1KN4L

Catalytic antibody d2.3 complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
219
structure length
219
Chain Sequence
DIVMTQSPLTLSVTIGQPASISCKSSQSLLYSNGKTYLNWLLQRPGQSPKRLIHLVSKLDSGVPDRITGSGSGTDFTLKISRVEAADLGVYYCVQGTHFPYTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Remarkable remote chiral recognition in a reaction mediated by a catalytic antibody.
pubmed doi rcsb
molecule tags Immune system
molecule keywords IG ANTIBODY D2.3 (LIGHT CHAIN)
total genus 50
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2001-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kn4L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kn4L01
4YHZH 4I48B 1NGZA 4NC2B 4HUXA 2W0LA 4L3CB 3AXLA 1MSPA 3TN0B 1Y0LA 5L7XL 3OKLB 4Q0XL 4JFDB 3PV6B 5JW5A 4F57H 2XQBL 3AFLA 4R7NA 2FX8H 4LHJB 2JIXB 2FGZA 4QNPF 5DC4B 2OJZH 4NQED 2WSKA 2BFVH 2RFXB 1T5WB 1U8IB 2QJDA 4NO2B 3L3HA 5GGUA 1HILB 3GSRA 5D7LE 2QSCH 3OB0K 5ENWA 4UIMB 2FB4L 2NY6D 4YPGB 5BRZB 1X5YA 4ORGA 4YXLL 2HLFC 1AGFB 1T6WA 5FYKL 4Q74A 5ITBH 2NMSA 5T1KB 2VMFA 3UC0H 1P84J 3CX5J 4NHCL 1AJ7L 1FG2A 2VO5A 3HAEG 1RIHH 3VMPA 3VD3A 5D2LF 4HKZA 3QDGD 3QXWA 4KI5F 4EXKA 3MFGB 3OKMB 3UYRL 5EN2B 1KT2B 2HVKB 4CVZB 1LO3L 1Z6JT 2LV4A 1UWGH 5KG9B 1J05B 5IM7B 4RFOL 4I5BB 4G43B 2VDQH 5E0QA 2I07A 4L3EB 1YPZF 2MKLC 1IC7H 5EU7C 5A16A 2L0DA 1AO7E 2EE2A 2FBJL 4LU5L 3V6BR 5E2JA 1JGVH 2Y07L 1IGMH 1J0IA 4OFDA 3VXSE 1R3JB 1HILA 5D1QD 3GI9H 1U0QA 1D7FA 1VADA 4D0DA 2QQKL 1B2WH 1IQDA 1OCWH 4JKMA 3VMNA 5EU5B 3RA7H 1CICC 2IQ9H 3QUYC 4LQFL 1CR9H 1MFNA 2AJZB 5D96B 5CJQH 2ZOKB 1A22B 4NJAH 3WN5A 3D39B 3QIUB 2IG2H 5LJYH 3P9LB 3SDYH 2G75A 5DRXA 4G80A 3KPLA 4P23B 3SDDA 1U95B 4P5TC 2ESVA 4XXDB 1I3GH 1N3NB 1QRND 4G6ML 1CE1L 3BKCH 3HE7B 4ZS6C 5FKAB 1NGYB 5EWIL 5I1GH 3MJ8A 4OKDA 3I3EA 3G9VA 5CD3A 4HD9A 1EEYB 3O6LL 1GC1L 3CSYB 1OAZL 2F53A 3QXAB 4JQIL 1SMAA 3O8XB 4ZXBC 1IFHL 1MREH 4GRMA 5LCVL 4LDOB 3LHPH 1MWAH 1KJ3L 2XACC 4GBXC 1EX0A 3SGDI 4NO5A 5BMFH 2AJUL 4FQIL 3P9MA 3VXSA 5B39B 3OR7B 3WIHA 4V1DE 4G42A 1FN4B 4Z7WB 2ZJSL 1C7SA 3GSUB 4M7KH 4P49A 5AWNH 1RMFL 3NABH 4O9HL 5CS7A 3PDOA 2ZPKL 1GGIH 1MCNA 3C6SA 3ZHKA 1JF1B 3MRBA 3PHSA 2XWBB 4P2OB 3TZVB 1NSNL 4QLRA 4QRQA 4KI5C 5IG7A 4UT7H 4N5UA 2P7TA 4R4BB 1KYOK 4Z9KB 4GAJL 4L8DA 5I1KL 1FNEA 2VQ1B 2JCCB 1KCRH 5LBSH 1VENA 3HHRB 2EDRA 5IJVA 2B8OT 1TVBA 3ZSTA 2DWDB 3FQNA 4NOFA 3Q0HA 3IRZA 3T4AB 2VQ1A 4PLOB 3ZT5A 4PBVC 4ZOAA 4G7YL 1JHKL 4XRCA 4I18A 5I15H 4UDTA 4U2ZA 5MEOA 4PGBA 5SX4H 5L88L 3VWJA 2XN9D 5DSCA 2QQNL 1UJ3A 5LAXB 4Z7VA 4R0LB 1OLZA 2B4CC 4MD5A 4QXWA 1S7VA 2VLJD 1FE8H 1HH9B 1RZFL 4H26B 4JFOB 3S96B 4BH7A 4L5FL 4XTRD 3O3BB 3LAFA 3S34L 3GJFH 4CMMA 2NZIA 5HGGS 4G42B 1RZIB 1WFOA 4Q58C 4KJYA 2F58H 5B38A 1OAXL 1Y18B 5MERA 1DP0A 5KS9B 1CYGA 2BJMH 4JO2L 1QZ1A 4LLQA 4HUWA 3UJTH 4E0RA 2XWTA 1IAKA 5SWQB 5JHDB 3S36H 5GISL 4OZIE 1EO8L 4JY6B 2NY3B 3MJ9A 2R29H 1LEGA 3UMTA 4P4RA 3RVTC 3TBYA 1BM3H 4QTIH 1DDHA 2NTFB 4YXHH 5IMLA 4N0UE 4QT5B 1I1YB 5A2IH 4M4RA 3RWIA 5JLZA 3QEQD 2AKRB 3Q1SL 4O5LH 1ZWIA 4XHJC 1BQHG 3U1SH 5KANI 3DVNA 4N8PA 3VXRA 2P5WB 3MMEA 4R3SB 4BKLB 4APQC 1BOGB 1EVTC 4K9EH 1A1MA 3TH2T 2YPLD 4PRBB 3J8F7 4DKEL 2YPLE 3WJLA 3T08A 4LEXL 4ONFH 5C0JA 3BESR 3MYJA 5HHOA 3SGKA 4PJDE 2JJSC 3U48A 3RI5K 5F1IB 4JKWA 4G9FA 3THML 4TOYL 1Q9KB 2H2SD 1URLA 3HFMH 3IXTA 5H35A 4WI6A 1S7WA 4U1SB 4RMSA 5BQ7B 4IRZL 3BKML 4XZUB 4KRLB 1CWVA 3TBYB 3IU3B 3WUWB 3BQUB 1ZT7B 1WBZB 4HUNB 4E41B 1NCWH 2HLAB 4Z78A 3C6LB 3QCTL 3SPVA 2PCPB 2MSPA 2OI9B 3L3KB 3VXQB 3ZDYF 3QUYA 3MLPA 1QFWM 4EI6A 2V7NA 3GMQA 4EOWL 2Y7QB 4OUUA 1AHWA 1QYGL 2ICEA 5GRVK 2NTSP 5FYKU 1IRAY 4KUZL 4ESKA 5C0NC 2Z8VC 3ZE2F 5AYUL 4DGIL 5EOTB 6FABH 2DMKA 2YMXH 4C56B 1NAKH 2FX9L 5GS0C 3VGFA 3H9HA 1WCQA 3OGOE 5IFAH 3B8SA 4XHJD 5ABDE 5F3HA 3O4OB 4PJBF 4JY5H 4U1KA 5B39G 3NCJL 3FJTA 3UBXA 1AGDB 5HHNB 4JFYB 1JZ5A 4QTHB 2XRAL 1IT9H 1TZGH 1HHIA 2PYFA 2YPVL 1KTRL 4WFHD 3EYVB 3VGEA 1CG9B 2MJWA 1RHHB 4ZUTA 2GFBB 4Z77A 1A21A 3CVHB 4PJ8A 4XCNB 4L8DB 2BOBB 2X6MA 3ULSA 4XWOD 2B20A 1X5IA 3U0PA 1WWCA 4GS7C 4HG4J 1FL3B 3G5YB 3MJ9H 4JDZB 1NMAL 1S8DB 1HHKA 3HE6C 4JN1L 1RURL 4YHPA 2R0LH 3DPBA 4HC1L 3C5JA 3B2VL 2IH3B 3DYPA 4IOSD 1IC4H 4BJLA 4I2XB 1RZ8A 1A9EB 3CXDH 4LSSH 4YHNA 4D3CL 3MRCB 3QEHA 1YY8B 5KSAA 3BP7A 4JVPA 4WU5B 2D7QA 2YPLA 2A0LC 5D7LD 2DQJL 2BNQB 4MAYA 5CEZD 3JV4B 5EBLB 5BRZE 2EEBA 4ELME 3SE8H 5BZDA 2VXTH 1DBKH 3VFSB 3KJ4B 4LL9A 1LK3H 3H7LA 3OF6A 2A83A 4ONFL 4Y2OA 2WNGA 5HHOD 4OZFB 4ZUTB 1AGEA 1KTKE 1OAUL 3QQ3B 2JJWA 4K94L 4DK3A 2CKBH 2BDNL 5IMLB 4JFDE 4U6HA 3CFDB 1YN6A 5HBBA 4JFPA 3G5YA 3HMXL 4DFHA 5ILTH 4DN4L 2HMID 3QG6B 4XPGL 2V5YA 2VE6A 2BSTA 1C5DB 1QFWI 5HGHA 1RK0B 1KIRB 2Q76B 1HI6B 1MY5A 3ZKXB 5DMYA 1BGXL 1U91A 4ODXA 4MA7L 5EUOE 2E5EA 2GTWA 5I8CA 1ITCA 3IDNB 4D0CA 3KXFE 4ELKB 4PRBA 1XGTA 1N7ML 3KS0H 4X80L 5FUZL 2XZCL 4U1MB 3QWRA 2JKXA 5KVGL 2R29L 4HKXA 2P4AB 2OS7A 5CJ8A 5ISZA 4MQXD 3FRUB 1I85C 2A73A 1ZVSA 2PW2B 1T83C 2ZSWA 3RVXD 4FP8H 3C60D 4K9EC 2W0PA 3SKJL 3D0VB 4WI3A 3HA0A 4PJIB 2BRRL 5DC0A 3TC9A 1KELH 4HJJH 4YGVA 1I9IH 4LLYA 1ED3A 2DN7A 4PLKC 4F33A 1MHPL 4AZ8A 5IW6A 4QY8B 1KIQB 1T5XA 2X4PB 2XN9E 2Y06L 2O5YL 4OAWB 4LCWD 3UO1H 4OUOA 2Q8AL 2ZWLT 3MV11 1I8LC 1T80A 3BKYH 1XZ0B 5GSRA 3REWB 5C8JA 4XPAH 5IWLA 3K4DA 2ATKB 4XPHH 5HYQA 3UZEA 3LCYA 4GW5B 5GGSY 1QKZL 2C4FT 3AREA 4NKOA 4FQCL 4L1DA 1C5BL 1JHKH 3EHBC 1LO2L 4I0PA 4LCIL 1TNNA 3TJHD 3WNLA 3W9EA 3VWKC 3CFJB 3HC3L 1WC7B 5IB3B 3EOBA 1BVLA 3BWAA 1INDL 4C4KT 3KHOA 4LQ1A 5K9OB 4UT7L 1PY4A 4Z76A 3S3JA 2CUIA 4RGNB 5DJCA 4D8PA 5IJKC 1HNFA 4BFBD 3MUGA 4PGCB 5AWNL 2IPTH 3GSNA 5FCUH 1IAMA 4IRSC 3T3ME 1BIIB 4PP1D 3JBG7 1D5IH 5EA0L 2PKDA 3BGFC 3BOVA 1KJ3H 4RQQB 3ZHDA 3FQWA 4X0KA 3FKUS 2BC4A 3MNWA 2Z4QA 3RDTC 3B3IA 3BHBB 3HN3A 3WN5B 1A6AA 1JNJA 1P9MC 3ARBD 3VXSB 3TIDA 5GS1C 3VG9C 2MFNA 3BKCL 3ARGA 4PJ8C 5KANG 4X98B 4M4PA 4NQEE 4W81A 3BJ91 1OT2A 4QXTA 1ERNA 4RAVA 5IEHB 1R3HB 5LQBL 3DO7B 3GMRB 5HSFA 5J06A 4LARL 3CXHK 1F4HA 5FCSH 1V05A 4LGSB 5DC9B 3SO3C 3EW3B 2WLZA 3QWRD 1UCBH 2IQ9L 2Z8SA 3CVIL 3I6GB 1OCWL 4FFZL 4J3WA 1IAIL 5SWSE 3TCLA 3HNTL 3W11D 4JPWH 2M2DA 5TF0A 1AI1H 1XIWC 4M6AA 3WDJA 5F9JA 1AGEB 4W4OA 3HPLA 2AJVL 4GW1B 2HMIC 4M6NL 3DIFA 4DJMA 4EDXA 1WWBX 4Z5RB 2ZOKA 1OM3H 3MNZA 2YD5A 4RMVA 2D7OA 2CDGB 3F7RA 1QP1A 1JV5B 5D1QB 5DFVD 1TJIL 4FQHA 1L9NA 1GL4B 3GMPB 1U2CA 4X6DB 3L3DA 1IC1A 4PJFB 2HVJA 3BXNB 3FMGH 3TA3B 1IZJA 5LQBH 4ONGL 3QHTC 3GMPA 3T2NH 3TA3A 2YBRA 5IHZA 5DUBB 4RX4D 2ADFH 3BISA 1VEPA 5HVHC 4MVBD 4MDIA 4KC3B 2D4FA 3I50L 5D2NC 3QDJB 4H1LA 3RY6A 4OF5A 1LP9E 4OLEA 2XZAL 1F3JA 2X41A 1ZHLB 4NHUB 3ARFA 3EO1A 4Y5VA 5B39A 2CDEB 2VTFA 1HXMB 1DUYA 5ESVA 5E7FA 1A6VH 2WWKO 1NL0L 2YK1L 4JM2F 3BWUC 2Q3AA 5F1NA 1D9KC 5E56A 1DZBA 1FFQA 2CSPA 3V4UL 4U0RB 3LKQA 3AGVA 4DFIA 3MRKB 2D7TL 4Y0GA 2ZCKH 1CLOH 1BP3B 1A7RL 3K3QA 1AQDA 5FA3A 1T7YA 4Y2DB 2XTJE 1W0YT 2DQGL 1AGBB 4QCIB 3C60B 4J3VA 1X7QB 4NQEB 3KR3H 1SJHB 5EIIA 3I75A 3SCMB 2H32A 3OX8B 1UB6A 4MJ4A 4Y1AE 5HDQH 2DL2A 2WIIB 3KDMA 2X7LA 5BVPL 2P8MA 2N56A 4ETQB 5EU4A 3UTTD 4QEGA 5L2KB 1ZK9A 1FORH 1OSZB 5I9QB 4OLXH 1MAML 5KAQG 4YDLB 1S7QB 2LU4A 2NY5C 5J1SC 4HKBB 4UT6H 3MRFA 1E28B 1ODAA 4K3EH 4BZ1H 1X5ZA 3GSNB 1CFBA 1PG7W 1XCTA 1YN6B 1MHPH 1PZ5B 1Y6NR 2DJ4A 4IOIB 2O61B 1I9IL 5F9AC 2QTEA 2W9DH 2XA3A 4J8RB 4LNVA 1KLUB 3RHWF 1QLEL 2HTKC 3CUPB 5AYQA 4CBPA 1IM9D 2VXQL 5HHOB 4Z8FL 3TPKA 3OAZK 1I1AD 1CD1A 1DN0B 3U36B 1CDHA 1G6RL 5EZJA 5CZVL 3FQTB 1Q38A 4JO1L 4QRSA 3VI3F 3VFGH 5TF1L 5D70H 5KVGH 2BNQD 3ZTJG 4ODTH 3C08H 4DKFH 5I30H 2VN4A 3F58L 4XX1G 4MS8C 1QSZA 2ZUWA 4GKNA 4Y19D 1JGEA 5J6HB 3OR7A 1RZGA 3FB5A 2IALA 3OKNA 1J10A 1FJ1B 1F58H 1I8IB 3LN4B 4LNRA 5TQ0H 3EFDH 4M3KB 2I07B 1P4LB 4FQ1L 5JMOC 1DBAH 2A1WL 8FABA 3FAXA 4NSKA 4LVOB 4OGYL 5CKAA 4W4NA 1IAIM 5I71B 3DTXB 1XR8A 3MLTB 4XCYA 5FFLA 5B38G 1JRHI 4FQ2L 3FOLB 2RCSL 2NY1D 1OAKL 1OP5H 4XTRC 1NDGA 5CSZB 1P7KB 4MYWB 3RVUD 2OTWB 4ZO8A 3B5GA 3TYGH 2FZ3A 4ZSOE 3BZ4A 5KSBB 5JPMA 2Q87A 5HXMA 4JFYA 1A7OL 2K9UA 3BYTA 3IU4L 4KHTL 1DN2A 4TSAH 3QCVH 1GZPB 3O11A 4Y8DC 1NLDH 4HIIB 5CEYB 2BCKA 1HH9A 3BP6A 4GO6B 4C56A 4AIZB 2W59A 1EAPB 5EOCH 1NC4D 4P9HC 2WLYA 4ISVA 3B2VH 5EU6B 2R0WL 4UILL 2D0GA 4KI5E 2FCBA 4NQSB 4RGMB 4OD1L 1W0WB 4NKIH 1X5XA 1A1OA 3HNVL 4NOBA 1VFMA 4NFBA 2XPGB 4PY7A 3DVGB 2UWEF 3A0OA 2NZ9C 3MRNB 2DIBA 3O3DB 4XCFH 4R96B 1AKJB 4KHXH 3LSOB 5INCA 4R97B 1SYSB 3VG0H 5ID0A 5EFIB 5DK0A 3LEYL 3NN8B 3I84A 5IB4B 4YXKH 3NACH 4PB9L 3ARFC 4J4PD 4PS4H 3DRTA 2E6QA 2JB6B 1R0AL 4P59L 2VZTA 4XP1L 3PWUA 4WIQA 4P2QB 4AEIH 4ZG1A 4UB0L 5ESQB 1KOAA 4GW4B 2DQIL 4ODUB 1NGQH 1NGQL 1EAPA 2DQIH 5M94B 3D0LB 1NCBL 4NN6B 1I1YA 5J4MA 2LTQC 1KTDA 3MBXL 3RWDA 1UH4A 1JWSA 4UV7L 4ZPVA 2XG5A 3T65A 3SDCA 4LRIA 3LEXB 1EJ6A 3QCUL 1RUPH 3VXNA 5I8EA 1NQBA 3MV9A 3TWCL 2P5WA 3LEYH 3QDHA 4LCCA 1MY7A 5F9JB 2CPCA 4Y4HC 3P4LA 4RA0C 1WAAE 3WFEL 1OAQL 1VACA 4UU9A 4WV1A 1KJMA 5IGXH 2OTPA 3MV9B 2HP4A 1DQLH 3HS0B 4PBWD 2AJZA 3WXWL 2CIIB 5CGYD 1RIVL 2AEPH 1KNOA 2UVFA 3WFBL 1MFAL 3IFNL 1UACL 3H2WA 1CQYA 3ULVD 4DKAA 3ULUF 5AZEH 2ICWI 5IK3A 1X5JA 5IMMA 1BD2B 4QXGL 3M1BB 1ZGLA 4DKEH 4H20H 4L4TE 1A6UL 3BIKB 4NO0B 2YSSB 3D69A 3QQ9D 3N9GL 2BK8A 2OTUB 3FOLA 5JIHA 1MLCA 2JJSA 1A4JB 4U1JB 5CGTA 3V9FA 3WUWA 5EPMB 3EJZD 4H88L 3MZTA 1B3JA 3IETA 2QKIB 3RTQD 3UBXG 1OY3B 4YBQD 4PRPB 4ZAKA 3LKQB 4G9FB 4LSQL 1T2JA 4F7TB 4PJ5A 3GKWL 2HT2C 1DE4A 2WUBH 3VFMB 4DVBB 4EI6B 4EUPH 4XCCH 3JV6A 1Q9LB 1PKQE 1EO8H 3VFNB 2GW5A 1JRHH 2PYEB 5C0JB 4CMHC 3QDMB 4FQXD 4IS6B 4R4BA 1HH6B 5FKPB 4N1CA 1INQB 1XH3A 3WHE1 5K9KA 3MLYL 2BSED 1Z3GL 1LE9B 5EC1B 3KPPB 4P4KA 1JGUH 1CGYA 4OGZA 4TPRL 4UAOB 1W0WA 4ODTL 3B6SB 5T3ZD 3VG9B 3GHEL 1FVCA 3DXAB 1JPSH 4GW5A 1XF2A 5BS0A 3FONA 1H3PH 4HH8A 1I3RA 3LKNB 2J6EA 3BIAX 5IBLD 4Y4KB 5EUOF 2AK4A 3TNMA 1CFQA 4AEEA 1DUZB 4UBDC 4JN2A 5D6CB 1NCCH 2BNQE 2VZOA 4H1LH 1FP5A 1MOEA 2Z93A 4PJ7E 4K7PX 4NZJA 3EDJA 5CIPH 3TVMA 4WCYH 3S35L 2VH5L 5C9KA 2VLRA 3LN5B 4Z0BH 1QR1B 4LP4A 4KFZC 5C0AE 2B5IB 2FIRT 4NT6A 4D8PB 1GXEA 1IAKB 2IFFL 2ED7A 3V0WH 5I8KH 4YDVB 3LQZA 1H5BA 5B8CB 5HHNA 4OLXL 3QT2A 5HVWA 3GIVB 1ZVHA 3JUZA 4V1DD 1FORL 1TQBB 2ZKHL 43CAA 4M8QB 4F7PA 3B8YA 3SY0B 1EGJH 1MCBA 3N1PC 1M71A 3BPNC 1BJ1H 4FQIH 3UPRA 1X5GA 5M7QA 2OBGA 1EBAA 2CMRL 3DVFA 3HE6A 3C9NA 2CK2A 1LK2B 3WIIL 3S35H 2NX5D 3WHXB 1Y18A 5MERB 4PPTA 1DLFH 4J6RH 4C58B 1DANU 4IDJH 2Y23A 9CGTA 3UCRA 4LCUB 5E2VH 4QRPA 2HKFL 3EOYG 3AUVA 1F90L 3VFRA 2LU3A 1WZ1L 2BVOB 5ADPH 1JPSL 1NMCC 2W1NA 4JG0H 4C57C 5DHYB 1QSVA 2E27H 4FXKB 4CW1B 3L3GA 1JYVA 5INDB 2UUDH 3GIVA 2NLJB 1E4KA 4AIXA 3T0WA 4OV5A 3WS3B 4RWYL 3KYNB 2DBLL 3B9KC 4OZFG 1BD2E 4NDMA 5KVMC 1IGML 3L3HB 3IF1B 3S98A 1MRFH 3C6SB 2GJZA 2JIXD 3N85H 1T1ZA 1T22A 4JFEA 3QG6A 4MMZC 4HG4K 4XP5L 2P5EE 4KTYA 1MJJB 1Z0NA 4LCUA 5ID1A 1HXYB 2CO7B 1VGKA 2YN3A 5F21B 2X2YA 4RCAA 1RAMA 5BOZG 4B7IA 4PGJA 4UDUA 4AG4H 3P40A 2EDEA 1AE6H 2GSGB 4QO1A 1UB5A 4JREC 4A2LA 5IB2B 3LQAH 1EV2E 4F2MA 5ITBL 1YYLL 4W6YB 5GGRB 3SE9L 2BY2A 4QXGH 1BECA 1T1ZB 3RRQA 3S37L 1NFIA 1FYTE 1G7HA 4EQ3A 3LKSA 4JG0L 5FECA 4YK4C 3T0AA 1U8NA 3UP1A 3BWAB 2HKFH 3CFBB 4V1DA 1WISA 2FX8L 2MQ3A 3PNWB 4XI5D 3I2CL 2XQBH 4JHWL 2IPKB 3FHAA 1UEMA 3V79C 3RUGB 1KC5H 5DLML 1TFHA 2AQ2A 2C1PA 4NM4H 5JA9A 3MLVL 4X4YA 3MZGB 1KCVL 4OCMC 5DHXB 3IDUA 4LDLB 3EOTH 4QOKB 5DFVC 3EOAA 4K3GA 3MRLB 5DURD 3QCUH 4Y4HA 4JRYD 3O2VL 2LFGA 3RVUC 5J6GB 3OHXB 5GGVH 5EZLB 5AD0B 3M45A 1J0JA 4U1LA 4PJEE 4XBEH 1HKLH 4M00A 4ORGB 1ORSA 4DKDC 3U6RB 4DN3L 3G6JB 1R6VA 1NCTA 5KSUA 4F8QA 1L0YA 3UPRB 1T3FA 1YY9C 1UA6H 4Q9CA 1INDH 1FLTX 32C2A 1HK6A 1U8QA 2F54D 5GIRA 4Z7WA 2FYYB 3BIKA 4LCIH 4YLQT 3RY4A 1CLZL 4WWKC 3ESUF 3SOBL 3TO4D 3OPZH 4M5ZL 1FFRA 3RNKB 5EH1A 2D9CA 1FVEA 3D2UD 3RPIB 2YEZA 1I7TB 1D5BA 1YMMD 1CLCA 1BIHA 4NKIL 4QNPE 1P4BH 3RJDA 2PXYB 3VXUD 4PJEB 4Z6AT 2DICA 4JFED 4R9HA 2J8HA 3FTGB 2Z92A 5GRYA 2GSIA 2OR9L 3QEQA 1QTYT 2VSDA 1F11A 5ACZB 1BVKA 1Z3GH 1OF2A 4JGJA 5C0AB 1KCSL 4JE4B 2P8LB 4NGHH 3VFPB 5BO1L 3WE6B 5ESQA 3MCLL 1SY6H 3B2UD 3OKEB 4XBPB 3CK0H 4D0BA 4XPTH 3GNMH 4WWKA 4LP5A 4YHIA 4HF5L 2VLKD 4XCCL 3BEWB 1QA9A 1IQWH 3O3BA 3SDXF 5F44A 2WUBL 1BQSA 1RJZA 1U91B 1OHQA 4Q9RL 5BVJB 1D5ZB 1TJHH 5D7IB 3ARDC 1PEWA 2EDWA 3BH8A 1ZS8A 4Q2ZA 1M4KA 1EK3A 3EDDA 1F3RB 1RD6A 2VN7A 5HYQB 4L4VD 3QFJB 4GMTH 3DV6B 1YPZA 4S1SL 2IH1A 5HJ3A 5DI8A 5D2NA 3BPLC 1G7MA 1V7ML 3MV8E 1ZLVH 4NUJB 3IFOA 1A3LL 2VLLA 4UU9B 4WV1B 2XKSA 1CL7H 4NKDA 1A6UH 3DSFH 1NBQA 2NXZC 3OAYK 4PJIA 4QRPE 1EZVY 5DHVA 3WHE0 5DUPL 4KJPD 2A6KB 3BH8B 5I1LB 2EZ0C 3MXVH 1TPXC 3QIWD 5HDBF 4J2XA 3TZVA 1G9MH 4YZFE 4F7EA 1PVHA 1JN6B 1UACH 1MCQA 2XPGA 3CFBA 4WWKB 4L3EE 1I1RA 5IMMB 3QUXC 3MRRA 3M1BA 5C2BH 4HXBH 3B83A 4X6FA 3QNYB 4JKLA 5DJAA 4AM0A 4BELD 5GS1B 3H7BA 5T3ZE 2DI7A 4U1IB 4JCLA 4M7LL 3VJ6A 2VDLL 4XMKL 1Q94A 1LEIB 3DRTB 4M02A 4Y8AA 2NTFA 1P1ZA 5HGHB 1NLBL 5DHVH 1HHJB 1J1PL 5HY9A 5DSCB 2VB5A 4X5XA 5BOPA 43C9B 5ICXA 2CIIA 2VISA 3KGRA 3OTTA 1DQTA 5FGCB 2F74A 3NGBC 3B9VA 2R4SH 1DANT 5CKGA 1BX2B 2EIBA 3HLAA 1G7LB 3HUJE 2F74B 3X11B 3QI9A 3E2HB 1A6PA 3ULUE 3JWDC 3W2DL 5FYLH 5DMGC 5I1LA 5IBUB 3SDCB 4QT5A 3TJHC 3KNBA 4GKNB 3L95A 4S1QL 2YPVH 32C2B 5BVPH 3K80A 4XP1H 4X5XB 4KVCL 3CFCH 4HFWA 1HSBB 3O2VH 4N0FB 1KENH 2R8SL 5ADOH 1WICA 4G7VL 3MLRH 4KVNH 2EDYA 1T3FB 1P4LA 5ETUB 4XMPL 4MNQE 4PR5A 3CFKB 1WAAF 4NO3A 2PXYC 4H5SA 4DGIH 6FABL 3VXRD 3UEZA 3FB5B 4WWKD 3NZ8A 2C7UA 3LPFA 2ICWA 2R1WA 1BJMA 1MCCA 2EKSB 4GXVL 4ZUUB 1JV5A 5F88B 2FR4A 4YBHA 2NW3B 2Q6WA 1ZV5A 4NUGL 4KROC 3RX7A 5CJXC 4OLWH 5L8JB 5EU7E 5EZJB 3MLTA 1AGCA 1PKOA 5CZXD 3CC5A 3TPUA 1N2RA 2XZAH 3C09B 2X10A 4PY7B 1T03L 1S9XB 4D9LH 4PJ5B 3CX5K 4PG9B 1MVUB 1HE7A 4G8GD 4ZNEA 3GJFA 4GKSA 4LLWB 4KHTH 1S8DA 2Z0BA 2IADA 3NIFF 5B21A 4KXZI 5IFJA 1I7RA 2JB5H 3O8XA 4HS3B 3FMGL 3PV7A 1M71B 3AM8C 5HHPB 3BP6B 1QBLL 5AG8A 3I3DA 1II4E 3FO0L 1QFPA 3EYVA 5HYSA 2JTDA 3N85L 5E8EA 3QRFM 2DQTH 3D3VB 1FFOB 5GJTH 5F97E 3RVVC 2VL4A 4LVOC 5DVNA 4FQ1H 5TE4H 3MRIA 4NQDB 3GSWB 3C60A 1G6RA 4Q6IB 3PF2A 4UOW0 3RUGE 4PJ5E 3IRPX 3BX7C 4K3JH 4XX1E 5A3IC 2F8OA 4RISL 4NZTH 2G9HB 1JZ4A 3F58H 3RQ3A 1HCVA 2E27L 4P46B 4U1LB 1I8KB 3FQNB 4JANB 4XCNA 1YEGL 2ORBH 1KJMB 3QB7C 1RV6X 1QVOB 1U58B 2NY4D 5D1XB 3RNQB 5KZCD 3NH7L 2E3VA 3IDJB 4KZEH 5E2VL 3UAJD 3KPOB 5F7LB 4G6KH 4HEPG 1AXTL 3MRPB 1EHXA 1R3LB 1DL7L 5F93C 2ADJB 1A0QL 3JWOH 4P23C 3SKMB 4WFED 3R4DA 3P77B 4NQDE 5KVFL 5CJOL 3KLHC 3H9SB 1AC0A 5EA0H 4LLDA 2BNRE 2R9HD 1G7JB 1YEKH 1EGJA 5INDA 3GJFK 3LB6D 1QPPA 1R5IB 5LGJA 5DUML 5IOPA 1KF9B 2CLVB 5C0FA 4GRLD 1HWHB 3K2MC 5HVGB 4K2UH 1H5BC 4Z5RA 3L7EB 1S7UB 3PIQB 4PJBA 4GAJH 2VABB 4GUPA 4WO4C 4YAQA 4ODSL 3VFTB 5GJSL 5J9PB 4UNTA 2BSRA 1J11A 4JFQB 3X12B 5IFHL 3NABL 4ZS7H 3W39B 4MAUL 1EUUA 4JFFE 4OI7A 4JJ5A 3IDNA 4B53A 4D0CB 3T04D 3ZDZF 1R5VA 2HTLD 1D9KB 3RL1B 4XP6L 1UCTA 4PJCA 4KH2A 4CU6A 4Z7WF 4GOSA 1P84K 3T2QA 3UO1L 5JIPA 1IFHH 1LDPH 1U8MB 2VSCA 2Y06H 1IEHA 3WS3A 1EPFA 5F72S 1HQ4A 2NY7H 3PV6A 3SKUD 5JW5B 5CZXC 2JELL 3HPJA 3V52H 1UKSA 3SQBA 3QZWB 2DLHA 5IB5A 4RMQA 4JGMA 5FECB 4TYUA 2PO6A 3H3BC 5KSBF 2R23A 3FO2A 2NY1C 5C7XH 1J5OH 5EO9B 2W07A 2DWEB 1UM5L 5E03A 4TTDC 5LKNA 4P5TA 3V6ZA 1UJ3B 1A14H 1QFUL 3WMSA 3TVMB 1T83A 3GKWH 3PWVB 5FYJE 5HHXL 1R3KA 2FGWL 4R7DB 3IAGC 5IT2H 1QFOA 1U8MA 3FFCE 5GS0L 1MCDA 4KKLD 2VDMH 4PRIB 1TJIH 1LO5B 3QP3A 4EI5B 5IFJB 4Z76B 4LF3A 1XGUA 3GUTA 3AREB 1JI2A 2E9JA 3X3FH 1M6OA 3IKKA 4X99B 3MFFA 1CL7I 4X5WA 4XNYL 2VITA 4YHLL 1CE6B 4M6MH 1FHGA 5GSRB 3EYUL 5CZKA 5DDHA 1S9YA 5FF6A 2FH6A 2VL5A 5D4QA 1QPXA 1N0XH 3LY6A 4Y1AD 4H20L 1ZHKA 3HI5L 3KPPA 1F45A 1IAIH 4P4KB 4L9LA 4RQQA 4FQLL 1FDLL 5FF6B 1NFKA 1PQZB 4JR9H 5TDPB 3VE0A 4OZ4B 3LQZB 1UEYA 3NCCB 4CN4A 5HYJD 3LIZL 3IS0X 2MMXA 2OM5A 5TFSH 5KZCB 5D1XD 4G6FB 5F6HJ 4IOIA 2O61A 2DQJH 1K8IB 3B5HA 5C0GA 3UC0L 4LSVL 2NX5B 3HMXA 3NAAL 1DQLL 4CL7A 4HDIB 4D3CH 1LK2A 3QHFL 4LSSL 3OZ9H 2CLRA 1T1WB 5JW4N 1H3WM 4YHMH 4G6JH 2QSCL 1U95A 1RK0A 4QRRD 1RURH 1FNLA 4XAKD 1PX3A 3QQ9C 1H5BB 4JFHD 2R2HA 3MRHA 3FQUA 3L9RA 4BQCA 2OQJB 4P48A 1L7TH 3WHXA 1SBBA 4WUUE 5JW4Q 4BQ6A 2Z4QB 2YXFA 1WSST 1QR1A 1W72B 5HDOA 1RJLB 4LSTH 1AGCB 1T1WA 4QOKE 3IDGB 4NN7C 4OFIA 5DRNA 2Y25A 1DQQB 5I1DA 1T0PB 3ARDA 2NY7L 1VFAB 3X12A 2VDOL 5C07B 4RAUA 4Y4KD 2EDJA 3VFVA 2EDNA 4CW1A 4MZ3A 2H3NB 3MRCA 3QEHB 3RI5F 4KHXL 1NKOA 2GT9B 3OG6B 3TBSB 1I1AA 2WBKA 4F7MA 3BD4A 5E4EC 1XAUA 1RZ7L 5C1MB 1BQHA 4LVEA 1CVRA 2J8OA 2VXVH 2EC8A 1TCRA 1MHHA 3ZTJH 1S7RB 1BQHB 2BVUA 5ALBL 2WBWB 1O7SA 5F1OB 1OPGH 2PYEA 4B5EA 4HJJL 4XBPA 4LLMA 4IS6A 1JIBA 4IRSA 3QNXB 4GG6B 4XPFH 4NUJA 3KJ6H 1CGSH 4G9FD 4WO4B 4CU7A 3TO2A 3MV8B 4TOYH 3EDEA 4M8VA 1BJ8A 3JV0A 4LK4A 4ELMF 4NC0B 4V2CB 3L7FB 1P5UA 1TNMA 1U41A 3KPRB 3U0WL 3WLBB 4ELMA 1IGTA 2XTLA 2HAZA 3D25B 3PUCA 2XWTB 5F6IC 2Y9RT 4M93C 4P99A 3LZFH 5FV1L 5J11C 3QAZC 2W60B 4XPGH 5KSAB 4M6OL 1KACB 4UIMA 5ILTL 4H5SB 4Z0XB 1JHLL 1NCDL 4I13B 3JSSA 3OX8A 4ONHB 3IAQA 2FIKB 3NCBB 2OLDA 3UTSA 2F19H 2EO9A 4MNQD 5FUCC 5C0EA 1J8HD 4R90L 4JFZL 1KN4H 2V2WB 4C54A 3E6HB 1W72L 1FL3A 1RZJL 4D94A 5B8CA 1DBKL 2NY6C 4WO4A 4PUBL 1S9WB 4P2CG 2CJUL 2J7LA 4JO1H 1YEJL 2F8XC 5J6GA 3KHQA 5FYKD 1JYWA 3L5WB 2WWMD 3DGCR 4Z8FH 4MJID 1P7KA 3U4AA 2CRYA 2Z93B 2VISB 4LRNH 1Q0XH 1TDQA 3ARDD 1JK8A 5F96H 4EN3C 3S34H 4OF6A 3REVB 3ZYOA 3WNNA 4LAQL 3FL7A 4W6XB 5E8DL 4YIQA 3LN4A 3WLWD 3CFKA 4GS7B 1UGNA 2ITDA 5MENA 2VLME 3GGWB 3T0XA 4L4VB 1TITA 3K7UA 3MGOA 1B0GA 3LQAC 4OFKA 1P69B 1ND0A 5IB3A 4OFYD 3W0WD 1JNLL 4N0FA 3MRGA 1ZSDB 3QUKA 4O4YL 2DM3A 2AGJL 3O3AA 3O6MH 3VMOA 3MUZ1 4K23H 4R6UA 1CS6A 1V7NH 1NGYA 4P9ML 3MO1A 4YDLC 2MTPA 2R56L 1KG0A 3OWEA 5LWYH 4JY5L 4WEBH 5E95B 3WFDL 1KJ2L 5I66B 4J3UA 1NCAH 3HZMB 3MRNA 4TQEH 5SWSB 1W8NA 3QUML 4F58H 5ACZA 4XB7A 2Z91B 1SEQH 3QHZL 4FFYH 1J0ZA 3DGGA 2ATPB 5GS2H 1MJUL 4LAJH 2ZJSH 5L0QB 1MJUH 1XF3A 1UM6L 4ZTOH 4YX2H 4JFEB 6CGTA 4G5ZL 4LCYB 1LE5B 1NL0H 2YK1H 4XP4H 5IHUL 5F3BA 2EH8L 3D2UB 1G6RB 2AV1B 4YE4L 3RZCB 1A9BB 2GFBA 4JQIH 4X98A 2BOCB 4X6CB 3KLHD 4OZIA 2R8SH 4YNYA 4UMGA 1SM3L 4KK6C 3ORJA 4TULL 1VERA 2X9XA 1FNGB 3ZE0F 4G6MH 4G43A 5FYLL 4OSUH 2J8UF 5HHPA 4M3JA 2Q20A 2ZUUA 5EO0A 5KS9F 1CBVH 4NQCE 2Z31B 1T22B 2ICCA 4AL8L 5DJ2A 3HUJB 4P4RB 2ICES 3TO2B 3MV01 3GO1L 5MP6H 1CR9L 3G6AB 3BD5A 5JUEH 5KN5B 2A6DB 4M62L 4YHML 4HWNA 1HYSD 1YY9D 1WBXB 4L9DA 1JN6A 3EAKA 1RU9H 3BMVA 4JRYB 4M6NH 1GGYA 3S36X 1U8HA 1T1XB 1A2YA 1BEYH 4Y19B 1D3CA 4QOKA 3NAAH 5ECJE 3T65B 4BFIB 3WIFA 1SBSL 4H25B 3DWTA 4LSPL 1DVFC 2Y6SD 2VZ3A 4OD2A 3T0BA 3ZE0E 1JGLH 1HDMA 1K5NA 4BM7A 4QRSB 3FN3A 4XNZC 1YDPA 4U6YA 5BS0D 3P9WB 1UWGL 3RWGB 3IDJA 4OKVA 2VDKH 3SDAD 3MRQB 4I3GA 4L9LC 5DJ8A 4I0KA 3E6FB 3Q6FB 4OFYA 4PJAE 1ZA6A 1N0XL 2R1YB 4LHUD 3QO0B 5L2JB 1AQDB 4AMKL 5DJZB 3EYUH 4J23A 3SGKC 4MNGE 1OAXH 5SX4I 5C0BE 4YXLH 5GGTH 1CGWA 2APFA 1IQDB 4QXUL 4OF8A 3KNBB 1A47A 1R3KB 3MYZA 3QDME 2VKXA 4KKCC 2EDOA 3AU1B 5DQ9A 3WFCL 1F4AA 5I19L 2Z35A 1DLHB 4MB3A 2J3SA 2VDML 1L7IL 1UH2A 5L2KD 5ESAA 3JVGA 1ZGLM 3TCLB 3OBAA 5MEQB 5FDWB 1E4XH 5J13B 1A14L 1QFUH 2IANE 4HQQH 3GMMA 2VDNL 1IC5L 5HYIA 2AJSL 3SCMD 3NIDE 1IKNA 4YUEH 1NBZB 5I1AB 5IQ7L 4MA3B 1EEUA 3V52L 1FBIH 4GJTB 1MAKA 3FOMA 4PGBB 2O5XH 4FFVD 3RZCC 1BBJB 1KPVB 2COQA 2EC9T 4M1GL 3SGDH 3W39A 2NXZD 1V5JA 2R1YA 2X1PA 1S78C 4H0HB 1AQKL 3TZVC 4HULB 1P4BL 1ES0B 1AGFA 3VD5A 2V7NB 3GMQB 5D1ZD 1EAJA 3T3PE 1KIPA 3MOBL 1JUFB 1DVFD 1VGKB 2Y6SC 3K8LA 3PWJA 4JFOA 5E8OB 1CLYL 1ROWA 3WNKA 5C6WH 4MJ2A 5FA3B 2AJYL 3V6ZB 2P7TB 4BZ2H 3BKYL 1FGNL 3G08A 1R3IL 3ROLA 3RWCB 1OGAD 2OXGA 2NNAA 1E0OB 2YHGA 2VDOH 2VLLB 5DR5H 2QADC 5IJVB 35C8L 5H2BB 5I6XB 1FYHB 3SKJH 2WINB 3GSRB 1ADQL 3MJ7A 2ARWA 5DVMA 1IC5H 3HAEH 3KYOB 5I1AA 4NKMA 2M26A 5DUMH 2IPUK 4HQQL 4U7MA 5EZIH 5ACMA 2HT3D 1LO5A 4LCCC 1YEKL 4DOHB 4QHUA 1JPFA 5DJYB 2HT4C 5F89A 1A6AB 1WFUA 2RR3A 3MOAL 1OB1A 4KMTH 2ED8A 4X5WB 5FYJH 3ARTA 3SDAA 2LQRA 2UWEA 3OXSB 4G80B 5I0ZA 3TV3L 2ADIA 3OZ9L 1QRNA 2EZ0D 3STZB 4Y7MA 1CD9B 2I9LA 2R4RH 2MHAA 5LG1A 3SDXE 4G6KL 3VXME 4KV5E 1YN7A 2WW8A 3TT1L 1T89C 1D5BB 1XGRB 1IC7L 1J9CT 1JL8A 2F53D 2G2RB 3BP5A 3GSWA 5JW4M 4YHYC 1REIA 1KBGH 3Q6GL 3HE7C 3WS6C 1KNOB 2ORBL 3ETBF 1FC2D 3Q5OA 3D48R 1H3VA 2UWEB 4ODUA 43CAB 3VXSD 1ZA3B 2A38A 3SE8L 2JJUA 2FO1A 3RX8A 1I9EA 5CEZL 2C9AA 3NCMA 1XCQB 3LQAL 5H8DA 5FOBB 2EXWD 4D9QE 5I1HH 4TTDD 2HFFA 5IBLC 5IVZA 2YS4A 4GUPB 3IXAB 3ILPB 1JPGB 1F02I 4QWWC 5EFIA 1JTPA 3MGTA 2P5EA 5T3XH 5CBAB 1NGXA 3UTPE 2BSTB 4UINH 4CJ0A 2BVQA 5JXAH 3IFPB 2PETA 3STZA 4IEFB 3ES6B 4RGND 4PRPE 3NCEB 3AM8A 1MCLA 2HRPL 1CDUA 1MRFL 1CBVL 2HH0L 1ZT1B 4OI8A 4JDTL 5FYLD 3LPWA 5EUOA 3QR2A 3RWJA 2YWZA 3A67H 5CWSA 4NBYB 1XEDA 1M7IA 4X7EC 2I5YL 4P2QE 4CAGA 3HZYA 1T4KA 1MUJA 1UQSB 1UWEL 2EYSB 2PW2A 2ZSWB 5KAQF 3UTSB 4OCXL 5LGJB 2JELH 1NBYB 3WJLC 5J12C 3GSUA 2YC1B 3WSQL 5K9KB 2ICWJ 3MX0A 7FABL 2J4WL 1T21A 3B9KB 4KJQD 5JZ7C 3U7YL 4YE4H 3DSNA 2DQCL 2IGFH 3PWPA 1IKFH 3KPNA 2N7AA 1OOAA 4YX2L 4ZTOL 2F5AL 1WCBA 3Q3GA 4U1HB 2EDDA 3G6AA 2DKMA 3GMLA 4NFDA 1UXSB 2V6HA 5F3HB 1LP9B 3OJVC 1RK1B 2R15A 4M1CC 3HG1D 5C0BB 3MTRA 4TQEL 4HWEH 1TQBC 4N1HB 4OD3L 2A74B 4ODSH 2AK1L 5ISZB 5B8CC 2SEBB 5D7KD 1ZVSB 4OZHB 4M1DL 3QCTH 5TQ2H 1BF2A 5E6IB 1KULA 2MQCA 5HHVH 3PABA 1YNKH 1QQDB 1QLRA 5IESL 1PLGL 2ARJB 1VKXA 1Q9OA 4GG8B 4WDIA 4CMMB 1F6AA 4N0YH 4QHUB 1OQOA 4U6XB 3CDCA 4XWGH 8CGTA 5F7MC 3NA9H 1IGTB 4K55A 3KXFB 4HIEA 1OQXA 4Z7WE 5H94A 3VD7A 3F7PC 4PRHB 2D03L 1TJGL 1Q94B 1LEIA 3QUZB 2VLRE 4OGXH 4OZGA 3KYOA 4I9WD 1QLFB 3S3SA 2R4SL 2QV2A 5E8DH 3IKCA 4APQB 3VWKA 1A9EA 4Q9QL 1M7DA 3VWJC 4P2QD 5DEGA 3V5KB 1A3QA 1DL7H 5DJ0B 5TE7L 2J8UA 3MRJB 3T0EE 1BLNB 3PWUB 4X0KB 3LRSB 4UQ3B 1Z2KA 1GGBL 3IJSA 3ZTNL 3W9EB 1A1NB 4IOFC 4NYLA 4KK8D 3EOAB 2EECA 2VYRE 4YC2C 4HXBL 3VFSA 4HCRL 5C2BL 4XMLL 5JA8B 1H3PL 4XVTH 3Q1SH 5D5MB 5C09E 3VFNA 1EFXB 1AY1L 1CFNB 5GZOD 1S7WB 1IE5A 4YQXH 4PG2A 4RISH 1Z9MA 1BLNA 4YNYB 2LU7A 5AUMA 2XZQH 3V5HB 4KZDH 3N1FC 1FFNB 3BQUC 4LGRB 4WW1B 4LLYB 3RVXC 1WAAA 5J1AA 3KVQA 4KDWA 5HI3D 4HBQA 5TH2A 3SGJA 4NM8L 4PJ9D 1QLFA 1JRHL 1FL5B 2ADJA 1RUML 3S88H 1A3LH 2FR4B 3C5ZA 4LIQE 5HTSA 5HGBA 4HFUL 2F54A 1TZIB 2VERN 2ICEB 3MC0A 1QBAA 4OTXL 5E1HB 2CH8A 4G9FE 5HI5C 2DJSA 4P5KA 3SO5A 1RZFH 5IHBA 2ZCLH 5HHME 4QHLB 5EULV 3T2PA 3WDIA 4ODVH 3O9WB 4Q9RH 3KPLB 4P23A 2GHWB 3U0TB 3HB3C 4GQ9H 3N9GH 3AAZB 2CRZA 2NY1B 3QISA 4HF5H 5ICZA 3GNML 5A43C 2HJFA 3RPIA 5TGBB 5DD6B 1VGEH 2VZ1A 3O2WH 2KBGA 3TJEL 2Z91A 3ZYJA 3QNYA 3IFNH 4HCRA 5FB8A 4CGTA 4OKVB 4L4TD 1F00I 1HSAB 3L5XL 1I1CA 2E9WA 2V2XA 1BOYA 1VFOA 2NR6D 2VLKA 4XBGA 4YO0A 3UBXB 1N59A 3DXAE 3VCLA 5FGCE 4P3WA 1KJVA 4ZXBB 1OWRM 1JMZA 1MHHB 3D25A 4MAYB 4FXGB 4MA8L 4WW2A 5JHDE 1H0DB 1OAQH 3BZFA 5F71A 3BI9X 2JF1A 4HK0A 3BQUD 3FN0L 2WZPD 1KN2H 3QFDB 4QYOA 5DD5L 1J0KA 1OP5K 3MLRL 3RTQA 3DV4A 3FN9A 5ADOL 3WS6A 5C0RL 5DUBA 1PZ5A 4W6WB 1H15A 5E9DA 4PJFF 4R0LC 4Y4HB 4ALAL 1HHKB 2F5AH 3DX6B 4Z95H 3GSVB 4TVPH 2CIKB 1X4YA 3BZFB 3QXDA 3OGCB 3TBWA 4FTVB 4PRHD 3CNKA 4UB0H 1L7TL 2EC9U 5MHSD 3U4EB 3X14B 3JTTB 25C8H 2MPAL 5JXEA 2YPLB 1VFUA 3GGWA 2V17H 3EOTL 2QR0A 2VITB 1F8TL 2WWKT 1KLFA 2LAGB 4UDUB 5I71C 4FZ8L 5IMOA 1KTLA 2QEJA 4OLZH 1JGDB 1JGVL 4NRXA 5LGHL 1FIGL 2KDGA 4J8RA 1P7HL 2FWOB 4JHWH 4LSVH 1HSBA 1WQVT 2OP4H 3EJJX 4NC1C 4Q97A 3HG1B 2YD7A 3CCHA 3HNVH 3QUMA 5D1XC 3BH9B 2PO6C 4CVUA 1B6DA 1RZKC 2Z8RA 4WJ5A 5IHLB 3OKDB 3QNZB 4QF1A 3SDXB 2GSGA 4X9IA 3S97C 1JBJA 3KYMA 1FH5H 4J3XA 2HYMA 1O0VA 3GMNA 3RWFA 1KTLB 4RA3A 1NEUA 1U9KA 4OGAC 3KYNA 4ZTPL 1F13A 1K8DA 3R8BB 3G6JF 1NLDL 1OL0A 1AJ7H 1G0XA 1NBYA 3MUHL 3RKDC 1CTOA 4KK9C 5FYKH 1A7OH 5EU5A 1U8QB 1SEBA 4CKVX 3TFKD 2GJZB 1KSRA 1H9VA 3MRGB 1FL6B 3QUKB 3C8DA 3WL9B 1UVQA 3QXTA 4PJCB 3X3FL 4JZNA 5I76B 1UXWA 3ZL4H 3HE6D 4JCMA 4WUUB 1XF1A 1NMBL 2HVJB 5TE6H 3GUTB 5GS0H 2C4FU 3ZE1E 4M93B 4OGYH 4Z7UF 5DMGD 1SY6L 1BVLB 3MUJA 2B2XL 2XN9A 5KG9A 1T2QL 1QSED 3BQUA 2HLFD 4NHUA 5JQ6H 3LKRB 2MOVA 3QUXA 5E9DE 1ES0A 2H26B 2OR9H 3CFEA 4MXQD 2A73B 3WYRA 3H42L 5FUCE 4PYHA 2EDBA 5CSGA 3CXHJ 3BHBA 4GSDH 1NFDB 1F90H 2D2OA 1LDSA 3MFFB 3WFHB 1RUAL 4UBDD 3HKFA 5EO1B 4OZGB 3L5IA 3PQYE 3O8XD 4JFHE 4Y19E 1ACYL 5F70A 1KXTB 3SOBH 4F8TA 3HNSH 4UT9H 1CLZH 4ZFZB 2ZUVA 4S0TD 1R3HA 4QRRE 4RGOL 2P8PB 3P0YL 5DGRA 2ZOLB 4M7ZB 3STLB 3FB6A 4JQXC 1E6OL 5GJSH 3F8UB 2Q7YA 3DNKA 5I9QC 2C3HA 4UNUA 4LPUA 2P8LA 3I85A 2JJTC 4BZ2L 3HC0A 3HNSL 4UT9L 3AY4C 3G04A 4P4KC 3ZKMC 4ZFFA 1MJ7L 4C4KO 1F3DH 4I18C 3D39D 3QIUD 4MD5B 1MCSA 1H8SA 2XA8H 3SGEH 3C60C 1FYTB 1MCOL 4LSRH 3WIFB 4KRMB 2R1XA 4CMHB 2OL3L 2HJLB 1CICA 2ADIB 5BJTB 4Z0BL 1ZA6B 4NBZB 4X9FA 1EJOH 1NCUA 3WXVL 5KVFH 1T1XA 1B88A 4D2NA 3BXNA 4BUGA 1YDPB 5GRJH 2IF7A 5JOPD 1JPST 1AO7B 3EIFA 4GAGL 3WEXA 2FHBA 4JQVA 3OKYA 4CADB 1L6XA 1AXTH 1G7QB 3S5LB 3WKNA 3RKPA 4AQ1B 3BT2H 2OYPA 1I7UA 5A2LH 1M1SA 5TDOA 3O6KL 3UTZA 2DIJA 4X7SH 2XWJA 2OXHA 2YR3A 3MRDB 4EEEA 5BZDB 1G6VK 1I7ZB 4LSUL 3GHEH 5KJRH 3P4OA 3U0TA 3QWQB 3MLUH 5D1ZB 2WUCH 1JUFA 5BXFB 1J18A 4JRYE 3ES6A 3KPMB 3VXPB 5BV7L 3TA3C 3MLYH 5F8QC 3OL2A 4NRZA 1N2RB 4YHKL 3UX9B 2HG5A 1C1EH 1TETL 3PP4L 2KQNA 2NXYC 3NTCL 2DQEH 4S2SB 3TH4T 1A64A 1OAYH 3GM8A 3U4BL 5IIEA 4OT1L 2VDKL 5I1CH 1FH5L 3R0NA 4D9QD 1G7IA 4OLUH 2OTUA 4MQSB 2RAMA 4FFWC 4U1NB 3E3QC 2VXSL 5F7WC 4E42B 3JWDL 4U2YA 2IQAA 4OCLC 4PJHA 1WT5A 2APVA 2IAMD 4WW2F 3NFPA 2AV1A 3X3GH 1DLHA 1SJHA 4PJXE 2F9BT 3L3KA 5F9WC 4KPHH 2NQCA 2P24B 1MHCA 2A9ML 2QQQA 5CUSL 4ZQKB 3W9DB 4JG1H 4JJ5B 3WDHA 4HMCA 2B0SL 2N1KA 3HRZB 4X8XA 5DRZA 4K71B 1N5YH 4M43H 4B50A 4NQVA 4NN5B 1MVUA 1OTUD 1MH5A 4LARH 3VRIB 1SQ2N 4LBEB 1C12A 2PO6D 2OJEA 4HW6A 4IRJC 3WFBH 4R8WL 4FQJL 2BHYA 5BS0B 4Z95L 3ARFB 3P4MA 4GXVH 4Z7OF 3MA7B 3PHQB 3BPCA 1EXUB 2PR4L 1I8LA 4MAYD 4FABL 1YC8A 4FRWA 4AH2A 2BVPA 4J6RL 1HHJA 3VGHA 4X9BA 5HY9B 4TN9A 3NN8A 1DLFL 4OCWL 3OAUL 4O2EA 5EORL 1XF4A 3E8UL 4OQTA 5DD5H 4XMPH 2VNCA 4ZD3H 1FIEA 1QLRB 1BFOB 3WN5C 4HIHA 5D9SB 5A2JH 4JHZA 1ZEAL 3SE3C 4UV7H 1EHLH 3VA6A 5BZWA 1AR1C 3V5DA 4DTGH 3MRJA 2HKHL 1AP2A 4DZ8A 1TTUA 2ZKHH 3ZDYE 1NPUA 12E8H 1DDHB 3L95B 4OZFA 3VWKB 4R7NB 1KT2A 2HVKA 2Z31D 4KKAC 2E7BA 3FO9B 2X09A 2EYRA 4JPKH 2IFFH 5DD0L 4QRTB 3PXJA 3QIWA 4PRNB 5JHDA 4UQ2B 2X4OB 3RNKA 2KZWA 3O9WD 2HFFB 5IVZB 4WCYL 4F15B 2NY0B 5EUKA 4PJDA 2CKBA 1CD0A 4OF3A 1IGCL 3PL6D 4R97C 5FK9B 2CR3A 1ZA3A 4KMLB 2BXZA 5IVXE 2QHRH 5GRUH 4OCRL 1DTUA 1BFVL 1ETZA 1BF8A 4QXTB 2GTZB 4QRRA 5F1SA 4RGMC 4XNXH 3RAJH 4LLAA 3TNNB 2YD6A 4YHYB 4YHOL 2EIDA 5MI0B 4HFUH 5KVEL 2BOCA 4X6CA 4OZIB 1H3XA 3CVHA 4MAYC 4QHLA 1GGTA 3GI8H 4LASL 2XXCB 3UXFA 3JTSB 4MJIA 4P46A 3VA2C 3WLBA 2EDHA 2GSIB 4KV5F 2H9GA 3G5XA 2CJUH 4TUOA 5IQ9B 5JOFA 4NQXA 4B0MM 1U42A 4PUBH 2NW3A 3OXRB 4RDQF 4I0PD 2XWBA 4P2OA 4EVNB 2I9TB 4JHAH 3IFOB 4Y4KA 3PGDB 1MELA 3T09A 3VRJA 4JQXA 2DKUA 5FIEA 4MA7H 1OTSD 5EUOB 1BWWA 4JRXA 3ET9F 2DB8A 2G5BA 2H45A 1P6FA 3W0WA 5B22A 1JHLH 5DD6A 1DBAL 4HSQA 2A1WH 4OUUB 4Q2ZB 1KUMA 3OKOB 2BDNH 3WD5H 1X3DA 3VXOA 1I7RB 3MJ8B 5IB2A 1WFNA 1QQDA 2P5WD 3EJYC 4JZJC 4WTXA 5H37H 1I4FB 1TJGH 2PNDA 3FO2B 1NMCB 3KYKH 5IV2B 1FC1A 3GJEA 1CT8A 1J1OL 1NUFA 4BSVB 2ZUQB 3M17A 1QRKA 1RIVH 2AEPL 1YC7A 3P9MB 1AGDA 3OJDB 4MNHB 5ICXB 5C0BD 3SCMC 4YGAB 5EU6A 4KK9D 4OCYH 1FAIH 5A1AA 1T7WA 3NMEA 4JY6A 3P11L 4L29A 5JHDD 1LNUB 5H94B 1GAFL 2D0FA 3PQYB 1RUPL 1EXUA 1MIMH 1S5IH 5GGRY 3O0RH 5H2BA 4AENA 2DI8A 1RZ7H 2APTA 1VEOA 3HG1E 2ZCHH 3LB6C 1KLGB 4K8RH 5M95B 4HPYH 3UTSD 4N0CD 2EYRB 2IGFL 3VWJB 5LXGL 1EDQA 4HIXH 2XN9B 5AZ2L 5HVHB 4PJEA 5JDSA 1FFNA 1YEEH 2IBZY 4JJHA 4WO4D 4NRZB 3I02A 1AIFB 4MWFB 4S1RH 4Y2DC 3MLVH 2I5YH 3V6OE 2H1PL 4N90E 4PRNA 3K46A 4F9PA 2A83B 1E4WH 1N64L 3ZYZA 4FG6D 4X4YB 4HX1B 1F4XH 4X6DE 2VUOA 4L9LB 2HRPH 5E6IC 3IVKB 1FZJB 1PSKH 2Q1EA 4FNLL 4KJQC 4PB0H 3WLWC 4P2OD 3EYSH 4JAMB 2FATH 3GSQB 4MQXC 1SEBB 2XZZA 4KQ4L 1FL5A 3RWCA 4TUJA 1JWMB 1B0GB 3PHOA 3ARPA 4WFEE 4F3FB 1NAMA 4YFLI 3H6JA 4JRXD 4Z7VF 3X17A 2NY3C 2YRZA 3QHFH 3TO4C 5D93C 1MPAL 4QHNA 5C08A 1ZT4B 2F53B 2LABA 1CK0L 1RUKH 4NQVB 5JDSB 4LPVA 5CBAA 5JMRA 4M9OA 5LGKA 4U31A 1S7SA 1S5HB 4PJ8B 4EDWL 4LEXH 1QBMH 5HI4D 1KXVC 1NC2D 3HI6H 3BGAA 5IR1B 5CJXA 3OJ2C 5C0CE 2FJFB 5D2LA 3TIDB 3ZDXE 4EKXA 1P2CA 4LVHC 3ZKND 5I17B 1LP9A 1UWXK 5LVEA 3SCMA 3MREA 1K5NB 3ALWA 4M6ML 3BGFB 5I0DA 1UB6B 4XNYH 1F58L 5TQ0L 4AEFA 3D87B 5C0CD 3RDTD 2BCKB 3PDDA 3ECBA 1J87A 4O5LL 2AABL 3CVIH 3MROA 1MQ8A 3U7AA 4TSBL 4WFGD 2DRUA 3MOAH 4KMTL 3ULVC 5MHSE 4XRCB 4ETYA 4GRLC 4RGNC 3N06B 1UKTA 1M05A 1MCWW 4PGCA 2FGWH 2FNBA 4KGJA 3PWLB 3QQNA 5D1ZA 5TF1H 3B3IB 3MLXH 3G5VA 4OM1L 3THMH 3S36L 1IM9A 1G1YA 1UM4H 2DMCA 5DQ9B 2MCPH 5ERWA 2VXQH 4R2GD 4HK0B 3UJTL 5D7IF 2C1PB 3D85A 1ZAGA 2Y72A 2YKLL 1JPGA 1ZHKB 4LMQE 5DGQA 3QDGB 2QSQA 3S5LA 5DR5L 3MUGB 2V7HA 4Y1AB 4RMUA 5CGMA 5EIVA 1TMCB 3U9UB 3IJHB 4Y19A 4WTWA 4RSVA 1G7PA 5ANME 4YHNB 2LTQB 3P4OB 3QJHA 4GKOA 4JB9L 1WBXA 3GMRA 4EI5D 4FQXC 4PRID 4FXKA 2B4CL 2PF6A 3EYQD 3V0WL 2FD6L 3V6OC 4L3AA 3SE3A 3QDJE 1MFDH 2IPUG 1D6VL 4JFDD 5E1AB 5D5MF 5CCKH 1VPOL 1E27A 5HYSG 5FV2A 3PWJB 3G5VB 5FYJU 1CU4L 1D6VH 3HPLB 3KR3L 1ZLVK 4JVWA 2P48B 1JGDA 4ZUWB 5D6DC 2PTTB 3VRIA 2V5TA 2AJSH 4HPYL 4YBLB 3RZWA 5EB9A 4M48L 1D6EA 5EOQH 4F33B 4OBSA 2CDGA 3RWEA 2UZIL 1CGTA 2X4PA 5JOPE 1YA5A 5GZOC 1CF8H 3DHJA 4WJ5B 4DQOH 4H8WC 3S9DB 1U3HD 1CXKA 4LHUB 4XC1L 4RAHA 1D9KD 2H2SC 1FZOB 3FQXB 5CEXA 3WFCH 1LE5A 4OQTH 3MGOB 4NWUH 3ZO0A 1ZKAA 1ULVA 1GC1H 4LLVB 4OCYL 4KQ3L 4MX7B 4PJGF 5E8EB 5GGTL 4XAKE 4BQ8A 2EYTB 5ACLA 4ENEC 1Y0LB 5F6HI 3UTTA 3ALXA 3NA4A 3PQYD 1FVDB 1BZQK 3QUYB 1QSFB 5D96C 1YQVL 1GIGH 4HZLB 3KWWB 3QFJE 1RUQH 1XGYL 3HRPA 3F62A 1N6QH 2VE6B 4MCYA 2NY0C 3MJGX 1KIRA 2Q76A 4WNQB 1T66C 2PW1A 4HPOH 1JPTL 2FH8A 5FUZH 1XGPA 3VXMD 2MHAB 3FZUC 4LQFH 4NZTL 3GBMH 4YDIL 1SBSH 4ZAKB 2B1AH 2W91A 5DEGB 3V5KA 3O6FB 1OP3H 2AJXL 1FV1A 1WBYA 3H9SD 2Y07H 2AJVH 2AXGA 5E5MA 1E4KC 5J13C 1DFBL 1RULL 3NBNA 4P2RD 4HJGA 4YFDB 1BAFL 1JNNL 4K94H 3BZEA 4FFZH 3QIBC 5JUEL 4NZUH 3CLEL 3KLDA 3LS4L 5ANMA 3E0GA 3MJ7B 5AEAA 2NW2B 4C83A 3GSVA 1NGZB 2KPNA 3DVNB 4PJFE 4YEFA 1MFAH 3HCVA 3JWOC 4IRSD 3ZDXF 3NCFB 4MQ7B 5C6PB 3D39E 3HAEA 3BE1L 4M5YH 2YOCA 1RIHL 4HMEA 4YHPB 1EMTL 3LV3A 3HUJA 2ZP0T 2HTKD 3OMZA 1BHGA 4F7PB 4D9LL 1ZTXL 2CUHA 2UUDK 4M7JL 3T2OA 5GGVY 4NQXB 3C5ZB 4ENED 5C0EB 3DJ9A 3DBXB 4FQQB 1IC4L 3KLSA 3VH8A 3NPZB 3CX2A 3TWCH 4JRXE 4NQDD 2XI9A 5B4MC 4OLWL 2EH8H 2R39A 2D7PA 1D5IL 2QADD 3MRIB 3K8KA 4M9PA 4XNMB 4P3DB 4PP2B 5AAMA 3MJ9L 1PZUB 1NFDE 3D3VD 4MA1C 2B5IC 4MQTB 5J1TC 5T5FH 2EDKA 3BEVB 3SKOA 1KTDB 3I9GH 3RWDB 1BBDL 1TPXB 3RGVC 1CGVA 1E4WL 4F58L 2P45B 1D9KA 3RL1A 3ZKNC 4Y5XA 2YA0A 1J8HA 3RVVD 1U93B 1NC4A 4P59H 1DN0A 4WHTA 3U36A 1R0AH 2R56H 4Y4KC 3IYLW 1V3KA 1HZHH 3ME0A 3NACL 3IGAB 1NUNB 8FABB 1K4DA 4PJ5D 3PGDA 1FZMB 5JPMB 2NXYB 2BSRB 1CT8B 2DM4A 3QWOA 1C5BH 4NCC1 2JCCA 2KQMA 4FQCH 2QKIA 3QRGH 4XCFL 1KGCE 2GITA 4U7KA 1J88A 2I27N 3ARDB 5INCB 1X9QA 5F7YC 4TUKH 2VZVA 3WNPA 5DK0B 2VJXA 2VDRH 5DHVB 2BVEA 4Y5XB 4F7CA 1QYGH 4JM2D 1GC1C 4OIIL 3O0RL 3DO3A 1YNTA 4NQCD 3EO9H 3E8UH 5FM5O 1HOCB 4WDIB 4HUUA 4P0DA 1HHGA 1FZMA 2AV7A 4XXCC 4PJGE 4LEOA 3HMWH 4IIQB 3DHMA 4FQJH 4IRZH 1NEZG 5JLZB 1J8HB 2HTLC 4XXCA 1EEYA 5DVLA 4GXUM 4U4BA 2XFXB 3CDYA 3KYKL 2NYYC 2HA1A 3SDCD 1XGQB 1IZKA 2OL3A 3UTQB 2AW2A 1KN4L 4UV4H 3JV6B 1LD9A 3MXVL 4DK6A 1WZMA 1EO5A 3T0DA 4H0GA 5C09D 4MJ5B 4HUWB 1AC6A 3UTQA 2ESVE 2AKRA 3HZVA 1IM3B 4K9EL 43C9A 3PJSB 3JWDH 4TRPL 5DRZB 2YZ8A 1V7MH 2CKBL 3CU7A 3IKCB 3HG1A 1WCBB 3HZVB 1UENA 1X7QA 3QDJA 3MV8D 4NQEA 4X8JA 3SBWC 5KSBE 2D31B 3KPRE 4X6FB 3ILQD 1FNSL 4KU1A 1MIEL 3HCVB 3WO4B 4OT1H 1VFBB 5FK9A 4YXHL 3HZKA 3Q48A 4JFFB 4OB5L 5D71H 1RZIA 5EZOH 4UTAL 3G9AB 3PP4H 3R06A 3P30H 1KB5L 2ZUXA 3T0VA 2Q7NA 4OQ1A 1G9EA 5GISH 5CZVH 4I8DA 1RQ5A 3VFTA 3MCLH 1J05A 2R69L 3HMWL 4ODXB 4ZFGH 3A6CL 1C5CL 2BJML 4PJXA 5JIKA 2X4RB 4BFGA 4JN1H 2DTSA 2CR6A 4XC1H 1A1NA 1G9MC 2FLRT 5E9DD 5BZWB 4L5FH 4CADA 3TFKC 4K3EL 4BZ1L 1FE8L 1ZLWK 1TCMA 4TTGA 3IFPA 3TBTA 3OHXA 1YJDH 1PGRB 5EOQL 3O8XC 4TUKL 3K1DA 4OCRH 1XF5A 5FO8A 3BVNB 4H0IA 3P73B 2XXMB 2ZNXA 1IGCH 1T04B 4NQCA 2WBJA 1IT9L 3BEVA 4O2CB 1RIUH 3G6DH 2VLKB 4YO0B 2DQUH 3R06B 5HGDA 4JO4H 4P5TB 2X4TA 5DD0H 5IFAL 4FZEL 1PDKA 1FAKT 3S4SA 1NAKL 4RAUB 1UC6A 3CUPA 4ISVB 5KBNC 5HHMB 1PG7H 4G8IB 1T7VA 4XHQA 4P5MB 3C5ZD 4W4OC 1XGPB 1XR8B 5D7JC 4DTGL 3O11B 1XFPA 4CJ1A 2PXYA 1N3NA 2X9YA 3F12B 4EOWH 1CN4A 5EBMA 3I3BA 3DOSA 3MACL 2VLRD 4RGOH 4S1DD 2V2TA 2YKLH 4G6FD 4AIOA 1ZANL 3SKNA 1Q1JL 1RZGB 1U8PB 5MI0C 3T1FA 2NY2C 1UM4L 1ZTXH 5FO9A 3AS0A 2I25N 1EMTH 3F65A 4ONOA 3HFML 5CP7A 4U3CA 5IVXA 4R0LA 3K74B 3ROLB 3SDYL 5IVXF 5E2WH 1OTTD 3PWPB 3TBSA 5JQ6L 3LS4H 3CSBA 2LVCA 1MQKH 4KJYB 5B38B 1DQJB 4OF0A 1YNLH 1T20B 2F53E 1B2WL 1BAFH 3KPSE 1QR4A 2APWA 1YYML 4KPHL 5EBWA 3U9UA 3T0EB 3IJYA 1TCRB 5DURB 2MNUA 4QYOB 4YHLH 4RNRB 3CIQA 2EDTA 4LU5H 1KYOJ 1NMBH 2B1AL 4WW2B 1NJ9A 1OGAA 2WM0A 2ZUYA 3V95A 2VDQL 4LBEA 1R5IA 1GJIA 1BFSA 4NQSA 1OARH 4GKZB 4UUJA 4YWGL 2FJGA 1RUQL 1XGYH 3U2SB 1K3IA 4L8SB 1GIGL 1QO3A 2D3VA 2AXFA 1LO4H 3LRHA 4NHCH 1INEL 4DEPC 4L29B 4JANA 2E7LA 4MXWL 5T5NG 3WO4C 4PLNC 3I6LE 4ZDHB 4G8FB 2FB4H 5FDWA 2J2ZA 4JFPB 4O51B 4JY4B 4KQ4H 2FWOA 2BVTA 3V8CA 2P46B 1YUHB 3QO1A 3CU1A 4WI9A 1HYRC 3QZWA 4HV8B 1Y6KR 1TTGA 2VABA 2P1YA 3FT4A 4P57B 1N64H 2QR0B 3LKRA 4KAQH 4ZODA 2Z92B 4K71C 3F7QA 4ZS7L 4F57L 3QNZA 3VXUE 4S11A 4NJ9H 3CZFA 2BY0A 4X4MA 4PJAA 5DRNB 4O2CA 1P5VA 1KCRL 1CICD 5DJCB 2GAZB 4GG6F 2AXHA 5T3ZL 1YEFH 1YUHA 3QO1B 4L4VE 1L0QA 4C83B 5ALCH 1GPOH 2HN7B 4KTEH 3W0WE 2GYSA 4K8RL 1DBBH 4NO2A 5GGUB 3WL9A 4FN0A 5IW1A 1PG7X 5HGDB 3TT3L 4JAMA 4O58L 4IRJA 1IARB 1AGBA 1EIBA 4ZNCD 3O6FC 5C0RH 5EU6E 4PJ7F 1S5IL 1HH6A 5FKPA 5JNYB 4G6AD 5EPMA 1MIML 5DQJB 4C59B 4R2GB 1XR9B 4M1CD 5EO9A 4HC1A 1N6UA 5CJOH 2O5YH 3GFUA 4M03A 1KIPB 3L1OH 3P11H 1OAZH 4Y4HD 4M61A 4Y5XC 1GSMA 2A6DA 5C86A 1AR2A 1DE4B 2AQ1A 5FO7A 3O3EB 5ENWB 3QXVA 4YPGA 5CHNB 3R1GH 2OMNA 4OM0H 1AD0B 3BPOC 1I85A 5IF0A 1ZS8B 4WU7A 4XH2A 3RDTB 3N1MC 3WIHL 1BZ9A 1OSPL 1TXKA 1ZVYA 1S9YB 4RDQG 2RJMA 3HC0B 4V1DB 1AXSA 15C8L 3OJDA 4MNHA 2UYLB 4XBGB 2ATPA 3ULSB 2AABH 2YA1A 4I4WA 3ULVE 1MJ8H 1T2QH 3P4NB 2WQRA 3W82A 3HC4H 3LKSB 1CGXA 1QEWB 4EBQL 1K85A 5D1QA 2F5BH 1EUTA 4PJ8D 3SO3B 1MFEH 4U1GC 4G3YL 4P5KB 1Z0MA 5KSVA 5I2IB 4KRPC 5D72L 5C9JB 4NN6C 5I17A 5KOMC 2GTZA 4I3SH 5TE6L 3DMMC 4OTXH 1CVSC 3HI6L 2P42B 3MA9H 4OLYL 1QBML 4G8GB 4AT6B 4LPTA 4H88H 2C1OB 5D7JD 2AQ3A 3HAEB 4ZO9A 3VXTA 2AEQH 4BSVA 1WF5A 3PGFH 2DMBA 3ZE1F 1R5WB 4U6YB 3D39A 3QIUA 2DD8H 5SWZE 3EO1B 5F9OH 1CK0H 1A6WL 3JTTA 1RHFA 1VSCA 1MPAH 2A0LD 1WIOA 4ZO7A 5DT1H 4YQXL 1JK8B 2GJJA 3S3PA 5SWZD 1D5MA 3LQMA 3DROA 5AZEL 3S4SB 2KKQA 4K3DH 4LVNB 4F37K 3QDMD 3W5MA 5IEKB 4PREB 5E5UB 1BWMA 3U46A 4HUMB 2EEDA 2GJ6D 3BO8A 3VDCA 4LHUG 1GGCH 3HB3D 5C07E 3GBLA 1WIPA 1VB9A 3MLZH 3DMMB 3RTQB 3K81A 5TE7H 1ZXQA 3VW3H 3D0VA 4WEMB 1KG0B 1FNFA 3F7VA 3DIFB 3QDGE 3ISWA 3G5XB 4TUOB 3WO3B 2Y5TA 4U0QB 1IEAB 5HPMB 1NGWA 3G5ZB 2DKSA 2V5SA 4G7VH 4I2XE 3QEGH 3CPLA 2L7UA 1FVDA 3EDKA 4IMKA 4HKJB 4KK8C 4PJHB 1BQLH 4S1QH 2OL3B 3HZKB 3FT2B 1G7MB 1HSAA 2W60A 5T33H 4JQVC 1FZKB 3SEPA 3RJQB 2YMXL 4QHKI 3W2DH 1HINH 1NKRA 5E24E 4LSDA 1BVKB 5I76A 3QUZD 4MNQA 4ELMB 1U8IA 2FIKA 1A9BA 5E2UH 2R0ZL 2VLJA 4R4FH 5F3BB 4LDEB 3PJSA 2W9EL 5T1DL 2VDPH 5FHAL 1G0DA 1KEML 1CFTA 1FNAA 1KEMH 4YXKL 5MEQA 1Q9OB 4Z0XA 2GKIA 3FT2A 2DWDA 3QI9B 5BV7C 1KGCD 4O2FA 4HGWA 1RI8A 4X6CF 1F6FB 1A02N 3OKDA 3QIWB 3QH3B 4LPYA 4E5XB 1NGPL 1XF4B 5FUOH 1GCFA 2J4WH 4LKXA 3BAEL 3K8MA 2C3GA 4KKBD 4M43L 5HD8D 3V0VB 4HK3N 1S3KH 3TJEH 1MI5B 3L6FA 5GGSA 1DR9A 5DJ6A 3SGEI 2RHEA 1K6QH 3P3YA 3MV7B 4R4NC 2ITDB 3B9KD 4L4TA 3WD5L 3ARQA 2YD4A 3T3PF 4N8VG 3VRLE 4K8RD 5GIRB 2EXYC 3BZEB 5FGBA 5E6YA 5I6XC 5IBTL 3REVA 1CFVH 4I77L 4KDVA 4H25A 2B1HH 5C2UB 3MODL 4GRLA 4MD4A 4KKCD 4ODVL 5SWZA 3NGBB 2A6JA 3BPCB 3BP4A 2P5EB 1AKJD 1NDMA 5JXAL 4XB8A 4WW1A 1DEEB 1I7UB 3DMMD 1F4WL 3MXWL 1OAKH 3I6KA 3MV7A 4XZUA 2CXGA 5T3XL 5J7CC 5C0AD 4N5ED 2E9BA 5DT1L 1MNUL 5K9QI 4ODWB 3TIEA 3JWNC 3DRQA 4G8GA 3ARBC 1EEQA 3E6HA 5EU6D 4F7CB 3C9NB 3MV7E 1RSFA 4NGHL 1Q72L 5SWZB 2HJLA 1E28A 3UPAA 3GI8L 1W8OA 4ZYKA 5IMKB 4JM4L 5IG7B 4KZDL 5KVEH 1RZKL 1NAMH 2UWEE 2VR4A 5IB1B 4U0RC 4HIIA 4YHOH 5CEYA 2C7UB 4X7SL 2OI9C 4L8SC 5IW1B 3GHBH 3RWEB 1UJTA 2W9LA 3VFGL 4XVSL 2R0KL 1TZHA 3EYQC 1JFQL 1OF2B 2NY0D 4PRAA 4BK5A 2HT4D 2HFEA 1CQKA 2QQNH 3EFFA 1NDGB 5CSZA 5L88H 3D1MC 3NFSH 3E1F1 2FEEL 2LAAA 3F7YB 4MCZB 4X7FC 1S7UA 1I7ZA 3PIQA 4G7YH 4PJBB 1L4IA 3MBEB 3T77B 5KOVC 3Q5YA 3SJVE 5CD3B 1N6VA 5F7FA 3C8HA 3VFWA 1TLKA 1MHCB 4K7PH 1MCOH 3UJIL 1R3JA 1TVBB 3MCKB 2PTTA 5IHZB 1UA6L 2WMPA 3OKNB 4UT6L 3TP4A 1J1XH 3ROOB 1X5AA 5B3JE 2DBJA 2C3VA 1T21B 1GRWA 1QFHA 4HK3J 4QOKD 1ZHLA 2ZPKH 2BRQA 3VDBA 1MJ7H 1RVFH 1V3MA 4XBEL 4JO3L 3VXOB 5TDOB 2A9NH 2AVGA 4NNXA 5C3LD 5CP7B 5TQ2L 3DUHA 3MA7A 3GBNH 3T1WA 4RZCB 2GQHA 5DXWA 5BMFL 5I16A 1N0LA 1CE6A 1VDGA 1MWAL 2EIEA 3ARFD 3L1OL 4J4PC 1XIWB 1MREL 1A2YB 5E5MB 3VD4A 2DQGH 1ZHBB 3IJHA 2IFGA 1ACYH 3CVHH 4N9GA 3BP5B 2PR4H 5TPWH 1NFIB 3PWNB 4GRMB 4O58H 5GRVL 5TDNB 2XKUA 1LEGB 4FXLA 4MCYB 2A6KA 5I1IL 4HKBA 3H42H 2DL9A 5GHWH 1SYVA 3D85B 4ZFZA 3K2UL 1QSEA 1JCKA 5T3ZH 1C08B 4L8BA 1R5WA 2ZG2A 4OV6F 7FABH 3K1KC 3PNWA 1YMME 3H9YA 3CH8A 3U30B 3IXAA 2B2XH 4KI5D 4OCXH 1YYLH 3KPSA 4AK1A 2A9MH 3SGJC 1DSFH 5T1MB 3GI9L 2NY5H 2ADFL 2X4QB 3BSZH 1AE6L 1CDCA 4H26A 1D5MB 2BNRD 1HWGB 2X5PA 4QWWD 1F4YH 1LP9F 5KSAC 4I9WE 1QOKA 2CKNA 1U3YA 3D3VE 4ONHA 4LPXA 4JZJA 2BNRB 1OSZA 2VXSH 2EDLA 4BKLA 1MFCH 2FJGB 5EBGA 3U2SA 3PWNA 1ZWIB 4JFQA 5DYOB 1ORQA 1OAYL 3LH2H 3U4BH 1K9TA 2VWEC 5JORA 4PRPA 5I8OH 4IOFD 1AI1L 3D85D 1UXWB 1G9NH 2PCPA 1AD0A 1A4JA 4U1JA 3DTXA 5E7BA 4HH9A 5FYKE 1P6AB 4D0DB 3P73A 1JGLL 5IOPB 3D69B 1SJEA 4LNRB 4UNVA 1Q8MA 1WZ1H 5ADPL 2V9QA 5DK2B 2FX7L 2VZUA 2BFVL 1BD2A 1Q9LA 3DECA 1DBML 3O6KH 2OJZL 1CDJA 2EIZA 3VI4E 1WC7A 1FVCB 4DUVA 4IDJL 3ZKSD 3EOBB 2BSSA 2BHUA 4IRJB 1JMXA 3VFWB 3PWVA 4M62H 2VLMD 4YGVB 3TV3H 4X6BB 4JFDA 5DJDA 4JHBA 3GO1H 3MMEB 2IBBA 3VI4F 5MP6L 5KVDH 4XAWH 5FO8B 2WINA 4MCZA 5E2WL 2J12B 2ZSVA 4J3SA 4OZIF 1W0VB 2C3VB 1WEJH 1ZLSH 3T0ED 5C8JB 3VXTB 1QRNE 1BFTA 2Y36L 2BMKA 1WUNT 5C0ND 4LFHD 3TLRA 1I3UA 2EE6A 1I8KA 4TULH 1PYWA 3MR9B 2QQLH 3MBED 3KPQB 1ZANH 4PGEB 35C8H 2ITCA 4G8IA 2VLKE 5JPNA 3INUL 2VUYA 1NFDA 3F6LA 5T5NF 1H8OA 4OCSL 4IHOB 4OCNC 4ZPTA 3KPSD 1IVLA 4P2YA 3DXAD 4G5ZH 3BDXA 5E8PB 5JO5A 1HN1A 1S9XA 4RWHA 1RVFL 1NJ9B 2VLRB 3L5XH 3Q5TA 1SEQL 5C0CA 4Z7NE 2NZ9D 1DEEA 3KPRA 3MPCA 1QSEB 5CBEA 4DGYL 2B39A 2G9HA 3N1GC 1LO0H 1OW0C 1B4JL 4P9MH 4N1EA 2DIAA 1V3LA 3DRQB 3B5TA 3LKPA 1FBIL 2BC4B 1SMOA 1A7NL 1MFBH 1CFSA 5IQ7H 2G5BB 4LLDB 4PRPD 4YUEL 2XQYG 4HLJA 2XV6B 4RRPA 2L4OA 3HE6B 1PKQB 4LIQL 3RPKA 4HHAA 3AS2A 4KWUA 1I1FB 3QUZC 5DJZA 5ITFB 4XVSH 3SKMA 5E08L 2EH7L 2IAMC 2R9HC 3VGAC 1EEZB 3O4LA 1YECH 3QDAA 3W0WB 1CCZA 4WGWB 1NAML 5FYJD 1B4RA 5IK3B 1BD2D 5FHBH 1DBJL 4QXUH 1OT1A 2E6PA 3A6CH 2AV7B 3QG7L 3HMXH 3FT3B 3DUSA 2LE9A 3ZDZE 5IQ9A 5HDLA 5JOFB 1TVDA 1U8LB 3OXRA 2X4RA 5DEFB 1KEGL 4KI1A 2WAHA 4KKBC 5HD8C 1TVHB 3NFPB 4JFZH 4R90H 3BZDA 4NPYB 2F19L 1JHTB 3KS0J 1OP9A 3PABB 4JFFD 4DEPB 5IW6B 2A2QT 3ZSSA 2FO4A 4HT1L 5HHQB 2OP4L 5HPOA 4NWTH 2H6PA 3OR6A 3VFUB 2OX5A 1FIGH 4U1NA 1CIUA 1U3HA 3IFLH 1XH3B 4MNQB 3LZFL 4FZ8H 4Q9QH 1F8TH 1L6ZA 4DGVL 1HEZA 4J1UA 4UV4L 1ZHNA 4MJ6B 3TYFB 2R0LL 4HC1H 1S3KL 2A6IB 3BKJL 3W5NA 2K7PA 3DXAA 2MPAH 3NA9L 5IV2A 3MNWB 1NGPH 2J8UB 3NFNB 1MF2H 2UY7A 1NCBH 4M61B 5F7KC 3FFCD 4JDVA 2ZSVB 2MWCA 1EHNA 4TVPL 1F2QA 3KPRD 4J7RA 3VH8B 2HRLA 4APQA 4XNUL 4X6EA 1A7QL 5E4IA 1AHWC 4JRWA 4HZLA 2CGRH 3WKMH 1MI5E 3QQ4B 4ZXBD 4PS4L 1T0NA 2EEAA 2ERJC 5L6YH 2GJ6B 1HKFA 4OIIH 3VG0L 3DURB 1K3ZA 5DJXA 5EU4B 1VFBA 2FX9H 1A5FL 3EZ8A 2XKNA 4UAOC 3BRFA 4BSJA 1FNHA 3DURA 1IKFL 1LQSR 2J6EH 3QRGL 1NC4B 4LKXB 1F11B 3V7AE 1UYWL 3D18A 5IVXB 3V0VA 5GRZA 4CRPA 1B9ZA 3H3KA 2F54E 4N90D 3CLFL 1UFUA 3T8XA 5L6YL 3QUMH 4R3SA 1JWUB 3QULB 3FQTA 1A1MB 1G0YR 3WKML 2IAND 4PP2A 1DQDL 2ARJA 1RJLA 4U6VL 2GITB 5E00A 4RMTA 1VGEL 3O2WL 2IH3A 1OLLA 4NRYA 3TVMC 2PYEE 3RIFF 5D7JB 4LSTL 4HS6B 1ZE3C 1Q9WA 3I9GL 3IU4H 3SHSA 1MF2L 2ZNWA 1AD9B 4CNIB 5C9JA 3TNNA 3BJLA 4R26L 3CCHB 4YDKL 2CK0H 4MD0B 4RIRB 5T1LB 1QEWA 5IIEB 1XGRA 2YZ1A 1RJZB 2EIZB 4GLRH 1GZPA 1J86A 3HZMA 4Z7VE 3C8KA 4GKZA 4M7JH 1NUGA 4E42A 4LRNL 2QADB 1J0HA 4ODHH 4QRRB 2E8ZA 4NM8H 3FQWB 1NGWB 5F9OL 1S7TA 4F9PC 5K33A 5DHYA 1E27B 2IC2A 5CP3A 5GRXG 4YDJA 1C5DA 1MUJB 4BYHA 4E41D 1QHPA 3C09C 1C16B 2YXMA 3V7AG 5L0QC 3JZ7A 3MA9L 1PFCA 4OLYH 1IM9B 1Q0YH 4MDIB 2HJKB 1AY1H 4FQLH 5DO2D 3KAAA 3MLWL 1IEBA 5I73B 2OZ4L 4IRSB 4HCRH 5IB4A 2R4RL 4APQD 3ARUA 1DCLA 3QFJA 4PJGB 1L9MA 1GGBH 5HYEA 4KK6D 4X7TB 4YDIH 3EJZC 4ZFOB 3GBML 4NP4L 4P2RB 3VCLB 5JO5B 4HZAA 1P7QD 2FL5A 3UTTB 5E08H 2AEWA 4Y4FC 3RBSA 1U8NB 2HN7A 5E6ID 2SEBA 1KLUA 3O6FD 2YPKB 5IR1A 4GQPH 5DYOA 2H3NA 3QSKB 4PJCE 4OFPA 3U30C 1J5OL 1ADQH 2UZXB 4P3CL 1CICB 3GZKA 1AFVH 2D4DA 1CGSL 4Y2DD 1SJXA 5HHVL 3BH9A 3P4MB 2NY3D 2BZDA 5HDQL 5HVFB 5E6ZA 4OZGF 3U79A 3GMOB 4POZC 3L5WA 5H37G 2V5MA 2LVEA 4N9GB 4NRXB 3DX7A 4NNYA 1X5KA 1BX2A 4XVUC 2AJYH 2YPKA 3DI2B 4L4JA 4HS8L 3GIZL 1CLYH 1U92B 1CFTB 4JGUA 4XNZB 3S37X 3TT3H 3GIZH 1HDMB 3BN3B