA 1VCAA 5L9DH 3DSNA 3L3KB 3WMSA 3QHTC 5DJAB 4Y5VA 3HRZB 5J3HC 4WWKC 4ZUSA 1M7DA 5T1DL 1GGTA 4FFZH 4XVJL 2ZSVB 4XX1E 4M7JH 3P9WB 4ZNEE 4C4KO 2UWEF 3BXNA 2NY3D 4JFED 2VAAA 2YWYA 1LO3H 3MV9E 1NFDA 5JA9A 1F45A 4OD2A 3D18B 3JBG7 1OAUH 3OF6A 4JRYD 3CC5A 2E9JA 4QHKI 1EFXB 2PO6D 2Y36H 4NCC2 2W92A 3VH8G 1J05B 3PG2A 4GQ9L 2G5BB 2EDWA 3KDMB 1JK8A 4HBCH 4JKKA 5D7IE 4LLQB 5ANME 3E6FB 3SJVE 1GCFA 4ZSOB 3A6BL 4URTB 4BQBA 4PP2B 1BREA 1FFPB 4GG6A 5IVZA 4WJ5A 4F9PC 3I2CH 2R4RL 1AE6H 2DAVA 1F11A 1FVEA 5MENE 3RNQB 3C5ZB 4QF1A 4RMSA 1L6ZA 1QPPA 5E6ZA 1YQVL 1QO3A 4YHLL 2FLRT 1T1ZA 1CVSC 2P4AB 3GNML 4M6NL 2Q8BL 3TN0B 5DJDB 5E6YA 3CFDA 3FHQA 4JG0L 2XA3A 1PZ5B 2HRPH 5A2IH 1YMME 2DKMA 4XPGL 4Z7WF 3TIEA 5EBMA 4BJLA 1EZVX 3QDJB 1QFUL 4NCDA 4HWZB 3CFKB 2P8LA 2V9QA 2CDEA 5IM7A 5I1JH 5C0IA 4JFZH 1T7XA 3DVNB 4R26H 3RVVC 4PJIF 1TVBA 4QCIA 4BH7B 2AKRB 5B3NA 3GRWA 2Y06L 4N1CA 4MJID 4P9HH 3ZKXC 2H45A 4RMVA 5DI8B 1HHIB 2DLEA 1SYVA 3SDAD 3RA7L 4JFXB 3L3GA 4JFOB 3TNMA 5F70A 3TBYB 5GGRB 4JM2B 4GLRH 2A6JA 3A67L 3DX8A 3FB6A 3TO2A 4UDUA 2YMXL 35C8H 1I4FA 1WTLA 3FT3A 5DC0A 4NKOA 4RAVA 1OPGL 1PQZA 5C6WH 5I1DA 2FNBA 3C6LC 3D25B 1G6RA 1MIMH 5EO9A 4DVBB 1AI1H 3HKFA 3THMH 1CICA 5BVJA 5A2JH 5I18L 1CLOL 4JHZA 4TULH 4OIBA 1LD9B 3QCUH 1MAML 1JWMB 1QRNB 3ZYJA 3H9YA 4QHNA 2VDQH 3GO1L 1XGRB 4H1LB 2NQCA 1CU4H 1HSBB 4PUBH 1A7NL 5I74C 4DN4H 3LIZH 1NAKH 2FX7H 1J8HD 1ZK9A 1DBAL 3MLSH 4PPTA 2CRYA 5D2NA 4YWGH 1FV1B 3H9HA 5JPMB 1JWSA 4XP6H 3M45A 1PD6A 2A9NH 3V4VL 5ICXB 1D9KB 3UDWC 2VB5A 1CXEA 4KRPD 3LQZB 4W6XB 4RMQA 5GS0H 4I5BA 3QEGH 3CSYB 2LAAA 3IGAA 2W0FA 3ARDB 5CSZA 4UUJA 3G6AA 5JDJA 2ZG1A 5CINL 3MA7B 1N4XH 2FEDD 3TJHC 3W9EA 4WCYL 4M3JA 5IJKC 2PN5A 4XCFL 1TZHB 1L7TL 4JDZA 3OSKA 2A6DB 3ESUF 3E3QC 1IQWL 1P7QD 4JN2B 1SBSL 1VB9A 1S3KL 1TVDA 4X7SH 2LTQB 4M7LT 3TH2T 4WDIB 5I6XC 3CLFL 4U1NA 5E2UL 4ODUA 1BM3L 1MJ7H 1A6AB 1AXTL 3VW3L 4P23C 3X3GH 3IJSA 5F7WC 5AUMB 4LVNC 5IW1B 4M93B 1RULH 3IDXL 4PJAE 3ZTJG 2NY1C 4FABL 3QQ3B 4IBLT 5BQ7B 2DWDB 3EO0B 1E28A 5IQ9B 2QADC 5CLTA 1BQLH 5JZ7D 5ALBH 2ID5A 2OZ4A 3IFOA 1M7IA 1I75A 2ICCA 5DURB 3SGKC 4NKIH 2R2HB 4JRXB 5JW4Q 4LLWA 2C1PA 4N0CC 2D7TH 2JTDA 3MMEA 5EOQH 5EU6E 3L5WB 2R2BA 3DVNA 2DS4A 2CDFB 3VWJC 1AXSB 3BPCB 5TDOA 3ZTNH 4L8DB 4UT9H 2C4FU 4ODVH 1DBMH 3K2UL 1BZ9B 2AP2A 1MVUB 1HOCA 3PWNB 3QIWB 4M7JL 1QACA 1TVHB 1XF4A 2VSCA 4PGDA 4Z7VA 3D39B 1PFCA 2YD8A 1YNKH 1BQHG 5FCUH 3F6IA 1KN2H 1LO3L 4QRPB 1NUNB 3MPCA 4L29A 4DGYH 2DQIH 2HFTA 3BZEA 2OJEB 2Z92A 2H2SC 4GAGH 1ZHNA 2I07B 2J3SA 1OAUL 3GUTA 2AEPH 3RHWF 4DAGH 2O26U 1QLRB 5GSVB 2Y36L 1JUFA 1VERA 2EEAA 3KPQB 4KMQA 4HBCL 1OT2A 3HI6H 2CKBH 4Y19E 3OKLB 1NLDH 4H88L 1MCLA 3Q6GH 1F4HA 1T1WB 3RWHA 1U58A 3I2CL 3QNXA 1AE6L 1T5XA 4U7KA 4U1KB 4YHNB 5LBSH 4WW1B 5HDOA 1A2YB 4OFIA 1A7BA 1MI5B 2Z91B 4JPKH 4BSVB 3T0EA 4QY8B 5HVHC 4PLJD 3SKOB 4E0RB 1ROWA 3MBEB 1JTTA 1MREH 1EEZA 4Z7OF 2PYFA 1TDQA 1P7HL 2HRPL 4EI5C 1MCOH 3EKCA 3QUZB 4FXGB 3NFPA 5FDYA 3LEXA 4IEFB 5I8KH 2BK8A 3SDDC 4L4VD 5D9SB 2VZTA 3OKOA 1YN7A 4RGNB 3V52H 4C83A 5I1JL 4R26L 5DJYA 3OMZA 3QUXD 3B8SA 1BD2A 4NO5B 1FL6A 3C8KB 4P9HL 1F90H 5L8LB 4G8FB 3RU8H 2DLGA 4Y4KD 5DZNA 1XEDA 2IQ9H 4NHCH 3G08B 4CAGA 3BISA 1QEWA 1AO7E 4P5KB 5FK9B 2CR3A 5IROC 5KSVA 3U7AA 2O5ZH 3QHFL 4NZUH 3S4SG 3DMMA 4XAKD 3JV5A 5EIIA 4ELKA 5C0GB 3SJVD 2OLDA 1T0NA 1ZA6B 4XPBH 4HT1H 4OI7A 2XZCH 5HHQB 1J9CT 5F97E 5AD0A 5E94B 4G6MH 3DECA 3KYOB 1MIML 1OM3H 1AI1L 4CDHA 2W60A 5EU5B 2NY3C 3LVEA 3BYTA 4EDWH 4Y5YA 4LPWA 3Q0HA 4S10A 4TULL 5KSBF 3FQWB 3RZCD 3VD4A 4WHYH 3QCUL 3MSPA 3D3VE 3FQNA 1KN4H 1PX4A 2PO6C 2VDQL 5D1XC 1EVUA 1OAYH 4M7ZC 1CU4L 4PUBL 1ZLVK 1MCJA 5T3ZD 2MWCA 4DN4L 3LIZL 1NAKL 1EXUB 4JO3H 2FX7L 3NCBB 5HYIA 3MLSL 5F7LB 4R4ND 2YC1A 4YWGL 2JF1A 2UZXB 5E03A 3ETBF 3U36A 5SWZD 2AJVH 3V6BR 3U6RB 5J89A 2A9NL 5I30H 3OJDA 5KSUA 3BP6B 2GIYA 2DQHH 5T33H 1XZ0A 3ORJA 5DGRA 5GS0L 3QEGL 5DLMH 4X9BA 3CFIC 2Q20A 1I9RH 3UEZA 3WDJA 3VA6A 5CGMA 1N4XL 4HPYL 4G9FB 5HYJA 1LK3H 2RB8A 3NACH 1NAMA 5HI3D 1VFOA 3OQ3B 4YHMH 4CMMA 4G9DA 3O2VH 4YPGB 4X7SL 4ZAKA 2E9WA 3VFRB 2EYSB 2FWOA 3E1F1 2IGFH 4C56A 1LP9E 3O4LA 2DN7A 2NXYD 1MJ7L 3X3GL 3HNVL 2V7NA 2AABH 1T0PB 4OFYA 3FONA 1RULL 3WNLA 1I9EA 3S96A 5JPNA 1S7QA 1BBJB 4NO0A 3MRJB 1BQLL 3SDAC 5ALBL 4XX1G 2HVJB 1U2CA 2W0KA 4ZD3H 4MX7A 4R3SA 4MAYB 3KYMB 1KT2B 4EVNB 5GGQL 4P4KD 1WUNT 2BRRH 1UM6H 4OKVB 3VFNB 1RV6X 3OKEA 5LXGH 5D7JA 2YPLA 3MRBB 2EDEA 2D7TL 5ESVB 4F8TA 2XACC 2X41A 1JV5B 3TYGH 2VLJD 3O6FD 1OOAA 3S3JA 3OAYK 3GJEA 2Z4QA 3CXDH 4HGWA 3UTTA 5EZOH 3WNPA 2P5WE 4UT9L 4ODVL 2K1MA 1AGFA 4P3CH 4LVOB 4LCCB 4PJCB 1QBBA 1LILA 3LSOB 3MLYH 5KSAD 4UQ2B 3HMXH 1YNKL 5FCUL 4YHPA 3D85D 3SE4C 4DGYL 2DQIL 2VISB 4CKVX 5EN2B 4X6CB 2GJZB 4GAGL 3HNSL 3RY5A 5HHMD 3PIQB 3PGCA 1HSAA 1AKJB 3BP4A 5BS0E 4M7LH 4R7DB 3HE6D 4P5TD 5EU7C 5C0BA 2K7PA 2B4CL 4JM4H 4KRPC 1LEKB 4C54A 5I1EH 1ORSB 3K0WA 3W0WB 4RCAA 1XF2A 4L3CA 4Z76A 3Q6GL 3QRGH 4HH8A 3PHQB 4K94H 4JE4B 3ARED 4XBPA 1D5MB 1SY6A 1KJMB 1BX2A 3PWJB 2Q7NA 2QHRH 2FEDC 1INQB 4EZMA 4PJ9B 1JMXA 2B8OT 5E70A 1CR9H 4YQXH 5LBSL 4AL8H 1PG7W 4PJ8A 4FQXA 2HJKB 4IDJH 2GQHA 4LDLB 4GUPB 4U1LB 4Y7MA 1MREL 4WWKB 4G8GB 1D5BA 1MCOL 3KPOB 4M9OA 3AU1A 3B9EA 5I8KL 5BZDB 3BDXA 5FA3A 2H6PB 3DYPA 5LQBL 4TOYH 4PJIA 1A1OA 3GSRA 2JCCB 2XTJE 1AHWA 5E00A 3ES6A 3I85A 4LLYA 4TQEL 1F90L 3MJ9A 2X4UA 3O8XA 1W8NA 3QAZC 4PFEA 3RU8L 5IF0A 3OX8B 3HAEG 1MCPH 4Z78A 3IDGB 2O5ZL 1V7MH 2FHFA 4HUXA 1S9XB 4NBZB 2RGSA 3QNZA 3ULSA 3OKNA 1UWXK 3S98A 2FH8A 4HT1L 1VADB 2GY5A 2RCSH 3CPLA 3PF2A 2PTTB 4Y19D 4DUVA 5CD3A 4EKXA 1JHKH 1WFUA 3F7YB 4YBQD 4P2RA 5MHSE 5I1GH 1OM3L 2AV7A 4ONHB 3G04B 4TUOA 4ONFL 4EDWL 1FG2A 1AP2A 4RWYH 3MRBA 5ICZB 1HINH 2FJHA 5HVWA 3MLVL 3D5OF 5GIRB 4GRWE 5L6YL 4R8WH 1KN4L 1OCWH 5HHPA 1IGYA 2Q1EA 2GUOB 4OBSA 4PD4J 1EGJA 1SBBA 2Y25A 3IDNA 1A7RH 4S1SL 3S3PA 1AD9B 1PY4A 2J8UF 4JO3L 5DRXA 2X05A 2GJJA 1MELA 3VRIA 4UQ2A 4QGYA 5TPWL 2AJVL 1T22B 2FCBA 4LVHB 5C9KA 4KMLB 2M26A 4LLMB 2DQHL 5D1QD 5EPMA 2EYRB 5GISH 3P4OA 1FCCA 1N6QH 2YSSA 1DQDH 1I9RL 2E7CA 3BE1L 1M6OB 3BYYA 1DQMH 5I1AA 1ZHBB 2XYCA 1LK3L 3NACL 5HHNA 1D6EB 4PLJC 4YGVA 4XZUA 4YHML 1OSPH 1A0QH 3U83A 2I9TB 4MJ6B 1DEEB 3O2VL 5E5MB 4LASH 2NXZB 3HS0B 1B0GA 2JJTA 2XZZA 2IGFL 5HTSA 1LO4H 3WL9A 3JVGA 2V7HB 3SGEH 4YAQA 5KS9F 5F72S 4G8EA 5JR1H 2AABL 4TVPD 4PJGB 1OB1B 1D5IH 4HH9B 4ENED 3HG1B 3QUXC 3D3VD 3WFHB 2LU4A 3GEWB 4PJHF 4P2YA 4Y4KC 3O0RL 4YBLB 1S78D 4ZD3L 2F5BH 4JCMA 1QG3A 1A21A 1J1PH 4G7VH 2BRRL 3B9AA 1UM6L 1NUFA 3HRPA 1D5XA 2QKIA 3ULUH 3C6SB 5LXGL 1HILA 5DJ8B 2E27H 4QHMB 5GRZA 3TYGL 15C8L 5IKCB 3V0AC 2LQRA 3K8MA 5DEGB 4D0BB 2COQA 3CVHB 1ND0B 1R3HB 1GZQB 3CXDL 2R0WL 5EZOL 2X4SA 3WFDH 4CJ1A 4OZFB 1XR8A 1QSFD 4WV1A 4P3CL 3S3SA 5D93C 1ZWIB 3M17A 3VXSA 3RZCC 1F58H 5E8PA 3LKNB 3MLYL 4NFBA 3HMXL 5L2KB 1FPTH 2Z93A 1JZ3A 3WIHA 3P0GB 4JZJC 2FRGP 2DLTA 3FRUB 1QFWH 5ACZA 2MNUA 1UJ3A 4R4NC 4M7LL 2DLFH 3HB3D 1DE4A 4L4TB 5CJOH 3KPNA 1I7ZB 4X5XA 4JM4L 4DZBA 4I3RH 4MLSA 3KLAB 4LLVB 4JFQA 4P23B 5I1HH 4QYOB 5I1EL 1RZ8A 2NTFB 1KTKE 1RUAH 2XFXB 4UTBH 1MPAH 4JZNA 3QRGL 4K94L 4OB5H 1MLCB 2O5XL 3HC0A 3BW9A 2QHRL 4NFCA 1MH5B 4IMKA 2PXYD 2P1YA 1CR9L 1U3HA 4AL8L 4YQXL 3TNNB 1RU9H 2Y4SA 2FDBP 4MDJB 3Q3GA 4FG6D 4R90H 3WNNA 4RISH 2NXYC 3PNWA 4QHUB 4F9LC 3HMWH 4EN3B 3AGVA 1QLEH 2BNRA 4KV5F 3PV6A 1A9EB 3MV7B 3WS3A 4JY6B 5DC9B 3LKRA 1JGEB 5TE6H 4JO2H 1WWAX 4FQ2L 1DL7H 3DRTA 4N8VA 2OL3H 4XAWH 4TOYL 4UAOC 2F54D 3GFUA 4OZHA 2VL5A 1UXWA 5BJTB 3GK8H 3TO4B 3EJJX 1K3ZA 3RNKA 2D31B 3C5SB 4D0DB 4P4KC 3DRQA 1MCPL 3RGVB 5BS0D 2AJYH 2XN9B 2HP4A 3U0WH 3BO8B 1LEIB 3O6FC 4LLUA 4PG9A 2JJWA 4WIQA 1WFOA 1WZ1H 4DWHA 2OR9H 4OD3L 3ZYOA 1K8IA 2RCSL 1IAOB 5D7LE 2AJZB 2QV2A 5DJ2B 5EZIH 1JHKL 1S9WB 3MLTA 5F1NB 4APQA 4Z77A 2ADFH 5KSAC 4LCIH 5JTWA 2YHGA 2F74A 4RWYL 5IB2A 4KHTL 1HINL 1YQ2A 4WI3A 3TZVD 1IC7H 1PGRB 4P2OD 1A3RH 1NC2A 3QWOA 1HQ4A 1L4IA 1B9ZA 5GGSB 2ATKB 2EICA 4YHOH 4ZUTA 4BA8A 3HE6C 4WI5A 4P5TC 1A7RL 3DROA 3O3AA 1JF5A 3FHAA 1BF8A 1K4DB 1UFUA 4JPWH 3D87B 4PRPA 3ARBD 1YNLL 4JAMA 4EI5B 4KVCH 4L9LB 3BVNA 1H15B 2GJ6B 3V7AE 4JFFA 2E9IA 4YDIH 5M7QA 3AREC 4MA3B 1V3LA 4IMLB 2YPVH 5GISL 4X6DE 5JOPD 1N6QL 4ISVA 4PBWD 4OLYL 2NY2B 2ZP0T 5C92A 1F5WA 3C09C 1DQML 3FCTB 4PJDA 5C0CA 3PWLB 1UZ6F 5IBUB 4JM2F 5DR5H 1CF8L 3FQTA 3PHSA 1OSPL 4LNRB 4QXTA 4F37K 3NZ8B 5IUSA 3GMPB 3CIQA 3DX7A 4LASL 4HDIA 5DEFB 3SKMB 3T08A 2ICWB 2Q87A 2WIIB 2OMNA 1NMCB 2Q76B 5MHSD 1A6PA 4ZS6D 3BPLC 1LO4L 3TCXA 5IW6B 3UP1A 4BZ1H 1L0YA 4X6FB 5F7KC 5JR1L 1H3GA 4GFTB 2J5LB 3V8CA 4I2XA 4PJ5A 3KPLB 3V5DA 4ZXBB 3B2UD 2EXWD 2Y5TA 5GS2H 4G7YH 4Q6IA 3U30C 3ULUE 1TTUA 3OWEA 1I1AA 5D1XB 3MRRA 1J1PL 2BNQA 2RFXA 4G7VL 5FA4A 3ULUL 2WV3A 5E6ID 1IGJA 3GSOB 2ZCKH 1QLFB 3HPLB 3OKDA 5MEOB 1KUMA 1EEYB 1UB5B 3VU2A 1NCCH 4NQEE 1PAMA 3AMKA 1AIFA 2X09A 4KJWD 1WAAF 4EQ3A 4N0RA 1RIUH 5ABDE 3VH8A 4HUVB 4NQDE 2CR6A 3B5TA 4YBQC 3VFVA 3WFDL 3T04D 1ACZA 3KXFB 2VLRA 5IJVB 3U9UA 3MO1B 2OJZH 4KRMB 3LN9A 3BRFA 2N4IA 1F58L 7FABH 3OZ9L 4OAWA 5DUBA 2VLKD 5D70L 1RZFL 4U6XA 3BGMA 1FPTL 4QTHB 1YPZF 2W0LA 1RJLA 3O81A 3H3BC 4MXWH 5K59E 2R23B 1QFWL 3RPKA 2VLME 4QXUH 3BQUB 4EUPH 3L95A 4IHOA 4PRHE 3ZO0A 1NFIA 4BZYA 1I7TA 5DMIH 2BVOB 3UBXG 5CJOL 4I3RL 3ZZ1A 4YHKH 3JV6A 3RDTD 3W39A 3KHQA 4LCUB 1RPQA 3H7BA 5D1QC 4O2FB 3QO0A 5BXFB 5I1HL 4S11A 2ATPB 3TFKD 1A7PH 4UINH 1RUAL 3MJGX 4UTBL 1MPAL 3ARGA 4LARH 4OB5L 1JPTH 1XGTA 2XXMB 3ARFD 3O41B 3LAFA 5MEPA 4N0YH 5GHWH 4E41D 4F7TA 5E9DE 4FQHB 2R1XA 1BIIB 5FUZL 3DNKA 5FYKD 4JG1H 1F8TL 4NCC1 8FABA 4U1IB 3VRJB 4U6VH 5KVDH 1VGKA 4MJ5B 4R90L 4Q2ZB 4F7CB 2V9RA 1CDYA 3IDMA 3MNZB 4UDTB 5F9OH 1CD1A 3QEQD 5IHUH 5CEZH 1TQCB 3HMWL 1QLEL 1H3VA 3AB0C 5E8EB 3D69A 2ZUXA 1DVFD 5F1KC 4GRLA 3FO9B 3K4AA 4ENEC 4Q9CA 1N7MH 3BKCH 1R3KA 4JO2L 1DL7L 4YDJA 4XAWL 3ZE2F 2YD6A 3SPVA 1S78C 4IOFC 3IXAB 4WHYG 3GK8L 3WHE0 4OCLC 4XH2A 3LQAH 3VGEA 5IVXB 5FB8A 5F9JB 4PJBB 3EYOA 3SCMA 3UTSB 1WFTA 2OM5A 1HI6A 2ITCA 2AJYL 1OTUD 3BHBB 4XCYA 2C26A 4ZUVB 1ZLWH 5EC1B 3IJHB 3NMEA 1HHGA 2GTWB 2OR9L 5IB5B 1AJ7H 3VXUD 1S7WA 3JWOH 3HI1A 2Z8VC 5FO7A 1OGAA 5EZIL 5E56A 4D9QE 1DN0B 2MPAH 3IXTA 5B21A 3MRGB 4JY4A 3O3DB 4EIGB 4HG4K 3JV0A 1DBJH 1IT9H 1YJDC 2ADFL 4YHIA 5DVMA 1J10A 4LCIL 1ZGLB 1ED3A 5TE7H 1SJHA 4GG8B 3DI3B 4NQTA 4NQCD 1NDMB 1RUQH 5TFSH 3VXRA 3PP3H 4JFDB 1A3RL 3FFCE 3VMOA 4YHOL 1U0QA 4X8JB 1RSFA 4LSQH 3BSZH 3V6FA 4XPHH 3HB3C 3KLSA 1U36A 2HYMA 1MAKA 4U6HB 2J8UA 1HHJA 4J8RA 2KL6A 4JPWL 5LGKA 3BFOA 3RWCA 3QEHA 4YXHH 5FCSH 2EXYD 2DF3A 3MROA 5KW9H 2CRZA 3UTQB 2YD5A 3IDYB 4HAFA 5C0AE 2AXGA 4WO4A 4HK3J 3S4SB 2H26B 2YPVL 3KPSD 3TVMA 5CEXB 3OR7B 4P59H 4ERSH 2MSPA 2PXYC 2Q6WB 3RL1A 4X7DC 5FO8B 1FGVH 1R3LB 2EECA 3P0VH 4PREB 1KTLA 3HR5B 5CJ8A 3FQXA 2ERJB 2J12B 1GPOL 2WK2A 4FG6C 5DR5L 3O9WD 4LRIA 3MFFB 4NM4H 4W6WB 1A6VL 4RFOH 5D7LD 2P45B 3MV8D 4NRYB 1T5WA 4I13B 3NFSL 4V1DE 1VESA 5JQ6H 2AI0L 3WJLA 4G8IB 2FIRT 5EU4A 4WFHE 1CIUA 1Q94B 2X4QA 4Y4FA 4QXGH 1ITCA 3S5LG 1FNEB 5J1TC 3VXTA 4ESKA 2IBZY 4NHUB 3O3EB 3PWPD 4G7YL 4P2QE 5CILH 1BQHA 2C7UB 1FORH 4ZO7A 3VXMA 1CDBA 1CWVA 5E2VH 1QSEA 4W68A 2ZCKL 1Q9OB 1VPOH 4HC1H 4O2EA 1V5JA 2J4WL 3RVUD 3U46A 1DANU 1NCCL 4Z5RA 1F97A 1RIUL 1H5BB 4D9LH 2F5AH 1AGEB 3QIUB 3B3IA 2PTUA 4OUUB 3DGCR 1CL7I 1RJZA 5GPRA 1A4JB 1Y6MR 2OJZL 3JV4B 1S5IH 3T3PE 4YEFA 7FABL 3V0WH 4XCNA 5IFHH 4RZCA 3TZVC 3EUUA 4P2OC 1OTTD 2G9HA 1HHHB 1U8PA 1F4XH 2ESVB 2QJDA 3EO9L 4MXWL 3GSWA 4BQ9A 2VIRB 4KDWA 5F7MC 1CZ8H 4QXUL 4GXUM 1TQBC 4JFYA 3P4LA 3KPRD 4NQVA 4WFFD 4I0PD 5L7XH 5DK0B 3ARBC 3LS4H 5DMIL 1LEGB 5IK3A 2A1WH 3DHJA 4YHKL 3MZTA 3TYFA 1CGXA 1HIML 1J88A 3WDIA 2XTJC 3MV9B 1BFOA 1EMTH 1KYOK 4MNQD 5E8DL 4LARL 4DFIA 1JPTL 5JHLH 4N0YL 3D2UA 4QRUB 3A0OA 2AJSH 2ZUQB 3MRQB 4ODHH 3RL2A 4L8CB 4B7IA 4MCYB 1EPFA 4JG1L 2QQKH 3H42H 5CEZE 4XXCA 5ANMB 3MRKB 1C5CH 3V5HB 2ZZUT 3WD5L 1FJ1B 5F9OL 1PZUB 1KB9K 2H26A 4ZS6C 1GC1C 3CFJB 4TNVF 1OF2B 5DMJB 5CEZL 4PRIA 4QOKD 3BEVB 3K8KA 3EGSA 5I9QC 4KDTC 1T4KA 4KZEL 3P4NA 4BZ2H 4N0UE 1NKOA 3B2UC 4O51B 4PJCF 2EXWC 2G2RB 2YUVA 3GJFA 5HGGS 3BKCL 5MENB 1KIRB 1XIWD 3MRNB 5JHDA 5K9OB 3CLEH 1S7VB 4JQXC 3CJJA 1J1XH 2VLMD 3LQAL 1LO5A 5GS1B 5BOPA 5E6IC 1KG0B 4KY1H 4R2GB 1LO2H 1RK1B 2IFGA 2AK4E 2XIDA 4YGAB 2WMPA 4KJWC 1YMMB 5JIPA 4OZ4B 4JHWH 4PJEE 4JVPA 5C08A 1AJ7L 3JWOL 3BIKB 5DJ0A 5T3XH 2MPAL 3QXDA 2NX5A 2EKSB 1IT9L 3BZDA 4RMRA 5SWQB 3IU4L 5I71C 5TE7L 4PG2C 2ZG2A 2IANA 1OW0A 1UKSA 4MCZB 4XP5H 5EUOB 2GSIB 1RUQL 2BCKA 3MRMB 1TITA 1WITA 4UOW1 1GGYA 1NEUA 4JFHE 4X7CC 3T77A 3WEXB 2GY7B 4L8SB 2D7QA 3WO4C 2V2TA 4LSQL 3BN9D 3BSZL 1PYWB 4XPHL 3PL6A 2DD8H 5SWSB 2VE6A 3RDTC 3B6SB 1U8OB 4YXHL 3V9FA 5D1ZD 4ZOEA 3I9GL 1QA9B 4L3EE 4PV8A 5KW9L 4UI2A 5F7DB 3TFKC 3CH8A 2FYYA 3N0PB 3GRWH 2OCFD 1AXIB 4MXQD 1NL0H 1ZTXL 3QFJA 3QWQB 4HKXA 4I4WB 1FFOA 4WHTA 4XNUL 3E2HB 3QDGB 1IGFH 4P59L 4ERSL 4JANB 3WJJA 1I1YB 4WU7A 1AGBB 4GS7C 1FGVL 4HIJB 3ARXA 5FOBB 5CBEA 3P0VL 1QBAA 1BOYA 4PRBB 3ULVF 5EIVA 1DUZB 3PDOB 1I1FB 3T8XA 4UQ3A 3MRLA 1YEDA 3R1GH 4NM4L 5ID0B 3IAQA 3I6KA 1G6RH 3P3YA 1JGUH 5F93C 5LGHH 1DVFC 1SJEB 2OYPA 4QKXB 5IQ7H 3QXAA 3HUJF 4KI1A 4QXGL 1T04B 5IW3A 1I3RB 1AC6A 2Y72A 2WBWB 3UYRH 4OZIF 3JTTB 2IPKB 4PY7B 4NBXB 3RAJH 3UPRA 5IWLA 3N1MC 1I8MB 5ERWA 4ELME 4P3DB 3TA3A 2MFNA 1F2XK 4MQ7B 3CFCH 2IBZX 3WS6A 3GMMA 3TIDA 1FORL 4IRJD 4EXKA 2XWBA 1OTUC 4TTDD 1VPOL 3GIVA 4YDVB 3MRDB 3PWVA 1QHOA 1I85C 2M1KA 3CSPA 2FIKB 5K9KB 2OS7A 4PJAB 3QDMD 4JDTH 2OTUB 3S36H 4JKLA 5EFIA 3VXQB 4D9LL 1LQSR 2F5AL 2GFBA 3NA9H 1T83C 5EZLB 5A43C 2EDHA 3DVGB 4KFZC 5IMMA 5D96B 4XVTH 1X5FA 5GGVH 1FIEA 5INDA 1CFNA 1M71A 1KCKA 4MS8D 3S35H 4N8PA 5IFHL 2CJUH 4HKZB 4P46D 1YPZA 1F4XL 5IHZB 3GMNA 1KIUA 1C16A 3CD4A 5AG9A 3BDYH 4ZDHA 5EU6B 2E7LA 1CFVH 5CP3A 1CZ8L 4YO0B 1SJVA 1XF3A 1MCDA 4OD1H 4PRAA 1MCIA 2R1WA 3X14B 3DXAA 1G7LB 1R0AH 2B1HH 5L7XL 2EXYC 3LS4L 5DF0A 2A1WL 4OQ1A 1WTGT 2AXFB 2ZCLL 3DBXB 5TQ0H 5I19H 3VWKA 4PJGF 1PSKH 3GI9L 1X5AA 1Y0LB 1EMTL 2OZ4H 2B7DT 2CLVB 4P2QD 4FQJH 2E6QA 5JHLL 4L8SA 2BSTA 1PYWA 4F3FA 3L3JA 4J3UA 2X1PA 1DN2A 5C2BH 2HTLD 4OLUH 2AJSL 2HFFB 2UYLB 4ODHL 5ALCH 5AZEL 3O9WC 1T0MB 5GSRB 3HAEA 4LF3A 4Y1AE 2G75B 3H42L 1YEJH 4HMEA 1JWUA 1C5CL 5GQBA 2MHAA 2GITA 2P5EA 1JZ7A 1NFDE 1GHFH 3N1PC 4BK5A 4I0CC 4BZ2L 2PYEB 2CUHA 3DYMA 4Q0XH 3GSNA 1WZLA 1FZKB 2L4OA 3CLEL 1LE5B 1IGMH 1J1XL 4F7EA 1KPUA 4Z7UA 5LAXA 4D94A 3IU3B 4KY1L 1J8KA 2V2WB 1LO2L 2OSLB 1CXKA 3MOBH 3RVUC 2GEEA 5D72H 4GG6E 4IIQB 1UGNA 4G6KH 5T3XE 4XNQB 3IT8D 1F3JB 5FYJD 4GXVH 1P84K 1E6OH 1U93B 5T3XL 3QZWA 1WBYB 2FR4B 4Y88A 1HE7A 4GKZA 3W11C 3AS3A 3MUGA 4HFUH 1J0IA 4GLRI 3I6GB 1OTTC 5C09D 1G9NC 1F3DH 1N6VA 1Y18A 4NN6C 1NC4B 4ZPTB 1AO7B 1KLGB 4YH6A 3AAZA 3SHSA 3HZKB 2IFFH 3JWDH 3GSUB 3IB4A 3B9KB 4I0PC 1KXTB 2DD8L 2RQ8A 3LKSA 4K7FA 4HIEA 1D5ZB 5TDPA 3ABZA 3AB0B 1FH5H 2C1OA 4Y2DA 3OXRA 2PCPB 1XGQA 3GRWL 3D3VB 1E4JA 2W65B 4LEOA 2ITDA 5DRZA 3ARVA 1MF2H 4BQ6A 2F53B 3CDFA 3MNVA 3PQYE 4KTYA 1A6ZB 5CHNB 3BEWB 4WFGD 1ZOXA 1S7SB 3R1GL 5DD0H 4MD5B 3VFUB 1G7MA 5HVFB 4CNIA 4IRSD 4HXBH 4K9EC 1JGUL 4HJGA 43C9B 3QUYB 3REVA 2WLYA 5IQ7L 1NCBL 2QSCH 4J12A 1TIUA 2IH3A 1UKTA 1XIWC 2P46B 3RAJL 4YIQA 4CRPA 1U8NB 2OMBA 1OQOA 1WEJH 4X7TB 1MJ8H 3QEUA 3CFCL 5D2NE 5LGJA 4NDMA 1QVOA 3GM0A 2R69H 1ORQA 43CAA 1LP9B 1IM9D 2OP4L 4NSKA 1QPXA 2OTPA 1MUJB 5CCKH 3QIBD 4CU7A 4QNPE 4EUPG 5DQJB 4R0LA 3SY0B 5FM5O 4OV5A 2H9GB 4XBGA 4JDTL 2IAMA 3S36L 2ZPKH 1PEWA 3IFNH 3QJHA 4LCWD 4XVTL 3VA2C 5GGVL 4TN9A 5J7CC 1F00I 1HCVA 3S35L 1NAMH 5C0JA 4PGBB 3WUWA 5L2JB 3FO1A 3MV11 4WUUD 4XMPH 5C2UB 1UB6B 3D0VA 4LHUD 3BDYL 4NYLA 3BN9C 1J11A 1MNUL 5EBWA 3RWFB 4NNYA 3TH4T 4LLDA 4OGYL 3GGWA 2I27N 5GGUB 2P5WB 4M7KH 3QULA 4OD1L 1XGPA 5IESL 1KB5A 1R0AL 4J6RH 1GIGH 2A73A 3PABA 2C3XA 2LFGA 1T1XA 5D1ZC 5SX5H 1OQXA 1A5FL 3EZJB 3NH7H 5J13B 1ERNA 2F9BT 1D3CA 2PTVA 1ADQA 1K2DB 3LDBC 4RWHA 5INCA 4MXQC 5I19L 1PSKL 2OK0H 4XXDB 2OZ4L 1YEGH 3K7UA 4HSQA 1R5IB 4NO3B 1BLNA 1QQDA 4X6BB 3OHXA 4LK4A 3X3FH 3O11B 3GSVB 5I1CH 5JW5A 2IBGA 1CE6A 3VGFA 5C2BL 2X70A 4OLUL 3VXNA 2DJ4A 3LKOA 4UIMB 3EJZD 5ALCL 1FYTD 4QRSA 1P53A 1WQVT 4Y16B 4Z8FH 1WK0A 3STBA 5JA8B 2V5YA 3MJ6A 4AENA 2DQEH 4QGTA 4Z7VE 2WSKA 2MTPA 3CXHK 4QRRA 4HLJA 2Z31D 1FZJA 5JW4R 2ZSWA 1A7OH 4K7PH 3NIFE 1GHFL 5DUPL 1UC6A 4AEHH 5C3TA 4CN4A 4S0SD 4C57C 2VTFA 3MV01 4Q0XL 2GK2A 1CXIA 2W1NA 1WT5A 3UBXB 4HS8L 5I1KH 2DQDL 2D4DA 5TJWK 2QQQA 5T1MA 1IGML 3OXSB 4IRJC 5FAAA 4TTDC 4ZOCA 1TPXC 4FQIH 3FN9A 2DYPD 3MUHL 2EDDA 3EOAA 1ZT7A 3MOBL 5D72L 1H3PH 3QPQD 2E5EA 4WW2C 5D5MF 3G6DH 4G6KL 3BDBA 4Y5XA 4LQFH 1G7PB 1NBZA 1BWMA 3HC3L 5JNYB 1T6WA 3BGFC 3G5VA 3GDBA 1ZT1A 4GXVL 2IH1A 2VR4A 1E6OL 3V5KA 4NRZA 4FTVA 1SY6H 5CJ5A 4JDVA 5IR1B 2XTJB 1KIQB 1TCRB 1WGOA 4MS8C 3ROLA 3D0LA 4P57B 3T0EE 3ZKSD 3TBSA 1DDHA 4HFUL 3OGCA 1WBZA 1UADC 3UJJH 3V6ZB 5B8CC 1YZZA 4Y1AD 3JWDL 1X7QA 3LKQB 1XCTB 4OLVH 2JIXA 2J88H 1TFHA 3DO3A 5HDBF 2ZUSA 1YMHB 3L3IB 2EDFA 4MXVF 1MCWW 5F6IC 4WHCA 1BD2E 1JF1B 4HXAH 5C0FA 5F1OB 1HH9A 3U7WH 2EDBA 4KJQD 5IMKA 1VACA 4KAQH 4EJ1C 5DQ9A 1TXKA 3MJ9H 5CBAB 3U79A 2J8HA 4ZO9A 1AY1L 5FYKL 3NFNB 4XT1C 3LV3B 1A1NA 1MF2L 2HTLC 5IVXF 2HJFA 5TF1H 4PJBF 1N59A 2ZCHH 3ZL4H 5T1LB 3MR9B 3N9GL 4I1NB 4LSTH 3SDYL 3RWEB 4JQVC 4MQXD 5IOPA 5E99L 2HA1A 4HXBL 3L5XH 3REWA 4NP4H 5CJXC 4KDVA 5F9WC 2FJFB 2VXVH 1FNLA 3HUJA 3UYPA 2QSCL 5ITFA 2YWZA 1UVQB 2LE9A 2VWEE 1KIPB 4KI5E 4OZIA 3OKKB 4G43B 4ZQKB 5I71B 4PYHA 4K71C 2FB4H 1ZVSA 5D2LB 4U2YA 1WC7B 2HWZH 1EGJH 1WEJL 2OI9C 3PXJA 3H9SA 5CLWA 3WN5B 1DP0A 1UYWL 2R69L 2CIKB 3S36X 3WO4B 3FO2A 3UZEA 2AGJL 1UQSA 2P24B 1CBVH 5IVNA 2YRZA 3TCLB 3FL7A 3S35X 5MERB 2WWKT 5TH2B 2ZPKL 4LVEA 3T0XA 2DM4A 2BY2A 2H8PB 2NY0D 5ISZA 2B5IB 4G3YH 4Y4HD 4PJXA 1PW3A 3WLBA 5F96H 2VABB 1S7TB 1NAML 1Z6JT 4XMPL 2WBJB 3PQYD 3L3OA 1S8DB 4C56E 4MGXA 4JPIB 5A3ID 5C07B 3VJ6B 1OSZA 4HX1A 3S5LB 2DQJH 1CICD 2H41A 4E5XA 4CU8A 3JUZA 4QWWD 3RX8A 2R2CA 3EYVB 3RJDA 2HMIC 4OFKA 4KRNA 3RQ3A 2YD2A 4AEEA 2MKLC 2A9ML 2EKJA 1GZPB 1V7NH 5ID1A 3IFLH 4M7KL 4ZFZB 1E4XH 4JFPA 5EZJA 3O45A 2Q7YB 4J6RL 4LP4A 5DMYA 3NGBB 4QT5A 3NH7L 5IMOB 3C6LA 1DBBH 2ZOKA 2W0PA 1ONQB 3MJ8A 2OK0L 5DVOA 2HG5A 1HXMA 3P9MB 3QJFB 1G9MC 1YEGL 2YPLE 3QPXH 2P8MB 1R5VB 1XGUB 4ZOAA 3X3FL 3STZB 5MEQB 1QFWM 3L3HB 4K7PY 2CUIA 2VITB 5B39B 3UTTE 3QP3A 4Z8FL 1KCSH 4PTUA 3OKMB 1EFXD 3GMRA 4KUCF 3PWUA 1DLHA 1OARH 2Q86B 1LO0H 5CEYA 1VEPA 1A7OL 2W38A 4K7PL 4KU1A 3UDWA 1VEMA 3LKPB 1G7QA 1ZAGA 4K8RH 5IT2L 5CIPA 2WW8A 1U95B 5I16A 4KJPD 3LD8C 1MHEB 2P8PB 4ZTPH 2GKIA 4AEHL 2IPTH 3RWIB 3WIHH 5C71A 2CK0H 3RPIB 2EIBA 4MA1C 1I8KB 4GW5B 3PHOB 3T2QA 5I1KL 5C0BE 1JYWA 5IJKA 4P3WA 2X4NB 5E5UB 4HWNA 2Z8SA 5FF6A 5KZCB 4FQIL 3QH3A 3RIAK 3C5ZD 4MNHB 1S7XA 3QIBC 1RK0B 1H3PL 2SEBB 1YEKH 3G6DL 1LE9A 1U8MA 2E6PA 2GYSA 4LQFL 1MHHB 3MGTA 5HYFA 3TN0D 4O2CA 1KLFA 1YEEL 1RHHA 1SY6L 1TMCB 3QDJD 3Q5YA 4XNXL 5HHOA 4X98A 4HZAA 1OAKH 3F12A 3NCYS 3DV6A 5H2BA 2LABA 1UEMA 1Q9WA 3SGKA 3RKDD 3UJJL 1T3FA 1BEYL 1FVCB 3B83A 2NY7H 5D7IF 1IGTA 1U8HA 4OLVL 4JM2D 4WUKL 2J88L 3KYAA 4YR6B 1BFSA 4U1SA 3HE7B 5DRWB 2YUXA 5CWSB 3V0VB 1KFAL 4HXAL 1HH6B 1A9BB 3V4PL 4RRPG 3H8NA 3PDGA 4Z7NE 3MJ9L 4E9LA 4KQ3H 3NBNA 3ET9F 4I9WE 1J12A 5DDHA 3ZDZE 2VSDA 2MJWA 4JHAH 4M5YH 1EJ6A 1LVEA 3MRPA 4HGKC 5TF1L 1QRND 3EJZC 1LK2B 2IQAA 3ZL4L 2ZCHL 3V7MA 1N3NB 4AMKH 1NLBH 3DSFH 4GRMA 1SYSA 4FN0A 4YFLI 3TBVB 4P2RE 4YHYC 4LSTL 5ETUA 1RURH 2KH2B 1WCBB 2VDLH 1SJXA 3LB6D 2VC2H 4KKLC 2Z31C 4IOSD 1EAPB 1J1OH 25C8H 2X89A 2HN7A 1S7RA 4NP4L 1MRDH 3B2VH 2PF6A 3DUUB 4X6DB 1P1ZA 4OLWH 3BP5B 1QTYT 2ICEB 1D9KD 1G1CA 4M6OL 5DRNB 2EO1A 3IVKA 1CTNA 2FB4L 4R96B 3ARDD 1INEH 1EGJL 1RIVH 1E4KC 1AD0A 3QQ4B 4M1GH 5ICYA 3VD5A 3E0GA 3H3KA 3SGEI 4OLXH 3DX9B 3QPQC 3FO0H 4FXKA 4X6CE 5CD5D 1CBVL 2B0SH 3MRIA 4NNXB 4E42A 3P9LB 1BAFH 4H25A 3VXPA 2NY4C 3X17A 4X99B 3HN3A 3QA3B 2X42A 3C60C 1ZE3C 3IETB 4NN5B 3SDDA 5MI0C 1CDIA 4G3YL 2AJXH 1CDGA 3DTXB 1NJ9B 4O00A 5F96L 1IEAA 2BSSB 1C08A 1CCZA 4I18B 4NQEB 5DURD 2XKSA 3GIZH 3O2DA 4JRXD 5IROA 5IEKB 2RAMA 1RZJH 2V5RA 4OV6F 1NBYA 4NQDB 2DWEB 3ARZA 3MCKB 1IKNC 5HDQL 1R3JB 1V7NL 1ZHLB 3IFLL 5HGDA 2XNAB 1MFAH 4PLKD 1HNFA 4ORGA 1KLUA 4KJQC 5EU3B 4KI5D 2JB5H 4JN1H 1DBBL 1JPSH 1GGIH 1QFWI 2DLHA 4JFEA 2R2EA 3QIWD 2ZUUA 2DL2A 3CFEA 1W72A 3QPXL 5HPMB 3D39D 1MVFA 3QCVH 3ALPA 4JRYA 2X1OA 4QRPD 2FGWH 4PRHB 2PO6A 3C5JB 4YHZH 2JCCE 5TGBB 4K7PX 4FQ1H 1OGTB 3RWJB 3LRSA 1RI8A 1KCSL 1BECA 4M43H 3L5IA 4K23H 3VG9B 3DURB 1AGCA 4MQXC 3VXSE 3NPSC 3I3DA 4YE4H 3GI8H 4PJAF 3DLQR 12E8L 5DO2D 1LO0L 2Y5EA 3KJ4C 4GQPH 1GOFA 2R4SH 4CVXB 2BVQB 4K8RL 5TDNA 1U41A 4F2MA 4U1JB 3KVQA 4ZTPL 4PRDB 2IPTL 3MRFA 5E9DB 1JNJA 4U1HA 2CK0L 1KJ3H 4NWTH 1BWWA 4BFBD 2BOBA 1FLRH 5I8OH 4HEME 1KPRB 1V3MA 3N06B 4MNGB 1BIHA 1MI5D 3KS0J 4PRNA 2KDGA 1P4LA 1CDHA 5D5MA 1YEKL 1A02N 5DA0B 2X4OB 4DKAA 3MBED 3WXVH 4HKBB 3RWDA 4X7EC 1BP3B 1Z0NA 1BJ1J 4KTDH 4DN3H 5E8OA 2NY0C 3ECBA 1BOGA 3QUZD 3T0DA 2GTZB 4Y4HC 3UPAA 4WNQB 1SEBA 4MJIA 5HGAA 4RGND 2I9LB 1OAKL 3SDAA 2JK5A 4I77H 1I9JH 4XGZB 5A3IC 3BZFA 3SDXA 3HCVB 1CICC 3O6MH 4QWWC 2BNRE 2HT2D 2NY7L 2KQMA 1NMBH 1G7IA 1MLBB 4TUJB 3WHXB 3CH1B 5HJ3B 4GW1B 1ZLUK 2R56H 4NUGH 1T2XA 1DQQA 5JMOC 1EHXA 3CUPB 4OZHE 5C8JB 5IB4B 4YPJA 2OXHA 4OT1H 4G80B 4MQTB 5EUKA 4MHHG 3TWCH 4HD9A 1DQJA 3GMQB 2N56A 3FFCB 3FQUB 4KQ3L 2QSTA 2DMKA 4DCQA 3SE4A 3MLZH 4M5YL 4JHAL 3TEUA 5C0DB 2B2XH 2VAJA 4NBYB 1JYNA 3BPNC 1QOKA 1NLBL 3DSFL 1PKQA 5J9PA 1S9YA 1J8HA 4N9GA 4IS6B 3S88H 2VDLL 2NY6B 2VC2L 1B0RA 1J1OL 25C8L 2BOCB 5C0AB 2EDKA 1NANH 1MRDL 3B2VL 4KJPC 4AIZA 1KJVB 4OLWL 1RJYA 4HFWB 1A1MA 5B4MD 1ETZA 2X40A 2XPGA 3HZMB 3I75A 1EDQA 1JTPA 5JDSA 4NNPH 3IDIA 3BMVA 2NLJB 3SKNA 1U8QB 1INEL 1IFHH 1RIVL 4M1GL 3T4AA 4PRPE 2C3VA 4KQ4L 3C5ZC 4G9FD 1OTSD 5ILTH 1P7QA 4BH8A 4GBXB 4V1DB 5HYSB 4PV9A 4OLXL 4JFFE 2VQ1B 4HPOL 1KNOA 4XNMB 5L8KB 3QHZH 4MVBD 1R5WB 2B0SL 5EDXA 1NKRA 5I2IB 2F8VA 3TN0C 4MB4A 5JOFA 3CAFA 4PJDE 4F80A 5C0CE 4ODWA 3ZTJH 5KG9A 2WINB 1FBIH 2VR9A 2F15A 2AJXL 4ZFOA 3DV4B 2AV1A 4KGJA 1C5DB 3RKDC 5A2KH 5JOEA 3OJMB 1FIGL 4LNVA 4X80H 2LAGB 5DD1H 4D0CA 4MAYD 3RWGB 3CU1A 3GIZL 4QHLB 1EUUA 1I7RB 4JM2C 1RZJL 2GSGB 2DQUH 1B3JA 4M02A 4I2XE 5E8NA 4PJ5E 1DSFH 2C4FT 4AK1A 1N5AB 1JHTB 1MFAL 1IE5A 5E5RB 1B90A 5CFHA 2Y1VA 2HLAB 4QXWA 1JPSL 2Z35B 4FZ8H 1GGIL 1FN4A 2ADGA 2R39A 4IDLA 2X10A 1K85A 2BNQE 2ARJA 4M8QB 3L6FA 4G6FB 1A47A 4EUPB 4I3SH 1PJ9A 1EIBA 7CGTA 2V6HA 3QCVL 1EAJA 4HCRA 1UWEH 4XVSH 2FGWL 3U0PB 2YUZA 3QO1A 5ESAB 3ILPB 3EO1A 2BX5A 4FQ1L 3FOMA 2VLRE 3LB6C 3SBWC 4M43L 4K23L 4BKLA 4NO2B 4UZGA 4YE4L 3GI8L 5IB3B 1R24B 3CVIH 5C86A 4TVSa 3BUYB 3FFDB 1AQDB 3CX5J 3FKUS 1IQDA 1A3LH 2VERN 4X4XA 1M1SA 3VFWA 2XWTA 3W0WD 2APWA 2W59A 1YN6A 1IM3B 3BMWA 3BZ4B 2VRAA 3RTQB 3ARDC 4X4ME 4GKNA 1KJ3L 5JORA 4NWTL 1MIEH 1FLRL 5F1IB 5EA0H 2AEIT 3RVXD 5DT1H 4PJ9D 1B4JH 3A6CH 4ZPVB 4M48H 5CD5C 3I3BA 1ZLVH 2LTQC 4S1QH 2VLLB 1EO5A 3GKWH 4N0UB 3WXVL 4OUOA 4WWKD 1JMZA 3EFFB 4KTDL 2DJUA 2NR6D 4FS0A 4G8GD 4DN3L 4L4VA 3VFMA 4M93C 3RX7A 4PR5A 3QUXA 4QLRA 2C5DC 1HKLH 5J57B 3MOAH 1WBXB 1CI5A 1N26A 4FRWA 4I77L 4Y4KA 5IG7B 3EOBA 3C9NA 2AK4B 5EWIH 4EI6A 3O6ML 4RNRA 2CK2A 1UH3A 4XB7A 4H8WL 4Y5YC 1E4WH 3ULVD 2EDJA 4DW2H 5D7IA 3SJVA 1CD0A 1FL5B 1TNMA 4F33A 1ZA3A 3AFLA 4PLKC 2R56L 1JPFA 3VFOB 3LPGA 3P77A 2VWEC 4PGEB 4KI5C 1KGCD 4DVRH 4A2MA 3KPTA 3GJFH 2EE2A 1KTDB 2C3WA 3U2SA 1MJJA 3GMOA 4OT1L 1ZSDA 3FQRB 2VZSA 3IRPX 2BFVH 5KANG 5EO1A 3QIWC 3RZCA 1MCHA 2GK0A 5IMLA 3QI9B 2APXA 2J1KA 2V9TA 2UY7A 4OLZL 3STLB 5D6DC 4QTIH 2RHEA 3MLZL 4JZJA 1N8ZA 3CFBB 3G5YA 4HUUA 3OR6A 4MWFB 2B2XL 1JNHB 4P9ML 1OGAE 4A2LA 4NKDB 5KVMC 4U33A 1DLFH 2O61B 1ZMYA 1CFQA 5F7HA 5DTFA 3S88L 4L3EB 4RAUA 5ITBH 5DO2C 5SWZA 4LHQB 4CADA 5CJQH 1T21B 5CMAB 3OAYH 3F7QA 1I9IH 3KG5A 3VXRE 1T20A 3CZFB 3I02A 1JN6A 2PW2B 3G5ZB 3NIGE 1A4KB 1OL0A 3NA4A 2YD4A 4O4YH 5K9QG 3K4DA 3KXFE 3FB5B 2Z9TA 4NNPL 4KJYB 2J8UE 3T2OA 5J6GB 2OX5A 1IFHL 4JJ5A 4PS4H 5B3JE 4X4YA 1G7HB 2WIMA 5DYOA 1Q9KB 2BNUA 5ILTL 5DD6B 5FDWB 5EO0A 2XT1B 3HZVA 5FGCE 2OQJA 2HT3D 1JGVL 1PDKA 1KSRA 3MBEC 2H32A 3QHZL 4Z0XA 5D7SH 2NXZD 3QUZC 1JZ4A 1UXSB 4ELMB 5I17A 5DK2B 2V2XB 4GRWF 4H26B 1I3VA 1FBIL 4RGNC 4LSUL 3AY4C 3FB8A 3HG1D 2XG5A 2FECL 4JGMA 2UZIH 1X5KA 3BH8B 3FN3A 1XMWA 4P4KA 2HT2C 1ZT4A 4X80L 1YEIH 3LOWA 4ZNCD 3GSXA 3KJ6H 1A6TA 2WANA 1C8PA 5T5NF 2W9EH 4R7NB 2UUDH 2QSQA 1P7KA 2VLJA 3O6FA 5BZWA 1DSFL 1NGYB 3ZKND 1CTOA 2P7TA 1DUYB 4POUB 5DVNA 2YEZB 1JJUA 2L7JA 3JTSA 2A74B 2A6IA 4OF7A 3WIIH 4L8BB 3VXME 5KSAA 3FOLA 4GOSA 1AGDB 4U6YA 3P11H 3M1BA 3CDCA 3D85A 4HUKB 4I3SL 2X4TA 4OZGA 5L2KD 4JZOA 2P48B 4HS3B 3H9ZA 4XVSL 3W9DB 4Q74A 1Z9SA 1UA6H 2EDLA 2EYTA 3UCRA 3HE6A 4P5TA 1FCGA 1WLHA 3HLAB 5IB1A 2P42B 3UTSE 3TF7C 4LAQH 4S1RH 5LWYH 1QHPA 1GRWA 3FT2B 4AYFA 1UWXH 1EZVY 4WFEE 3S34H 1XH3A 3X11A 2NY4B 4L4TD 4KKCD 3ZYZA 1U3JA 3C60B 3QSKB 5B4MC 4H0IA 1A3LL 3AREA 3P73A 4Y5VB 4ZUSB 3SN6N 3VCLA 1FNHA 2Y23A 2Y06H 3AMLA 1M7DB 4XMKH 5IEHA 5CP3H 2J7LA 1MIEL 5EA0L 1OTSC 2XKUA 1CQKA 3BP7A 3BXNB 1B4JL 2VAAB 2I26N 3SGDH 3DGGA 4M48L 5HBBA 2YMXH 4MVBC 1NFDB 4DK3A 5E95B 3EHBD 5B38G 4S1QL 5EBLA 3AVEA 4OD2B 4BFEA 3GKWL 3CC5B 2X1XR 1ZEAH 4EN3D 4KJYA 4ZUWA 3O3BA 3MV7D 1K6QH 4P0DA 1NEZG 2R29L 4X0KA 4JGUA 1JK8B 1FDLH 1F6AA 1HKLL 2WWMD 2XV6B 3MOAL 2YD3A 1MAMH 4MDIA 4CVWA 1LMKA 1L6XA 4HWBA 5EWIL 1I1CA 3HAEH 5AWNL 3TO4D 4MAYC 4GG6B 5IVZB 4WJ5B 4PRIE 1WJ3A 2IWGA 4KV5E 2Q3AA 3CMOH 1E4WL 3MA9L 3RGVD 2XN9D 5C0RL 2YRPA 1O5DT 5D8JH 1DBAH 2FL5A 1FVEB 4Y19A 1FC1A 2EIZA 4QF1B 1NCAH 5JHDE 3ROOA 2BVPA 4AH2A 4DVRL 5GGTL 3ILQD 1QO3B 3EDJA 3GSNH 3IS1X 2BFVL 1T1ZB 4LVOC 2IALA 4LCCC 1B6UA 2R1YA 2DRUA 3CFDB 3U7YH 3ARQA 1U8IA 4QTIL 3VE0A 3TIEB 3TC9A 5F3HA 5EBMB 5JLZA 5C08E 3KWWA 2P8LB 2CDEB 5IM7B 5C0IB 3MLPA 4PTTA 4QCIB 1TVBB 1T66D 1DLFL 2NX5E 3FTGA 4H0GA 4RGMB 3NIDE 5CSGA 1SYVB 3C2AH 5ITBL 3L3GB 4HV8A 2GAZA 3TNMB 2IANE 5CJQL 3VW3H 4KGLA 2N7AA 2A6JB 1I9IL 4MD0A 4WTZA 5D1QA 3VXOA 4EI5D 3DX8B 3FB6B 3TO2B 2XKNA 4UDUB 1S7UA 1I4FB 2GJ6D 3FT3B 4O4YL 4NKOB 4RAVB 1PQZB 5I1DB 3VD3A 3RVXC 1G6RB 5EO9B 2NY2D 4HZLA 4PJ9C 1CICB 2QQLH 5BVJB 4LRNH 1U8LA 4LLAA 5EOCJ 3HZYA 2ESVE 4W4OC 2Y07H 5DSCA 3TBTA 3QFJE 4M03A 3FN0H 4KVNH 4QHNB 5D7SL 3T2NL 3MRHA 1MCCA 4GKSA 2NR6C 2BSED 1L0QA 2YBRA 3K2UH 1HHKA 3NCEB 2RIKA 5D2NB 2WBKA 3Q1SL 4NKMA 3H9HB 1JWSB 5HDLA 4ZXBD 2UZIL 2UV3A 3GHEL 5EORH 1YEIL 5DJZA 1KV3A 2EDTA 3BPNB 3KJ6L 3ULVC 4I5BB 3IGAB 3TPUA 2W9EL 2W0FB 5D1XD 2EE3A 5CSZB 1KJ2L 3G6AB 4UUJB 3MYJA 1HNGA 1U91A 2D9CA 3W9EB 3WO3B 1Z9MA 3ZSTA 4JDZB 1F4YH 1QSFA 4NZTH 4FQCL 4X6DF 4H88H 3WIIL 3KXFD 2B20A 5ACMA 4U1NB 4ODUB 4KMTH 1H8OA 3P11L 3U0TA 3IJSB 2VXTL 3MGOA 2G60H 4WU5A 5K9JH 3RI5F 3EDFA 5CZKA 3RBGA 1II4E 3QUMA 4A6YA 4LBEA 1UA6L 4JRWA 1E28B 2CDGA 1FZMA 3ARSA 1G84A 1BFVH 3IFOB 1M7IB 1JRHI 3BQUD 2FSEA 4LAQL 4S1RL 5LWYL 3L7FA 1QUNA 4J3VA 3S34L 2C3HA 4LLWB 4PD4K 1Q72L 2C1PB 1T7YA 1PG7H 4LDEB 4LVHC 1MCSA 4HHAA 3MMEB 3ULUF 4M6AA 1W0VA 2R2BB 4LHUG 3WSQH 4MMXC 5BV7H 2BP3A 2HFEA 2W07A 5TDOB 2PXYA 1FAIL 3LHPL 4XMKL 1NGWA 3DXAE 3EYFA 1IMHC 1HOCB 5JIHA 5DUMH 3X12A 1XF4B 4PGDB 3BKYH 4MD4A 4Z7VB 1KB5H 1FHGA 3KAAA 5EUOE 3VGBA 2HT3C 3QHFH 1U6AL 2KUTA 1BZ7A 4L29B 4OSUH 1FVDA 3WE6A 3BZEB 2NXZC 1ADQH 2Z92B 1YY8A 1ZHNB 1ZEAL 4YZFE 5AEAA 3GUTB 4M1DL 2J2ZA 2WP3T 5SWSE 1K6QL 1JUFB 3DO7A 2E6JA 4NRXA 4CW1A 4RRPA 2F54A 5K59F 1FDLL 3KPPA 3OB8A 4XBEH 5I8CA 4YBLC 5J0BA 1W0YT 1OWRM 5BS0A 3VGAB 2P5EE 4BSWA 4D8PA 3CDGA 3QDGE 2CKBA 4JLRA 3RWHB 1U58B 3QNXB 3UTSD 3CMOL 1T5XB 4S2SA 5DQDH 4K2UH 4XI5D 4WFED 3VI3E 3ZKNC 5D8JL 5E08H 2D3VA 1WIOA 1WCQA 1NCAL 3ZE2E 2BC4A 3T0EB 2AQ1A 4R4FH 2F8OA 4Z7UE 2EDOA 1I7UA 3GSNL 4M61A 3F7VA 4AEIH 3VFTA 1EEZB 2PYFB 5FKAA 1KCRL 3KYNA 3U7YL 3TZVA 4P2OA 3NFPB 1YEHH 4X5WA 3LEXB 4HPYH 2YS4A 2VR5A 3W81A 2D0GA 4WEBH 3OKOB 1YN7B 4JFDD 3VMNA 4Q7DA 5HPOA 4C83B 1HDMA 5DJYB 1BD2B 4NC1E 1FL6B 2FJGA 3T3ME 1E6JH 3C2AL 3ARBA 3NN8A 4KKCC 3GMLA 1QEWB 5KSVB 4K3HA 3HNVH 2FGZA 3W5MA 3DMMB 1QD0A 1BGXL 5EIIB 4ELKB 3VGHA 3RX5A 4F58H 5KBNC 1DJSA 1T0NB 1NCWL 2Z0BA 3ZMRA 2FBJL 2FD6H 5AD0B 1K4CA 4Q9BA 2W60B 2QQLL 4N1EA 5GGQH 4LRNL 1HXYA 1K5NA 3RUGA 4Y5YB 3QG6A 3EHBC 2Y07L 4H5SA 4DZ8A 1ZHKA 4D9RE 3FQNB 2WM0A 3FN0L 4KVNL 4EN3C 3MXWH 1KOAA 4GO6B 4KDTA 1RUPH 1ZVYA 5I66A 2YC1B 2WWMC 3U36B 1AH1A 1K3IA 4HUMB 3RVTD 3OJDB 5KSUB 4JQXA 3TO4C 2R0KL 1XZ0B 3HNSH 5EORL 1CLZL 5E6IA 4ODXA 3RGVC 2BJMH 4X6EA 1GVIA 4WW2F 3QNYA 1BJ8A 4PJ7A 2EE9A 1F6FB 5HYJB 4O5LH 1NAMB 2B4CH 4KUCD 3GSQA 3ILQC 5I75B 1JGDA 1F4YL 4NZTL 2AS5M 4CMMB 1PY9A 4G9DB 3QIUD 4ZAKB 3INUH 4OGZA 2VLKA 2FWOB 4XCEA 4C56B 3O4LB 4KMTL 3T65A 4PG2A 2XI9A 4ACPA 4JREB 4BFIA 2V7NB 2G60L 3U4AA 4RQQA 5K9JL 2PYEE 1CD9B 3Q2CA 2ESVD 3FONB 1FNSH 3S96B 1T66C 1F4WH 1S7QB 5JPNB 4NO0B 4XP1L 2BY1A 1BFVL 3F5WA 4MX7B 4R3SB 4F8QA 3RDTA 2DB8A 4F57L 3OKEB 5D7JB 1PG7L 2YPLB 4HKJB 1CFSA 1QFPA 4L9LC 2VZUA 1Q9LA 3ARFA 5IHBA 3MV9D 5LQBH 2VUYA 3GJEB 4LPCA 2Z4QB 3WSQL 5BV7L 3AC0A 3DIFA 4HGWB 1KENH 3UTTB 4E41A 3UTOA 2NY2C 1QRKA 5F8QC 4TQEH 1NCUA 2EDYA 1IL1A 5F88A 1AGFB 4WTXA 5DUML 4LKCA 4RDQF 5DVLA 5DMKA 3BKYL 1KB5L 1QFOA 2O5YH 3G9VA 2BSRA 4OSUL 4YHPB 5I1LA 3QEQA 4B5EA 5HVGB 5KJRH 1ADQL 1YYLH 1DVFA 1H3UA 1NMCC 3MQIA 3T3PF 3EYSL 3MREA 4JO1H 1OP5K 3PGCB 1HSAB 1FFNA 3BP4B 4XP9H 1CXLA 2J5LC 3U4EA 5ESQA 4XWGL 4ONFH 5C0BB 1FO0A 2QL1A 4ZXBC 5J12B 4RFEA 3OAZH 2ADJA 5MEND 4XBEL 3MJ7A 3MLVH 5F7FA 3GHBH 1LNUA 4HW6A 4DEPC 4YUEH 1GOHA 5L6YH 4AJ0A 4QRRE 4L3CB 3ZT5A 4Z76B 1XF2B 4XBPB 4OF8A 1EUTA 1BX2B 2F53E 4R2GD 5DQDL 4K2UL 5FYLH 4S1SH 4TSBL 3SQOL 5E08L 4YDLB 2CPCA 1I85A 3VXUA 1YMMD 3QBTB 5CIPH 3VMPA 1RHFA 5TPWH 3WNMA 4PJ8B 3MLWL 4FQXB 4J7RA 4P5MA 2I60H 3EJYD 4R4FL 1RFDH 2NNAA 2FEEI 5CP7A 2OR7A 2UY6A 4OCRH 4AEIL 1WVZA 4GW4A 4NQCA 4NT6A 3KHOA 3PXHA 4Q9QL 1XCQA 1D5BB 2DMCA 4P2CG 2X4RA 1XT5A 3BE1H 2CIIA 2L0DA 1YEHL 3AU1B 5H35A 5FA3B 1VA9A 4U7SA 4WEBL 5DHYA 5A16A 1EERB 3TVMC 4FTVE 4PJIB 1A1OB 3GSRB 2Q8AH 4LL9A 1AHWB 4K07A 3BQUC 3ES6B 4LLYB 5E00B 5C9JA 2X4UB 4TYUA 3O8XB 1E6JL 1F02I 1KCUH 5IF0B 3GJFK 1TTFA 3RY6C 3GBNL 4U0RB 4Z78B 1C12A 2ZOLA 5SWSD 5DJCA 1SVZA 5KAQF 3IDJA 4HUXB 5FGSA 3ULSB 3V79C 3QNZB 1ACYL 3OKNB 3KPSA 4LU5H 2DICA 4F58L 4KKNA 1XF5A 2CLRA 3CPLB 5CD3B 1KC5L 2CXGA 1H3XA 2FD6L 3O0RH 3FT4A 3TT1H 3RFZC 3QDGD 4P2RB 4U6TA 2AV7B 1UWGH 4X7FC 1CDUA 3MRCA 4IOIB 4TUOB 4ZTOH 3O9WA 4PJEF 5IBLD 1FG2B 1AP2B 4QRQA 4HKJA 5D7LA 3MV8A 2FJHB 15C8H 5E4IA 1NBQA 4NN7B 3LS5H 1IGYB 5HHPB 1TQCC 3N1GC 2OTWA 2R0WH 3RGHA 3MXWL 3V6OC 1UG9A 3IDNB 1RUPL 1JE6A 5DRXB 4KROB 3PWPA 3G6JF 2UWEA 3VRIB 2UVEA 4RIRA 1N0XH 4H1LG 1I8LC 5EPMB 1DANT 3P4OB 5FHAH 2BJML 4XI5C 3HUJE 3BIAX 2YSSB 3WV0A 5L0QB 4N8CH 1I8IA 5K9QI 3R06A 5I1AB 5HHNB 4O5LL 2BHUA 4ZS7H 2BRQA 2BY3A 4NQSA 2NY5C 4YGVB 4XZUB 4XMLH 1J0KA 5H37H 3H9SE 1A8JH 1U92A 4MYWB 2AXJA 5F7UA 1ZS8A 1UZ8A 1B0GB 3INUL 1W0WA 4UT7H 3QUKA 2O5XH 2IF7A 3WL9B 1VFBA 4YAQB 1ZLSH 4GAJH 4G8EB 1E4XI 1FSKB 4XCCH 5TQ2H 4UNTA 2XRAL 1FNSL 2UUDK 1F4WL 1GL4B 1I3GH 1PG7X 3KPRA 5EU6D 1LDSA 4I0PA 5ISZE 2YUWA 4PJXE