1KN5A

Solution structure of arid domain of adr6 from saccharomyces cerevisiae
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
102
structure length
102
Chain Sequence
NNKQYELFMKSLIENCKKRNMPLQSIPEIGNRKINLFYLYMLVQKFGGADQVTRTQQWSMVAQRLQISDYQQLESIYFRILLPYERHMISQEGIKETQAKRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription regulatory protein ADR6
publication title 1H, 13C and 15N resonance assignments and secondary structure of ADR6 DNA-binding domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 19
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2001-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 1kn5A00
1KQQA 2EH9A 2JXJA 2OEHA 2KK0A 2RQ5A 2YQEA 4LJXA 1IG6A 2CXYA 1C20A 2LM1A 2JRZA 5K4LA 5CEHA 2EQYA 2LI6A 1RYUA 1KKXA 1KN5A
chains in the Genus database with same CATH superfamily
2ESEA 1Q3UA 3WKEA 2PFOA 5J0SA 8ICJA 2KHVA 4TURA 8ICEA 4DO9A 1PUZA 2HVIA 8ICQA 3ZD9A 1SL2A 2K60A 1TFRA 3AMZA 4NLZA 1T94A 3QU5A 5AKZA 2HOIA 5ALKA 2ATLA 3HJEA 2IOHA 1KN5A 1T4GA 3Q8SB 3ZDEA 4PGYA 1CRXA 4YR0A 5HR6A 2LMRA 5D49A 4DSEA 2KEYA 2PMZF 4CRXA 3TFSA 3SV4A 2ZIVB 3PR5B 5KFAA 3OGUA 2ASJA 3TARA 2DL0A 4NWIA 4ACOA 3Q8QB 3G6VA 5DKWA 1OXJA 5DGBA 4KX5A 4XQ8A 1PVQA 3UXOA 2XO7A 9ICJA 1PK1A 4DQIA 2BCUA 3D2QA 1TKDA 1KW4A 3B0XA 4F5OA 2Y1JA 2MA1A 2JEFA 5CEHA 2ZUBA 5KFDA 2P6RA 3HWTA 4JV0A 1TAMA 3M6KA 5KFQA 3BQ7A 1TK0A 3GIMA 4I2FA 2HHVA 5KT5A 2UVRA 4J9SA 3LK9A 2R8HA 3WK7A 1BPYA 2DQNB 4JMUA 1ZD3A 4EELA 5DBBA 3C2MA 4F5NA 3PX4A 4TUQA 4EEKA 1WG8A 4U7CA 4KITB 2LYAA 1L3UA 4FZNA 2K4EA 4QIWC 5ALGA 4UB1A 4RQ8A 3QEBZ 5B66U 3GIJA 4GXJA 3KKAA 4RQ4A 4MF2A 5EWGA 2WB1F 3QX7A 9ICKA 1WWVA 3TAPA 1Y88A 1KLNA 4ELTA 4GXKA 2I5HA 5AICA 3MABA 1L7PA 2LHTA 4O3QA 3KHGA 4M9NA 3RF9A 3E58A 2HHWA 5AI0A 4J9PA 5TISU 5J0WA 2LM1A 1K1QA 4YN4A 3C28A 4MEXA 5GTHU 1S97A 1RYSA 3MR2A 1SL1A 2GLEA 5ALQA 4DL5A 4ZOHC 4UATA 1FFUA 2KV2A 2ZXIA 3M7DA 5AM2A 2K8BB 7ICVA 1HUOA 4IS7A 2H3QA 4IQTA 2MRLA 1ZQGA 2FDRA 4DLEA 1DGSA 2W3RA 2NRTA 3UMGA 2DWQA 2W54A 1ZQOA 4O5KA 4IC9A 1ZQZA 2KVSA 4QW8A 2W9CA 4KLGA 5G5HA 3NRWA 4PGXA 5J2GA 5ALPA 1NK0A 3G6XA 2LBOA 4K4GA 4USAA 3ALRA 2FLLA 2AXTU 2JXJA 4QZDA 5KFVA 4I2EA 4B9NA 3MC1A 2WHEA 1UHUA 3FAHA 2KSOA 5KG3A 2AQ0A 4HYKA 2WF8A 5KFEA 1FIQA 3NVZA 3EYZA 3RJIA 2DKZA 3Q8RB 2JR5A 1PK1B 3KKAC 2PFPA 3UXPA 2HBLA 1FO4A 2QB0A 3NTUA 3A0HU 1Z1VA 5KL1B 3I1YA 1IM4A 4DQSA 1NKEA 1S8OA 4UB4A 2EDUA 1QLNA 8ICVA 1X2IA 3RBEA 1JX4A 3CRXA 2J6SA 2K4IA 3OTQA 1RPLA 3RTVA 2PFNA 4Z6EA 3SMVA 1ZJNA 3WKBA 1XC9A 2F1HA 2E8NA 4GFJA 3E0FA 4KN4A 1EXNA 4FZMA 3ISBA 3TAQA 3ZDCA 4PHDA 2ZJ8A 2XC9A 3C1YA 4PL1A 1X9XA 1SB3C 2OH2A 4IR9A 1KFSA 3LYSA 8ICLA 1V85A 3NUQA 3RR8A 4PZNA 4Z6DA 3HP6A 3QUCA 4DQPA 4M9HA 2KJ8A 3H8MA 4F71A 2PI4A 9ICLA 4YMNA 4JV2A 2D3DA 2HDOA 9ICBA 1LKYA 2MU2A 4QW9A 3ED5A 5GTIU 4FS1A 3MBYA 1ZQRA 1VLBA 1NK4A 9ICEA 3U26A 5CJ7A 2LI6A 2FI1A 5KFIA 3QUBA 4QZCA 3HRDD 4NLNA 2CRXA 4PHEA 2DGZA 5DBCA 5KFSA 4I27A 1ZQVA 1GO3F 3OPXA 2FMSA 2V4QA 4PL2A 5BPCA 4F50A 2EAPA 3KZXA 1JIHA 3GU3A 5F9LA 4KLHA 4ECVA 4F4XA 2NRXA 1KKXA 4X5VA 2W11A 4ICAA 1LV5A 4TQRA 2YMMA 3H0RB 1L3TA 5KL8B 2IHMA 3B0YA 4YMMA 4DOBA 2WF9A 4OD0A 3RJHA 1DK3A 2AGQA 2QB1A 4P0PA 2Y0SC 4NL9C 1N62A 2HHQA 3M6ZA 4Z6CA 4I2CA 4I29A 3QNMA 2BR0A 1ZQEA 5C0YA 4ED3A 5DDYA 1TV9A 5KFPA 4B9UA 1UCVA 2KSOB 3V72A 1JALA 2KK0A 2R8JA 2E5SA 3H8JA 2ZXHA 1XO0A 1FEZA 1ZD2P 4MFAA 1QTMA 4Y2PA 2K8CB 5AKXA 5AK6A 2XI9A 3RB3A 3BQ2A 4DSJA 7ICUA 3O0FA 4ELUA 2G5HB 4UAWA 4KLOA 4Y2QA 2HHUA 2QB0B 4M04A 1CI4A 2KKVA 2JGAA 3N97B 1ZD5A 2GWSA 1RG6A 1QSLA 1ZQFA 3QUQA 2J6UA 2E1FA 1C20A 5DLGA 1D8BA 1DRGA 4OCZA 3QEAZ 2ISOA 1ZXIA 5AKYA 4B6JA 4P4MA 3S6JA 1Z19A 5CRXA 3NVYA 2H5XA 5KFMA 1DGJA 3PW5A 3NASA 2YMQA 3SAHA 3T5KA 2P6UA 5AM5A 1DXSA 4UQGA 4IRKA 3DV9A 4QZ9A 3RH6A 2OXOA 5KAIU 2BKEA 5EOZA 1MN8A 3GILA 3BS7A 1WUDA 4EZ9A 5AIAA 4P4PA 1ZQTA 1KFDA 3J81j 3MR3A 4I2DA 1S9FA 1NJXA 5EE1A 2YN4A 1H38A 4QWBA 5HP4A 4NLBA 2K4HA 5BOLA 1LKYB 4C80A 4ED0A 4M9GA 1BNPA 4ECXA 2ZTCA 1SV0C 4BWMA 4AYBF 4J9RA 3FDSA 9ICAA 5KG4A 3SR6A 3DDHA 4UASA 3RRHA 4KTQA 5ALNA 5AKEA 5KFKA 5F9NA 1KSPA 3PSTA 3GZFA 1RYUA 2RDJA 3PR4A 5J0UA 1SKWA 1NK5A 2BPFA 1L6NA 4QZFA 3V6KA 5KFOA 4NXZA 2HVHA 4GIBA 4UAZA 2RRDA 1C7YA 4M0AA 4DS4A 1QSSA 5IILA 4UB8U 4EEYA 2BPGA 2PFQA 3PMLA 3MR6A 4M47A 4DFMA 3K1RB 4P0PB 2OEHA 3TQ1A 1VJ5A 8ICXA 4LJXA 1M6YA 4IQWA 1B43A 4ECRA 3IHQB 1ZOLA 4ED7A 2EANA 3SAGA 5J0XA 4UBCA 3F53A 5KG1A 3FM9A 2XCAA 3AUOA 3CW2C 3MR5A 2ZIWA 3JPSA 3PX0A 3AU6A 2KN7A 1S0NA 3WK4A 2RLTA 1NK7A 3FYHA 3T5HA 2LYHA 2P35A 4DFDA 4F2SA 2KICA 5HR7A 1QCKA 2BCVA 2B0CA 5KAFU 3D2SA 2CPRA 3BQ0A 1S77D 4QZ8A 5T14A 2PMZC 2NRWA 3PNCA 4RT3A 3UQ0A 4UAVA 4RQ0A 4NV0A 1BPXA 2ZTEA 4EZ6A 7ICLA 3LWLA 4M6WA 3MGIA 1QQ5A 5ALEA 1ZQQA 4RQ2A 3KHRA 5HHHA 3H0LB 1ZQMA 5AI5A 4NLCA 4C8OA 4DOCA 4Q8EA 2B21A 4Q8FA 1TK5A 9ICPA 4Y2VA 3QZ7A 1U9LA 1VDVA 7ICKA 7ICSA 1HJPA 3FC4A 7ICOA 1KQQA 4KLUA 4B9LA 8ICWA 4F4WA 2LM4A 2PKEA 2NV3A 7ICPA 5KG5A 1SWWA 1Q3VA 3ZDBA 1Z4OA 3HT3A 4G3IA 4DL6A 1ZQ1C 1HIWA 3EPGA 1RQNA 8ICAA 2IOFK 4K4HA 4DEZA 5ALZA 4U6PA 4EENA 4YXMA 3T5LA 1NZBA 8ICBA 1IXRA 4BJQA 5ALYA 5KT6A 7ICMA 1ZQNA 1SZHA 5ALXA 4RPYA 1WCLA 5DDMA 2WB1C 2HBJA 2KTQA 5AHXA 5DB6A 1X40A 2BQ3A 5ALVA 3ICXA 1JXLA 1TK8A 1NNLA 3TACB 1NJYA 2XICA 5H2FU 4UARA 4OJ5A 1HEKA 4ECYA 1A6SA 3TADC 1S76D 2E8PA 1L3SA 5G5GA 4US8A 5ALJA 5IIIA 2P66A 3EZ5A 2M0NA 4PGQA 1U4BA 1L7OA 1SXDA 4MFFA 3ETRA 1CEZA 4F5RA 2BCRA 5KFWA 3PO4A 3ISDA 2ZIWB 3OSPA 2KVCA 3KOOA 1JN3A 1XWLA 1RM6C 1KEJA 1L8LA 1X42A 5JU5A 2I6XA 2MSNA 2AGPA 1NJZA 1BVSA 5AKLA 3Q8KA 4F4KA 1RXVA 4J9OA 2JEJA 4LZGA 2A1JB 3UM9A 4Q44A 2ASDA 2RP5A 4TQSA 4RQMA 4QZEA 2L5YA 4M6WB 3HKZF 2W7PA 3UMBA 3EWAA 3IRUA 5IIJA 4B9SA 3ONNA 4RNMA 5ALLA 3ISCA 3QU4A 4BXOA 4BUGA 2FMPA 3QXGA 4O3OA 5B5EU 2HBMA 3KFUF 1D9FA 3AN1A 8ICKA 4YMOA 2VJ4A 2GO7A 4R8UA 2ZG6A 2J6TA 2CXYA 4Y2UA 1KFTA 4CF3A 4IRCA 3RB4A 2F3NA 3HILA 2EZYA 3BQTA 1MSWD 4YD2A 2R8GA 4QZBA 4GC6A 3G6YA 2BCQA 1NZPA 3PV8A 5DB7A 2NYVA 5AKJA 3OJSA 1N63A 1S5LU 1ZRMA 5KT7A 4O5CA 5IIOA 4F93B 2PI5A 5IIKA 3NS1A 3V7LA 1YT3A 2EZXA 1COKA 4PPXA 4M9JA 4EX6A 5A0LA 5KFGA 2UVUA 4O9MA 4IR1A 1QH9A 2F76X 4RQ6A 5AI4A 3E2EA 3T3FA 4OJPA 3PY8A 5L1JA 4DSLA 4ED6A 3AL0B 5EE9A 1ZQHA 8ICNA 4MFCA 2HHXA 1NI3A 1T8EA 2ZUDA 1A0PA 4NLGA 2C2EA 2HI0A 4YR3A 4J9NA 1N60A 4UAYA 3V7JA 3TFRA 2G06A 8ICFA 1ZJMA 1X6IA 4QNLA 2FE9A 2Y9UA 2W8LA 1X6JA 1U49A 1PVRA 3THVA 2A19A 2DPJA 3MGHA 1ED1A 4F3OA 4R66A 4NL9A 3WK8A 2QLTA 2ZIXA 3JPTA 2MUTA 4EYHB 4DSKA 3PW4A 3UMCA 2FLPA 1X9MA 2YY6A 1F44A 2VKQA 1OW5A 4I2GA 4UW9A 4YCXA 7ICEA 4F2RA 2E3TA 5KFRA 3QE9Y 3QU7A 4CF4A 2W55A 1JXEA 2DF4B 2HMXA 1ZQKA 2JZBA 1UPHA 1T3QA 3M9NB 4IL6U 4KLFA 1IG6A 2AGOA 4KMUA 1S0MA 2DBYA 4C8NA 3VCBA 5J2HA 3AQEA 1N56A 2HHSA 4BXOB 2H3VA 2VA2A 2BPCA 2UVVA 3PVXA 4R8UB 5CHGA 4O5EA 1ZQJA 3RFAA 4WJ3B 4ELVA 2BGWA 1D8YA 2NRVA 5AKHA 4CDGA 5J0OA 5J0RA 3ZD8A 4ED1A 4RQ5A 1COOA 2KJ5A 3H0MB 1Q46A 4F4ZA 2BQRA 3K4GA 1NJWA 1SL0A 1NK6A 3M8SA 1LVHA 4YXJA 5AIBA 3SYZA 2ZJAA 1IV8A 2AHOB 3D6JA 4OJOA 4KX3A 2KFZA 3PSPA 2IMWP 2HBKA 1SV0A 5AKIA 5AKKA 5AKGA 3JPPA 4DF4A 2AU0A 1YZ6A 4EBCA 1D8LA 1V38A 3KBBA 1JROA 5ALIA 4K4IA 1J2MA 4LVSA 4JWMA 2HHTA 2LPEA 2YMPA 3GV5B 4FE3A 4C7ZA 9ICXA 5KFNA 5DBAA 1L7MA 4AYBC 5ALWA 1ZQCA 2HW3A 2I1QA 2OWOA 4FS2A 1RXWA 3RH4A 3JPRA 8ICHA 7ICQA 4FFDA 4O0IA 2F44A 1RYRA 1NK9A 9ICHA 1OUQA 2ZIXB 4GXIA 2MUTB 3RB6A 2VIXA 3ZI4A 2W43A 4IRDA 1KL9A 1SWVA 2KIVA 1S10A 3IDWA 3SZ2A 2F77X 3BDPA 1BPDA 4KMOB 2ISPA 9ICFA 1A76A 1N5WA 4IQUA 1Z1BA 3CP8A 1B22A 3AU2A 1ZQUA 2VA8A 4MHVA 4JV1A 2JZBB 4DSFA 1S0OA 3I76A 1S0VA 3GV8B 4ECWA 5ALHA 4J9QA 2KZMA 1AQ6A 3C5GA 4GC7A 3PX6A 2WF7A 5C5JA 2I9GA 4UBBA 4F92B 4DQQA 1RDFA 4DS5A 1ZQSA 1TVAA 5EWFA 1O08A 5KT2A 3N4MB 1LB2B 5EWEA 2DPIA 9ICGA 2OM6A 3RBDA 5DGAA 1UA1A 2ZUCA 4US9A 1WWUA 3N7SC 4O3MA 4P2HA 3TI0A 8ICGA 2QARA 2LKYA 1L3VA 4Q45A 2H3ZA 3Q8MA 3LWMA 2YX8A 2GOLA 1N48A 3F2DA 2RDIA 2ZJ5A 4YR2A 1A77A 4PH5A 5JUMA 1ZD4A 5AK3A 3ORYA 4ED8A 5IIMA 2EZZA 5D46A 2OCEA 2E8MA 2KOBA 2EH9A 2A3VA 2XIDA 7ICHA 4QWEA 4Y2YA 2HOQA 7ICGA 3DEEA 2O6KA 2F2AB 3WK5A 3BQ1A 3BS5A 4R63A 1Z00A 4RUAA 2XGQA 3SI8A 4CNQA 2KJ9A 5L9XA 4ECUA 4F4YA 2BZFA 2W9MA 4KLMA 3R9KA 3SV3A 1BPZA 2FJ6A 4MEYA 5F3XB 3PO5A 4DL3A 5KFXA 5KG0A 2XCPA 1SV4A 3MFIA 1SXEA 2HSZA 4TUSA 2E8OA 3TKAA 3A0BU 1SZPA 5E79U 2A1JA 2KZZA 4O3SA 9ICIA 5HHIA 5EE0A 3GV7B 4Z6FA 5KFHA 5J0QA 8ICUA 4DF8A 3TADA 2XVTA 3IP4B 4JB3A 4LZDA 1BPBA 2R8IA 3T79A 2WF6A 5KFFA 2YTUA 9ICSA 4NLKA 4Y2RA 1FFVA 4RNNA 5AM1A 2JRZA 4J9LA 2KD1A 1JMSA 1N2XA 7ICJA 5CP2A 1XSNA 4F5QA 4M2YA 1IIPA 3PZPA 3GQCA 3PW2A 2AJQA 5J2CA 5DQHA 4NM1A 4O3NA 4RPXA 2AH5A 4C4SA 4UAUA 5KG6A 2F8LA 8ICSA 1UT5A 4PZOA 2K8AA 5J2FA 3NGDA 4IQVA 4QJFB 5DB8A 1F0MA 2V9WA 4I28A 3VC8A 2Q4TA 3RAXA 3AEVA 1J97A 3MDAA 3TANA 1NOMA 4I2AA 3L3FX 3IG5A 2DFLA 5DB9A 2IA6A 2E1EA 3EPIA 3RRGA 2GH1A 2QKQA 2IHNA 4ZH4A 2QARB 5KTQA 4EYIB 5J0TA 3HKZC 4YVZA 2F1IA 5BOMA 2KMDA 3L4PA 2F8KA 2R8KA 5KT4A 9ICOA 5KG2A 2FPLA 1U47A 1SKRA 5IINA 3AM9A 3ZDAA 3NVVA 4Y2XA 1K1SA 2FPMA 5JTIA 1XU4A 4RQ7A 3PW7A 8ICPA 3M8RA 3KHLA 2WAQF 2DKXA 1PK3A 4B9VA 4KLLA 5KFCA 3BS5B 2JH1A 4B9MA 1Z00B 2VANA 5J0PA 4RQ3A 3CNHA 4RNOA 2KFNA 1KTQA 5AM0A 4RQ1A 4CCHA 5D4BA 2BQUA 3WKCA 4P4OA 2DUYA 5KFZA 2YQEA 4AP9A 8ICOA 9ICRA 4RQNA 1O03A 4MF8A 5AM3A 2NRZA 3GDXA 5J2IA 3H7IA 5ALUA 8ICTA 2PXIA 3QU2A 3RR7A 3UQ2A 1J2NA 2HOFA 2H3FA 2YB1A 2FPKA 1TAQA 4QZAA 2W9AA 4I2HA 3F2CA 5DG8A 1XSPA 2IOFA 3C23A 1V97A 2YB4A 3N28A 2N1RA 2W3SA 5KFLA 1B0XA 1F5SA 2FLNA 5KFUA 1ZQDA 3RJKA 1ZRNA 4PHAA 4CE6A 3T5JA 1N61A 2WFAA 1KBUA 2KIWA 3ZDDA 2C28A 4O3RA 2ES6A 3N7PD 1MA7A 5ALTA 5J2EA 5CWRA 5L1IA 1K5OA 4EX7A 5AI8A 1T3NA 3RJJA 3H8SA 4C4TA 4KN7A 2G08A 5J8YA 5AI9A 2M9NA 3WKDA 2H3IA 3MGVA 4F5PA 4RT2A 2XY5A 3NRZA 2C2DA 5DQGA 3M9OB 2ZIUA 5L1MA 5J2BA 1B4FA 4QIWF 1ZQYA 4FBTA 4FO6A 4DL2A 2C2RA 3PSIA 3MDCA 2K4PA 1ZQWA 3BZCA 7ICTA 3NVWA 2G07A 1L7NA 2FMQA 1RQLA 2NO4A 4KLSA 3RB0A 4YQWA 3MFHA 2W9BA 2BDPA 2HCFA 4G9BA 5J2DA 3M9MB 2JV3A 1XS9D 1WCNA 3IM1A 5AI6A 8ICMA 9ICWA 3OSNA 4F91B 1NKCA 2RHFA 4DCCA 2KNJA 1ZQBA 1ZQPA 1V9PA 3H40A 5J2KA 3WKAA 3RJGA 4C8MA 4YFKA 2KZ3A 3F5EA 4M9LA 3RAQA 2BDUA 5CB1A 4KLDA 2EQYA 9ICCA 1TAUA 3AQFA 4DFPA 5J2AA 3SD7A 4OO1J 2F1JA 4R64A 1JRPA 2ODGA 3Q8LA 4ECSA 4KLQA 5CA7A 5HMLA 1QSYA 1MQ2A 2KHQA 9ICUA 1D9DA 2WTFA 3C2LA 3SQIA 3OHBA 4YG2A 2EAOA 3IN5A 5DQIA 5J8YC 1T7PA 1XNSA 7ICNA 4PJ0U 5KFYA 4DWIA 3C1ZA 5HMMA 1BNOA 2Y9TA 3HX0A 3V6HA 3PW0A 2CN1A 3LVVA 3JPNA 1PVPA 2UVWA 3SAFA 1ZQAA 5AK4A 4DFKA 4QWCA 2KKPA 2D8CA 4QZIA 2XY7A 2VJ5A 3QYPA 4DQRA 3KTQA 3D2NA 5KFJA 2KP7A 4JK1A 1XSLA 2C22A 4A8EA 3LDAA 4GLXA 4BWJA 5K4LA 4J9KA 2BHNA 1ZQXA 3K1ZA 4Y2SA 3C29A 4UB5A 1RZTA 1URJA 3JPQA 4RZRA 5DG9A 1SKSA 3QUTA 2G0AA 3C2KA 2W9CB 4DFJA 2ZIUB 2VA3A 3Q8PB 3WK6A 5ALSA 4YP3A 1X66A 2JHDA 3K75D 4DL7A 1U48A 4F8RA 2KE7A 4P0QA 4O3PA 4I2BA 3HPOA 3L5KA 3QU9A 4DOAA 1ZQIA 2BCSA 3H8WA 5HNKA 5KT3A 3RH5A 2W9BB 2XY6A 4NJ8A 2G09A 2Y1IA 3IV6A 2Q0ZX 4UB3A 4KLEA 4ECZA 3V7KA 2W7OA 5KFBA 3C5FA 9ICQA 1X9WA 4R65A 3N7RC 1ZETA 3SEIA 4JWNA 9ICMA 2W8KA 4E0DA 5KG7A 2D6FC 3BZKA 4J03A 9ICNA 4XRHA 4ECTA 2WF5A 9ICTA 4JUZA 3GFKB 4B9TA 3EUB2 5JRTA 3ETLA 1Q8KA 4I2IA 2ALZA 4BX9C 1Z3EB 5J0YA 1NKBA 2Y0SF 1MQ3A 1ZQLA 2XGPA 1KDHA 3UXNA 3WU2U 5ALRA 2EAMA 2W03A 1DK2A 4I2JA 4KLIA 3BJYA 5AM4A 1SIJA 1X9SA 4NY8A 3F5AA 4UB6U 1JUDA 1BGXT 9ICVA 1L5UA 8ICYA 5ALDA 3SENA 1L8OA 2JH7A 3PMNA 3PSFA 4OJLA 4EBDA 7ICFA 4RPZA 3HW8A 5J29A 4BGDA 1QQ7A 1JI7A 4XUSA 4HAIA 2A1AA 3KHHA 1TE2A 2ZIVA 2NO5A 3F2BA 3RJFA 1SGGA 5EE3A 4FZLA 2B6GA 4FBUA 3H4DA 2K89A 5ALFA 3KZIU 2IBKA 2YMLA 5KFTA 2OHFA 7ICRA 5L1KA 4C0ZA 3CYMA 4QWDA 2Z7JA 1KRPA 1PZNA 4QWAA 3JPOA 8ICRA 3H4BA 4BDPA 3C21A 4TUPA 4DLGA 4EBEA 4KLJA 2G5IB 8ICZA 3QZ8A 4Q43A 5TZVA 3KD3A 1P7DA 1AROP 2LYBA 2RQ5A 1HUZA 1NK8A 5J2JA 4F72A 4C7YA 3M1YA 4YD1A 2OYYA 4P0QB 1CUKA 1MC8A 5FP0A 3V6JA 2AQ4A 2MAXA 2JEIA 1ZYQA 5ALOA 3OHAA 1Z4NA 4ED2A 2R18A 2JMGA 1QQ6A 4ECQA 2ZTDA 3B9JA 5L1LA 4DL4A 4RU9A 7ICIA 1U45A 4KLTA 3EW9A 1WYGA 3I28A 3GIKA 1UA0A 4RUCA 5DLFA 4CF5A 2KG5A 1YZ7A 1DOQA 1UQVA 4J9MA 8ICIA 3GIIA 4DSIA 2JEGA 4UB2A 5ALMA 2V4RA 1ECWA 4QZGA 1N5XA 4XA5A 8ICCA 3WK9A 5AK5A 5KNIA 4C8LA 2ASLA 5DG7A 2WAQC 4Y2JA 4C8KA 1BPEA 3IG8A 4PHPA 3LVWA 4NM2A 2W04A 4QZHA 3OJUA 3UPQA 4C4RA 5CR0A 4OJ6A 3RJEA 1UT8A 1XO1A 4CGZA 4Y2TA
chains in the Genus database with same CATH topology
1KQQA 2EH9A 2JXJA 2OEHA 2KK0A 2RQ5A 2YQEA 4LJXA 1IG6A 2CXYA 1C20A 2LM1A 2JRZA 5K4LA 5CEHA 2EQYA 2LI6A 1RYUA 1KKXA 1KN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQQ A;  2EH9 A;  2JXJ A;  2OEH A;  2KK0 A;  2RQ5 A;  2YQE A;  4LJX A;  1IG6 A;  2CXY A;  1C20 A;  2LM1 A;  2JRZ A;  5K4L A;  5CEH A;  2EQY A;  2LI6 A;  1RYU A;  1KKX A;  1KN5 A; 
#chains in the Genus database with same CATH topology
 2ESE A;  1Q3U A;  3WKE A;  2PFO A;  5J0S A;  8ICJ A;  2KHV A;  4TUR A;  8ICE A;  4DO9 A;  1PUZ A;  2HVI A;  8ICQ A;  3ZD9 A;  1SL2 A;  2K60 A;  1TFR A;  3AMZ A;  4NLZ A;  1T94 A;  3QU5 A;  5AKZ A;  2HOI A;  5ALK A;  2ATL A;  3HJE A;  2IOH A;  1KN5 A;  1T4G A;  3Q8S B;  3ZDE A;  4PGY A;  1CRX A;  4YR0 A;  5HR6 A;  2LMR A;  5D49 A;  4DSE A;  2KEY A;  2PMZ F;  4CRX A;  3TFS A;  3SV4 A;  2ZIV B;  3PR5 B;  5KFA A;  3OGU A;  2ASJ A;  3TAR A;  2DL0 A;  4NWI A;  4ACO A;  3Q8Q B;  3G6V A;  5DKW A;  1OXJ A;  5DGB A;  4KX5 A;  4XQ8 A;  1PVQ A;  3UXO A;  2XO7 A;  9ICJ A;  1PK1 A;  4DQI A;  2BCU A;  3D2Q A;  1TKD A;  1KW4 A;  3B0X A;  4F5O A;  2Y1J A;  2MA1 A;  2JEF A;  5CEH A;  2ZUB A;  5KFD A;  2P6R A;  3HWT A;  4JV0 A;  1TAM A;  3M6K A;  5KFQ A;  3BQ7 A;  1TK0 A;  3GIM A;  4I2F A;  2HHV A;  5KT5 A;  2UVR A;  4J9S A;  3LK9 A;  2R8H A;  3WK7 A;  1BPY A;  2DQN B;  4JMU A;  1ZD3 A;  4EEL A;  5DBB A;  3C2M A;  4F5N A;  3PX4 A;  4TUQ A;  4EEK A;  1WG8 A;  4U7C A;  4KIT B;  2LYA A;  1L3U A;  4FZN A;  2K4E A;  4QIW C;  5ALG A;  4UB1 A;  4RQ8 A;  3QEB Z;  5B66 U;  3GIJ A;  4GXJ A;  3KKA A;  4RQ4 A;  4MF2 A;  5EWG A;  2WB1 F;  3QX7 A;  9ICK A;  1WWV A;  3TAP A;  1Y88 A;  1KLN A;  4ELT A;  4GXK A;  2I5H A;  5AIC A;  3MAB A;  1L7P A;  2LHT A;  4O3Q A;  3KHG A;  4M9N A;  3RF9 A;  3E58 A;  2HHW A;  5AI0 A;  4J9P A;  5TIS U;  5J0W A;  2LM1 A;  1K1Q A;  4YN4 A;  3C28 A;  4MEX A;  5GTH U;  1S97 A;  1RYS A;  3MR2 A;  1SL1 A;  2GLE A;  5ALQ A;  4DL5 A;  4ZOH C;  4UAT A;  1FFU A;  2KV2 A;  2ZXI A;  3M7D A;  5AM2 A;  2K8B B;  7ICV A;  1HUO A;  4IS7 A;  2H3Q A;  4IQT A;  2MRL A;  1ZQG A;  2FDR A;  4DLE A;  1DGS A;  2W3R A;  2NRT A;  3UMG A;  2DWQ A;  2W54 A;  1ZQO A;  4O5K A;  4IC9 A;  1ZQZ A;  2KVS A;  4QW8 A;  2W9C A;  4KLG A;  5G5H A;  3NRW A;  4PGX A;  5J2G A;  5ALP A;  1NK0 A;  3G6X A;  2LBO A;  4K4G A;  4USA A;  3ALR A;  2FLL A;  2AXT U;  2JXJ A;  4QZD A;  5KFV A;  4I2E A;  4B9N A;  3MC1 A;  2WHE A;  1UHU A;  3FAH A;  2KSO A;  5KG3 A;  2AQ0 A;  4HYK A;  2WF8 A;  5KFE A;  1FIQ A;  3NVZ A;  3EYZ A;  3RJI A;  2DKZ A;  3Q8R B;  2JR5 A;  1PK1 B;  3KKA C;  2PFP A;  3UXP A;  2HBL A;  1FO4 A;  2QB0 A;  3NTU A;  3A0H U;  1Z1V A;  5KL1 B;  3I1Y A;  1IM4 A;  4DQS A;  1NKE A;  1S8O A;  4UB4 A;  2EDU A;  1QLN A;  8ICV A;  1X2I A;  3RBE A;  1JX4 A;  3CRX A;  2J6S A;  2K4I A;  3OTQ A;  1RPL A;  3RTV A;  2PFN A;  4Z6E A;  3SMV A;  1ZJN A;  3WKB A;  1XC9 A;  2F1H A;  2E8N A;  4GFJ A;  3E0F A;  4KN4 A;  1EXN A;  4FZM A;  3ISB A;  3TAQ A;  3ZDC A;  4PHD A;  2ZJ8 A;  2XC9 A;  3C1Y A;  4PL1 A;  1X9X A;  1SB3 C;  2OH2 A;  4IR9 A;  1KFS A;  3LYS A;  8ICL A;  1V85 A;  3NUQ A;  3RR8 A;  4PZN A;  4Z6D A;  3HP6 A;  3QUC A;  4DQP A;  4M9H A;  2KJ8 A;  3H8M A;  4F71 A;  2PI4 A;  9ICL A;  4YMN A;  4JV2 A;  2D3D A;  2HDO A;  9ICB A;  1LKY A;  2MU2 A;  4QW9 A;  3ED5 A;  5GTI U;  4FS1 A;  3MBY A;  1ZQR A;  1VLB A;  1NK4 A;  9ICE A;  3U26 A;  5CJ7 A;  2LI6 A;  2FI1 A;  5KFI A;  3QUB A;  4QZC A;  3HRD D;  4NLN A;  2CRX A;  4PHE A;  2DGZ A;  5DBC A;  5KFS A;  4I27 A;  1ZQV A;  1GO3 F;  3OPX A;  2FMS A;  2V4Q A;  4PL2 A;  5BPC A;  4F50 A;  2EAP A;  3KZX A;  1JIH A;  3GU3 A;  5F9L A;  4KLH A;  4ECV A;  4F4X A;  2NRX A;  1KKX A;  4X5V A;  2W11 A;  4ICA A;  1LV5 A;  4TQR A;  2YMM A;  3H0R B;  1L3T A;  5KL8 B;  2IHM A;  3B0Y A;  4YMM A;  4DOB A;  2WF9 A;  4OD0 A;  3RJH A;  1DK3 A;  2AGQ A;  2QB1 A;  4P0P A;  2Y0S C;  4NL9 C;  1N62 A;  2HHQ A;  3M6Z A;  4Z6C A;  4I2C A;  4I29 A;  3QNM A;  2BR0 A;  1ZQE A;  5C0Y A;  4ED3 A;  5DDY A;  1TV9 A;  5KFP A;  4B9U A;  1UCV A;  2KSO B;  3V72 A;  1JAL A;  2KK0 A;  2R8J A;  2E5S A;  3H8J A;  2ZXH A;  1XO0 A;  1FEZ A;  1ZD2 P;  4MFA A;  1QTM A;  4Y2P A;  2K8C B;  5AKX A;  5AK6 A;  2XI9 A;  3RB3 A;  3BQ2 A;  4DSJ A;  7ICU A;  3O0F A;  4ELU A;  2G5H B;  4UAW A;  4KLO A;  4Y2Q A;  2HHU A;  2QB0 B;  4M04 A;  1CI4 A;  2KKV A;  2JGA A;  3N97 B;  1ZD5 A;  2GWS A;  1RG6 A;  1QSL A;  1ZQF A;  3QUQ A;  2J6U A;  2E1F A;  1C20 A;  5DLG A;  1D8B A;  1DRG A;  4OCZ A;  3QEA Z;  2ISO A;  1ZXI A;  5AKY A;  4B6J A;  4P4M A;  3S6J A;  1Z19 A;  5CRX A;  3NVY A;  2H5X A;  5KFM A;  1DGJ A;  3PW5 A;  3NAS A;  2YMQ A;  3SAH A;  3T5K A;  2P6U A;  5AM5 A;  1DXS A;  4UQG A;  4IRK A;  3DV9 A;  4QZ9 A;  3RH6 A;  2OXO A;  5KAI U;  2BKE A;  5EOZ A;  1MN8 A;  3GIL A;  3BS7 A;  1WUD A;  4EZ9 A;  5AIA A;  4P4P A;  1ZQT A;  1KFD A;  3J81 j;  3MR3 A;  4I2D A;  1S9F A;  1NJX A;  5EE1 A;  2YN4 A;  1H38 A;  4QWB A;  5HP4 A;  4NLB A;  2K4H A;  5BOL A;  1LKY B;  4C80 A;  4ED0 A;  4M9G A;  1BNP A;  4ECX A;  2ZTC A;  1SV0 C;  4BWM A;  4AYB F;  4J9R A;  3FDS A;  9ICA A;  5KG4 A;  3SR6 A;  3DDH A;  4UAS A;  3RRH A;  4KTQ A;  5ALN A;  5AKE A;  5KFK A;  5F9N A;  1KSP A;  3PST A;  3GZF A;  1RYU A;  2RDJ A;  3PR4 A;  5J0U A;  1SKW A;  1NK5 A;  2BPF A;  1L6N A;  4QZF A;  3V6K A;  5KFO A;  4NXZ A;  2HVH A;  4GIB A;  4UAZ A;  2RRD A;  1C7Y A;  4M0A A;  4DS4 A;  1QSS A;  5IIL A;  4UB8 U;  4EEY A;  2BPG A;  2PFQ A;  3PML A;  3MR6 A;  4M47 A;  4DFM A;  3K1R B;  4P0P B;  2OEH A;  3TQ1 A;  1VJ5 A;  8ICX A;  4LJX A;  1M6Y A;  4IQW A;  1B43 A;  4ECR A;  3IHQ B;  1ZOL A;  4ED7 A;  2EAN A;  3SAG A;  5J0X A;  4UBC A;  3F53 A;  5KG1 A;  3FM9 A;  2XCA A;  3AUO A;  3CW2 C;  3MR5 A;  2ZIW A;  3JPS A;  3PX0 A;  3AU6 A;  2KN7 A;  1S0N A;  3WK4 A;  2RLT A;  1NK7 A;  3FYH A;  3T5H A;  2LYH A;  2P35 A;  4DFD A;  4F2S A;  2KIC A;  5HR7 A;  1QCK A;  2BCV A;  2B0C A;  5KAF U;  3D2S A;  2CPR A;  3BQ0 A;  1S77 D;  4QZ8 A;  5T14 A;  2PMZ C;  2NRW A;  3PNC A;  4RT3 A;  3UQ0 A;  4UAV A;  4RQ0 A;  4NV0 A;  1BPX A;  2ZTE A;  4EZ6 A;  7ICL A;  3LWL A;  4M6W A;  3MGI A;  1QQ5 A;  5ALE A;  1ZQQ A;  4RQ2 A;  3KHR A;  5HHH A;  3H0L B;  1ZQM A;  5AI5 A;  4NLC A;  4C8O A;  4DOC A;  4Q8E A;  2B21 A;  4Q8F A;  1TK5 A;  9ICP A;  4Y2V A;  3QZ7 A;  1U9L A;  1VDV A;  7ICK A;  7ICS A;  1HJP A;  3FC4 A;  7ICO A;  1KQQ A;  4KLU A;  4B9L A;  8ICW A;  4F4W A;  2LM4 A;  2PKE A;  2NV3 A;  7ICP A;  5KG5 A;  1SWW A;  1Q3V A;  3ZDB A;  1Z4O A;  3HT3 A;  4G3I A;  4DL6 A;  1ZQ1 C;  1HIW A;  3EPG A;  1RQN A;  8ICA A;  2IOF K;  4K4H A;  4DEZ A;  5ALZ A;  4U6P A;  4EEN A;  4YXM A;  3T5L A;  1NZB A;  8ICB A;  1IXR A;  4BJQ A;  5ALY A;  5KT6 A;  7ICM A;  1ZQN A;  1SZH A;  5ALX A;  4RPY A;  1WCL A;  5DDM A;  2WB1 C;  2HBJ A;  2KTQ A;  5AHX A;  5DB6 A;  1X40 A;  2BQ3 A;  5ALV A;  3ICX A;  1JXL A;  1TK8 A;  1NNL A;  3TAC B;  1NJY A;  2XIC A;  5H2F U;  4UAR A;  4OJ5 A;  1HEK A;  4ECY A;  1A6S A;  3TAD C;  1S76 D;  2E8P A;  1L3S A;  5G5G A;  4US8 A;  5ALJ A;  5III A;  2P66 A;  3EZ5 A;  2M0N A;  4PGQ A;  1U4B A;  1L7O A;  1SXD A;  4MFF A;  3ETR A;  1CEZ A;  4F5R A;  2BCR A;  5KFW A;  3PO4 A;  3ISD A;  2ZIW B;  3OSP A;  2KVC A;  3KOO A;  1JN3 A;  1XWL A;  1RM6 C;  1KEJ A;  1L8L A;  1X42 A;  5JU5 A;  2I6X A;  2MSN A;  2AGP A;  1NJZ A;  1BVS A;  5AKL A;  3Q8K A;  4F4K A;  1RXV A;  4J9O A;  2JEJ A;  4LZG A;  2A1J B;  3UM9 A;  4Q44 A;  2ASD A;  2RP5 A;  4TQS A;  4RQM A;  4QZE A;  2L5Y A;  4M6W B;  3HKZ F;  2W7P A;  3UMB A;  3EWA A;  3IRU A;  5IIJ A;  4B9S A;  3ONN A;  4RNM A;  5ALL A;  3ISC A;  3QU4 A;  4BXO A;  4BUG A;  2FMP A;  3QXG A;  4O3O A;  5B5E U;  2HBM A;  3KFU F;  1D9F A;  3AN1 A;  8ICK A;  4YMO A;  2VJ4 A;  2GO7 A;  4R8U A;  2ZG6 A;  2J6T A;  2CXY A;  4Y2U A;  1KFT A;  4CF3 A;  4IRC A;  3RB4 A;  2F3N A;  3HIL A;  2EZY A;  3BQT A;  1MSW D;  4YD2 A;  2R8G A;  4QZB A;  4GC6 A;  3G6Y A;  2BCQ A;  1NZP A;  3PV8 A;  5DB7 A;  2NYV A;  5AKJ A;  3OJS A;  1N63 A;  1S5L U;  1ZRM A;  5KT7 A;  4O5C A;  5IIO A;  4F93 B;  2PI5 A;  5IIK A;  3NS1 A;  3V7L A;  1YT3 A;  2EZX A;  1COK A;  4PPX A;  4M9J A;  4EX6 A;  5A0L A;  5KFG A;  2UVU A;  4O9M A;  4IR1 A;  1QH9 A;  2F76 X;  4RQ6 A;  5AI4 A;  3E2E A;  3T3F A;  4OJP A;  3PY8 A;  5L1J A;  4DSL A;  4ED6 A;  3AL0 B;  5EE9 A;  1ZQH A;  8ICN A;  4MFC A;  2HHX A;  1NI3 A;  1T8E A;  2ZUD A;  1A0P A;  4NLG A;  2C2E A;  2HI0 A;  4YR3 A;  4J9N A;  1N60 A;  4UAY A;  3V7J A;  3TFR A;  2G06 A;  8ICF A;  1ZJM A;  1X6I A;  4QNL A;  2FE9 A;  2Y9U A;  2W8L A;  1X6J A;  1U49 A;  1PVR A;  3THV A;  2A19 A;  2DPJ A;  3MGH A;  1ED1 A;  4F3O A;  4R66 A;  4NL9 A;  3WK8 A;  2QLT A;  2ZIX A;  3JPT A;  2MUT A;  4EYH B;  4DSK A;  3PW4 A;  3UMC A;  2FLP A;  1X9M A;  2YY6 A;  1F44 A;  2VKQ A;  1OW5 A;  4I2G A;  4UW9 A;  4YCX A;  7ICE A;  4F2R A;  2E3T A;  5KFR A;  3QE9 Y;  3QU7 A;  4CF4 A;  2W55 A;  1JXE A;  2DF4 B;  2HMX A;  1ZQK A;  2JZB A;  1UPH A;  1T3Q A;  3M9N B;  4IL6 U;  4KLF A;  1IG6 A;  2AGO A;  4KMU A;  1S0M A;  2DBY A;  4C8N A;  3VCB A;  5J2H A;  3AQE A;  1N56 A;  2HHS A;  4BXO B;  2H3V A;  2VA2 A;  2BPC A;  2UVV A;  3PVX A;  4R8U B;  5CHG A;  4O5E A;  1ZQJ A;  3RFA A;  4WJ3 B;  4ELV A;  2BGW A;  1D8Y A;  2NRV A;  5AKH A;  4CDG A;  5J0O A;  5J0R A;  3ZD8 A;  4ED1 A;  4RQ5 A;  1COO A;  2KJ5 A;  3H0M B;  1Q46 A;  4F4Z A;  2BQR A;  3K4G A;  1NJW A;  1SL0 A;  1NK6 A;  3M8S A;  1LVH A;  4YXJ A;  5AIB A;  3SYZ A;  2ZJA A;  1IV8 A;  2AHO B;  3D6J A;  4OJO A;  4KX3 A;  2KFZ A;  3PSP A;  2IMW P;  2HBK A;  1SV0 A;  5AKI A;  5AKK A;  5AKG A;  3JPP A;  4DF4 A;  2AU0 A;  1YZ6 A;  4EBC A;  1D8L A;  1V38 A;  3KBB A;  1JRO A;  5ALI A;  4K4I A;  1J2M A;  4LVS A;  4JWM A;  2HHT A;  2LPE A;  2YMP A;  3GV5 B;  4FE3 A;  4C7Z A;  9ICX A;  5KFN A;  5DBA A;  1L7M A;  4AYB C;  5ALW A;  1ZQC A;  2HW3 A;  2I1Q A;  2OWO A;  4FS2 A;  1RXW A;  3RH4 A;  3JPR A;  8ICH A;  7ICQ A;  4FFD A;  4O0I A;  2F44 A;  1RYR A;  1NK9 A;  9ICH A;  1OUQ A;  2ZIX B;  4GXI A;  2MUT B;  3RB6 A;  2VIX A;  3ZI4 A;  2W43 A;  4IRD A;  1KL9 A;  1SWV A;  2KIV A;  1S10 A;  3IDW A;  3SZ2 A;  2F77 X;  3BDP A;  1BPD A;  4KMO B;  2ISP A;  9ICF A;  1A76 A;  1N5W A;  4IQU A;  1Z1B A;  3CP8 A;  1B22 A;  3AU2 A;  1ZQU A;  2VA8 A;  4MHV A;  4JV1 A;  2JZB B;  4DSF A;  1S0O A;  3I76 A;  1S0V A;  3GV8 B;  4ECW A;  5ALH A;  4J9Q A;  2KZM A;  1AQ6 A;  3C5G A;  4GC7 A;  3PX6 A;  2WF7 A;  5C5J A;  2I9G A;  4UBB A;  4F92 B;  4DQQ A;  1RDF A;  4DS5 A;  1ZQS A;  1TVA A;  5EWF A;  1O08 A;  5KT2 A;  3N4M B;  1LB2 B;  5EWE A;  2DPI A;  9ICG A;  2OM6 A;  3RBD A;  5DGA A;  1UA1 A;  2ZUC A;  4US9 A;  1WWU A;  3N7S C;  4O3M A;  4P2H A;  3TI0 A;  8ICG A;  2QAR A;  2LKY A;  1L3V A;  4Q45 A;  2H3Z A;  3Q8M A;  3LWM A;  2YX8 A;  2GOL A;  1N48 A;  3F2D A;  2RDI A;  2ZJ5 A;  4YR2 A;  1A77 A;  4PH5 A;  5JUM A;  1ZD4 A;  5AK3 A;  3ORY A;  4ED8 A;  5IIM A;  2EZZ A;  5D46 A;  2OCE A;  2E8M A;  2KOB A;  2EH9 A;  2A3V A;  2XID A;  7ICH A;  4QWE A;  4Y2Y A;  2HOQ A;  7ICG A;  3DEE A;  2O6K A;  2F2A B;  3WK5 A;  3BQ1 A;  3BS5 A;  4R63 A;  1Z00 A;  4RUA A;  2XGQ A;  3SI8 A;  4CNQ A;  2KJ9 A;  5L9X A;  4ECU A;  4F4Y A;  2BZF A;  2W9M A;  4KLM A;  3R9K A;  3SV3 A;  1BPZ A;  2FJ6 A;  4MEY A;  5F3X B;  3PO5 A;  4DL3 A;  5KFX A;  5KG0 A;  2XCP A;  1SV4 A;  3MFI A;  1SXE A;  2HSZ A;  4TUS A;  2E8O A;  3TKA A;  3A0B U;  1SZP A;  5E79 U;  2A1J A;  2KZZ A;  4O3S A;  9ICI A;  5HHI A;  5EE0 A;  3GV7 B;  4Z6F A;  5KFH A;  5J0Q A;  8ICU A;  4DF8 A;  3TAD A;  2XVT A;  3IP4 B;  4JB3 A;  4LZD A;  1BPB A;  2R8I A;  3T79 A;  2WF6 A;  5KFF A;  2YTU A;  9ICS A;  4NLK A;  4Y2R A;  1FFV A;  4RNN A;  5AM1 A;  2JRZ A;  4J9L A;  2KD1 A;  1JMS A;  1N2X A;  7ICJ A;  5CP2 A;  1XSN A;  4F5Q A;  4M2Y A;  1IIP A;  3PZP A;  3GQC A;  3PW2 A;  2AJQ A;  5J2C A;  5DQH A;  4NM1 A;  4O3N A;  4RPX A;  2AH5 A;  4C4S A;  4UAU A;  5KG6 A;  2F8L A;  8ICS A;  1UT5 A;  4PZO A;  2K8A A;  5J2F A;  3NGD A;  4IQV A;  4QJF B;  5DB8 A;  1F0M A;  2V9W A;  4I28 A;  3VC8 A;  2Q4T A;  3RAX A;  3AEV A;  1J97 A;  3MDA A;  3TAN A;  1NOM A;  4I2A A;  3L3F X;  3IG5 A;  2DFL A;  5DB9 A;  2IA6 A;  2E1E A;  3EPI A;  3RRG A;  2GH1 A;  2QKQ A;  2IHN A;  4ZH4 A;  2QAR B;  5KTQ A;  4EYI B;  5J0T A;  3HKZ C;  4YVZ A;  2F1I A;  5BOM A;  2KMD A;  3L4P A;  2F8K A;  2R8K A;  5KT4 A;  9ICO A;  5KG2 A;  2FPL A;  1U47 A;  1SKR A;  5IIN A;  3AM9 A;  3ZDA A;  3NVV A;  4Y2X A;  1K1S A;  2FPM A;  5JTI A;  1XU4 A;  4RQ7 A;  3PW7 A;  8ICP A;  3M8R A;  3KHL A;  2WAQ F;  2DKX A;  1PK3 A;  4B9V A;  4KLL A;  5KFC A;  3BS5 B;  2JH1 A;  4B9M A;  1Z00 B;  2VAN A;  5J0P A;  4RQ3 A;  3CNH A;  4RNO A;  2KFN A;  1KTQ A;  5AM0 A;  4RQ1 A;  4CCH A;  5D4B A;  2BQU A;  3WKC A;  4P4O A;  2DUY A;  5KFZ A;  2YQE A;  4AP9 A;  8ICO A;  9ICR A;  4RQN A;  1O03 A;  4MF8 A;  5AM3 A;  2NRZ A;  3GDX A;  5J2I A;  3H7I A;  5ALU A;  8ICT A;  2PXI A;  3QU2 A;  3RR7 A;  3UQ2 A;  1J2N A;  2HOF A;  2H3F A;  2YB1 A;  2FPK A;  1TAQ A;  4QZA A;  2W9A A;  4I2H A;  3F2C A;  5DG8 A;  1XSP A;  2IOF A;  3C23 A;  1V97 A;  2YB4 A;  3N28 A;  2N1R A;  2W3S A;  5KFL A;  1B0X A;  1F5S A;  2FLN A;  5KFU A;  1ZQD A;  3RJK A;  1ZRN A;  4PHA A;  4CE6 A;  3T5J A;  1N61 A;  2WFA A;  1KBU A;  2KIW A;  3ZDD A;  2C28 A;  4O3R A;  2ES6 A;  3N7P D;  1MA7 A;  5ALT A;  5J2E A;  5CWR A;  5L1I A;  1K5O A;  4EX7 A;  5AI8 A;  1T3N A;  3RJJ A;  3H8S A;  4C4T A;  4KN7 A;  2G08 A;  5J8Y A;  5AI9 A;  2M9N A;  3WKD A;  2H3I A;  3MGV A;  4F5P A;  4RT2 A;  2XY5 A;  3NRZ A;  2C2D A;  5DQG A;  3M9O B;  2ZIU A;  5L1M A;  5J2B A;  1B4F A;  4QIW F;  1ZQY A;  4FBT A;  4FO6 A;  4DL2 A;  2C2R A;  3PSI A;  3MDC A;  2K4P A;  1ZQW A;  3BZC A;  7ICT A;  3NVW A;  2G07 A;  1L7N A;  2FMQ A;  1RQL A;  2NO4 A;  4KLS A;  3RB0 A;  4YQW A;  3MFH A;  2W9B A;  2BDP A;  2HCF A;  4G9B A;  5J2D A;  3M9M B;  2JV3 A;  1XS9 D;  1WCN A;  3IM1 A;  5AI6 A;  8ICM A;  9ICW A;  3OSN A;  4F91 B;  1NKC A;  2RHF A;  4DCC A;  2KNJ A;  1ZQB A;  1ZQP A;  1V9P A;  3H40 A;  5J2K A;  3WKA A;  3RJG A;  4C8M A;  4YFK A;  2KZ3 A;  3F5E A;  4M9L A;  3RAQ A;  2BDU A;  5CB1 A;  4KLD A;  2EQY A;  9ICC A;  1TAU A;  3AQF A;  4DFP A;  5J2A A;  3SD7 A;  4OO1 J;  2F1J A;  4R64 A;  1JRP A;  2ODG A;  3Q8L A;  4ECS A;  4KLQ A;  5CA7 A;  5HML A;  1QSY A;  1MQ2 A;  2KHQ A;  9ICU A;  1D9D A;  2WTF A;  3C2L A;  3SQI A;  3OHB A;  4YG2 A;  2EAO A;  3IN5 A;  5DQI A;  5J8Y C;  1T7P A;  1XNS A;  7ICN A;  4PJ0 U;  5KFY A;  4DWI A;  3C1Z A;  5HMM A;  1BNO A;  2Y9T A;  3HX0 A;  3V6H A;  3PW0 A;  2CN1 A;  3LVV A;  3JPN A;  1PVP A;  2UVW A;  3SAF A;  1ZQA A;  5AK4 A;  4DFK A;  4QWC A;  2KKP A;  2D8C A;  4QZI A;  2XY7 A;  2VJ5 A;  3QYP A;  4DQR A;  3KTQ A;  3D2N A;  5KFJ A;  2KP7 A;  4JK1 A;  1XSL A;  2C22 A;  4A8E A;  3LDA A;  4GLX A;  4BWJ A;  5K4L A;  4J9K A;  2BHN A;  1ZQX A;  3K1Z A;  4Y2S A;  3C29 A;  4UB5 A;  1RZT A;  1URJ A;  3JPQ A;  4RZR A;  5DG9 A;  1SKS A;  3QUT A;  2G0A A;  3C2K A;  2W9C B;  4DFJ A;  2ZIU B;  2VA3 A;  3Q8P B;  3WK6 A;  5ALS A;  4YP3 A;  1X66 A;  2JHD A;  3K75 D;  4DL7 A;  1U48 A;  4F8R A;  2KE7 A;  4P0Q A;  4O3P A;  4I2B A;  3HPO A;  3L5K A;  3QU9 A;  4DOA A;  1ZQI A;  2BCS A;  3H8W A;  5HNK A;  5KT3 A;  3RH5 A;  2W9B B;  2XY6 A;  4NJ8 A;  2G09 A;  2Y1I A;  3IV6 A;  2Q0Z X;  4UB3 A;  4KLE A;  4ECZ A;  3V7K A;  2W7O A;  5KFB A;  3C5F A;  9ICQ A;  1X9W A;  4R65 A;  3N7R C;  1ZET A;  3SEI A;  4JWN A;  9ICM A;  2W8K A;  4E0D A;  5KG7 A;  2D6F C;  3BZK A;  4J03 A;  9ICN A;  4XRH A;  4ECT A;  2WF5 A;  9ICT A;  4JUZ A;  3GFK B;  4B9T A;  3EUB 2;  5JRT A;  3ETL A;  1Q8K A;  4I2I A;  2ALZ A;  4BX9 C;  1Z3E B;  5J0Y A;  1NKB A;  2Y0S F;  1MQ3 A;  1ZQL A;  2XGP A;  1KDH A;  3UXN A;  3WU2 U;  5ALR A;  2EAM A;  2W03 A;  1DK2 A;  4I2J A;  4KLI A;  3BJY A;  5AM4 A;  1SIJ A;  1X9S A;  4NY8 A;  3F5A A;  4UB6 U;  1JUD A;  1BGX T;  9ICV A;  1L5U A;  8ICY A;  5ALD A;  3SEN A;  1L8O A;  2JH7 A;  3PMN A;  3PSF A;  4OJL A;  4EBD A;  7ICF A;  4RPZ A;  3HW8 A;  5J29 A;  4BGD A;  1QQ7 A;  1JI7 A;  4XUS A;  4HAI A;  2A1A A;  3KHH A;  1TE2 A;  2ZIV A;  2NO5 A;  3F2B A;  3RJF A;  1SGG A;  5EE3 A;  4FZL A;  2B6G A;  4FBU A;  3H4D A;  2K89 A;  5ALF A;  3KZI U;  2IBK A;  2YML A;  5KFT A;  2OHF A;  7ICR A;  5L1K A;  4C0Z A;  3CYM A;  4QWD A;  2Z7J A;  1KRP A;  1PZN A;  4QWA A;  3JPO A;  8ICR A;  3H4B A;  4BDP A;  3C21 A;  4TUP A;  4DLG A;  4EBE A;  4KLJ A;  2G5I B;  8ICZ A;  3QZ8 A;  4Q43 A;  5TZV A;  3KD3 A;  1P7D A;  1ARO P;  2LYB A;  2RQ5 A;  1HUZ A;  1NK8 A;  5J2J A;  4F72 A;  4C7Y A;  3M1Y A;  4YD1 A;  2OYY A;  4P0Q B;  1CUK A;  1MC8 A;  5FP0 A;  3V6J A;  2AQ4 A;  2MAX A;  2JEI A;  1ZYQ A;  5ALO A;  3OHA A;  1Z4N A;  4ED2 A;  2R18 A;  2JMG A;  1QQ6 A;  4ECQ A;  2ZTD A;  3B9J A;  5L1L A;  4DL4 A;  4RU9 A;  7ICI A;  1U45 A;  4KLT A;  3EW9 A;  1WYG A;  3I28 A;  3GIK A;  1UA0 A;  4RUC A;  5DLF A;  4CF5 A;  2KG5 A;  1YZ7 A;  1DOQ A;  1UQV A;  4J9M A;  8ICI A;  3GII A;  4DSI A;  2JEG A;  4UB2 A;  5ALM A;  2V4R A;  1ECW A;  4QZG A;  1N5X A;  4XA5 A;  8ICC A;  3WK9 A;  5AK5 A;  5KNI A;  4C8L A;  2ASL A;  5DG7 A;  2WAQ C;  4Y2J A;  4C8K A;  1BPE A;  3IG8 A;  4PHP A;  3LVW A;  4NM2 A;  2W04 A;  4QZH A;  3OJU A;  3UPQ A;  4C4R A;  5CR0 A;  4OJ6 A;  3RJE A;  1UT8 A;  1XO1 A;  4CGZ A;  4Y2T A; 
#chains in the Genus database with same CATH homology
 1KQQ A;  2EH9 A;  2JXJ A;  2OEH A;  2KK0 A;  2RQ5 A;  2YQE A;  4LJX A;  1IG6 A;  2CXY A;  1C20 A;  2LM1 A;  2JRZ A;  5K4L A;  5CEH A;  2EQY A;  2LI6 A;  1RYU A;  1KKX A;  1KN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...