1KN4L

Catalytic antibody d2.3 complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
219
structure length
219
Chain Sequence
b'DIVMTQSPLTLSVTIGQPASISCKSSQSLLYSNGKTYLNWLLQRPGQSPKRLIHLVSKLDSGVPDRITGSGSGTDFTLKISRVEAADLGVYYCVQGTHFPYTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IG ANTIBODY D2.3 (LIGHT CHAIN)
publication title Remarkable remote chiral recognition in a reaction mediated by a catalytic antibody.
pubmed doi rcsb
molecule tags Immune system
total genus 50
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2001-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kn4L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kn4L01
1JZ8A 5IEHA 4GRWH 3CLFH 4NGHH 4YHNA 1KPVB 4QT5B 4G6FD 4PRDA 1V7MH 2VH5L 3IAQA 3K7UA 5FGCE 3BSZL 1Y6NR 2EXWD 3B5HA 3OB0K 3VI3E 2DQEL 4OZFH 3FAWA 3P0YL 3S96A 4M7LL 4XNZC 5CS7A 5HI3C 1BZ7B 2MMXA 3HE6B 3I3BA 5F7KC 5IWLA 4FXKB 4ZS6D 4P49A 3MV9D 2KQMA 5ETUA 4D8PB 5GS0H 1U95B 3U4BH 3NZHH 5CZXC 4KZEL 5D7KE 3DRTB 5EO9B 4O51B 4G9DB 3PHSA 2HJKA 1BQHB 3IFPB 2Y6SC 3I9GH 3T3PE 5CGYD 2DI7A 2R4RH 3DARA 5KSAD 5I16A 1OAYH 2JB5H 5ESVA 1PG7L 4KV5E 2LAGB 2FYYB 1NGXA 1HQRB 3ARQA 5D1XC 3ULUC 1S7SA 1CK0H 4G8IA 4OB5L 1JN6A 2AJ3A 5C09D 5ENWA 3MRKA 4K9EL 3ULUH 5HYIA 2NZ9C 3UTPD 3MXVL 4TNVK 2AV1A 3KJ4B 1EUUA 4H88L 4HH9A 1IAOB 1O7VA 4ZSOB 3NN8A 3GJFB 4R9HA 5E9DD 1K3IA 3D9AL 4Z76A 2O26U 1EAPA 1LP9A 5CINH 2XFXA 4KXZI 5F7UA 4EDXA 3MNVB 3HPJA 5C9KA 1A6UH 1YA5A 1R6VA 1IC4H 4XPTL 4C4KT 5T1KB 4NNPH 4PP2A 5GRVL 2FJFB 4OZHB 4XBEL 3BDYL 3ZHLA 2Z93A 1B6DA 1MRCL 4OCLC 4S1QL 4P4RA 4GRLD 4PJAF 3RVWD 2EIBA 3NZ8B 3MRDA 3V0VB 1IL1A 3GI8H 2FATH 1DFBL 1FVEA 4KHTH 1OTTD 1R3IL 4YO0B 2HYMA 4LLQB 3GMMB 5BV7L 3QUXD 2WP3T 4RRPG 2V2WB 1C16A 2YD3A 3O8XA 4ETQA 1BFTA 5DK0B 1M4KA 4XP5L 3NH7H 3MJ9A 1NJ9A 1A6TA 4AEIH 1FRGH 4IOFC 5EBWA 1CXHA 1FNSL 1K5NA 4HBCH 4WV1C 4CVUA 1KC5L 4WTZG 5T33L 4NUJB 4DJMA 1UXSB 2J12B 1G9MH 1JZ2A 1BQHG 3U6RB 1JJUA 2J1KA 3T0XA 5BW7C 4OLWL 5C3LD 4ZUSB 3V95A 4HFWB 4XVTL 3S97C 1A7PL 2Q8AL 2HT3C 4X9BA 3MRRA 3QDJD 3MLUH 3GSUA 2FIRT 2PW1A 3HC4L 4LU5L 3O41A 5D71L 1EAJA 1EX0A 4KGJA 3TN0D 1NCWL 2BJMH 1MHPL 3GBML 1FNEA 2WQRA 3WO3B 4TRPL 4YPGB 4PJHE 1U3HC 1NC2A 2OL3B 1R5IB 5D6DC 5TGBA 2ZCLH 3LKRB 4PLOB 5KANG 4Z7WB 1KCKA 3OB8A 4C56A 3IU3B 4NKOA 4O00A 2PTTB 5KJRH 2F5AL 3D18A 3C9NA 5I2IA 5DA4A 5F7EH 4Q9RH 4HCRA 4WWKD 2J6EA 3KYNB 3T4YA 1H5BA 3K8MA 4KDTA 4R2GD 3ARRA 1G6RL 3HB3C 4HWZB 1M7XA 4RCAA 4LPTA 3MJ7A 1NGZB 5I1CL 2VOTA 4CAGA 3TGXA 2FHBA 5DJZA 4W6WB 1UCTA 4M3KB 2P4AB 4Q74A 4BFEA 5I71B 4HK3J 3O6FC 4DKEL 5JMOC 2IG2L 4NZTL 1IQDB 2Z8SA 4WU5B 3DETD 4K94L 4PJ8D 5ID1A 1FZKA 5K9OB 5CEZE 3D87B 2HJLB 3GIZH 5IESL 2GSGA 4XC3H 3RIFK 4EIGB 1I4FA 5J11B 3ZKMD 2YRPA 5TDNA 3VWKB 1I1AC 4Y4KD 4KGLA 3V5HA 4F7PA 4JFZL 2JTDA 2H6PB 4M5YH 4PJAA 4NRYB 4Z7UE 5EU4A 3VG9C 2EO1A 2VZ3A 3WLBA 2IANE 3PIQA 3QAZB 4NJ9L 5GJTL 3U9UB 3IU4H 1GGCH 1ZHKB 3ZL4L 1MF2L 1EK3A 4JFEE 3QQ3B 2GITA 1ZT1A 3EFFA 4K9EC 2DWDA 5I76A 3TEUA 4OB5H 3TZVC 4B0MM 2PUQT 3RWIA 4GAGH 5H37G 3T0WA 2VDNH 4MX7B 5DJ2B 1MWAB 3U30C 1T03L 1NAMB 1KIRA 3GI9L 4QOKD 3V0WH 3LIZH 2YUWA 2OTWA 3P3YA 2W65B 5D2NC 4GRWB 3ARGB 5ITFA 4PJCE 1TPXC 1S7RA 2N4IA 2C4FT 3CXDH 5I73B 4OLVH 1MCSA 3BD4A 3FO0H 2XQYG 4IRSD 4BELD 3BDYH 3JWOH 4J2XA 1C5DA 3QFJA 5BV7C 1D5BA 4JQVC 3X13A 5AAMA 1JNHA 5F7LB 3BYYA 1GOFA 1D5ZB 1A1MA 4WGWB 3KPNA 3QXAB 3LPGA 1TTUA 3MNZB 2FZ3A 1P9MC 5KZCB 1BOGA 2ICCA 2XA8L 4H1LA 2V2TB 1CBVL 5DRZB 4YUEL 4JFDA 4G5ZH 1IAII 4R90L 1A6WL 3SGDH 3VFMA 2D03L 1IT9L 1OARL 4WIQA 5F89A 1ED3B 1S78C 2DI9A 3VG0L 1RMFL 4HWEL 5D1ZA 3C6LD 4U0RB 1A3QA 1V7NL 1Q94A 2OMBA 2BDNH 4LSPL 2BZDA 2APTA 2NMSA 3PDOB 1SBSL 3I50L 3FONA 4W4NA 3MTRA 3LEXA 4OCNC 3DNKA 2IALB 4Z5RB 1A7PH 4TQEH 2WZPD 3VXSB 3QWRA 2NX5D 3LEVH 1XIWA 1YMMD 2CUMA 2LABA 2VLRE 4Q7DA 3IDJB 1PEWA 4M8VA 3HC4H 4GXVH 4JANB 5HHVH 3O45A 4KI5F 5FO7B 2VDPL 4EIZC 5KSBF 1OWWA 1ZLVK 1RHFA 4Q9CA 2E9BA 5BO1H 2DD8L 1R5VB 3UDWC 5L8KB 3ARWA 2QBWA 2H3NB 4G6FB 5FV2A 4IDJL 4Q9QH 1QSFE 1NUDA 1WITA 1HXMA 1IAIM 5GS1B 4V1DE 2ZJSH 3U48A 4LLYB 2ATKA 4U4BA 1WFNA 1XEDA 1VDGA 2AEPH 2W38A 4KRNA 5EZLB 4OZFG 4XVSL 3ZT6A 4OFVA 4GMSL 2X9WA 3A67L 3DECA 3MV9B 5E6YA 3ABZA 1U91A 1NCTA 4WW1A 4ELMA 4G43B 1FLTX 4GG8A 2OJZL 1IGFL 3ARFA 3H3BC 4K94C 4MDJA 3OTTA 1IM3B 4MB3A 4OFKA 3RNKA 3NGBB 1MPAH 5E6IA 4XT1C 5SV3A 2J8HA 2DKSA 1C08B 1ZS8A 4G8FA 5KSAB 5E03A 1FG2B 2XRAL 1S5IH 3CDYA 4JDVB 1RIUL 4FP8H 3AM8C 3X11A 1SHMA 3OJVC 1NCCL 5DFTA 3FJTA 4U1NA 1SY6A 1JGEB 5LCVH 1FP5A 5C09B 4CNIA 4PJXE 2AS5M 3MUGA 3GSNB 4JO1H 1Y6KR 4MXQC 4ZFOA 3MJ8A 4P2OD 1J0YA 4GW1A 4M6OH 4F7EB 1L0XA 4GW5A 4HJGA 5A2IH 1IGIL 1WK0A 5IR1B 5E9DB 2APFA 2A6DA 2FL5B 1P4BL 3RGVC 2O93L 4I2XA 5C8JB 6CGTA 4WTXA 3E3QC 3DTXA 5HPOA 1X5JA 3QP3A 3U4EA 3O6ML 5E00A 1YPZF 1ZA3B 3UPCA 1CDUA 1F90H 2J4WH 3L3KB 4WW2C 4KMTL 1CE1H 3WD5L 2VDQH 1L7IH 3HI1A 3O2DL 1I8LA 4RFOL 3WXVL 4KDVA 1BLNB 3I75A 5KTEL 1DJSA 1Y18B 1OPGH 2JCCA 4WUUA 4GRLB 3LRSB 4QTHB 5F1KC 5SX4H 5C0FA 3SCMC 5AYUH 4C83A 4HD9A 2D7PA 4UUJA 3TIDA 4M02A 2XA3A 1NGYB 4QXGH 4YHZL 2HAZA 2A9MH 1J1PL 2ORBH 3QUXB 4RBPH 1KIPB 2XICA 3FQWB 3CC5A 1S8DA 3TWCH 5D4QA 4R4BB 4RA3A 5DA0B 2J2ZA 5TDPA 2X4TB 3VGFA 3K3QA 4PJGF 4HGMA 4L8CB 3H9ZA 3CZFA 1CGWA 2QQLH 4NC2B 4P2QD 3ZDZE 2VXTH 4LEXH 2HH0L 3EFDL 4BM7A 5EUOB 3O3DA 3RNQB 1XGQA 4F7MA 2XQBH 3O6LH 2FEEL 4MS8D 4YAQA 4J3SA 2VR5A 2NW3A 4GRMA 3S5LA 2YXMA 5JUEL 1I9JL 5JW3H 1FC2D 1V3LA 1J1XH 1RAMA 5L2KE 1P84J 4XH2A 5C0JB 1UM6H 1HHJA 4KROC 4KJWD 3SDXB 3UBXG 2J5LB 1Y0LA 3Q5OA 4L3AA 5KVEL 3QDJB 4HWEH 3SPVA 1KB9K 3VXQA 3V52L 5DJ8B 4ZQKB 1A14L 1RUPL 3F5WB 3HAEG 3MCLH 1J9CT 3CX2A 3ARBD 3TN0B 1TTFA 3WBDA 4Y2OA 1OOAA 1DBJL 1T89C 4OKVA 3P11L 5JMRA 3K81A 4MA3B 4RX4A 1PG7W 5DJCB 4HS6B 5ICXA 1AR1C 3EDDA 5EC2A 1CL7I 2AJZA 2PO6A 2DQUH 2X09A 5IOPA 4RGNC 3HR5A 4WI5A 1NSNL 2K7QA 5JNYA 2QQNH 3L3IA 4Y19A 4ZFZB 4F9LC 1H3PL 3MA9L 3BKML 3O4OB 4IMLA 4B41A 4QRUA 1TJHL 3U0WL 1BQSA 4PG9A 2ESVD 3BN9C 3CSYB 4R2GB 4GKSB 5DXWA 2R56H 5IM7A 2Z35B 3HG1E 4JJHA 2P8PA 5GRYA 3GKWL 3RY5A 2QR0B 4OZ4A 4MXVE 2CKBB 1KYOJ 2PN5A 3MACL 4FQHB 1I7TA 3IKCA 1N59B 2WMPA 3CVIL 5DDHA 4OM0L 1YPZA 2ADJA 2HLAA 4V2CB 5HHPA 4L4TA 3UJJH 3ZYIA 1UC6A 3QJHB 4Y16D 4RGMB 2XKUA 5IFHH 4Y4KB 4OQTA 5BQ7A 4KWUA 2DLGA 4P9HH 4POUB 1PKQB 1MIML 1MFBH 2EEAA 3VH8B 3ARZA 1JE6A 4ODTL 5GRUL 4KZDL 2V5MA 4KTEH 1CYGA 2NZIA 3DI2B 2FEDC 4PBXA 3H9SA 4JR9L 2EDXA 4LLUB 4NP4L 3RWHB 3HR6A 4DKFH 1NCCH 1CFSB 1SM3L 2QV2A 4HFUL 4LFHD 3VI3F 1EPFA 5JA9A 1HIML 4NZUL 5EU6D 3KYOA 2OXHA 4HKXB 4YDVA 3PWPA 3C08H 4LSQL 4PJGA 1CDBA 3L5HA 2HFFB 2ITDB 3DUSB 2ARJA 4FQCH 4FQJL 3FRPA 3TO4A 2HVKA 1UWEH 1F3DH 4QOKB 3HUJB 4CMHB 4DZBA 5DD3L 2Q7YA 1EZVY 3T3PF 4DGIH 3OAYH 4EI5A 1CWVA 3OBAA 2R29L 3AXLB 3QFJD 4KV5F 5CKAA 4DVBB 2VXSH 4Y5YA 5CJOL 5H2BB 4IRSB 5J1SC 3ULVL 5J12B 5CIPH 4G6JH 5MEOB 4BSVB 3IXAA 1FV1B 4JFDD 3MRNB 3QR2A 4OTXH 5FGBC 3BGFC 5FA4A 3MYZA 4YBLB 4HKJA 3TBVB 3KPSD 3K4DA 4PG2C 2YWYA 5I1HH 3D69A 3ROOA 4KY1L 1NLDH 2Z4QB 1WTLA 5DJDA 2UY7A 3L3JA 3V7AE 3BMVA 5D1ZD 4AEFA 1Q1JL 4F33A 4LRIA 3N9GH 4YWGL 1WWBX 3I2CL 3N1MC 3LKPA 1TTGA 1JCKA 4FQXC 4ZAKC 2PKDA 1Q0YL 3C6LB 4I3SH 4KK6C 2G5RA 2EYTB 2LV4A 5J6GB 2BCKA 4G80A 2ICWB 5F97E 3BUYA 3QDMD 4MWFA 1VFMA 3B9KC 1XGUA 1XIWD 3BPCB 1NPUA 2AXFA 2VN7A 5DC0A 1BZ9B 2Q87A 4MJ5B 5HHOE 4ERSH 4OZIB 3KJ6L 3QDGD 3MBXH 4ZUTA 3ZMRA 2NX5B 2ZSWA 3GSXA 1QLEH 2XG5A 3EGSB 4NIKB 4WEMB 1YMMB 4XNMB 2B1HH 5IBUB 1GSMA 5C0AD 1CG9A 4PRDB 2GY5A 1JI1A 1QYGL 3EOTL 1FNGA 1NUFA 1Z3GH 5A2FA 2AK1L 4U31A 1HKLL 4OBSA 4BA8A 2VNCA 3L6FA 4Q6YA 5DQDH 1FZMA 1G0XA 1G0DA 5ETUB 2EKJA 1F97A 1WBYA 2YD5A 3FO9B 3KS0J 2D7TL 1W72L 4N0UA 4P3DA 3F7RA 2XY2A 4Q6IA 4FNLL 3N85H 4Y5XC 4JFOA 2QHRH 5BZDA 4ZFGH 1BGXH 3CUPB 4GBXD 4ISVB 3ZYOA 2NXZD 5HVGB 4YFEA 5I16B 1OTUC 5ESVB 4JG1L 3RTQA 4M48L 3PV6A 5LWYH 1FBIH 1MFEL 1UA6H 4L29A 3VD4A 3CFJB 1I3GH 2R8SL 3THMH 1S7SB 5DRNA 1MLBA 3O2VH 3O3AB 4PJHF 2HP4A 1MCDA 3MRJA 1JN6B 2Y7QB 3DX8A 4HGWA 2AJYL 4MJIE 5F21B 3MRKB 4PRHE 4PYHA 1E4JA 1NMBL 5D2NE 4LCYB 2AV1B 1RSFA 5L0QC 5I9QC 3D0LA 4WHCA 2JF1A 3NN8B 5EZIH 5FCUL 4Z76B 5L8LB 5I1EH 4LSUL 1LP9B 2XFXB 4OD3H 4EDXB 4ODTH 4P2OB 1UH4A 3HPJB 1AXIB 2GFBA 4MJ6B 3FRUB 2NTSP 2CDGA 3VXRE 4PP2B 1DEEB 4GS7B 3JSSA 2Z93B 4JN1L 3E2HC 1H15A 1TMCB 4P4RB 2UWEE 2VE6A 5D7IA 4OM1L 4ZPVA 3MRDB 3ALXA 3ECBA 1IL1B 4X4MA 4YHIA 1FVEB 1CLOH 3TM6A 2PXYD 2A38A 1KCLA 3MLVH 1QPXA 3BI9X 3MZGB 3BRGC 1C16B 1O5DT 2NTFA 4ETQB 2H1PL 4M1CD 5DD3H 4Z7UF 4UINL 1OGTA 2DMBA 3ULVC 5LGJB 3IS1X 3VFWA 1JZ4A 1NDMA 4KK5C 5A16A 3O4LA 4OCWH 4XZUA 3FQNA 5FDYA 2WSKA 3FQUB 5GRJL 4EXKA 4KKNA 4S10A 4XCCL 3HMXL 2I07A 2P1YA 2WUCH 1X5ZA 3KPQA 4XRCA 5EU5A 4JE4B 5CAYB 4NQSB 2QL1A 4JAMA 4MSWA 4OLUH 3S98A 1NC4A 1K8IB 3O9WC 4TN9A 5C2UB 1AHWC 1KTDA 1NAKH 2C3VA 3GMNA 4RWYH 4P2QB 4ELKA 5FB8A 1K9TA 1MQ8A 4NN6C 4J3UA 2WUBH 5KOMC 4YGVB 1MI5A 1KCRH 1JWSA 4E41E 1IC1A 3MRRB 1HH9B 1XCQA 4ODBD 2CJUH 5J13B 1V3KA 1KENH 3CK0L 4PJCF 3FB8A 2OBGA 3S34L 3I2CH 5DVLA 5I1LB 1FNEB 1MWAL 3QUZA 4CN1A 1UWGH 1IAKB 4RX4D 2P5EE 4YXHL 2CK0L 3WL9B 1QFUL 5TGBB 1OY3B 2PO6D 5GGVH 3ARBB 3GBNL 4NKOB 4F58L 1PYWA 4Y19D 4NT6A 3D18B 3C9NB 1IEBA 3DLQR 5I2IB 3MX0A 4PJHA 4M7KH 5EFIA 3T4YB 1H5BB 4PS4H 1A3RH 1UJ3A 4K3GA 2W1NA 3ARYA 3S35H 1QFOA 3MJ7B 4S1DC 3W2DH 2W59A 3V6OE 3DV6A 1T66D 3QYCA 3EOTH 4MQSB 1MRFH 2ESVB 5I19L 4MLSA 5CP3A 2DYPD 4UDUB 1FE8H 1KV3A 3AUVA 4XP9L 3MRIA 4MD5A 1LVEA 4HIIB 3CIQA 1JPST 3LZFL 5ID1B 2QADD 3ARDC 5T3XH 4RISH 4NHCL 4ZPTB 5DMKB 3U0TB 2ZOLA 4HQQH 3MUZ1 4L4TD 4PLKD 5AUMA 3K46A 2X5PA 3F65A 1I4FB 2Y1VA 3V5HB 1DVFD 4I1NB 5E8NB 5GGRA 1YJDH 3H9HA 4O58H 4JRXE 5IVZA 4NJAH 4TPRH 3RVVD 3PF2A 1V3MA 3EJJX 3FTGA 4AMKH 3WLBB 3PIQB 1XF3A 3E3QE 3SY0B 2IH1B 4Y16B 3H9SD 3BW9A 3Q6GL 4S0TD 2G75B 4K3JL 2GITB 1ZT1B 3S4SB 1VEMA 4ETYA 4QWWC 3D3VE 1GL4B 4R96B 4XCNA 5AWNH 3RY6A 5HDBE 4KAQH 3LDBB 3INUH 5CJXA 1RZGB 3FO1A 4XAKE 5I1JL 3MUJA 2DJ4A 3TO4D 2IGFL 1R3HA 4UV7H 5EU6B 1KIRB 3GSOA 3IDYB 3EO1A 3P30H 3C2AH 3GNMH 4OI8A 2OTWB 4EVNA 3I02A 3I3DA 4EI5D 3OSKA 5HGGS 4MJ4A 2ZP0T 4FQIL 5IG7B 5ITFB 3BO8A 3IJYA 3QI9A 5F3BB 3VFGH 5JIPA 4P9MH 1EGJH 2A1WL 4UT7L 3VD5A 4F80A 1KJVA 1C5DB 2JJVA 4YDJA 1Y6MR 5DUML 2UYLA 5HSFA 4PJCA 1TQCC 5I71C 3LEYH 4UOW0 3UAJC 3X13B 4EBQL 4MNGB 1JHKL 1T20A 2IPUK 1H3GA 3UTTE 4P99A 5J89A 1F8TL 3L5JA 3NMEA 1A1MB 3LQMA 3KPNB 4F57L 2FZ3B 3QIWA 2HG5A 2C1PB 1Z9MA 5F8RC 5KN5A 4H1LB 4PJXF 4OBRA 3QXWA 4JFDB 4GH7B 1AO7A 2XZZA 5KSVA 4R6UA 1K8DA 4YX2H 2A6IB 4U6HA 5TE4H 3KPSB 3MOAH 4JO3L 3WN5C 5F89B 4E42B 4LASH 5GGUA 1R3LA 3FB7A 5GRJH 2NY2D 1YEIL 2AJSL 2GKIA 5D1ZB 4JCMA 3G6JA 1NBZB 2K9UA 4QHLA 3WNMA 3GSNL 5C0ND 1ZLWK 1YY9C 2IAMC 3MLZL 5F1OB 1OSZB 4ZNEE 2BSRA 4RGNE 1NBYB 2AVGA 4CJ0A 3FONB 4A6YA 3LEXB 1WZ1L 2X4NA 4M6MH 1KEML 3V6FB 4HSQA 4AY0A 2H2PD 3F7VB 1UGNA 3S4SG 1D7FA 1S7WA 1RVFH 3QDMB 1NMAL 1XIWB 3ZE2E 5DFWH 3PL6C 4LVEA 2RIKA 4DCQA 5DS8B 3D85D 3O45B 1JF1A 1DQQA 3QDGB 3CDCA 5MEQB 5F9JA 4LFHG 1YN6A 3BKJH 4HV8B 5I0ZA 1CFTA 2JIXD 2V6HA 4P4KA 1J05A 3C5ZD 3S35X 1U42A 4EN3A 5I73C 4J3WA 5C0AB 2B4CL 1YEHL 4ZXBC 4LCUA 3NCCB 2CIKB 1CXLA 1AD0B 3ZDZF 3SE9H 1A22B 4G6KH 2ATKB 2R0LL 4LSVH 1KXVC 1OGAE 3MOBH 1UM4H 1BIHA 4I18A 3EDEA 1P84K 5JQ6L 1ZMYA 1EEYB 3MYJB 1LK3L 4Y7MA 1U91B 4WW1B 3SDCA 4ELMB 5I30H 4X6FA 3SDYH 4GG8B 1O7SA 3RNKB 2EEBA 1OW0C 1IGCL 2BY1A 3Q6FA 3S36H 4XWGL 3SE4A 1ZS8B 3UROR 4G8FB 4KQ3L 1B0RA 4GBXB 3ULSB 2NXZB 3VRIA 3PWUA 1SYVA 1NDGA 2QJDA 3X11B 5IHLB 3BP7A 1FGVL 2XKNA 1X4YA 1BWMA 1XZ0A 1W8OA 1WCBB 4N90D 1IZKA 1KFAH 4BZ1L 2H2SD 2WLYA 4MNQE 1ROWA 3GMOA 3NVQA 5E8PA 5JDSB 1BD2D 2E7CA 1H0DA 2FWOB 4FABH 4ZFOB 3MJ8B 4GW1B 4OUUA 3BJ91 5LAXA 3V2AR 4YBQD 2A6DB 3KYKH 4I2XB 1T80A 4BZ2H 1T04A 1J5OH 2CXKA 1KYOK 4GSDL 1F4HA 4DEPB 4MVBD 4MXVF 4O2FA 4RDQG 4GJTB 1QQDB 4UBDC 4AIXA 3BGMA 1KB5H 4NDMB 3HI1B 1VGKA 4RMQA 1GIGL 5I17B 4POZC 1O0VA 2JCCB 1UZ6E 5KW9L 4M8QA 1PJ9A 2VR9A 3MLTA 4D2NA 3OKYA 2EXWC 2PR4L 4I77H 4UUJB 2PTUA 2IEPA 2D0FA 2PXYB 5E94B 3WHE1 4PRPE 5CZVL 3EYOA 3WDIA 1MVUB 1XCTA 3O4LD 1FL6A 3UTZA 1N2RA 4GUPB 1TVBB 1S8DB 4K2UL 1WEJL 4P5MA 1F2QA 3Q1SH 1NC4D 4U7SA 5DUMH 5IVXE 3VGDA 3TIEA 5CGYC 2HKHL 3EYFA 3QHFL 5DMIH 5I66A 1MLCA 2VWEE 3EYVB 5I1IH 4X7DC 1MI5D 1N6VA 4F7MB 2NY0D 3SJVA 4M9OA 4FZ8L 1RZ8B 4YAQB 2NW3B 3S5LB 5E8DH 3IS0X 3UBXI 4XWOD 4LHQB 1EIBA 4JO3H 1HHJB 2CUIA 5I8KH 5DJXA 3TJEL 4NN7B 5JLZA 1P7HL 5EBLB 1PX3A 1FLRL 5L2KA 3WIHL 1K85A 2R2CA 1GPOL 4OLZH 4OKVB 1MNUH 3N1GC 4TYUA 3FQRA 4NHUA 5I15H 4FN0A 5B3JE 4A2LA 5ICXB 5EC2B 2AJZB 2PO6B 2DTMH 5IOPB 3D0VA 5FK9A 4MA7L 1XF5A 4OGXL 4Q0XH 5JNYB 4PJBB 2YPVL 3WUZA 4N5ED 5B8CB 4IMLB 5EOCH 1U6AL 2O5XL 4LCIL 5F7WC 3RVWC 2B4CC 4PG9B 3KPRD 4HG4J 2CPCA 5IM7B 4KK8D 1Q9WA 2P8PB 3HLAA 2Y36H 3WNOA 4K3DH 4R8WH 1PX4A 4ZUWA 4OZ4B 4XPHH 3IKKA 5IFJB 1NCBL 3NFNB 4OSUL 4S0SD 5HY9A 2DYPB 1NCAL 4H0GA 4LVHC 5ILTL 3S36X 3ZE1F 3OAZH 1P7QA 3HG1A 3IKCB 2EDFA 4LARH 4PRBB 5DDHB 2QADB 5T3ZD 2HLAB 3QJFA 4NQDA 5GHWH 1CDGA 1M6OB 5CSZA 5HHPB 4L4TB 1PAMA 1N0XL 1RFDL 4XVUC 4ZUUB 3G5ZA 2VKXA 1DVFB 4GG6A 4Z7QE 3T3ME 4G6MH 3F58L 4NO2B 4FFYL 1ZHBA 5HVHB 3SDAD 3P4NB 5D93C 1LDPH 4KJPD 4MD0A 4LEOA 3HZMA 1MCQA 3H9SB 5DHYA 1KLFA 5E2VH 1MCOL 1KPUA 2X42A 1UXWA 4R3SA 2HTKC 1GOHA 5DMYA 4M5ZL 4WDIB 3VXOA 1I7RB 2EDHA 3QCTH 4X6CB 5DO2C 4NOFA 1FFNA 3HA0A 5SV4A 1OT2A 4CRPA 1HOCB 1HCFX 2EC8A 1DBKL 3ULVE 2DIAA 4IEFB 3TO4B 3OJDA 1IQWL 1KBGH 5BZWA 3A6CL 3NTCH 4WCYH 4DZBB 1IZJA 3G5VA 2Q7YB 2MQ0A 4GAJL 1XGRA 5DJYA 4EI5B 2VQ1B 4XGZA 2VSCA 4MZ3A 4JQIH 3ARXA 4ODVH 4DN4L 4WWKC 3MRPA 2EE3A 1FO0A 4Y5YB 1U8KA 3SGJC 2VDKH 3NA4A 2HJFB 5CEXA 5I74C 3MLWL 4X4YA 2F15A 4LCWE 3UC0H 2FSEA 3RI5F 5KW9H 3RWJB 1AO7D 4OCYH 3VGGA 2E7MA 4KI1A 2CGRL 5FA4B 2RFXA 3K8LA 4YHOH 3MA7A 4HPOH 4NQVA 5TQ2H 3DETC 4PJ8C 5JPNA 3MRLA 3D69B 5F9OH 3ROOB 1PQZA 4HS3A 2P8LB 1TETH 2CDFA 2ERJB 4NUGH 4HJJH 5DJDB 3L3JB 5IEKA 4S1SL 3LVEA 1WEJH 4N1CA 5T3ZH 2GTZA 4P3CH 4F33B 3E6FB 3FKUS 4Y4FA 5CFHA 1A1NB 1W8NA 3MXWH 4M1GL 1N64H 5TE7H 2AKRB 3BFOA 3LKPB 4EDWL 1G7LB 4OZHE 2NY2B 1ACYH 1MIEH 2QEJA 2BRRL 2BMKB 5DMGD 5MHSE 4AH2A 4S1RH 2BCKB 4G80B 2UWEF 3M17A 4OFDA 4QXTA 2E6PA 3KLAB 3BUYB 1F4WL 4MWFB 5E1HB 2Q76A 4IRZL 1XGUB 5FUCC 1MJ7H 1ZT4A 3MNWA 5AZEH 3PDGA 2AXFB 4N68A 1LO0L 2ZUQB 4J6RL 5EO0B 3J8F7 1HNGA 4NRZA 4KRMB 4JKLA 1A6ZA 2VLME 3VGEA 4ZUTB 5EBMA 4U6VH 1T1ZB 2ZSWB 1PGRB 3GSXB 3WKML 3NBNA 1I8KA 2CR6A 2EZ0D 2VAAA 4P4KD 2PW2A 1CGSH 4EN3D 3BP6A 4UT6H 4CMHC 3D85B 1CG9B 4U1SA 5HHOA 1GZQA 3V4UH 1F00I 2X7LA 1FNGB 5GGTA 4F15C 2EDBA 1KB5B 2YKLH 5DVOA 4UT9H 4BSWA 2JIXB 5B39G 1TZHA 4U1GC 3C5ZB 3RI5K 2DOCA 2OZ4H 4KMQA 3LB6C 2DQJL 3L6FB 4O4YH 4WEBH 1FZMB 5L6YH 3MJ9L 4F9PC 5DYOA 3JTTA 5FO9B 3SDCD 5DVMA 1WBYB 2VDLL 5LJYH 4N0UB 3GMQB 4P3DB 4LCIH 4GKOA 2AEQH 1QRNA 4JFOB 2AK4D 4U6YA 2FIKA 4QHKJ 2VJXA 2ICES 1I3UA 4DTGH 3KLDA 4U1HA 4XMPL 2N7AA 3R1GL 4ZTPL 5DRNB 1I9EA 1OF2A 1GH7A 4O2CA 1D5IL 5FGSA 3MRJB 1ZT7A 1ORQA 5GRZA 4Z7WE 4HGWB 4NYLA 4OT1L 5CILL 1IBGL 4TVPL 2JE8A 4X5LA 3TJHD 5T5FH 1SQ2N 3C6LC 2XZAH 4HEME 5EUKB 2CXGA 1EO8H 3VRLE 3GEWB 2C7UB 1BD2B 1K4CB 5CJQH 2RHEA 3V5KB 3LPFA 4MJIA 5HI5D 1CF8L 1MFDL 4XTRD 3RUGE 4C57C 4BJLA 3MR9B 2CDGB 4BH7A 1G7MA 5JPMB 3QA3A 4E9LA 4HCRL 1H15B 2J6EL 2DBJA 5LBSL 4JZJB 4XNQA 4M61A 3R4DA 4RFNC 4ZPVB 1F42A 5IQ7L 1SEQH 1HH6A 4GQ9H 4YHIB 4JM4H 1YUHA 3DHMA 3OAUH 4K7PH 1QSEA 4F8QA 1OAQH 1CGXA 4CVWA 5DJ0A 4LBEB 4L4JA 5IWLC 3VW3L 3ZKNC 1FHGA 1RUKH 1F58H 1CU4L 5HDQH 2NTFB 2UWEA 1TCRA 5L9DL 3EO9H 1NFDA 5KSUA 5GIRB 4LPVA 2P45B 1D5XA 1MELA 4AIZA 3TFKD 2M1KA 4OD2B 2VLJA 2I07B 2LVEA 3G9AB 5FUOH 1P5UA 3KPQB 4XRCB 5DEGB 2F58L 2QQKH 5EU5B 3HI5H 3QCVH 1J87A 4MSWB 1AXTL 4YE4L 1NC4B 3SJVD 1F11A 4NKIL 3F12B 2H32A 3DYMA 3GMNB 4XBPA 4YXKL 2DDQH 5EU7E 1F4XL 4ELKB 5GZOD 4ORGA 1RUAH 3BRFA 1MAJA 4M7LT 1MI5B 1NL0H 3B6SB 1DLHA 5C1MB 2NY0B 1JWSB 5C0BE 3VE0B 3MO1B 4KRPD 2DQTL 4GRWE 2X6MA 3MODL 3E8UL 1CS6A 4GW4B 4EUPA 1XF4A 5IHBA 4KVNH 4GKNA 5JW5B 4IBLT 3QIUA 2V7NA 4NC1C 2WQ8A 1OAZL 3U1SL 1M1SA 4K8RD 2EH7H 2GJ6A 2AJVH 5EOQL 2ADGA 2E7LA 1A7NL 2OSLB 4XNYH 4LMQE 4YDIH 3NA9L 2DQGL 3LOWA 1BBJB 4ODXA 3QEGL 4HWBL 1UFUA 4M3JA 4MDIA 4NWTL 4GS7C 3BD3A 4XPBL 4NT6B 4LIQH 3TF7C 3AS1A 4LHUA 2OP4H 1LO0H 2P5EA 1NGPH 1MJJA 3QIBA 4TSBL 3CLEL 3WUWB 3T0ED 3ZDYE 4L4VA 2PCPA 1UJ3B 3PJSA 4HLZG 4CBPA 5TF1L 4GMTL 2WBJD 2A77H 3DV6B 3VFUA 3O8XC 2C3HA 2ZPKL 2Q3ZA 2J88L 3KPRB 5E99L 4P59L 2XXCB 1IC5H 1R0AH 1EXUB 1P7QD 3GGWA 3S88L 4MD5B 2ZOKB 1N5YH 4ZTOH 4I8DA 3I6LE 1M7DA 2EH8L 4XP4L 4NSKA 2VXUH 4NQDD 3QG6B 4PGEB 3NAAH 4YPJA 2NY5L 5AUMB 4HIJA 1B0GA 5JHDA 1NCDL 3VXSE 4JHAH 3BT2H 4YXLL 1BM3H 3H7BA 1YEFH 4WI8A 3IDIA 5GGRB 3H9HB 3QQ9C 2VDRL 5IVZB 4X7CC 1JGUH 1VFUA 5DEZA 2IPTH 3AAZB 3FTGB 3ZE2F 1HI6A 2AJUL 2D0GA 1XF3B 1NEZA 4PUBH 3BW9B 3EYQC 4EXPX 3BX7C 1BOYA 2FR4A 4JFXA 5J13C 1RJYB 2YMXL 3QEQD 3SDAB 4XCNB 5DHVH 3F62A 2APVA 3PHQA 1S5HA 4J8RA 2YD6A 2BFVH 4OF6A 2W9LA 4OFPA 3VRJA 4KJWC 4PJ9A 4GLRI 3ILPB 5FYLH 2LTQB 3QO0A 1KJ2A 3FO1B 4PJDA 3VXUD 4MGXA 1A7QL 1FC1A 4K8RH 3KPMB 2IJ0C 5HHNA 3GSOB 2Y07H 1GAFL 4DKDC 5HHXH 1UM5L 1XGPB 3NCJL 3MV9E 3I02B 4CW1A 1WWAX 2XT1B 1A2YB 2XNAB 3T2NH 3KR3L 5FXCH 5C0IA 5F6IB 1MFDH 3BO8B 3IJYB 4K7PX 4UQ2B 1H5BC 2APXA 4KDTC 3IFOA 2HRLA 3RWGA 2B39A 3A0OA 3OPZH 5KG9A 2CLRB 3MLRH 4LVNB 3FZUD 3S37L 5CCKH 3IDUA 1YNKL 5CD5C 4HZLA 3RJQB 3WUWG 5FYJL 3AROA 4G7VH 1I8MA 3HS0A 3HNSH 3KYMA 5IQ7H 3FFDA 5DD6A 3QULB 3O11B 2NW2A 4JZNA 5C09E 1T1YB 2HG5B 5B4MC 1S7UA 4HGKC 5FYKL 5KN5B 3K2UL 1MSPA 1CU4H 3DX9A 1KPRB 1CICD 3UTPE 1AO7B 3MGOB 4PB9L 5JR1L 5KSVB 2X4OA 4G3YH 2AJXL 1LILA 1ADQL 4U6HB 4Y4FD 5E9DE 1U8NA 2D7QA 1SY6L 5GGUB 1DDHA 1OSPH 4KXZH 5GGQL 4OZGB 4HC1H 4XP1L 3G6JB 1YNLL 2X4SB 2GHWB 4ZFOL 4P2RA 3AMLA 7FABH 3PXHA 5FHBL 1UZ6F 2OQJA 3NCYP 2FEEI 1S7WB 4M7JH 3B9DA 1MQKL 3SQOH 3IDYC 1YN7A 2HFGL 2Y9RT 1C1EH 4QRPD 2R15A 2MTPA 5EOTA 1DQQB 4X7SH 4Y4HA 5A3ID 3T1FA 3V4VL 5E7BA 1YN6B 1CFTB 1NMCC 43C9A 4PV9A 4P4KB 1JK8B 5KVMC 1CDJA 2R1WA 1J05B 3VWJA 4EN3B 3IDGA 4HWBH 4LCUB 3SDDA 1U92A 5EUOE 1AIFA 4WFFD 4D3CH 1VFBB 4N5UA 3RZCC 5HTSA 1QR4A 5EIIA 1QRND 1EERB 3AVEA 5E8EA 1MY7A 5GSVA 1IC7L 1MRDH 2A0LC 2YRZA 2EYSB 4HIHA 3SDCB 1G7HB 1KELH 1PLGH 2IBZY 4GMTH 3LQZB 3SDXE 3T8XA 3Q6FB 3QDJE 5JO5B 4JPWH 5BXFA 1T7YA 4JG0H 5ACMA 1T0MA 3HMWL 2NY5C 3IDNA 2AK4B 1Z6JT 3ELAT 3VRIB 2VDOH 3PWUB 1NDGB 1K3ZA 4HK3N 4JO4L 5GQBA 1BQUA 2DLFL 3BP7B 1KACB 3T2QA 2R4SL 5D1ZC 3RDTC 1FNLA 1XZ0B 2B7DT 1WTGT 4ALAL 3L3OA 3GMOB 4JPIA 5B3JF 5KAQG 3DGGB 32C2B 2YD2A 3NFPB 2RCSH 4UZGA 5D9SA 3VFOA 2F8XC 3P4MA 1FAIL 3U9PL 1CE6A 4OUUB 5FFLA 2FLBT 5LAXB 3WKNA 3HRZA 1AGEA 1I8IA 4MNQA 1AY1L 3NPZB 1XIWC 1I1FA 5E95B 5D1QA 3CVHA 1PY4A 5SWSA 4WWID 3CH1A 5D5MA 1ZOXA 4O2FB 2YUXA 1J7VR 5GGTH 3BGMB 4D9LL 1QSED 4OCRH 1FNHA 1A7QH 4XPFL 1A6AA 3AS2A 4YZFF 3WO4B 4WI3A 1RU9L 1WZMA 4M8QB 3MLTB 4KKAC 3NCJH 4CDHA 1YEEH 4AENB 2I25N 4J12A 4B7IA 3EYOB 3UJIL 1XCTB 4Z7QF 3V8CA 1E28A 1FL6B 1PKQE 2Z31A 1FFRA 3HC3H 1E27B 3T3MF 2HFTA 2VLJD 3V4PH 1DN2A 1MJ8H 2AEIT 1U8JA 3S37H 5BOZG 4DUVA 3ARFC 4BK4A 3DVGA 3HZYA 2ZCHL 3P0VH 3BH9A 5E6IC 4IMKC 3OKKA 3TIEB 2ILLA 2NXZC 4O2EA 4NWUL 4OQTL 1LE5A 1I1RA 2YXFA 3SJVB 2FH8A 3T04D 1S3KH 5C6TL 3DX6A 4HX1A 4OJFL 2AJXH 2A6KA 3ULVF 1T4KB 1ADQH 3QPXH 4G6AD 4O9HL 4QOKE 5D7SH 1OP5K 5I8CA 4KK9C 1X5FA 3N0PB 4XC1H 2IADA 4KRPB 4RNRB 4D0DA 2GJ6D 1FORH 1UB6A 1VHPA 5ALBH 1FFPA 3C60A 5F71A 2CDEA 4WTWA 4JHZA 1U8IA 4TUJA 1GVIA 2VISA 4BFBD 4GKZB 2D9CA 3AFLA 1KCVH 3OKOA 4NPYA 4NZRH 1W0WB 1QNZH 4LHUD 5CD3A 3FQRB 4NHUB 3SE8L 5JOEA 3WDHA 3QIBD 2E7BA 3WIFB 4QHKI 1I8LC 1WAAE 4F7TB 1XF5B 3GK8L 4W70A 5IBTH 5JQHC 1KN4H 4MXWL 2HFGH 3VXPA 1S9WA 1DQDH 3T0EB 1U8HA 4TUKH 3GSVA 1OTSC 4KUCF 1IAIH 4N9GA 2X9XA 2IFFH 3DSFL 2FRGP 2WBJB 5DEFB 3HLAB 4X80L 2P42B 4HXBL 4M1CC 1QFPA 4OZHF 3RZWA 4N8VB 5HY9B 2B5IB 2GK2A 3V6ZB 5JHDD 1P7QB 4OKDA 3BZEA 3CSGA 3TNMA 4KI5C 2VQUA 3QJFB 1U58B 4NQDB 4HKBA 1IGMH 2L0DA 15C8H 1ZWIA 1TNNA 4GFTB 4WO4C 1BVLA 1HINL 3W9EA 3G5ZB 1ETZA 5D8JH 4GG6B 1GGIL 2NX5E 4PJEA 3EHBD 1YMME 5F93C 3W0WD 1AP2B 3BVNA 3TESA 4OLXL 3HZMB 3NIFF 3SOBL 4PJ9D 2O5YH 4R7NB 1KPUB 4NN7C 1FPTH 2VRAA 1VACB 1N4XL 1UXWB 4R3SB 3QEQB 3DBXB 2W0KA 3ARTA 1MHHB 3PE9A 3STBA 3VXOB 1KPVA 1IEAB 1BBDH 1K6QH 1IVLA 2W9EH 1FFNB 4OFIA 3K1KC 3VXUB 5D7JA 5JA8B 3GJFK 1SEBB 2PO6C 5BZWB 2VDMH 1TITA 5K9JH 3N06B 3G5VB 5C70A 3RU8L 4FXKA 1SJXA 5DJYB 1GGBL 3QWQB 4D8PA 1U95A 3ESVF 4IJ3B 4WI2A 3DRTA 2V9QA 4G9DA 4OV5A 2P48B 1UEMA 1BQHA 1M71A 1JZ3A 1ZK9A 1MCPH 5CEXB 3GB7A 5HD8D 2B8OT 2WIIA 3GFUA 4Z7WF 1NGQL 3S37X 4DFHA 1RULL 1HQRA 2YD8A 2ICWJ 1UB5B 3N1FC 3VRLF 2YZ8A 4N8CH 2ZSVA 4K7FA 4HS3B 4WHDA 2CDFB 4N8VG 1LP9E 4NC1E 1CICB 3BZFA 5IB2A 2DQHL 2GTZB 4Y4FB 3L1OL 3OR7A 1JNLL 3RUGF 1IAOA 4ZSOA 3JV5A 5JHLL 4L9LA 3GJFA 4P2RD 4TOYH 1N3NB 1ZKAA 5D70L 3HE7A 3MNVA 2LAAA 2BVEA 2OJEA 2QSVA 2BOBB 3HPLA 5FHAH 4AH2B 3LD8C 5L88H 4MAUH 1T3FA 5T1KA 2CH8A 2FJFA 2Q76B 4OZHA 4PRIA 4NNXA 3RKDD 3FN0H 1GGUA 5FGRA 1FG9C 5DLML 4Y4HD 2VXVL 2WBWB 1PW3A 1A6ZB 3V0VA 4KJQC 4M4PA 4U6TA 3TH3T 3TPUA 1I8KB 4MQTB 5SWZD 4YO0A 12E8L 3BP6B 4JKPL 4YDKL 3U7YH 5TQ0L 2V5YA 4QRPB 2V2WA 1GZQB 3PG2A 1J11A 1BJMA 3SDDD 4EI5C 3RWFA 4BSWB 1YEGL 1TZHB 3SE8H 2R9HD 2KL6A 4OIIL 3IT8D 4W68A 5IK3A 4P2QE 2XQYK 5DYOB 1F45A 2AGJL 3C2SA 4LRNL 4Y2DD 2YK1L 3JTTB 4FQLH 4MD4B 5K93A 4P5TD 3U6RA 2X4UB 4M43L 1QRNB 5GGSY 1YYLL 4GRWF 4RMUA 4LMQI 4HFWA 2RB8A 1OP3K 1T5XB 4ZUVA 2NY1C 3KVQA 2FIKB 3IDXL 2VL4A 2OTUA 3STLA 5GGVY 4Y5VA 5ANMB 4AIOA 4Y88A 3OKLB 1UZ8A 3QG7H 4LRIC 2HMIC 3DVNB 2NY3C 3TC9A 4WHYG 1AE6H 1ZT7B 4MLIA 1RZFL 4ZD3L 5IHUL 1CGUA 4NYLB 4ONGL 1FGNL 4LLDB 1MJUL 4XCFL 8FABB 3RVTD 1IKFL 5JIHA 1U8PA 4YPGA 3WHE0 2BNUA 1HN1A 2X1OA 1INEH 1R5IA 2V9RA 1B4JH 4MQ7B 3AREC 3QWOA 5IFAL 3GM0A 3ZDYF 4GAFB 1CL7H 2XPGA 1H8SA 1YY8A 3QCUL 1UYWL 2PTTA 3CMOL 5D1QD 5CBEA 1AD9B 5SWSD 3BPLB 4JQXA 1ZHLB 3SOBH 2ESVE 3KDMA 2YHGA 2HT4D 4KKLD 1G7MB 1VERA 4BH7B 4M62L 3UYPA 3QA3B 1UCBH 3VA2C 3QPQD 4E0RA 1I9IH 2GYSA 4YQXH 1NGZA 1FYTA 1LNUA 3QB7C 3QEHA 5DK2A 4I3RL 1YUHB 2X10A 5D96B 1QSEB 6FABL 1RHHA 5DJ0B 4WU5A 2Z31D 5DWUL 1X3DA 4YHPA 2GT9A 3PGFL 4PBVC 1XGTB 1TCRB 1NFDB 2VB5A 3X3FH 1NFIB 4AG4H 1X5LA 5KSUB 1S7VA 4Q6IC 1A4KB 1D5XB 2ZG1A 4LF3B 4AL8H 2H6PA 2VLJB 3U79A 1U8MA 1KCUL 2FJGA 4HIXH 4O02L 3RTQC 4OF7A 2HA1A 3U7WL 1AI1H 3U9UA 3BKYH 2EDWA 5MERA 3W9DB 1CLYH 2VIRA 1F11B 2DQCL 3FFCD 1PDKA 2JELL 1JP5A 4HAGA 5I6XC 3QRGH 2Z8WC 5CJ8A 4ORGB 3BQUC 5IT2H 5EULV 1YECH 5ICZB 4RGOH 4FFZH 5D2LA 3BDBA 1T2XA 3QXDA 2VR4A 1GXEA 3WEXB 1AKJB 2R1YA 4TTDD 1XF4B 3C60D 2FGWH 4GKNB 1NAMA 4J3OC 3UYRH 3ZE0E 2R69L 2XWBB 1RI8A 2GJ6B 2X1PA 3QFJE 4OLEA 1QR1B 2WV3A 3CVHH 1HILB 2JLLA 1A3LH 4ODXB 4TSCL 5CLTA 1NCUA 4MNGE 3EOYG 5C07D 4DVRL 4OZFA 1KCSL 4LHUB 2Q8BH 1TJIH 2F9BT 3C8DA 3O2WL 1MJJB 3QIBB 4JFDE 3UTSD 3GO1L 2PCPB 1YC7A 3LMJL 3KPSE 1D5ZA 5TDOB 1JFQL 5JIKA 3VFUB 3BWAA 4JPVL 2ZZUT 2GUOA 4YDLB 3F7PC 1A7OH 5CWSB 3GGWB 3MREA 5HBBA 2I5YL 2I60H 5IF0A 5LGHL 5D72L 4L1DA 1B0GB 5JHDB 2KUTA 4NQED 3V9FA 3H7BB 1JHTA 3NCEB 2ARJQ 3OGCB 1OL0A 2IWGA 3PDOA 4MNHA 3O3BA 2DM7A 1F5WA 1HI6B 1NEZB 2IALA 3ZKXC 1R3JB 2VXQH 4Z5RA 1ZGLM 3W5NA 4A6YL 2C3XA 3NACH 2CKNA 1VPOH 5IB3A 3W0WB 3PHQB 1CFNA 4XWOC 3IDJA 3FB5A 5C0AE 5IB4B 4JANA 3VRJB 4UAOC 3AGVA 2B2XH 4J3TA 4PJ9B 3N50A 4YBHA 5FO7A 1MJUH 3QUZC 1FSKC 5EUOF 2ZKHL 4JM2D 4PJDB 2VN4A 4FMFA 5D7JD 5HHNB 2H3NA 1MEXL 4CL7A 5IFAH 4FFWD 1U8OB 3QCUH 5GS1A 8CGTA 5JXEC 4ELME 4LLYA 2PTVA 5CGMA 3PWJB 2BY2A 5C0IB 4LGRB 1BQLH 3IFOB 3SDXF 3X14A 3RWGB 1PSKH 2E27L 5KG9B 4H0IA 4HUMB 2PYEA 3HNVH 1JZ7A 1FZJA 2HRPL 1A7RH 1CR9H 1I8MB 3HS0B 3KYMB 2Q20A 3MRCA 3FFDB 4KK8C 5EA0H 1C08A 2ADFL 1CCZA 5D7LA 5HYJA 5KSAA 1RZ7H 2MCPH 2NW2B 4XMLL 1FG2A 1SYSA 3OZ9L 1S7UB 3LN4B 2XXMB 5JXAH 2QSTA 4IRJD 3K74B 3EJZC 1LO3H 3DX9B 4RMRA 5F1NB 2X4OB 4PB0L 4PJ7A 1CVSC 4HT1L 5TJWK 1BJ1H 3HNTH 3MBEB 5A2LH 2V7HB 1U8NB 5BW7A 3HAEA 4FQ1H 4I2XE 3HE7D 3KWWB 3LN9A 5I8EB 4F7EA 3VMNA 4P2RB 3VFPA 5CEZH 4N0YL 3SGDI 2FL5A 1DQML 4Y0GA 4Y89A 5EC1A 4PRID 4KJPC 5C8JA 3RY6C 3S6CA 1DQLL 2H9GB 2JCCE 5HPMA 3EOBB 3MFFB 4P5KB 2BNRA 4FMKA 4ODSH 1LE9B 4LQ1A 5CJXC 2DB8A 1P69B 1YQVH 1X4ZA 4DUXA 1BLNA 1CIUA 1YN7B 2KZ1B 3B4NA 4HZAA 1Y18A 4GRLA 4QTHA 4KUZL 5EOTB 4Y4HB 5L2JB 2AI0H 4LVOB 4Z8FH 5DVKA 1AC0A 2NLJA 2D31A 1NGYA 1P6AB 3QI9C 5SWZB 5ISZA 4N0CD 4HBQA 3VI4E 2UVFA 1CXEA 3IDGB 2BHYA 4UV4L 1KIPA 1JRHL 2CRZA 2VLRD 3FQWA 3W39B 1U92B 3L95B 1JZ5A 4LLAA 3KXFD 4U1LA 1MHCA 2ZCKL 4ODHH 5EU3B 4RA0C 4U1IB 1LO4H 3SKNA 1FCGA 1ULVA 4HUUA 1H3UA 4H20H 4Y2DB 4RMSA 1BP3B 3QIWC 3HUJF 5T1DL 3BE1L 4M7ZC 1DBML 1MAMH 4P5TB 1T83A 4OI9A 4YHKL 4LAQL 5DUPL 2DJSA 5BXFB 4IIQB 3PP4H 5LKNA 4NM4H 4Q58C 1E0OB 1RK0B 3TBYB 2F74B 3UTOA 3Q48A 4TULL 5C0JA 3SDXA 5JZ7D 3QDJA 1ZA6A 1PZUB 1OAKH 5F9WC 2BERA 5HGHA 3MRQA 4OCSL 4YK4C 3ETBF 5IB5A 4ZQKA 3N1QC 4X83A 3MLXL 2E9WA 1WAAF 3BPOB 4PJBE 4Y19E 5D9SB 3VFOB 1E4KC 3P4MB 1UWXH 5DFVD 1CE6B 4MA3A 1DQJB 5DJCA 2A74B 3HRZB 1AGEB 3FMGL 4UIKH 5H35A 3WFCH 4QY8B 1IGYA 1GHFH 4KKBC 1A0QH 1ZLSL 1WF5A 2ENSA 5LGKA 5D1QB 3UEZA 3CVHB 4ZFZA 3MLSL 1Z9OA 5SWSB 2ICWI 1FYTD 2Y06L 5CJBA 3CH1B 5D5MB 1KJ3L 3Q0HA 4GKSA 2D7NA 4P4KC 4WEUD 3BPNB 2Y5TA 4FZEL 3WFEL 4EN3C 2E6QA 1P6FA 1A6AB 2Z92A 1CDCA 4KH2A 2DQIL 3CFCH 4GOSA 2A9NL 4L4TE 1G0YR 3TV3H 1K4DA 3BH8B 1LO5A 4OZIF 3DPBA 4FQHA 4JQVA 4I18C 2J8UA 1FH5L 2Z31B 1JHLH 1IFHH 3KHQA 4L3CA 2FX9H 3SDCC 2NY7H 1P9MA 1I9RL 1U8JB 4QXWA 2VC2L 3H9SE 3QJHA 5JIIA 4Y4KA 4QYOA 1MCEA 5C08A 2JJWA 1FL5A 1PKQA 3SE4C 3OKKB 4OGZA 1IEHA 4O2EB 5AG9A 3L5XL 4ZNCD 5H37H 4JB9L 1EHLL 5DRWB 4X6CE 4R4FL 4ENEC 5CEYA 3ZO0A 4H25A 4Z0XB 3QQ4B 4DN3L 3FFCB 3DX6B 3G04A 4AEEA 4HX1B 3TT3H 2A6KB 3WFHB 1BF2A 5I8CB 1AJ7H 3DYPA 4HKXA 3T2OA 5T5NF 1LO2H 3ZTNH 4YIQA 5HJ3A 1OB1B 3IXTB 4D0DB 1JGLH 2ITDA 4U1JB 5BRZA 3DUSA 4OD1H 4AQ1B 1FFPB 3C60B 4X7EC 2CDEB 2P46B 3BAEL 5DTFA 3HUJA 1GC1L 4NFBA 4TUJB 2VISB 1L9MA 3E6HA 3CAFA 4PTUB 5ADPL 4NPYB 3GRWH 4OLYL 4IHOA 4QHMA 1OQXA 4OUOA 5GGRY 4UMGA 2GJJA 5GS0D 5CBAA 5C07B 4IRSA 3RPIB 3K8KA 5HI3D 1FO0L 3OKDA 1DN0A 2FDBP 5I1GL 1FDLL 2C9AA 4BSVA 1LP9F 1U8HB 3UTSB 5KVFH 3MRNA 4NKMB 2BVUA 2FHFA 3ZYJA 2AABL 5CZXD 2XTJD 1WAAA 1NGWA 2XN9D 4HPYH 5FAAA 3O0RL 3HN3A 3WNNA 1TFHA 4LLWB 4HUKB 2Y6SD 1DR9A 1ZTXH 1KNOA 3CXHJ 1ZANL 2KBGA 2VYRE 1A6VL 3HFMH 3K0WA 5E7FA 3EYUL 4OCXH 2V17H 3NFSH 1RZKL 3BZEB 5D1XD 3ULUD 1WIOA 2UZIH 2HT2C 3TNMB 1C7TA 2I9TB 4HKBB 4M1DL 1E6OL 4RBPK 1ZWIB 1BVLB 1S7XA 3ALPA 4JHWL 4NQEB 2EYTA 4XNXH 5MP6L 1ITCA 4M9PA 3AU1A 4BQBA 4PJEB 5KVGH 3EO0A 3SEPA 5ITBH 3BVNB 2Z8RA 3QHZL 4U2YA 3RAJL 4OZIA 4XPGL 4J3VA 2OI9B 2D4FA 1YYMH 3GSWB 4ONFL 4CU8A 3EGSA 4HLJA 5K33A 4YHML 1X7QB 1N7ML 1KN2H 1WIUA 4YHLL 2XIDA 4JM2B 9CGTA 4LP4A 4N0UE 5D7JB 4WY7L 1R3KA 5GISL 4YEEA 2FX7L 4WW2A 3BKCH 4FQ2H 3REWA 3MRMB 3U36A 2PYED 3FT2A 3TT1L 3CCHA 1TENA 4LSRL 3FO9A 1AH1A 5DJ6B 3SCMA 3U0PA 4IOSD 1A5FH 1HQ4B 1U9KA 4OV5B 2AQ2A 2EDJA 1M71B 3VDBA 2XZQH 5EZOH 3ROLA 5CJ5A 1HHGA 5D7LD 4OI7A 3CUPA 1WBZB 4ISVA 2WWKO 3GB7B 4PPTA 4IOFD 5HYJD 5LQBH 2WIIB 1P5VA 1B4RA 1A47A 3HCVA 3CFJA 4N90E 2AW2A 4Z7NE 5EB9A 3O3AA 1L0QA 5EWIL 4K3EL 1KEGH 1BD2E 2ED8A 2Y7QA 1IMHC 2FD6L 2ZSVB 4K7FB 1S9XB 5I0DA 4IRJB 3K80A 1WZLA 1EHXA 2VLLB 3BZFB 1EMTH 3IJSA 5IB2B 2HT3D 4LCYA 1I9RH 3OR7B 2XYCA 5ECJE 1XFPA 4L9LB 3EJYC 3D48R 2R0ZL 1PZ5B 3HE7B 4K7PY 4P2OA 1Q0XH 2OJEB 3HPLB 2PYFB 5DR5H 5C0DA 4M6NL 1T0NA 2R0KH 5D7IE 2BNRD 1FIGL 4MJ6A 3FRUA 3S3JA 3KLHC 1T3FB 4X4ME 2M26A 5TE6L 4MMZC 1DBBL 4CMMA 1A4JA 4DAGH 1DEEA 1U3HD 4PRIB 3LKQB 4G42B 4NNXB 4YC2B 3WXWH 1D6VL 1JGVH 2Q86B 2F19H 1I1YA 1Z2KA 4NBXB 3IGAB 4BQCA 2MSPA 1HYRC 4HS8L 4TVSa 3TPUB 4DQOL 5ISZD 3O4LE 2ENYA 3DUUB 3T0AA 3RX5A 3WS6A 3HB3D 1HZHL 3RWFB 5F7HA 3G6DL 5B3NA 5LGJA 2DF3A 1CTOA 3BRDA 3P77A 3CFKB 4MA8H 1T2JA 2Z8VC 5C6PB 3FQUA 5IK3B 4XP6L 1HWHB 2VLRB 4DKAA 3F7YA 3MPCA 5FYJU 2C5DC 1NBVH 3KXFB 4NM8L 3PQYA 3QEUA 3KGRA 1MI5E 5GPRA 5HXMA 4NQSA 4NQTA 5ICYA 3OAYK 3VGAC 5I1GH 4LCCA 1K8IA 4J7RA 4M93B 1U93B 2K1MA 3DIFB 2P5WA 3UJTL 4P2QA 5E2TH 1I1AD 4XPAL 4QEGA 3RIFF 4ZUVB 4K71B 3H42L 4YGVA 3GHBH 2OTUB 1RZKC 3STLB 3ZE0F 2X40A 2AEWA 4OGYH 4Y5VB 5E2UH 1UZ8B 2V5SA 1HH9A 3LS4H 4YHYB 4Y4FC 3HAEH 3H0TB 3TYGH 1A6VH 1FIEA 5I18L 5D6CB 4OCMC 1V05A 2X4QA 5C7XL 4UNVA 5BVPH 3RX7A 3GMLB 4ZO6A 4JCLA 4DGVH 3K1DA 1XF1A 5I1LA 1JIBA 2APBA 5EDXA 3KS0H 1PFCA 1U8PB 4KHXH 3TZVD 2AQ1A 5E08L 1IAKA 1VGEL 2BNUB 2YA0A 3LH2H 5EOCJ 5AZ2L 3VD7A 4DGYL 3WL9A 4EOWL 3QWOB 1ZSDB 2DQDH 3WHXB 4HULB 2XPGB 1I1CA 5IJVB 3ARBA 1YY8B 35C8H 3PNWA 3RWDA 5CBEB 4LOUD 1ODAA 3MLPA 1H3VA 1P53A 2G2RA 3QHZH 3DX7A 1HKFA 3DVIA 1CLZH 3CX5K 3A6BH 3KDMB 2JK5A 5C0EA 4ZO9A 4ZO7A 3CH8A 4UILH 3GHEH 4E0RB 3RL1B 3VJ6B 1M05A 4L9DA 4XMKH 2GCYB 1FYTB 1LNUB 5A3IC 4W81A 4I0PC 3QEHB 2VH5H 5DK2B 2ESVA 4TSAL 3BSZH 4UDUA 5TPWL 3UXFA 4XAWL 1RHHB 2DQEH 1EO5A 5CIPA 3VFRB 3WE6B 2XI9A 3P0YH 2QSCL 4HIIA 4M7LH 5ALCL 4YHPB 2GT9B 5SWQA 4PGCA 1RJCA 5T3ZE 2EDLA 5DMKA 4ZPTA 3U0TA 4YEFA 4G9FA 1S7VB 2VABA 1UH2A 2X44D 5E8NA 2UUDH 5C08D 4KZEH 3VCLB 4UTAL 3KHOA 3JXAA 2EO9A 2UY6A 4Q9BA 1U8MB 2FJGB 3VDCA 1S78D 1X44A 5MI0C 3SY0A 2IH1A 4Y16A 5EORL 1PG7H 5MERB 4JRYA 2VIRB 4BQ9A 2G75A 3S4SA 3WS3A 4B5EA 2EXYD 1F2XK 2HLFC 3WJLA 4R96A 5AEAA 2C26A 3L5WB 1F3JA 1Z0MA 5D2LB 4BSJA 3QXDB 4K9EH 4L8SA 2DN7A 4ELMF 3MXVH 5BRZD 1LMKA 1RZGA 2R1YB 4H88H 1QSZA 5EU6A 2B1AL 2YUVA 4ZMAT 3B9KA 1KJ2L 3D9AH 1RIHL 4X6DB 2O5ZL 5IMOB 5A2KH 1KGCD 4NN5C 5IG7A 2E7HA 25C8L 5F3BA 4W6YB 1N6QL 3AB0B 4XPTH 4OZFB 4XBEH 1LK2A 1C5BL 1MRCH 4L3ED 4S1QH 1KTLA 4R26L 2YWZA 4CN6A 4XCYB 1AO7E 5GJSL 3KPPA 5E8OB 5MEPA 3PWNB 4MNGA 3WNLA 1DFBH 3WLWC 4LDOB 1QEWA 4XNZB 1R3IH 1SMOA 5BMFL 1PEZA 1AGDA 5BV7H 2CSPA 2C1PA 3BWAB 3IF1B 3JV6B 2GUOB 3GSRB 2P47B 2V2XA 4Y1AA 1X9QA 4OZGE 4XP5H 2XTJB 1J88A 3G6JE 2A6IA 3KPSA 2XN9B 4XX1G 5B38B 1IGTA 3MREB 4JEGB 3V5DB 4D9RD 2AQ3A 4E42A 5DT1L 4LQFL 5IF0B 2BK8A 3QDAA 1FNSH 1QFWL 3BP5A 1KC5H 3FOLA 4PRNB 5T33H 2JCCF 1NBZA 2FX8L 1JHTB 5D1XB 3WFBL 1BZQK 5DVNA 1OSZA 4PREA 5J7CC 4EI6A 4MNHB 1NBYA 3O3BB 3FN9A 2YN5A 4OLWH 2IQ9L 4BH8A 4XVTH 3V6FA 3IDMB 2Y4SA 4Z95L 3F7VA 2Q8AH 4MXQD 5FDWB 5DK3A 3MV7D 4PJIB 5JORA 3QDMA 5DD0L 5IB3B 2NPLX 4DW2L 4G6AC 3WIIL 1CFNB 5FO8A 5EZJA 1S9VA 2VERN 3QIUC 3FB5B 3VI4F 5DS8A 4LU5H 1EJOL 4NO5A 4LNVA 5D71H 3T4AA 3QH3A 5M7QA 3QDGA 5MEQA 4MB4A 1NCWH 1MHPH 3GBMH 4HV8A 4UDTB 1TNMA 4TRPH 2E7LC 4S11A 5E08H 4Y8DC 5C0AA 1EFXA 1L4IA 2CIKA 2Y25A 1ACZA 1AD0A 2F5AH 2OS7A 5JW4R 3SCMD 3QIBC 2MCG1 4YNYA 1MFCL 3X14B 3FO2A 2PYEB 4QRRA 1G6RH 1EEYA 5DD1L 5HHQA 3MYJA 2AK4E 1FZJB 1JVKA 1RJZB 5I1CH 3PP3H 5HI4D 3G5XA 4P46C 3MRCB 4JREB 1BFVL 5D7LB 5ESQB 4DKEH 4GBXA 5HYJB 3ULSA 1B90A 4HXAL 2IG2H 3V6OC 4NZTH 1SYSB 5K9KA 4UQ3B 4K94H 1AR2A 4WI6A 2HTLC 1P4LA 1PG7X 3UO1L 4PJBF 4PJ7B 5IESH 1WCBA 3UBXB 5B38G 1YEKL 4AJ0A 3QO1A 3O9WA 1L9NA 5JDSA 2YPLD 4JFZH 1F3RB 2FWOA 3HAEB 1VFAA 1YEDA 3H3PL 1QA9B 1Z9LA 3JV4B 3DI3B 3JVGA 2DLEA 3LV3A 4NJ9H 1F6AA 4KROD 5GJTH 3O3UN 3NCYS 4MA1C 3ZL4H 5INDA 1MF2H 3VFPB 5ADOL 5GGSA 3BDXA 1TVHA 2FCBA 5EC1B 3ARSA 1A02N 1I7UA 3FQXB 4PJ9C 5HPMB 1D9KC 3D25A 4CN4A 3AC0A 2BNRB 2F53D 4R0LA 1HSAA 1QQDA 1JZ6A 1IRAY 3CJJA 2CO7B 1U3HB 1JPSL 4MAYA 4RIRB 4NDMA 2BNQD 1AR1D 1NCNA 5I17A 1T03H 4PP1D 3GI9H 1MFAL 4KVCL 4KPHL 1I3VA 5LXGL 2NLJB 2D31B 2PXYA 2VMFA 4YFLI 5E94A 2CRIA 3B8YA 3R0MA 5ISZB 4K23L 1TVDA 1I75A 1MVUA 1CQYA 25C8H 2OK0L 2OLDA 2EDRA 3DO7B 4GUPA 1XT5A 2BXYA 2R1XB 1TVBA 2I9LA 2DBLL 4HF5L 1DSFL 2MPAL 3RKPA 3PQYD 4U1LB 2EDYA 4YFLF 2BSED 1MHCB 4PV8B 4ZS7L 1L7TL 3SJVE 4X6CF 2H45A 3DURA 4J23A 5IGXL 2LU3A 4BK5A 3SKNB 2WAHA 3BGAA 2P5WD 4HUUB 3EYSL 5HD8C 3T0DA 3EYVA 3AY4C 1QBLL 1Q9KA 2XA8H 4F7CB 1CBVH 1E4WL 1RZ8A 1Q72L 4YUEH 2R2HB 1I1AB 4EKXA 4R90H 1A6WH 3C09C 2D03H 3CGTA 4JDTL 1IT9H 3VG9B 1OARH 1RUQL 2HN7A 4NQCD 3VG0H 3QUYC 4L5FL 4LKXB 4JO2L 3QUML 4Z7VA 1RMFH 1ZA6B 5EBLA 3DVFA 5HGHB 3MRQB 3JWDL 4DK3A 5IB5B 1V7NH 3C8KA 5FF6B 4UB0L 2CMRL 4LSPH 2Y72A 2IC2A 3LHPL 1KUMA 1ND0A 1CIDA 3TO2A 1SBSH 3I50H 3TZVB 4XBGB 2J3SA 1B3JA 4CVZA 3DWTA 5H35B 5INCB 3MSPA 3T0EE 1JPTL 2FB4L 1IGYB 4PTTB 3WSQL 1H3XA 3U30B 4PJBA 2G60L 5B8CA 3CXHK 3V7AG 4LAJH 3EOAA 1EGJA 3W5MA 2VDPH 1WZKA 4XXCA 1TPXB 2Y5TB 3VWJC 2DLTA 2BHZA 1PY9A 2DD8H 2DS4A 2Z92B 4G8GA 1BF8A 3QDHA 3SDDC 4NQDE 2NR6C 4IDJH 4MQXC 4KTDL 4LKCB 5IFJA 2NY4C 3NFNA 3TH2T 2DYPA 2YUZA 5BV7B 1K4DB 1LO5B 4G9FD 5J3HD 4GG6E 2A6JB 1JTOA 2J8UB 3IETB 4PRBA 1BMGA 4NC0B 4L3CB 4XVSH 1M6OA 2VZOA 4GMSH 3A67H 5E5MB 2C1OB 1FN4A 2KPNA 4ZUUA 1J8KA 5IMLA 1DVFA 4JRYD 4QYOB 1J1OL 2OJZH 5C08B 1CDYA 1IGFH 4NO2A 1FL5B 1TXKA 3BXNA 4PRPD 2P43B 4YR6A 4IS6A 3P4NA 4WUKL 3QNYB 4W4OA 2NY6C 1H3WM 3TCLB 2XRAH 5C6WH 5TF0A 1RIUH 5CEYB 4H25B 2KQNA 4GLRH 3EIFA 4KK6D 1UVQB 2WLZA 3G04B 5GRXG 1KSRA 1JWMA 5F3HB 5JOFA 3OF6D 1JF5A 4WDIA 2W9DL 1EHNA 3B9KD 1I7RA 4X6CA 3T08A 4M00A 1FYHB 5FCSH 2X1QA 1F6FB 4YIQB 5HJ3B 3TA3C 4JY4B 2ED7A 5BRZB 2VZUA 1HOCA 4NO3A 1RUML 1IGIH 2I27N 5DTFB 5B39A 1UJTA 3ARUA 3LS5L 3QNXA 4QHNB 1P4BH 4QXUL 3E6HB 3RQ3A 3OJ2C 2VQ1A 4JFFD 4IHOB 4L8DA 4QHMB 3O6MH 3MLYL 2HT4C 2DL2A 5C0CD 5L7XL 3EKCA 5CBAB 4Z7NF 1HHHB 4U49A 4KMTH 2HJFA 1N5AA 2FECL 3WD5H 3O2DH 3EW3B 4RFOH 3OKDB 3WXVH 1DN0B 5DZOA 4L3EB 4AEHL 5TH2B 5KTEH 2ARWA 1QLFA 1G6RB 3RWJA 1TZGL 1RPQA 4Y1AD 3MUHL 1NGWB 3CPLA 4YHZH 4K23H 1OT1A 1J1PH 5HGDB 5BS0D 2P8LA 3MRFA 4CVXA 4CKVX 1KNOB 3DXAA 1JNNL 5I8OL 1T6WA 3EDKA 3FOMB 4U7KA 5DUBA 1OAUL 2R2EB 3E6FA 4LDEB 1A1NA 5D7IF 4FG6C 1AFVL 5CUSL 2AKRA 3CDGA 3M8OL 1J8HD 2FBJL 1G7LA 1QVOB 1YEJL 2JJTA 1CD8A 3ZE1E 2HH0H 3EFDH 1S7XB 2BMKA 5DC9B 3AU1B 3KLAA 1RURL 1HHKA 3EO0B 3O6KL 4R97C 2H8PB 1J12A 5JUEH 1I9JH 2VWEC 1BVKA 4QRPE 5EO0A 3JWDC 1MCNA 2EIEA 3MV7B 1T7WA 3B2VL 3CD4A 2CIIA 3OKEA 1T1ZA 5KVEH 3PGDA 3RVUC 2FO4A 3JWDH 3V52H 3HZKB 1EFXD 1A14H 3D85A 1RUPH 1WWWX 3UZEA 1J18A 1KB5A 3HI6L 4WU7A 1WFTA 4YH6A 4WFFE 1DBJH 4APQA 2JIXA 2OR8A 2QSQA 3P11H 5TFSL 1R3KB 3C5ZA 5IROC 3RFZC 3KYAA 4WW2B 1QRNE 3REWB 3U36B 3FT2B 4QRRD 3OWEA 1NSNH 4N1HB 4BFGA 1BEYL 3CCHB 5FO9A 3HZVA 5EN2B 4HUXB 1H3PH 3MA9H 3BKMH 3SCMB 3GMQA 2C3GA 3U0PB 5ANME 1NLBL 1TJHH 3U0WH 1TJGL 2VZVA 4WHTB 3L3GA 3ROLB 3L3HB 1F4YL 1HHGB 4KK5D 2IMNA 5C3TA 3GKWH 4HKZB 3LQAL 3D39D 3HCVB 5DI8B 4FHBD 2HFEB 2AERT 1LDSA 1OAXL 3P2TA 3MACH 1BAFL 3GUTA 3I6KB 3O9WD 1ZEAL 4RMWA 2P24A 2VSDA 1XR8A 3CVIH 3WFDL 4OM0H 1Z0NA 3BMWA 2BVYA 3IJSB 5EUKA 3MGTB 4UTBL 5F9DC 1V5JA 2C7UA 2YD4A 3NIDF 1BD2A 1K4CA 1B2WL 2YPLB 3RGHA 3OAZK 4H8WL 1DBAL 4QRTA 4X0KA 3V5KA 1MIMH 3BISA 3EZ8A 2OL3L 3NABL 1ZLUH 5ABDE 5GRUH 4KZDH 1KIUA 2BXZA 1MCLA 5C0DB 1ZGLA 1T0NB 1ZVYA 4KROB 1KIQA 4JR9H 3MR9A 5KVDL 4NP4H 5JPMA 4CMMB 1A4JB 4MAYD 1HK6A 1QSEE 2FBOJ 1SM3H 2ZUWA 4HFUH 4M03A 4MHHI 1HIMH 4NZUH 1I1YB 4JZJA 3OX8A 4XVJL 2F53B 3ILQD 4LSQH 1NFDE 5D7JC 4AK1A 1WUNT 4JFHD 1D6EA 2BNQB 3L3DB 4J1UA 4FQJH 4FA8A 3HE6C 4LBEA 2B0SL 5GSRA 3SGEI 1JI2A 2VLJE 4F2MB 1E4XL 4MCYA 4J4PA 3SKUD 1U41A 1MREL 4FQQA 4S1DD 3C8HA 1QO3A 4GXUM 2R29H 1N0LA 5GIRA 5T3XD 3P77B 3VXMA 2X1WL 2MQ3A 1NKRA 2VO5A 4WNQB 1BREA 5CJOH 4OD2A 3F7YB 3IRPX 5SX5K 3ULVH 5DEGA 3PQYB 3QEUB 4BKLB 2EKSA 4R4NC 3ARDD 3MC0A 5ICYB 4I5BB 4LCCB 5F7DB 3F12A 4NQUA 2P5WB 2APWA 4RAUA 4S2SA 1D5MB 1X5YA 2F5BL 3B6SA 4KY1H 3VE0A 3MO1A 4WI7A 2GJ6E 3KJ4C 1JNNH 4L8BA 5K9QI 4GW4A 1Q1JH 5IP4A 5IHZB 3RA7L 2X4QB 4QTIL 5JW5A 4YWGH 2XZCL 4QF1B 4QWWD 1AFVH 4HWUA 4RZCA 1AQKL 3HE7C 2GSIB 5HYSB 4NQCB 3REVA 5IW3A 1NAML 1Q0YH 1P2CA 2OSLA 3M1BA 2J8OA 3VXTB 4U1MA 3EDJA 1BBJA 5A2JH 4L4VE 1LHZA 1DANT 3GMRA 3CLFL 1RJLA 4NGHL 3PNWB 3RWDB 1V7ML 5MENA 1PD6A 4Q97A 2G2RB 3ARPA 1T7VA 3DX7B 5KAQF 3WUWA 3KJ6H 2JK5B 5C0EB 3NCMA 5FKPA 4OZGF 3G6JF 3B9VA 1M05B 3HKFA 4KKCD 4G8GD 2GAZA 3JUZA 1XR9A 5GS0L 4XNUL 3U4BL 1QYGH 3NZHL 2RQ8A 2AK1H 3KPRA 3TBWB 1TIUA 3LSOB 5JHDE 1HKLH 1EXUA 3PDDA 1CN4A 3JV0A 5CIPB 2NYYC 3I9GL 5FOJA 2ZOKA 3OG4B 2P7TB 5SWQB 4PGCB 2MOVA 1OAYL 2JB5L 5GS3A 3QG6A 4PGEA 4EEEA 1X5XA 1JTPA 4C59B 4G9FB 4PJFA 2VABB 2D7TH 1CK0L 1EJ6A 1W72H 4M93C 4QGTA 3LQAC 5JOPD 1H9VA 3BZ4B 3BGFB 4FNLH 2YEZA 4JKMA 3W0WE 2AXGA 1F4YH 4K71C 3AAZA 3ULUL 4XCEB 4JG1H 4Q2ZA 1G7IA 4M48H 4Y5VC 4JRYB 1LEKB 1MFEH 4X7TB 3TLRA 4PRPB 3WS3B 1RJYA 4PJDE 2R8SH 3SDAA 5ID0B 5H94A 1YY9D 2IAMD 5CINL 2OYPA 1F3JB 5E2WL 2W0FB 3X17A 4FQXB 4UU9B 4ZAKB 2AJYH 1A6UL 3ILPA 5JZ7C 1EBAA 4H8WC 1J10A 4L8SB 1IC4L 4H0HB 1LEIA 1UH3A 1NMBH 3TVMA 5IVXB 3H9YA 4NNYA 3KPMA 2C3WA 3B9KB 5HYSG 5J0BA 2JJSA 1XGPA 5FCUH 1INQB 4H8WH 1AGBB 3SQBA 3PL6D 4LSUH 1A2YA 2XNAA 4JQXC 3GI8L 2FATL 3GJEA 4KHTL 5C0BD 3RJDA 4UQ2A 4P23A 3WIHA 2CLRA 2DLHA 2YPKB 3PWLB 3CFIC 3SKOB 1LK2B 5AD0B 1JYVA 5IVOA 4JFFB 4JN1H 2IH3A 2OZ4A 4ZXBD 1T21B 1KTLB 3NH7L 3KPPB 4OM1H 5C0CB 5MEPB 1FRGL 3V8OA 1QEWB 4HBCL 3QULA 3O11A 1AGDB 1T1YA 4JKWA 5GXBB 3DXAD 3MJGX 5E6ZA 1G9ML 1KPRA 3MGOA 2H1PH 2V2XB 4Y1AB 5M94B 4UINH 5CSGA 4URTB 1X4XA 5J11C 3QXTA 3VWKC 4P57A 5DQJB 1IGTB 4P2RE 2DM4A 3AMKA 3VXNB 5BS0B 1JRHI 3W11C 4XCCH 3BP5B 3HMXH 1GYAA 3FOLB 3QAZC 1CLCA 1U8QB 4CU7A 4OZGA 2X4SA 5DMJB 1U36A 3MLUL 2VITA 4QCIB 5KOVC 4PREB 1J8HB 4EI6B 1QP1A 2BJML 4BH8B 3CNKA 1OM3L 1FFOA 2F5BH 3GSQB 3OR6A 3OJMB 2N1KA 5JORB 2ZCLL 4LDLB 4X6EA 3RHWF 5EU7C 2MFNA 5L0QB 5I9QB 1G7PA 5FO8B 5EZJB 1S9VB 3CK0H 2VAJA 1T1WB 5KJRL 3T4AB 4NO5B 5F96L 1JV5A 3QH3B 2DTSA 5I1KL 3S34H 5F7EL 3Q5TA 4Q9RL 1MWAH 3DOSA 3ARGC 2QKIA 4APQD 5J6HA 4N0RA 4L1HA 2WWMC 1JK8A 3JUYA 4YXHH 2CK0H 5IJKA 4EZMA 5C2BL 1QFUH 3AB0C 4RMTA 1EFXB 2YN3A 3GBNH 1ZVSB 4LPWA 3E2HB 4IM8A 4F58H 4POZD 2AXHA 1XF2B 1VFBA 1B88A 4YNYB 4JRWA 3FO2B 1BX2A 5GS0C 3B9AA 4QRRB 4E5XB 5HHQB 2QTEA 2EYSA 3GIZL 1NANH 1G7HA 3LQZA 3ZZ1A 4XC3L 1HYSD 3G5XB 4NCC2 4F3FA 4XNUH 3SBWC 5JO5A 2XTJC 5I19H 4A2MA 2Q6WA 3DRQA 1D3CA 2AK4A 4M5YL 4XP9H 4QKXB 5K9KB 4PRAA 3NIGE 3D39B 3LZFH 2SEBB 1P4LB 3IU4L 1GGCL 4NHCH 4U0RC 4U6XA 3U46A 4RQQA 3QO1B 3O9WB 3HRPA 1J0ZA 1AHWB 5IMMA 4C55A 3DGGA 32C2A 3VGBA 1IM9D 3NFPA 1VFAB 4PGBA 1YEDB 3RHWK 3UP1A 4NN6B 1FJ1A 4LCWB 3WYRA 5SWSE 3K4AA 3LV3B 4GAGL 4JFQA 1F6AB 2VDNL 2FO1A 5D5ME 1SBBA 3Q6GH 5INDB 1KLUA 5GGSB 4K3JH 1TVHB 3GZKA 3V0WL 3LIZL 5J9PB 1GZPB 1I7UB 3D25B 5E2WH 4FRWA 4R0LB 1HSAB 3OXRA 4MAYB 3CXDL 4I9WD 4OLVL 2F54D 1R5WB 2M8XA 5I1JH 3FO0L 3TP4A 4GG6F 2IGFH 3JWOL 4I4WB 5BJTA 4TTGA 1DE4B 5GS1C 4J4PD 3IFLL 2Z0BA 4AENA 2F8OA 4FQIH 1NKOA 3VXMD 2CKBL 1E27A 1HWGB 4ZS6C 2X70B 4UT7H 2A1WH 1IAMA 2I9LB 1WBXB 4JFYA 3GM8A 4FXLA 3W82A 4G5ZL 3DURB 2ZG2A 3FFCE 3NGBC 1YDPB 2VLKA 4JREC 4EBQH 1G9MC 1QSVA 1JHKH 5KSAC 1F8TH 1DUZB 1W72B 3SKMA 3ARDB 1Q9KB 4F57H 3RL2B 4X4XA 2WWKT 3WCYA 4LSDA 5F88A 4XVUD 2BDNL 2DIJA 5F9AC 1T4KA 3L7EA 4CUCA 3MROA 2HN7B 3DROB 4TQEL 4PJ5D 5DHVA 4RNRA 4Z7VB 1YEIH 2AJSH 3GBLA 4JVWA 5B21A 4QNPE 3LEVL 2A2QT 3C8KB 4HUWB 4JVPA 3GSNH 1G9EA 2CQVA 2HTKD 3MLZH 5HHMD 5C07E 4GXVL 1ND0B 2MKWA 2RGSA 4GKZA 5HHVL 3TO2B 5MEND 1W0WA 1VA9A 3F7QA 1WZ1H 1KEMH 5DO2D 4CVZB 4HLZH 3UPRA 1OM3H 3CU1A 4NKDA 3UTSE 3QZWB 2BVPA 5BO1L 3WIFA 5KBNC 3S9DB 1FNAA 1W0VB 4F7TA 1NMAH 3B2UD 4Q9QL 1EHAA 4GRLC 3ZT5A 2ZJSL 3T0BA 3EOAB 2DQFA 5F96H 3VMPA 2X05A 3T0EA 5I1KH 1OTTC 3QFDA 2AEPL 3QUXC 2H41A 3OHXA 2WBJA 5DEFA 4D0BB 4G8GB 4HIEA 5C2BH 4X5WB 4NCC1 2B4CH 1YEHH 1FZOA 4N8VA 3RP1A 2YD9A 3RUGB 3V6ZA 4NQEE 4Z0BL 1MH5A 1MPAL 2R0LH 1TQCB 4YZFE 1S9YB 4X8XA 4PJEE 5IV2A 1S5IL 1U58A 2BSTA 4FP8L 3UZQA 5JQ6H 1LK3H 4QHUA 2EYRB 1KOAA 1FN4B 5CP7B 1S9KC 3QXUA 3CFBA 5IMLB 1T83C 1BIIB 3BXNB 4GT7A 1IGCH 5FM8A 5LCVL 4YR6B 1CFQB 4IS6B 4HC1A 4XWGH 4JDZA 1LWRA 4KQ3H 3WN5B 4JO1L 1AP2A 2AP2A 4M6OL 3VFTA 2J5LC 1KG0A 4X6BA 4R7NA 1FGVH 2X89A 1DQTA 1VACA 5GRWA 3QEQA 3DBXA 3TVMD 3G6AA 1MHHA 1JWMB 2IAMB 3KG5A 3P9MB 4BZ1H 5J8OA 5JOFB 3M07A 3TN0C 1IEAA 1LEGB 4HDIB 3MJ6A 3VXUA 1F90L 3R8BB 2J4WL 4NO3B 2VZSA 1SEBA 1CE1L 5C0RL 4P23D 2VDQL 1L7IL 3G5YB 5B39B 3MV11 3QNXB 4LOUC 1OPGL 1S7QA 3PL6B 3O4OC 5AYUL 2Z91B 2EIZB 4L8DB 1BFOA 5C0BB 3QHTC 3QZWG 4HWBA 4QXGL 4R2GC 3JWOC 5T1LB 4GSDH 2A9ML 2ORBL 3SGKC 3V79C 4PD4J 4JZOA 1N5AB 1BJ1J 3B9EA 3LB6D 4M4RA 3TWCL 1GIGH 4ZXBB 3MGAA 2BVOA 1QLFB 3C87A 2PR4H 3IFLH 1UB5A 3RZCA 3CPLB 4ZSOE 5CZVH 2QQLL 5FKAA 2VXTL 1QRKA 3KPOA 4LEXL 3MRFB 2CKBH 3BWUC 4CVXB 1K2DA 3DXAB 4LK4A 1CICA 2YRLA 3VA6A 2XQBL 5F7YC 3O6LL 4K2UH 5DUBB 3ZKMC 2D3VA 2RR3A 4RGMC 4Y4KC 5I75B 2N7BA 1XH3B 5JW3L 1J1XL 3CDGB 1N3NA 4U1KB 3MCKA 4PRIE 1PVHA 5FM5O 1UM6L 1IGJB 2HKHH 4C58B 3QHFH 1NEUA 2BOBA 3RDTA 4FZ8H 3TBTA 2EXYC 4KTYA 1NFDF 1HHKB 3MCLL 1T1XB 1BVKB 4WFGD 5K59E 4B7LA 2ICEA 5HYQB 1T6VN 2CIIB 3OKEB 3TJEH 3P9LA 2DQUL 3PGDB 2FO4B 1VADA 2QQNL 5J1AA 3NIFE 4QRPA 1FLRH 4WU7B 4BQ6A 3KXFE 3WIHH 1MHEB 4BFIA 2B20A 4ZYKA 1U3ZA 4APQB 3QNZB 1GPOH 3ISWA 2R56L 4POYA 2XOTA 3Q2CA 3LKOA 4IRSC 4RMVA 1YMHA 4MA7H 4OGXH 4DZ8A 1WFUA 2YPVH 3ZKND 2G9HA 5J12C 3HZVB 4PY7B 1U6AH 4MD4A 1RIVL 2DWEA 2O5XH 2X4UA 4I13B 4YBLC 3L3GB 2G5BA 5HDLA 1QPPA 1T5XA 3BEWA 3UJJL 5F1IA 5ANMA 3OKLA 5IFHL 4ZOCA 1NCBH 4OSUH 4P9HL 1NCAH 1M7IB 1MFBL 4XXDA 3DVNA 5ILTH 3GUTB 4Z0BH 1HDMA 1CFBA 4IMKA 4C54A 1QLRB 2P24B 1XR8B 3FT4B 4KTEL 4LLDA 1U3JA 3X12A 4OAWA 8FABA 1ADQA 5ESAB 3WJJC 3OKMB 2EDTA 1N0XH 4DKFL 1RFDH 1JNJA 3OXSA 4MQ7A 2ZUTA 5L8JB 4QRTB 1IM9B 3F58H 4X0KB 3A6OA 4FFYH 1CT8B 5B22A 1AD9A 1I85A 5EH1A 3C08L 1UT9A 4WVRA 1FYTE 4HMCA 1ZGLB 1KIQB 1ZHLA 4FQCL 1MCOH 1FL3A