1KN5A

Solution structure of arid domain of adr6 from saccharomyces cerevisiae
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
102
structure length
102
Chain Sequence
b'NNKQYELFMKSLIENCKKRNMPLQSIPEIGNRKINLFYLYMLVQKFGGADQVTRTQQWSMVAQRLQISDYQQLESIYFRILLPYERHMISQEGIKETQAKRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription regulatory protein ADR6
publication title 1H, 13C and 15N resonance assignments and secondary structure of ADR6 DNA-binding domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 19
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2001-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 1kn5A00
1C20A 2KK0A 5CEHA 5K4LA 2RQ5A 2YQEA 2OEHA 1KQQA 2CXYA 2LM1A 2JRZA 4LJXA 1RYUA 1KN5A 2EQYA 2EH9A 2JXJA 2LI6A 1IG6A 1KKXA
chains in the Genus database with same CATH superfamily
3TAQA 4DQPA 1SV0C 4KLFA 3BQ0A 1BPBA 7ICKA 1SWVA 3AQFA 4F72A 5L1JA 2FDRA 1D9DA 3J81j 4ICAA 2R8IA 2WF9A 3RRHA 1ZQQA 4A8EA 9ICXA 7ICPA 2W7OA 9ICHA 3IRUA 2ASJA 5KFCA 2HOFA 2IMWP 2NRZA 4R66A 2FMSA 3PX4A 1NK9A 3TADA 2ZJAA 4P4OA 4I2JA 3GIJA 4C8OA 2ZIVB 3AU6A 4TUSA 4B9UA 1BNPA 4EX6A 2C22A 4MFFA 5D49A 1NK6A 3V7KA 4RNMA 4J9MA 3UM9A 5AM5A 3KFUF 4RU9A 1WUDA 3S6JA 1COKA 4NL9A 1N62A 4J9NA 3F53A 5IINA 4M9HA 2IHNA 3ZDAA 1VDVA 2DQNB 1ZQLA 1PZNA 1QTMA 1IIPA 1SV4A 2H5XA 2A1JA 2F76X 3AEVA 3PMLA 2CN1A 2KE7A 2YMMA 3GIKA 2EH9A 3C2MA 3C5GA 1L7OA 4PPXA 2ZUDA 3IG8A 2AXTU 1ZQNA 2KJ5A 2UVUA 3PR5B 2A1AA 1N63A 4I2CA 4UB8U 5J29A 2BPFA 5C0YA 9ICTA 4NL9C 2IOFK 3EYZA 4I2FA 1X9MA 1RYUA 1L3TA 5DQGA 2W9BA 3N97B 3H4BA 3F5AA 1WCNA 1ZQZA 3VCBA 4DQRA 2MUTB 2ZXIA 2KK0A 3ONNA 4HAIA 2F2AB 5DB9A 4MF8A 4O5EA 4AP9A 9ICWA 3WK8A 1MA7A 5KG6A 5ALPA 1ZD4A 5GTIU 2A3VA 4ECXA 1UQVA 3EW9A 5KT6A 4QWCA 9ICRA 2BQ3A 1X6IA 2W55A 3RJGA 1NK7A 1OUQA 2GH1A 3NVWA 3QX7A 5KFUA 5DBCA 4DCCA 1DRGA 1UHUA 4RQ5A 4R63A 4O3QA 4QIWF 3H7IA 3H8WA 3KTQA 8ICUA 9ICNA 1XSLA 4EZ9A 4UB5A 1L7NA 4XUSA 3OHAA 2PFQA 5IIOA 5L1KA 3UQ2A 8ICZA 3ICXA 5BOMA 1ZQFA 1K1QA 5TZVA 5J2IA 2HW3A 5AM1A 2ZTEA 2KP7A 3SEIA 4B9VA 1IG6A 2BQRA 2JZBB 2Z7JA 3WKCA 5HR6A 5J2HA 2AJQA 4Q8EA 2F1JA 3MGHA 5EWEA 2H3IA 3HRDD 1NZPA 5ALKA 4F91B 1PVPA 4KLQA 4QZ8A 5BPCA 3BZCA 5ALHA 4CGZA 2K4PA 4K4IA 5JTIA 2R18A 1Z00A 5DG9A 2EZZA 2H3ZA 3SR6A 1RM6C 4YD2A 1CEZA 2HOIA 5DB7A 2IOFA 1KKXA 5KT7A 3H4DA 2OWOA 8ICEA 2KIVA 5AM2A 2JH1A 5HMMA 2BR0A 1ZQTA 2EAOA 2EAPA 3MC1A 3TI0A 3C1YA 2JEJA 3JPPA 4QNLA 4Y2XA 4B6JA 1YZ7A 2DPJA 1WWUA 2BCRA 4K4HA 2KG5A 5KFSA 5D4BA 3FC4A 1ZQ1C 3QEBZ 7ICQA 3V72A 5CJ7A 1KRPA 4J9SA 4MHVA 3AN1A 1SIJA 2MA1A 3Q8KA 2HHWA 5IIJA 2W9AA 2WFAA 4M6WA 2FLNA 4XA5A 1UA1A 3RBDA 4RQ4A 4O3OA 2HHQA 9ICCA 2JEIA 1T94A 2CPRA 4KX5A 1RZTA 4KLIA 2JGAA 1A0PA 5ALJA 1RG6A 4MFCA 2LM4A 7ICGA 2KZMA 1SZHA 2KD1A 5J0XA 4FBUA 5A0LA 3L3FX 4I2BA 4IL6U 3RJFA 5J0OA 5ALUA 1GO3F 3DDHA 1MN8A 5AI8A 1ZQKA 4DL7A 1T3NA 2BPGA 3SQIA 1TAMA 3RR7A 3EUB2 3SD7A 3B0YA 2ZJ5A 2CRXA 1F5SA 1PUZA 1X42A 3ORYA 4F4KA 2OH2A 2H3QA 2AGOA 5CHGA 8ICXA 5CA7A 3BS7A 4I2IA 4GC6A 1Q3VA 1KW4A 1L8OA 4OCZA 5AKJA 4F71A 4JV2A 4J9QA 4TURA 3RH6A 2R8JA 4RPXA 4I2DA 2JXJA 2OCEA 1BNOA 4Y2QA 4DL5A 1SL2A 3K1RB 2W11A 3LWMA 2A1JB 2RQ5A 5AKZA 2P6RA 2W9CA 1ED1A 4KLEA 2AH5A 4I2HA 4R64A 3RJJA 1ZQXA 4RQMA 3UXNA 2W3RA 2FLLA 1C20A 2BPCA 2NRWA 1B0XA 1XS9D 1SL1A 4QWBA 4O3SA 3D2SA 4TQSA 5ALTA 4QZFA 5DG8A 2W9BB 1ZRNA 2QARA 4IRCA 3NUQA 2RDJA 1O03A 1V85A 4EBCA 5IIMA 5DG7A 4RQ6A 5DQHA 4TUPA 1SKRA 4QZAA 4ZOHC 8ICNA 1BVSA 5KFYA 5HHHA 2ES6A 4C4SA 2F8LA 2KZ3A 1ZQDA 4XRHA 4C8MA 2AU0A 4CF4A 2AGQA 1QSSA 1N61A 5AHXA 1ZQSA 5AKYA 1PVRA 1JALA 3RH5A 4JB3A 2JV3A 4P0QA 4YXMA 2A19A 4QW9A 7ICTA 5KG4A 5E79U 5JRTA 4CRXA 1RPLA 2GO7A 1MSWD 3CW2C 2K4EA 5KFGA 1TE2A 3NGDA 1V9PA 1FFVA 1KDHA 2GWSA 3K1ZA 4QWDA 1ZD3A 2ZIWB 4DWIA 5AK6A 3HWTA 2JR5A 4LVSA 2V9WA 1H38A 4BDPA 3NVVA 4PHAA 3G6XA 3OJUA 2HI0A 5KNIA 4RUAA 3F2CA 2BCVA 3H8SA 1SXEA 2WF6A 2HHUA 1KLNA 4QIWC 3RTVA 3MDAA 2ZTCA 1N5XA 1JI7A 1DK3A 5KL1B 5KG7A 2HHXA 2AHOB 2JEGA 2K4HA 2K4IA 2W9MA 1LV5A 3E2EA 3ED5A 1YT3A 4ELUA 2QLTA 4UAZA 2WTFA 4O3MA 5AM3A 4FO6A 5AM0A 4F2SA 2UVRA 1WYGA 3RB3A 5CP2A 2D6FC 1S10A 8ICHA 3O0FA 4EX7A 7ICJA 2M9NA 1L7PA 4ZH4A 3E0FA 3WKEA 1HEKA 4O0IA 2NO5A 1KN5A 1JROA 4BWJA 4GLXA 3PZPA 4BX9C 1L3UA 1TFRA 4Y2SA 2DPIA 4YP3A 5KFZA 4NJ8A 5ALOA 5J2EA 1NI3A 1RYSA 4ELTA 2OEHA 2DBYA 4NLCA 3TACB 5KFIA 4BXOA 5J0RA 2ZIUB 4MEXA 4DOBA 1BGXT 1KBUA 4YR3A 1TAUA 3NRZA 4ECWA 4B9LA 1ZQCA 5JUMA 1S9FA 2YQEA 9ICPA 1X2IA 2NRTA 5J2FA 4DQSA 3F2BA 3Q8SB 3RF9A 8ICSA 5DB8A 2WF8A 5DBAA 4F92B 4M04A 4FE3A 4M9LA 4DOAA 3K4GA 4JV1A 2YMLA 2KICA 1BPEA 9ICAA 3M6ZA 1NJXA 4DF4A 3TFRA 2EANA 3M1YA 1S5LU 4PGQA 4QZDA 3ZI4A 3UQ0A 1M6YA 4XQ8A 5KFKA 4PHEA 2K89A 4ECVA 5J0YA 2XY5A 3PR4A 4DF8A 4CF5A 4F4XA 3MR6A 5KG0A 3IHQB 1NK5A 1ZQBA 8ICAA 4F8RA 2HCFA 2YTUA 2XI9A 1ZQEA 3B0XA 4EBDA 1N48A 5ALIA 2JMGA 2XO7A 4C7YA 4NLBA 4ECSA 1FO4A 1SB3C 4IQUA 5L1MA 1UT8A 4O5CA 3QNMA 3MDCA 1HUZA 1BPZA 3GDXA 5HMLA 3T5JA 4C4RA 3Q8LA 4Q44A 8ICMA 4O5KA 3GV8B 4M9NA 1ZQMA 2QB1A 4FS1A 4KLOA 3T5LA 1QQ7A 2YMQA 5DKWA 2WB1F 3U26A 3MBYA 4I2GA 1UT5A 2ODGA 3HJEA 1ZQAA 4EEYA 2Y1JA 1DXSA 4AYBF 4F5OA 2I5HA 5J0QA 4ED0A 3ETRA 4EYIB 3BS5A 3ISDA 3C5FA 3IN5A 4DFPA 5ALEA 3PX0A 3MR3A 5KL8B 4USAA 2I9GA 4RT3A 2G5IB 2K8AA 3TADC 5CR0A 5J2JA 3M9NB 4FFDA 8ICIA 2FPMA 5AI9A 3DEEA 4QWEA 4DFKA 5ALNA 1PK1B 2VANA 3AU2A 2K8BB 1FIQA 1L3VA 4O3RA 4O3NA 4F2RA 3RJKA 2FPLA 4O3PA 2E8MA 1UCVA 5ALMA 3T3FA 3C2KA 1Z1BA 5FP0A 4JUZA 1IXRA 4KLDA 3CYMA 3V6KA 3LDAA 1S0VA 3R9KA 4NLZA 2KTQA 4WJ3B 5J0WA 1DK2A 3GFKB 3UMCA 1AQ6A 4U7CA 1YZ6A 5L1LA 4YQWA 3JPQA 1DGSA 5KFAA 2P35A 1TKDA 2LYAA 2QB0B 5AKIA 2RP5A 2BGWA 1DGJA 1SGGA 2F1HA 8ICPA 1NK4A 1KEJA 4BJQA 4DSFA 3KHLA 4C7ZA 3RJHA 7ICEA 4YMOA 3RAQA 3GV7B 1P7DA 4ECRA 4YN4A 2PKEA 5EE3A 2Y0SF 4QZIA 1LKYB 3SI8A 3PVXA 3PSTA 2IHMA 1T8EA 4ECTA 1QH9A 9ICSA 1KTQA 4FZNA 3CP8A 5B66U 4JMUA 1NJWA 4DS4A 2E5SA 5G5HA 5J0UA 3B9JA 1ZQYA 5KG1A 3LYSA 4BXOB 5DLFA 4EELA 5KTQA 8ICBA 1X40A 4DSEA 4YMMA 4I28A 1N2XA 1KQQA 4PL2A 5KG3A 1CRXA 3HX0A 1KFDA 1NNLA 4C8NA 4Q43A 4KLSA 2YX8A 7ICLA 5ALWA 4PH5A 2FE9A 4R8UA 2LYBA 5AK5A 4MEYA 3C2LA 2NV3A 9ICVA 1ZJMA 2KSOB 4QZCA 2H3FA 4GXJA 3D2NA 4RPYA 5EOZA 3GQCA 1F0MA 3PSIA 4YR2A 3BQ2A 4Q8FA 3QUTA 5CWRA 5JU5A 3PW2A 5ALGA 3K75D 1TV9A 3I28A 4P0PA 3PO5A 1L6NA 1OXJA 3UMGA 5EE9A 1D8YA 5HNKA 1BPXA 4DSJA 7ICVA 1QSYA 4J9RA 3HW8A 4IR1A 2Q4TA 4OO1J 2HVHA 4EBEA 5HR7A 3MGVA 4M9GA 8ICLA 3KHRA 3GZFA 3UXPA 4KLTA 2FJ6A 5DLGA 1XWLA 4J9PA 3FDSA 5CB1A 5EWFA 3N4MB 2E8NA 4BGDA 4RQNA 2E1FA 4PZNA 3IDWA 4F5QA 3SYZA 1D9FA 3IG5A 4PGYA 1JN3A 3UXOA 4QZ9A 4DSLA 3C21A 5CRXA 4C4TA 1SXDA 1S77D 5ALLA 3FAHA 2KKVA 4GXIA 3EZ5A 2MSNA 2NO4A 2P66A 2IOHA 4ED6A 1HUOA 4Y2VA 1NK8A 4Y2TA 3L5KA 4US8A 2BKEA 4CDGA 2LI6A 2KVCA 1SKWA 3IV6A 4NXZA 2ASLA 4EENA 4DLGA 2P6UA 1J97A 4JK1A 2EDUA 3KKAA 4EZ6A 1TAQA 2XGPA 2XGQA 3MABA 1S0NA 3SAHA 4F4YA 4DL3A 2HOQA 2W7PA 5F9LA 3I76A 1L5UA 3SV4A 4OJOA 2LBOA 3NTUA 2LHTA 1T7PA 5G5GA 3KZXA 3THVA 4KLMA 1URJA 2KJ8A 3RB0A 3OJSA 2WB1C 1U9LA 3N7SC 3PV8A 3RRGA 4ED8A 1U45A 1X6JA 4UASA 4GFJA 4AYBC 1HIWA 3MFHA 5J2DA 1XSNA 2HHVA 9ICKA 5KFBA 2PXIA 1X9WA 5J0SA 2PFPA 1X9XA 1PVQA 5L1IA 3MGIA 1ZD5A 1AROP 4UAWA 5KFWA 1A77A 2DL0A 2I6XA 1D8BA 5CEHA 5DDMA 4M0AA 1QLNA 3QU2A 3WU2U 2G08A 1Q3UA 4FZLA 1DOQA 2W43A 5DQIA 2XCPA 5AKEA 2BZFA 2BHNA 4F3OA 9ICFA 3SZ2A 3EPIA 3OSNA 3V6HA 2D3DA 2ZIVA 3SAFA 9ICIA 5BOLA 2ZIXA 2RLTA 5DBBA 2WF5A 2EAMA 1S8OA 4OJ6A 3LWLA 2FPKA 4C80A 1NKCA 2I1QA 4RQ1A 1XSPA 3QU4A 5KFVA 3WK4A 1A76A 3MFIA 3QUQA 1NZBA 3V7LA 5ALXA 2B0CA 1BPDA 1RYRA 2G5HB 5ALYA 4G9BA 9ICUA 4YCXA 1ZQWA 5IILA 1Z00B 2UVVA 2PMZF 3D6JA 2KVSA 5EWGA 4DS5A 5KFNA 1C7YA 2J6UA 1TK8A 2KHVA 2XC9A 1WG8A 3H8MA 4DFDA 2H3VA 2YMPA 5B5EU 4DFJA 2LYHA 2Y0SC 4UAVA 3ZD8A 4IRKA 1VJ5A 2MAXA 3IP4B 3PSFA 4YXJA 5J2AA 4ECQA 1UPHA 2HMXA 5KAIU 4RQ2A 1U48A 2IA6A 7ICMA 1ZQGA 3BQ7A 4M6WB 4UBCA 3RB4A 2VJ5A 2LKYA 1IV8A 5AIBA 3H0LB 1ZJNA 3N7PD 1N60A 2GOLA 8ICFA 2MUTA 1Z4OA 4IQTA 5KT5A 1L3SA 5AKLA 8ICWA 2YB1A 2W04A 3TAPA 5ALSA 3RB6A 2KEYA 2W8KA 2ZJ8A 1V97A 8ICKA 2BDPA 2KKPA 1MC8A 2JH7A 4KX3A 2Y9TA 3WK9A 3QEAZ 4J9OA 5AICA 2HHSA 4QWAA 2Y9UA 5F9NA 2UVWA 2G06A 1L7MA 4Z6DA 5DGBA 4Y2JA 3NS1A 3A0HU 3SMVA 2IBKA 4CCHA 1JUDA 4M47A 4JWMA 4CNQA 1XO1A 4QW8A 1ZOLA 2E1EA 2JZBA 4QZEA 3N7RC 2RHFA 2AGPA 3M6KA 5H2FU 3BDPA 7ICSA 4GIBA 2JRZA 2WAQF 1JIHA 1JMSA 4P4MA 5DGAA 3Q8RB 8ICCA 2ATLA 1K5OA 2W9CB 3KOOA 5KFMA 4YD1A 9ICGA 4IC9A 7ICIA 4UAYA 2XCAA 1TVAA 3NVYA 3JPTA 1WWVA 3M9OB 4PL1A 2KJ9A 3RAXA 1B43A 1FFUA 4NLGA 5KFHA 2PFOA 4Y2UA 3T5HA 5KT3A 2C28A 4OJ5A 2QARB 1O08A 4DO9A 3SAGA 4Q45A 1SL0A 4Z6EA 1PK3A 3H0MB 2KMDA 3LVVA 3VC8A 2KNJA 3PW5A 3TKAA 1ZQJA 4PJ0U 2M0NA 8ICRA 2W8LA 1ZQRA 2ALZA 3ZDDA 4NY8A 3HP6A 1JXEA 2LPEA 2VKQA 2BDUA 2ZUBA 1ZYQA 4RZRA 5L9XA 1B4FA 1XU4A 2ISPA 4P0QB 4RPZA 4Z6FA 4OJLA 2DWQA 5KFEA 2RRDA 4Z6CA 2Y1IA 1MQ3A 1ZQVA 2F77X 1ZETA 2BQUA 1RXVA 5AK3A 2ZIXB 4Y2YA 4Y2PA 2HBLA 2D8CA 3JPOA 2G09A 4UW9A 1VLBA 4LZDA 2YY6A 2VJ4A 3GIMA 3MR5A 3T5KA 4X5VA 1RQLA 3LVWA 3CRXA 5ALVA 4F4WA 5AKKA 4ECYA 4E0DA 1NJYA 3F5EA 4JV0A 5KFDA 2FMQA 1JXLA 4TQRA 1Q8KA 3UPQA 1U4BA 1V38A 2VA2A 2XY7A 4IQVA 4PHPA 1N56A 2HVIA 5D46A 4I2AA 3NVZA 3AQEA 2FI1A 5ALDA 5KFQA 5KFLA 3OSPA 7ICFA 4GXKA 2L5YA 4I27A 3WK7A 3HPOA 2CXYA 1ZQOA 4C8KA 2NYVA 4NWIA 2XIDA 3HILA 4KTQA 3ZD9A 4G3IA 4UB3A 8ICJA 9ICEA 3OTQA 1B22A 4ELVA 1EXNA 3QU5A 4ED3A 3TARA 2PMZC 4KMOB 5GTHU 2NRVA 5F3XB 1NOMA 3G6YA 2OHFA 3M9MB 3ZDEA 1QSLA 1S0MA 3C28A 2B6GA 3A0BU 2J6TA 1U49A 5ALRA 2GLEA 4I29A 5IIIA 4PZOA 2ESEA 5KT4A 4ACOA 2V4RA 2B21A 1S97A 2WF7A 2C2DA 2BCQA 2R8GA 2DGZA 5EE1A 4IR9A 1ZQHA 4RT2A 2ISOA 2DKZA 3H8JA 1Z1VA 5KFOA 5AKGA 1XO0A 1NK0A 2E3TA 5AIAA 1X9SA 1QQ6A 3SV3A 3ISBA 4EEKA 3PO4A 3AMZA 9ICBA 3T79A 4IS7A 5AI5A 2E8PA 3Q8PB 3PW7A 2K8CB 2ZIWA 1NJZA 4UBBA 5AKXA 7ICHA 1OW5A 2FMPA 4KMUA 5KG5A 2PI4A 4KLUA 2XVTA 1HJPA 4GC7A 4RQ0A 2LM1A 2HBMA 5AK4A 4M9JA 4KLJA 2HSZA 2PFNA 2OYYA 3OGUA 3GIIA 3IM1A 2OXOA 4F4ZA 2AQ0A 4RQ7A 4MF2A 4MFAA 1D8LA 8ICQA 5AI0A 3Q8QB 5KFTA 4RQ3A 4DL2A 2NRXA 2C2RA 3GV5B 2F1IA 3KD3A 4J03A 3AL0B 1U47A 5AKHA 1BPYA 4UB1A 3JPSA 4NLKA 4KLLA 2KOBA 3C29A 1F44A 4K4GA 4QZBA 3QXGA 3CNHA 4UARA 2BCSA 2BCUA 4I2EA 9ICJA 2EZXA 2WAQC 1COOA 1JRPA 3QZ8A 3QU9A 4FBTA 3ISCA 3RJIA 3HKZF 4OD0A 2JEFA 3TFSA 2VIXA 1LVHA 1ZQIA 4ED2A 1Z3EB 5KG2A 5T14A 3BJYA 1J2MA 2ZUCA 4EYHB 1ZRMA 5K4LA 5HP4A 4IRDA 3QZ7A 1J2NA 2ZXHA 5KFJA 7ICOA 2AQ4A 2F3NA 4US9A 4B9MA 2F44A 4YG2A 3BS5B 2WHEA 3V6JA 2FLPA 4UB4A 2ZIUA 3SENA 4BUGA 1RXWA 4F5NA 1RQNA 3AUOA 3JPRA 2DUYA 1UA0A 5J0TA 4F50A 3EPGA 1WCLA 3PY8A 5J0PA 3C23A 4M2YA 1NKBA 2ZG6A 2KN7A 3JPNA 3KZIU 3WK6A 2R8KA 3WK5A 4ECUA 8ICOA 2YB4A 5J2GA 1CUKA 1IM4A 1ZD2P 5J2KA 1KL9A 3QUCA 5IIKA 3M8SA 4FS2A 4LZGA 3F2DA 3NASA 5KAFU 4DLEA 2ASDA 4TUQA 5ALQA 2XY6A 2W03A 1S76D 2W3SA 4PGXA 4U6PA 4YFKA 4RNOA 2ZTDA 2HHTA 3MR2A 2RDIA 1KFTA 8ICYA 3M8RA 2C2EA 2F8KA 4KLHA 1RDFA 1KSPA 2KFZA 3KHHA 3KKAC 4ED1A 4OJPA 4UQGA 3DV9A 2YN4A 4F5PA 3PW4A 8ICTA 4RUCA 4CF3A 5ALFA 5J8YA 3HT3A 3BQ1A 4R65A 1A6SA 1Z19A 4C0ZA 1N5WA 3RFAA 3WKBA 8ICGA 4CE6A 4QZGA 1SKSA 3H0RB 8ICVA 3UMBA 4UAUA 2G0AA 1T4GA 3GU3A 3L4PA 1CI4A 1Y88A 5J2CA 4B9TA 2HBJA 3ZDCA 3E58A 2LMRA 4NV0A 1SZPA 4F93B 1X66A 5HHIA 3OHBA 1MQ2A 4P2HA 3QU7A 4PHDA 1T3QA 1ZQUA 1Q46A 4UB2A 3RJEA 4Y2RA 4R8UB 5DDYA 3BZKA 4J9LA 1KFSA 1ZXIA 1JX4A 1L8LA 2KV2A 5KFFA 2J6SA 4RNNA 7ICNA 4RQ8A 4HYKA 5J8YC 3TANA 3PSPA 3WKDA 4QZHA 1PK1A 5DB6A 3NRWA 3RH4A 3RR8A 3KHGA 1ECWA 3LK9A 2PI5A 2Q0ZX 2DF4B 4KN4A 4KN7A 9ICLA 5KT2A 2KFNA 2KZZA 2VA8A 3WKAA 3D2QA 2QKQA 2VA3A 2EQYA 1K1SA 4J9KA 4B9SA 5AI6A 4P0PB 1Z4NA 9ICQA 1QQ5A 3EWAA 4C8LA 4UB6U 3N28A 3V7JA 4YR0A 1SWWA 2KHQA 4KITB 3ETLA 4IQWA 3PNCA 1ZQPA 4DSIA 4DQQA 3QE9Y 2O6KA 3C1ZA 7ICRA 2QB0A 3M7DA 2N1RA 5ALZA 2R8HA 1TK5A 3RBEA 5C5JA 2K60A 3Q8MA 9ICMA 5EE0A 2DFLA 4DEZA 4DL4A 4DQIA 3KBBA 1XNSA 3AM9A 4ECZA 4JWNA 4BWMA 3QUBA 4DOCA 2G07A 4B9NA 3FYHA 1LKYA 5J2BA 4F5RA 2KIWA 3PW0A 2OM6A 3ZDBA 7ICUA 1FEZA 3FM9A 4NM2A 3TQ1A 1SV0A 4QJFB 2MU2A 5KFRA 3GILA 3G6VA 3ALRA 4O9MA 2E8OA 2HBKA 5AI4A 5AM4A 4YMNA 1S0OA 2DKXA 3QYPA 2XICA 2HDOA 2V4QA 1LB2B 4NLNA 5TISU 4KLGA 3PMNA 9ICOA 4NM1A 1QCKA 3BQTA 2W54A 3PX6A 4ED7A 2EZYA 5KFXA 3I1YA 4DFMA 5KFPA 2JHDA 4YVZA 4UATA 4FZMA 3H40A 1XC9A 3HKZC 1NKEA 1TK0A 2MRLA 4P4PA 3OPXA 4LJXA 2KSOA 4DSKA 4DL6A
chains in the Genus database with same CATH topology
1C20A 2KK0A 5CEHA 5K4LA 2RQ5A 2YQEA 2OEHA 1KQQA 2CXYA 2LM1A 2JRZA 4LJXA 1RYUA 1KN5A 2EQYA 2EH9A 2JXJA 2LI6A 1IG6A 1KKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C20 A;  2KK0 A;  5CEH A;  5K4L A;  2RQ5 A;  2YQE A;  2OEH A;  1KQQ A;  2CXY A;  2LM1 A;  2JRZ A;  4LJX A;  1RYU A;  1KN5 A;  2EQY A;  2EH9 A;  2JXJ A;  2LI6 A;  1IG6 A;  1KKX A; 
#chains in the Genus database with same CATH topology
 3TAQ A;  4DQP A;  1SV0 C;  4KLF A;  3BQ0 A;  1BPB A;  7ICK A;  1SWV A;  3AQF A;  4F72 A;  5L1J A;  2FDR A;  1D9D A;  3J81 j;  4ICA A;  2R8I A;  2WF9 A;  3RRH A;  1ZQQ A;  4A8E A;  9ICX A;  7ICP A;  2W7O A;  9ICH A;  3IRU A;  2ASJ A;  5KFC A;  2HOF A;  2IMW P;  2NRZ A;  4R66 A;  2FMS A;  3PX4 A;  1NK9 A;  3TAD A;  2ZJA A;  4P4O A;  4I2J A;  3GIJ A;  4C8O A;  2ZIV B;  3AU6 A;  4TUS A;  4B9U A;  1BNP A;  4EX6 A;  2C22 A;  4MFF A;  5D49 A;  1NK6 A;  3V7K A;  4RNM A;  4J9M A;  3UM9 A;  5AM5 A;  3KFU F;  4RU9 A;  1WUD A;  3S6J A;  1COK A;  4NL9 A;  1N62 A;  4J9N A;  3F53 A;  5IIN A;  4M9H A;  2IHN A;  3ZDA A;  1VDV A;  2DQN B;  1ZQL A;  1PZN A;  1QTM A;  1IIP A;  1SV4 A;  2H5X A;  2A1J A;  2F76 X;  3AEV A;  3PML A;  2CN1 A;  2KE7 A;  2YMM A;  3GIK A;  2EH9 A;  3C2M A;  3C5G A;  1L7O A;  4PPX A;  2ZUD A;  3IG8 A;  2AXT U;  1ZQN A;  2KJ5 A;  2UVU A;  3PR5 B;  2A1A A;  1N63 A;  4I2C A;  4UB8 U;  5J29 A;  2BPF A;  5C0Y A;  9ICT A;  4NL9 C;  2IOF K;  3EYZ A;  4I2F A;  1X9M A;  1RYU A;  1L3T A;  5DQG A;  2W9B A;  3N97 B;  3H4B A;  3F5A A;  1WCN A;  1ZQZ A;  3VCB A;  4DQR A;  2MUT B;  2ZXI A;  2KK0 A;  3ONN A;  4HAI A;  2F2A B;  5DB9 A;  4MF8 A;  4O5E A;  4AP9 A;  9ICW A;  3WK8 A;  1MA7 A;  5KG6 A;  5ALP A;  1ZD4 A;  5GTI U;  2A3V A;  4ECX A;  1UQV A;  3EW9 A;  5KT6 A;  4QWC A;  9ICR A;  2BQ3 A;  1X6I A;  2W55 A;  3RJG A;  1NK7 A;  1OUQ A;  2GH1 A;  3NVW A;  3QX7 A;  5KFU A;  5DBC A;  4DCC A;  1DRG A;  1UHU A;  4RQ5 A;  4R63 A;  4O3Q A;  4QIW F;  3H7I A;  3H8W A;  3KTQ A;  8ICU A;  9ICN A;  1XSL A;  4EZ9 A;  4UB5 A;  1L7N A;  4XUS A;  3OHA A;  2PFQ A;  5IIO A;  5L1K A;  3UQ2 A;  8ICZ A;  3ICX A;  5BOM A;  1ZQF A;  1K1Q A;  5TZV A;  5J2I A;  2HW3 A;  5AM1 A;  2ZTE A;  2KP7 A;  3SEI A;  4B9V A;  1IG6 A;  2BQR A;  2JZB B;  2Z7J A;  3WKC A;  5HR6 A;  5J2H A;  2AJQ A;  4Q8E A;  2F1J A;  3MGH A;  5EWE A;  2H3I A;  3HRD D;  1NZP A;  5ALK A;  4F91 B;  1PVP A;  4KLQ A;  4QZ8 A;  5BPC A;  3BZC A;  5ALH A;  4CGZ A;  2K4P A;  4K4I A;  5JTI A;  2R18 A;  1Z00 A;  5DG9 A;  2EZZ A;  2H3Z A;  3SR6 A;  1RM6 C;  4YD2 A;  1CEZ A;  2HOI A;  5DB7 A;  2IOF A;  1KKX A;  5KT7 A;  3H4D A;  2OWO A;  8ICE A;  2KIV A;  5AM2 A;  2JH1 A;  5HMM A;  2BR0 A;  1ZQT A;  2EAO A;  2EAP A;  3MC1 A;  3TI0 A;  3C1Y A;  2JEJ A;  3JPP A;  4QNL A;  4Y2X A;  4B6J A;  1YZ7 A;  2DPJ A;  1WWU A;  2BCR A;  4K4H A;  2KG5 A;  5KFS A;  5D4B A;  3FC4 A;  1ZQ1 C;  3QEB Z;  7ICQ A;  3V72 A;  5CJ7 A;  1KRP A;  4J9S A;  4MHV A;  3AN1 A;  1SIJ A;  2MA1 A;  3Q8K A;  2HHW A;  5IIJ A;  2W9A A;  2WFA A;  4M6W A;  2FLN A;  4XA5 A;  1UA1 A;  3RBD A;  4RQ4 A;  4O3O A;  2HHQ A;  9ICC A;  2JEI A;  1T94 A;  2CPR A;  4KX5 A;  1RZT A;  4KLI A;  2JGA A;  1A0P A;  5ALJ A;  1RG6 A;  4MFC A;  2LM4 A;  7ICG A;  2KZM A;  1SZH A;  2KD1 A;  5J0X A;  4FBU A;  5A0L A;  3L3F X;  4I2B A;  4IL6 U;  3RJF A;  5J0O A;  5ALU A;  1GO3 F;  3DDH A;  1MN8 A;  5AI8 A;  1ZQK A;  4DL7 A;  1T3N A;  2BPG A;  3SQI A;  1TAM A;  3RR7 A;  3EUB 2;  3SD7 A;  3B0Y A;  2ZJ5 A;  2CRX A;  1F5S A;  1PUZ A;  1X42 A;  3ORY A;  4F4K A;  2OH2 A;  2H3Q A;  2AGO A;  5CHG A;  8ICX A;  5CA7 A;  3BS7 A;  4I2I A;  4GC6 A;  1Q3V A;  1KW4 A;  1L8O A;  4OCZ A;  5AKJ A;  4F71 A;  4JV2 A;  4J9Q A;  4TUR A;  3RH6 A;  2R8J A;  4RPX A;  4I2D A;  2JXJ A;  2OCE A;  1BNO A;  4Y2Q A;  4DL5 A;  1SL2 A;  3K1R B;  2W11 A;  3LWM A;  2A1J B;  2RQ5 A;  5AKZ A;  2P6R A;  2W9C A;  1ED1 A;  4KLE A;  2AH5 A;  4I2H A;  4R64 A;  3RJJ A;  1ZQX A;  4RQM A;  3UXN A;  2W3R A;  2FLL A;  1C20 A;  2BPC A;  2NRW A;  1B0X A;  1XS9 D;  1SL1 A;  4QWB A;  4O3S A;  3D2S A;  4TQS A;  5ALT A;  4QZF A;  5DG8 A;  2W9B B;  1ZRN A;  2QAR A;  4IRC A;  3NUQ A;  2RDJ A;  1O03 A;  1V85 A;  4EBC A;  5IIM A;  5DG7 A;  4RQ6 A;  5DQH A;  4TUP A;  1SKR A;  4QZA A;  4ZOH C;  8ICN A;  1BVS A;  5KFY A;  5HHH A;  2ES6 A;  4C4S A;  2F8L A;  2KZ3 A;  1ZQD A;  4XRH A;  4C8M A;  2AU0 A;  4CF4 A;  2AGQ A;  1QSS A;  1N61 A;  5AHX A;  1ZQS A;  5AKY A;  1PVR A;  1JAL A;  3RH5 A;  4JB3 A;  2JV3 A;  4P0Q A;  4YXM A;  2A19 A;  4QW9 A;  7ICT A;  5KG4 A;  5E79 U;  5JRT A;  4CRX A;  1RPL A;  2GO7 A;  1MSW D;  3CW2 C;  2K4E A;  5KFG A;  1TE2 A;  3NGD A;  1V9P A;  1FFV A;  1KDH A;  2GWS A;  3K1Z A;  4QWD A;  1ZD3 A;  2ZIW B;  4DWI A;  5AK6 A;  3HWT A;  2JR5 A;  4LVS A;  2V9W A;  1H38 A;  4BDP A;  3NVV A;  4PHA A;  3G6X A;  3OJU A;  2HI0 A;  5KNI A;  4RUA A;  3F2C A;  2BCV A;  3H8S A;  1SXE A;  2WF6 A;  2HHU A;  1KLN A;  4QIW C;  3RTV A;  3MDA A;  2ZTC A;  1N5X A;  1JI7 A;  1DK3 A;  5KL1 B;  5KG7 A;  2HHX A;  2AHO B;  2JEG A;  2K4H A;  2K4I A;  2W9M A;  1LV5 A;  3E2E A;  3ED5 A;  1YT3 A;  4ELU A;  2QLT A;  4UAZ A;  2WTF A;  4O3M A;  5AM3 A;  4FO6 A;  5AM0 A;  4F2S A;  2UVR A;  1WYG A;  3RB3 A;  5CP2 A;  2D6F C;  1S10 A;  8ICH A;  3O0F A;  4EX7 A;  7ICJ A;  2M9N A;  1L7P A;  4ZH4 A;  3E0F A;  3WKE A;  1HEK A;  4O0I A;  2NO5 A;  1KN5 A;  1JRO A;  4BWJ A;  4GLX A;  3PZP A;  4BX9 C;  1L3U A;  1TFR A;  4Y2S A;  2DPI A;  4YP3 A;  5KFZ A;  4NJ8 A;  5ALO A;  5J2E A;  1NI3 A;  1RYS A;  4ELT A;  2OEH A;  2DBY A;  4NLC A;  3TAC B;  5KFI A;  4BXO A;  5J0R A;  2ZIU B;  4MEX A;  4DOB A;  1BGX T;  1KBU A;  4YR3 A;  1TAU A;  3NRZ A;  4ECW A;  4B9L A;  1ZQC A;  5JUM A;  1S9F A;  2YQE A;  9ICP A;  1X2I A;  2NRT A;  5J2F A;  4DQS A;  3F2B A;  3Q8S B;  3RF9 A;  8ICS A;  5DB8 A;  2WF8 A;  5DBA A;  4F92 B;  4M04 A;  4FE3 A;  4M9L A;  4DOA A;  3K4G A;  4JV1 A;  2YML A;  2KIC A;  1BPE A;  9ICA A;  3M6Z A;  1NJX A;  4DF4 A;  3TFR A;  2EAN A;  3M1Y A;  1S5L U;  4PGQ A;  4QZD A;  3ZI4 A;  3UQ0 A;  1M6Y A;  4XQ8 A;  5KFK A;  4PHE A;  2K89 A;  4ECV A;  5J0Y A;  2XY5 A;  3PR4 A;  4DF8 A;  4CF5 A;  4F4X A;  3MR6 A;  5KG0 A;  3IHQ B;  1NK5 A;  1ZQB A;  8ICA A;  4F8R A;  2HCF A;  2YTU A;  2XI9 A;  1ZQE A;  3B0X A;  4EBD A;  1N48 A;  5ALI A;  2JMG A;  2XO7 A;  4C7Y A;  4NLB A;  4ECS A;  1FO4 A;  1SB3 C;  4IQU A;  5L1M A;  1UT8 A;  4O5C A;  3QNM A;  3MDC A;  1HUZ A;  1BPZ A;  3GDX A;  5HML A;  3T5J A;  4C4R A;  3Q8L A;  4Q44 A;  8ICM A;  4O5K A;  3GV8 B;  4M9N A;  1ZQM A;  2QB1 A;  4FS1 A;  4KLO A;  3T5L A;  1QQ7 A;  2YMQ A;  5DKW A;  2WB1 F;  3U26 A;  3MBY A;  4I2G A;  1UT5 A;  2ODG A;  3HJE A;  1ZQA A;  4EEY A;  2Y1J A;  1DXS A;  4AYB F;  4F5O A;  2I5H A;  5J0Q A;  4ED0 A;  3ETR A;  4EYI B;  3BS5 A;  3ISD A;  3C5F A;  3IN5 A;  4DFP A;  5ALE A;  3PX0 A;  3MR3 A;  5KL8 B;  4USA A;  2I9G A;  4RT3 A;  2G5I B;  2K8A A;  3TAD C;  5CR0 A;  5J2J A;  3M9N B;  4FFD A;  8ICI A;  2FPM A;  5AI9 A;  3DEE A;  4QWE A;  4DFK A;  5ALN A;  1PK1 B;  2VAN A;  3AU2 A;  2K8B B;  1FIQ A;  1L3V A;  4O3R A;  4O3N A;  4F2R A;  3RJK A;  2FPL A;  4O3P A;  2E8M A;  1UCV A;  5ALM A;  3T3F A;  3C2K A;  1Z1B A;  5FP0 A;  4JUZ A;  1IXR A;  4KLD A;  3CYM A;  3V6K A;  3LDA A;  1S0V A;  3R9K A;  4NLZ A;  2KTQ A;  4WJ3 B;  5J0W A;  1DK2 A;  3GFK B;  3UMC A;  1AQ6 A;  4U7C A;  1YZ6 A;  5L1L A;  4YQW A;  3JPQ A;  1DGS A;  5KFA A;  2P35 A;  1TKD A;  2LYA A;  2QB0 B;  5AKI A;  2RP5 A;  2BGW A;  1DGJ A;  1SGG A;  2F1H A;  8ICP A;  1NK4 A;  1KEJ A;  4BJQ A;  4DSF A;  3KHL A;  4C7Z A;  3RJH A;  7ICE A;  4YMO A;  3RAQ A;  3GV7 B;  1P7D A;  4ECR A;  4YN4 A;  2PKE A;  5EE3 A;  2Y0S F;  4QZI A;  1LKY B;  3SI8 A;  3PVX A;  3PST A;  2IHM A;  1T8E A;  4ECT A;  1QH9 A;  9ICS A;  1KTQ A;  4FZN A;  3CP8 A;  5B66 U;  4JMU A;  1NJW A;  4DS4 A;  2E5S A;  5G5H A;  5J0U A;  3B9J A;  1ZQY A;  5KG1 A;  3LYS A;  4BXO B;  5DLF A;  4EEL A;  5KTQ A;  8ICB A;  1X40 A;  4DSE A;  4YMM A;  4I28 A;  1N2X A;  1KQQ A;  4PL2 A;  5KG3 A;  1CRX A;  3HX0 A;  1KFD A;  1NNL A;  4C8N A;  4Q43 A;  4KLS A;  2YX8 A;  7ICL A;  5ALW A;  4PH5 A;  2FE9 A;  4R8U A;  2LYB A;  5AK5 A;  4MEY A;  3C2L A;  2NV3 A;  9ICV A;  1ZJM A;  2KSO B;  4QZC A;  2H3F A;  4GXJ A;  3D2N A;  4RPY A;  5EOZ A;  3GQC A;  1F0M A;  3PSI A;  4YR2 A;  3BQ2 A;  4Q8F A;  3QUT A;  5CWR A;  5JU5 A;  3PW2 A;  5ALG A;  3K75 D;  1TV9 A;  3I28 A;  4P0P A;  3PO5 A;  1L6N A;  1OXJ A;  3UMG A;  5EE9 A;  1D8Y A;  5HNK A;  1BPX A;  4DSJ A;  7ICV A;  1QSY A;  4J9R A;  3HW8 A;  4IR1 A;  2Q4T A;  4OO1 J;  2HVH A;  4EBE A;  5HR7 A;  3MGV A;  4M9G A;  8ICL A;  3KHR A;  3GZF A;  3UXP A;  4KLT A;  2FJ6 A;  5DLG A;  1XWL A;  4J9P A;  3FDS A;  5CB1 A;  5EWF A;  3N4M B;  2E8N A;  4BGD A;  4RQN A;  2E1F A;  4PZN A;  3IDW A;  4F5Q A;  3SYZ A;  1D9F A;  3IG5 A;  4PGY A;  1JN3 A;  3UXO A;  4QZ9 A;  4DSL A;  3C21 A;  5CRX A;  4C4T A;  1SXD A;  1S77 D;  5ALL A;  3FAH A;  2KKV A;  4GXI A;  3EZ5 A;  2MSN A;  2NO4 A;  2P66 A;  2IOH A;  4ED6 A;  1HUO A;  4Y2V A;  1NK8 A;  4Y2T A;  3L5K A;  4US8 A;  2BKE A;  4CDG A;  2LI6 A;  2KVC A;  1SKW A;  3IV6 A;  4NXZ A;  2ASL A;  4EEN A;  4DLG A;  2P6U A;  1J97 A;  4JK1 A;  2EDU A;  3KKA A;  4EZ6 A;  1TAQ A;  2XGP A;  2XGQ A;  3MAB A;  1S0N A;  3SAH A;  4F4Y A;  4DL3 A;  2HOQ A;  2W7P A;  5F9L A;  3I76 A;  1L5U A;  3SV4 A;  4OJO A;  2LBO A;  3NTU A;  2LHT A;  1T7P A;  5G5G A;  3KZX A;  3THV A;  4KLM A;  1URJ A;  2KJ8 A;  3RB0 A;  3OJS A;  2WB1 C;  1U9L A;  3N7S C;  3PV8 A;  3RRG A;  4ED8 A;  1U45 A;  1X6J A;  4UAS A;  4GFJ A;  4AYB C;  1HIW A;  3MFH A;  5J2D A;  1XSN A;  2HHV A;  9ICK A;  5KFB A;  2PXI A;  1X9W A;  5J0S A;  2PFP A;  1X9X A;  1PVQ A;  5L1I A;  3MGI A;  1ZD5 A;  1ARO P;  4UAW A;  5KFW A;  1A77 A;  2DL0 A;  2I6X A;  1D8B A;  5CEH A;  5DDM A;  4M0A A;  1QLN A;  3QU2 A;  3WU2 U;  2G08 A;  1Q3U A;  4FZL A;  1DOQ A;  2W43 A;  5DQI A;  2XCP A;  5AKE A;  2BZF A;  2BHN A;  4F3O A;  9ICF A;  3SZ2 A;  3EPI A;  3OSN A;  3V6H A;  2D3D A;  2ZIV A;  3SAF A;  9ICI A;  5BOL A;  2ZIX A;  2RLT A;  5DBB A;  2WF5 A;  2EAM A;  1S8O A;  4OJ6 A;  3LWL A;  2FPK A;  4C80 A;  1NKC A;  2I1Q A;  4RQ1 A;  1XSP A;  3QU4 A;  5KFV A;  3WK4 A;  1A76 A;  3MFI A;  3QUQ A;  1NZB A;  3V7L A;  5ALX A;  2B0C A;  1BPD A;  1RYR A;  2G5H B;  5ALY A;  4G9B A;  9ICU A;  4YCX A;  1ZQW A;  5IIL A;  1Z00 B;  2UVV A;  2PMZ F;  3D6J A;  2KVS A;  5EWG A;  4DS5 A;  5KFN A;  1C7Y A;  2J6U A;  1TK8 A;  2KHV A;  2XC9 A;  1WG8 A;  3H8M A;  4DFD A;  2H3V A;  2YMP A;  5B5E U;  4DFJ A;  2LYH A;  2Y0S C;  4UAV A;  3ZD8 A;  4IRK A;  1VJ5 A;  2MAX A;  3IP4 B;  3PSF A;  4YXJ A;  5J2A A;  4ECQ A;  1UPH A;  2HMX A;  5KAI U;  4RQ2 A;  1U48 A;  2IA6 A;  7ICM A;  1ZQG A;  3BQ7 A;  4M6W B;  4UBC A;  3RB4 A;  2VJ5 A;  2LKY A;  1IV8 A;  5AIB A;  3H0L B;  1ZJN A;  3N7P D;  1N60 A;  2GOL A;  8ICF A;  2MUT A;  1Z4O A;  4IQT A;  5KT5 A;  1L3S A;  5AKL A;  8ICW A;  2YB1 A;  2W04 A;  3TAP A;  5ALS A;  3RB6 A;  2KEY A;  2W8K A;  2ZJ8 A;  1V97 A;  8ICK A;  2BDP A;  2KKP A;  1MC8 A;  2JH7 A;  4KX3 A;  2Y9T A;  3WK9 A;  3QEA Z;  4J9O A;  5AIC A;  2HHS A;  4QWA A;  2Y9U A;  5F9N A;  2UVW A;  2G06 A;  1L7M A;  4Z6D A;  5DGB A;  4Y2J A;  3NS1 A;  3A0H U;  3SMV A;  2IBK A;  4CCH A;  1JUD A;  4M47 A;  4JWM A;  4CNQ A;  1XO1 A;  4QW8 A;  1ZOL A;  2E1E A;  2JZB A;  4QZE A;  3N7R C;  2RHF A;  2AGP A;  3M6K A;  5H2F U;  3BDP A;  7ICS A;  4GIB A;  2JRZ A;  2WAQ F;  1JIH A;  1JMS A;  4P4M A;  5DGA A;  3Q8R B;  8ICC A;  2ATL A;  1K5O A;  2W9C B;  3KOO A;  5KFM A;  4YD1 A;  9ICG A;  4IC9 A;  7ICI A;  4UAY A;  2XCA A;  1TVA A;  3NVY A;  3JPT A;  1WWV A;  3M9O B;  4PL1 A;  2KJ9 A;  3RAX A;  1B43 A;  1FFU A;  4NLG A;  5KFH A;  2PFO A;  4Y2U A;  3T5H A;  5KT3 A;  2C28 A;  4OJ5 A;  2QAR B;  1O08 A;  4DO9 A;  3SAG A;  4Q45 A;  1SL0 A;  4Z6E A;  1PK3 A;  3H0M B;  2KMD A;  3LVV A;  3VC8 A;  2KNJ A;  3PW5 A;  3TKA A;  1ZQJ A;  4PJ0 U;  2M0N A;  8ICR A;  2W8L A;  1ZQR A;  2ALZ A;  3ZDD A;  4NY8 A;  3HP6 A;  1JXE A;  2LPE A;  2VKQ A;  2BDU A;  2ZUB A;  1ZYQ A;  4RZR A;  5L9X A;  1B4F A;  1XU4 A;  2ISP A;  4P0Q B;  4RPZ A;  4Z6F A;  4OJL A;  2DWQ A;  5KFE A;  2RRD A;  4Z6C A;  2Y1I A;  1MQ3 A;  1ZQV A;  2F77 X;  1ZET A;  2BQU A;  1RXV A;  5AK3 A;  2ZIX B;  4Y2Y A;  4Y2P A;  2HBL A;  2D8C A;  3JPO A;  2G09 A;  4UW9 A;  1VLB A;  4LZD A;  2YY6 A;  2VJ4 A;  3GIM A;  3MR5 A;  3T5K A;  4X5V A;  1RQL A;  3LVW A;  3CRX A;  5ALV A;  4F4W A;  5AKK A;  4ECY A;  4E0D A;  1NJY A;  3F5E A;  4JV0 A;  5KFD A;  2FMQ A;  1JXL A;  4TQR A;  1Q8K A;  3UPQ A;  1U4B A;  1V38 A;  2VA2 A;  2XY7 A;  4IQV A;  4PHP A;  1N56 A;  2HVI A;  5D46 A;  4I2A A;  3NVZ A;  3AQE A;  2FI1 A;  5ALD A;  5KFQ A;  5KFL A;  3OSP A;  7ICF A;  4GXK A;  2L5Y A;  4I27 A;  3WK7 A;  3HPO A;  2CXY A;  1ZQO A;  4C8K A;  2NYV A;  4NWI A;  2XID A;  3HIL A;  4KTQ A;  3ZD9 A;  4G3I A;  4UB3 A;  8ICJ A;  9ICE A;  3OTQ A;  1B22 A;  4ELV A;  1EXN A;  3QU5 A;  4ED3 A;  3TAR A;  2PMZ C;  4KMO B;  5GTH U;  2NRV A;  5F3X B;  1NOM A;  3G6Y A;  2OHF A;  3M9M B;  3ZDE A;  1QSL A;  1S0M A;  3C28 A;  2B6G A;  3A0B U;  2J6T A;  1U49 A;  5ALR A;  2GLE A;  4I29 A;  5III A;  4PZO A;  2ESE A;  5KT4 A;  4ACO A;  2V4R A;  2B21 A;  1S97 A;  2WF7 A;  2C2D A;  2BCQ A;  2R8G A;  2DGZ A;  5EE1 A;  4IR9 A;  1ZQH A;  4RT2 A;  2ISO A;  2DKZ A;  3H8J A;  1Z1V A;  5KFO A;  5AKG A;  1XO0 A;  1NK0 A;  2E3T A;  5AIA A;  1X9S A;  1QQ6 A;  3SV3 A;  3ISB A;  4EEK A;  3PO4 A;  3AMZ A;  9ICB A;  3T79 A;  4IS7 A;  5AI5 A;  2E8P A;  3Q8P B;  3PW7 A;  2K8C B;  2ZIW A;  1NJZ A;  4UBB A;  5AKX A;  7ICH A;  1OW5 A;  2FMP A;  4KMU A;  5KG5 A;  2PI4 A;  4KLU A;  2XVT A;  1HJP A;  4GC7 A;  4RQ0 A;  2LM1 A;  2HBM A;  5AK4 A;  4M9J A;  4KLJ A;  2HSZ A;  2PFN A;  2OYY A;  3OGU A;  3GII A;  3IM1 A;  2OXO A;  4F4Z A;  2AQ0 A;  4RQ7 A;  4MF2 A;  4MFA A;  1D8L A;  8ICQ A;  5AI0 A;  3Q8Q B;  5KFT A;  4RQ3 A;  4DL2 A;  2NRX A;  2C2R A;  3GV5 B;  2F1I A;  3KD3 A;  4J03 A;  3AL0 B;  1U47 A;  5AKH A;  1BPY A;  4UB1 A;  3JPS A;  4NLK A;  4KLL A;  2KOB A;  3C29 A;  1F44 A;  4K4G A;  4QZB A;  3QXG A;  3CNH A;  4UAR A;  2BCS A;  2BCU A;  4I2E A;  9ICJ A;  2EZX A;  2WAQ C;  1COO A;  1JRP A;  3QZ8 A;  3QU9 A;  4FBT A;  3ISC A;  3RJI A;  3HKZ F;  4OD0 A;  2JEF A;  3TFS A;  2VIX A;  1LVH A;  1ZQI A;  4ED2 A;  1Z3E B;  5KG2 A;  5T14 A;  3BJY A;  1J2M A;  2ZUC A;  4EYH B;  1ZRM A;  5K4L A;  5HP4 A;  4IRD A;  3QZ7 A;  1J2N A;  2ZXH A;  5KFJ A;  7ICO A;  2AQ4 A;  2F3N A;  4US9 A;  4B9M A;  2F44 A;  4YG2 A;  3BS5 B;  2WHE A;  3V6J A;  2FLP A;  4UB4 A;  2ZIU A;  3SEN A;  4BUG A;  1RXW A;  4F5N A;  1RQN A;  3AUO A;  3JPR A;  2DUY A;  1UA0 A;  5J0T A;  4F50 A;  3EPG A;  1WCL A;  3PY8 A;  5J0P A;  3C23 A;  4M2Y A;  1NKB A;  2ZG6 A;  2KN7 A;  3JPN A;  3KZI U;  3WK6 A;  2R8K A;  3WK5 A;  4ECU A;  8ICO A;  2YB4 A;  5J2G A;  1CUK A;  1IM4 A;  1ZD2 P;  5J2K A;  1KL9 A;  3QUC A;  5IIK A;  3M8S A;  4FS2 A;  4LZG A;  3F2D A;  3NAS A;  5KAF U;  4DLE A;  2ASD A;  4TUQ A;  5ALQ A;  2XY6 A;  2W03 A;  1S76 D;  2W3S A;  4PGX A;  4U6P A;  4YFK A;  4RNO A;  2ZTD A;  2HHT A;  3MR2 A;  2RDI A;  1KFT A;  8ICY A;  3M8R A;  2C2E A;  2F8K A;  4KLH A;  1RDF A;  1KSP A;  2KFZ A;  3KHH A;  3KKA C;  4ED1 A;  4OJP A;  4UQG A;  3DV9 A;  2YN4 A;  4F5P A;  3PW4 A;  8ICT A;  4RUC A;  4CF3 A;  5ALF A;  5J8Y A;  3HT3 A;  3BQ1 A;  4R65 A;  1A6S A;  1Z19 A;  4C0Z A;  1N5W A;  3RFA A;  3WKB A;  8ICG A;  4CE6 A;  4QZG A;  1SKS A;  3H0R B;  8ICV A;  3UMB A;  4UAU A;  2G0A A;  1T4G A;  3GU3 A;  3L4P A;  1CI4 A;  1Y88 A;  5J2C A;  4B9T A;  2HBJ A;  3ZDC A;  3E58 A;  2LMR A;  4NV0 A;  1SZP A;  4F93 B;  1X66 A;  5HHI A;  3OHB A;  1MQ2 A;  4P2H A;  3QU7 A;  4PHD A;  1T3Q A;  1ZQU A;  1Q46 A;  4UB2 A;  3RJE A;  4Y2R A;  4R8U B;  5DDY A;  3BZK A;  4J9L A;  1KFS A;  1ZXI A;  1JX4 A;  1L8L A;  2KV2 A;  5KFF A;  2J6S A;  4RNN A;  7ICN A;  4RQ8 A;  4HYK A;  5J8Y C;  3TAN A;  3PSP A;  3WKD A;  4QZH A;  1PK1 A;  5DB6 A;  3NRW A;  3RH4 A;  3RR8 A;  3KHG A;  1ECW A;  3LK9 A;  2PI5 A;  2Q0Z X;  2DF4 B;  4KN4 A;  4KN7 A;  9ICL A;  5KT2 A;  2KFN A;  2KZZ A;  2VA8 A;  3WKA A;  3D2Q A;  2QKQ A;  2VA3 A;  2EQY A;  1K1S A;  4J9K A;  4B9S A;  5AI6 A;  4P0P B;  1Z4N A;  9ICQ A;  1QQ5 A;  3EWA A;  4C8L A;  4UB6 U;  3N28 A;  3V7J A;  4YR0 A;  1SWW A;  2KHQ A;  4KIT B;  3ETL A;  4IQW A;  3PNC A;  1ZQP A;  4DSI A;  4DQQ A;  3QE9 Y;  2O6K A;  3C1Z A;  7ICR A;  2QB0 A;  3M7D A;  2N1R A;  5ALZ A;  2R8H A;  1TK5 A;  3RBE A;  5C5J A;  2K60 A;  3Q8M A;  9ICM A;  5EE0 A;  2DFL A;  4DEZ A;  4DL4 A;  4DQI A;  3KBB A;  1XNS A;  3AM9 A;  4ECZ A;  4JWN A;  4BWM A;  3QUB A;  4DOC A;  2G07 A;  4B9N A;  3FYH A;  1LKY A;  5J2B A;  4F5R A;  2KIW A;  3PW0 A;  2OM6 A;  3ZDB A;  7ICU A;  1FEZ A;  3FM9 A;  4NM2 A;  3TQ1 A;  1SV0 A;  4QJF B;  2MU2 A;  5KFR A;  3GIL A;  3G6V A;  3ALR A;  4O9M A;  2E8O A;  2HBK A;  5AI4 A;  5AM4 A;  4YMN A;  1S0O A;  2DKX A;  3QYP A;  2XIC A;  2HDO A;  2V4Q A;  1LB2 B;  4NLN A;  5TIS U;  4KLG A;  3PMN A;  9ICO A;  4NM1 A;  1QCK A;  3BQT A;  2W54 A;  3PX6 A;  4ED7 A;  2EZY A;  5KFX A;  3I1Y A;  4DFM A;  5KFP A;  2JHD A;  4YVZ A;  4UAT A;  4FZM A;  3H40 A;  1XC9 A;  3HKZ C;  1NKE A;  1TK0 A;  2MRL A;  4P4P A;  3OPX A;  4LJX A;  2KSO A;  4DSK A;  4DL6 A; 
#chains in the Genus database with same CATH homology
 1C20 A;  2KK0 A;  5CEH A;  5K4L A;  2RQ5 A;  2YQE A;  2OEH A;  1KQQ A;  2CXY A;  2LM1 A;  2JRZ A;  4LJX A;  1RYU A;  1KN5 A;  2EQY A;  2EH9 A;  2JXJ A;  2LI6 A;  1IG6 A;  1KKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...