1KN5A

Solution structure of arid domain of adr6 from saccharomyces cerevisiae
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
102
structure length
102
Chain Sequence
b'NNKQYELFMKSLIENCKKRNMPLQSIPEIGNRKINLFYLYMLVQKFGGADQVTRTQQWSMVAQRLQISDYQQLESIYFRILLPYERHMISQEGIKETQAKRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription regulatory protein ADR6
molecule tags Dna binding protein
source organism Saccharomyces cerevisiae
publication title 1H, 13C and 15N resonance assignments and secondary structure of ADR6 DNA-binding domain.
pubmed doi rcsb
total genus 19
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2001-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 1kn5A00
1RYUA 2JRZA 1KQQA 2RQ5A 2EQYA 2KK0A 5CEHA 2LM1A 2EH9A 2OEHA 1C20A 1IG6A 1KN5A 4LJXA 2JXJA 2CXYA 2YQEA 5K4LA 1KKXA 2LI6A
chains in the Genus database with same CATH superfamily
3AEVA 4G9BA 4GXIA 5EOZA 2F1IA 3IRUA 5ALJA 4B9TA 1HUZA 5KG7A 2IOHA 8ICUA 5KG5A 4DQSA 5HR6A 1J97A 3V6KA 1Z4NA 1YT3A 5J0RA 1BPBA 3UMCA 2C2DA 8ICCA 3O0FA 3BZCA 3GV5B 4M2YA 2R8JA 3H40A 1ZETA 4CF4A 1ZYQA 9ICXA 4EELA 2ESEA 3PVXA 5J0QA 5ALNA 3KOOA 2JH7A 3HP6A 3V6JA 4EBEA 2YB4A 5AM3A 2W9CA 2HHQA 5KFJA 4PGQA 2C2RA 2C22A 3S6JA 4U6PA 2ZIXB 2CXYA 2W9CB 1SZPA 5DGBA 2MA1A 4Q8FA 4K4GA 4JMUA 5AK6A 3HW8A 1RQLA 4I2BA 2PMZC 4DFDA 3JPRA 4DOBA 4BWJA 1QCKA 1NK4A 1LKYA 2Y1JA 4IL6U 2ZTEA 4Z6DA 5CEHA 4NXZA 8ICRA 1ZQKA 3N97B 3IP4B 2FLNA 2DUYA 1U47A 1L7OA 2K60A 5DGAA 1KFDA 4J9QA 2E1FA 2AGOA 2W7PA 4J9PA 3ZI4A 5KFDA 3ORYA 1S0MA 5AKZA 3SV4A 2PFQA 5J0SA 5KG1A 1ZD3A 4F5PA 4LZGA 5DDMA 2PFPA 2KHVA 2F1HA 3RAQA 4K4IA 2YB1A 1SIJA 4RT2A 4TQSA 4I2FA 2K89A 2RDIA 8ICGA 4FBTA 3CP8A 4CCHA 2KVCA 1U9LA 4P2HA 3M8SA 5DQHA 5J2DA 4Z6CA 2HCFA 4US9A 3MFIA 4F4XA 2IMWP 4IRDA 4NLZA 2AGPA 2K4HA 1RYUA 1Z4OA 2ASLA 4MFCA 4GFJA 1RYSA 1N56A 5AM1A 4TUQA 3SAHA 4QIWF 4MF8A 3WKEA 4RQ2A 2BCRA 3NVZA 1MQ2A 4QNLA 5J0PA 2G07A 3KD3A 1S97A 1SKWA 3RRGA 2AU0A 2E5SA 1L8OA 4DFJA 3ZD8A 1SL0A 5KL8B 3ZD9A 1UT5A 3BS7A 4Y2TA 1JUDA 4Y2QA 1ZJMA 3QU7A 3FAHA 1S8OA 2BCVA 2YY6A 1N60A 1ZQGA 4ICAA 5D4BA 2IBKA 2H3ZA 4QWAA 4BXOA 2P66A 4AYBC 4QZEA 4KLFA 5KFNA 4C4SA 5ALFA 4F4ZA 1TVAA 3D2QA 4BXOB 4UW9A 4QZHA 3M9OB 3EW9A 4KLUA 5J8YC 2IHNA 3RB4A 3ALRA 3ZDBA 2BCUA 2IOFA 2L5YA 2XICA 2LBOA 4Q43A 2PI5A 2W9MA 2RLTA 3G6XA 3KHHA 2W9BB 3RH4A 3I28A 1KTQA 2NYVA 3RJFA 3QU9A 2F3NA 5KFUA 2W9BA 4UAUA 2RP5A 3GZFA 1C7YA 5AK4A 4ZH4A 4RQ4A 5DQGA 1F44A 4C4RA 3F2CA 3HILA 3AUOA 1DXSA 2NV3A 1N62A 1KRPA 4IRKA 2A3VA 5K4LA 5ALVA 3WKBA 2KE7A 3UXNA 4CRXA 5BPCA 4J9OA 2WF6A 1PK3A 4YR0A 1KBUA 1RXVA 2HW3A 3BQ0A 5AM0A 1Y88A 5EWEA 1AROP 5KFGA 3MGIA 1RQNA 2Q4TA 4RQMA 4ACOA 1WCNA 5AK5A 2KKVA 4YMNA 1SWWA 4PHEA 3GIKA 3T5JA 1ZQSA 7ICQA 1TK5A 1COKA 4ED0A 1IM4A 3Q8LA 3R9KA 3PO5A 5DQIA 4OJOA 2KJ8A 3N7RC 4DL5A 4HAIA 2LPEA 4NLCA 2C28A 2R8IA 1SGGA 2W8KA 1NK9A 4IR1A 5AHXA 7ICNA 1COOA 2JEJA 1UPHA 5BOLA 3F5EA 3CNHA 4JB3A 4QZBA 4RQ0A 3PMNA 2LYBA 1EXNA 3CYMA 1Q46A 8ICZA 3TAPA 7ICJA 1MC8A 4P0QB 3I76A 4IQTA 4QZAA 5KFQA 2XGQA 2B21A 7ICKA 2J6UA 2PXIA 4RQ8A 4ECVA 3UPQA 3DV9A 2DKZA 1CUKA 2IOFK 4M9JA 4UB5A 5KFEA 3WKCA 3RJHA 1D8YA 2ZIUB 3Q8MA 5HNKA 4ECZA 4CGZA 3PW0A 3LVWA 3MDCA 2OM6A 5L1MA 2EZYA 4NY8A 2WB1C 4U7CA 9ICFA 4DSIA 3NGDA 7ICUA 1BPEA 5AM2A 1NK6A 3BQ1A 2BPGA 2ZTDA 4O5KA 1TV9A 1ZQBA 4NM1A 9ICVA 5ALMA 2FI1A 4US8A 3KHGA 4UATA 2M0NA 4J9MA 2KICA 4DQQA 1MN8A 3ISCA 2Y9UA 3SYZA 3RB3A 5HP4A 2ALZA 2HDOA 4O3OA 4XQ8A 4F91B 5IILA 1NJYA 1Z3EB 4QZGA 2W54A 2UVWA 1U4BA 5KFTA 2NRWA 1BPDA 1ZQQA 1KLNA 2V9WA 4DSJA 1VDVA 4UB8U 1UQVA 2YX8A 4DL2A 5GTIU 3TQ1A 7ICRA 5FP0A 4PJ0U 2FMSA 5KFIA 2EAMA 5AI9A 4DOCA 3IN5A 5CP2A 3H8JA 4TUSA 1HUOA 1DK2A 1SL1A 9ICQA 3H4BA 4YQWA 7ICIA 2BGWA 2GH1A 3PV8A 1NK8A 2ZJAA 2UVVA 2IA6A 2I1QA 3L3FX 2MUTA 1KL9A 4J9RA 2LYAA 3AU2A 2OHFA 4QZ9A 3SENA 3NRZA 4R66A 3D2NA 2FPLA 2KTQA 5ALHA 4RPYA 4OO1J 5ALUA 1LVHA 8ICYA 3AN1A 3GIMA 2KK0A 1ZQCA 2R8GA 4I29A 2DL0A 3LWMA 3KHLA 4O3QA 2KZ3A 5KL1B 3IDWA 1N5WA 2ASDA 4BX9C 5KFXA 3GIIA 4UAYA 3GIJA 1TE2A 4KLEA 4DWIA 4C8KA 2OWOA 3H0LB 2IHMA 3ICXA 1NKCA 5KFFA 1ZXIA 4F2SA 3THVA 4BUGA 1LV5A 2OEHA 3KKAC 2QARB 3RJJA 4B9NA 1RXWA 2DKXA 1JXLA 2VJ5A 5J0WA 1NNLA 4KN7A 2FLPA 3SQIA 5AK3A 5G5GA 1H38A 1SL2A 9ICLA 3MDAA 4F93B 1QQ5A 2ZJ5A 3RAXA 1JALA 1N5XA 5DB7A 4C7ZA 3EUB2 5IIIA 3RFAA 4DL3A 1ZQFA 4PHDA 3Q8QB 4F92B 4ELUA 3SI8A 1K1QA 3SEIA 2XCPA 1ZQPA 4O3RA 2BPCA 3NVYA 2ZIUA 5KT2A 1JXEA 1T4GA 4PGXA 2BCQA 1SV0C 4KLQA 4YR2A 5J2CA 5ALOA 8ICKA 1PK1B 2H3FA 2O6KA 2AQ4A 2LYHA 3ISBA 4Z6EA 4RQ6A 5HHHA 1PK1A 2EH9A 3OHBA 3GV7B 2Z7JA 3WK7A 2W7OA 3A0HU 3UQ0A 4PZOA 1HEKA 1L8LA 2Y9TA 3FC4A 2QB1A 4EZ6A 2BHNA 2P35A 2OH2A 1N48A 1X9SA 5AKKA 2DFLA 2B0CA 1S9FA 2PI4A 2FPMA 4NLGA 3L4PA 5EWGA 5KFVA 1IG6A 4O3NA 3Q8SB 5CRXA 1OUQA 5DKWA 2H3VA 2XO7A 5J2IA 5E79U 3BZKA 1ZJNA 2KNJA 1N63A 4C7YA 5F9NA 1TFRA 2P6UA 2OCEA 9ICWA 1B43A 1QQ6A 1ZQHA 5ALRA 1XSNA 5L1LA 2DQNB 2K4PA 4NJ8A 1NKBA 3K75D 4DFPA 4DSKA 1Q3UA 2HHSA 4UAVA 3RBDA 1TAUA 4O0IA 1BPZA 5AKXA 5IIKA 4R8UA 3C2MA 4RZRA 2ZXHA 5HMLA 1J2NA 3TACB 5AM5A 1X40A 2V4RA 9ICGA 4DOAA 3GQCA 3I1YA 2BPFA 3C5FA 2AQ0A 1N61A 4MHVA 1X9WA 4YG2A 4FBUA 1YZ6A 3RJKA 4J9NA 2E8PA 2HOQA 3T5LA 3RB0A 5J2HA 3MR3A 1BPYA 7ICEA 4YVZA 2W55A 2NO4A 5B5EU 4DFKA 2LKYA 1V9PA 2KJ9A 3K4GA 4OJ6A 2FE9A 5KT7A 1J2MA 1DK3A 1SV4A 2FJ6A 3QX7A 3PX4A 2KD1A 3IG5A 2G08A 5KNIA 3SAGA 4DL4A 5AIAA 5KFKA 4JWNA 2HBMA 1BGXT 2E8MA 2WFAA 4UBBA 2RHFA 4KLOA 1XSLA 3T79A 5AKYA 4ED7A 1OW5A 3HWTA 4J9LA 2ZG6A 1RDFA 5ALYA 3NUQA 3C28A 2KHQA 3C5GA 3VC8A 3QE9Y 3H8WA 5H2FU 1QSSA 1JRPA 1WG8A 2KFZA 3BQ7A 1FEZA 1S10A 2JXJA 2E1EA 4F4KA 2E8NA 1SXDA 2GLEA 5EWFA 3TKAA 3QEBZ 3AQFA 1JX4A 5IIMA 1ZQDA 1X42A 2OYYA 2WF5A 3N7PD 3NVVA 3RJIA 3RJEA 5J2FA 2G09A 5KFRA 1ZQNA 5CR0A 1NJXA 2UVRA 1U45A 4QIWC 1XS9D 2PFNA 4YN4A 2DWQA 4IRCA 1VLBA 5KFSA 5JUMA 2YMPA 2YN4A 4ED2A 1L3VA 3PNCA 2AJQA 1HJPA 9ICBA 2XY7A 5EE3A 3ETRA 4LZDA 4RU9A 1KFTA 3MFHA 2G5HB 5KFPA 5D46A 3M9MB 4BGDA 4DEZA 2ODGA 5KFMA 3K1RB 4ECQA 4RQ5A 3AM9A 1DGSA 5F9LA 2F2AB 4R64A 8ICJA 3RR8A 1QH9A 3UMBA 3QYPA 1XO1A 1ZQ1C 4EX7A 4WJ3B 3NRWA 3AQEA 4Y2PA 2J6SA 8ICNA 2RRDA 2WF9A 3NS1A 1SZHA 4KX5A 8ICMA 4Q44A 3KZXA 3EYZA 1K5OA 3AMZA 5AI5A 1TK8A 3SD7A 5J29A 3OTQA 1X2IA 1QSLA 4DS4A 5L1KA 2GO7A 3QUBA 1T8EA 2H3QA 4M9NA 1XC9A 5DB8A 1N2XA 1ZQJA 2HHXA 2HSZA 1RG6A 4HYKA 3PW7A 1LKYB 2XCAA 2FPKA 2QLTA 5AI4A 2ZJ8A 5CHGA 2ZIVB 4KLHA 2G0AA 1A77A 1Z00A 2KIWA 2LM4A 3MGVA 3GDXA 4EYIB 1ZRMA 2F1JA 2E3TA 3IHQB 5J0TA 2Q0ZX 3JPPA 4DL7A 2XIDA 4I2CA 1ZQIA 2VA2A 4KLTA 1O08A 2HVIA 1L5UA 5AKIA 3BQTA 5J2EA 1ZQTA 2EZZA 4OD0A 4R63A 2BKEA 2D6FC 2ZIWA 4QZDA 1NK5A 3BS5B 2AGQA 3JPSA 1C20A 4P4OA 5ALKA 2HBLA 5GTHU 5CA7A 1L7MA 4DF4A 4ED1A 4DCCA 3OHAA 1JN3A 4ECYA 4QWDA 2E8OA 2VJ4A 1AQ6A 8ICAA 8ICFA 1SKSA 2HOIA 4JUZA 8ICSA 3C21A 1GO3F 3ETLA 4DSLA 4QZ8A 2BZFA 3LWLA 2JR5A 5ALGA 5EE9A 4O5CA 1FFVA 4DSEA 9ICUA 2YTUA 2XC9A 4TUPA 4FO6A 4FE3A 4Z6FA 2F77X 2LMRA 1KKXA 1ED1A 5ALIA 2QKQA 2P6RA 5L1IA 5KFAA 1WUDA 1CEZA 4UAWA 8ICBA 4RQ7A 4F8RA 4RQ1A 5ALTA 1U49A 3WKAA 1NJWA 5CJ7A 2FMPA 5AICA 1ZQVA 4ELTA 2W9AA 1FO4A 2BCSA 4JV1A 4KLIA 2JZBA 4M6WA 5AIBA 4KX3A 9ICNA 4K4HA 5DLFA 1ZQMA 3H8MA 4F5RA 3SMVA 2AHOB 1RM6C 4Y2SA 5KG0A 1DOQA 9ICHA 2BDUA 4R65A 4I2GA 2D8CA 5KFCA 5KG4A 1DGJA 2JEIA 3MR5A 5G5HA 3M6KA 5AKHA 5ALQA 3EZ5A 8ICLA 2EAPA 4CF5A 3V72A 2VIXA 4UAZA 5KFYA 4RNNA 4M47A 3OSNA 4NWIA 2HBKA 2HHUA 1F5SA 8ICEA 4EZ9A 2MUTB 1BNPA 1Z1BA 1PVRA 4I27A 5HHIA 5DB6A 1QTMA 1TKDA 2MU2A 2HOFA 2AH5A 4EEKA 1LB2B 4AP9A 1ZQLA 8ICIA 1UHUA 2VA3A 1D8BA 3V7LA 4UARA 5ALZA 2LI6A 4B9VA 4ZOHC 2K8AA 2KZZA 2BR0A 2FLLA 1WCLA 2KIVA 4MFAA 5KAIU 1NK0A 3UQ2A 5J0OA 1D9FA 3T5KA 4B9SA 1HIWA 1X6JA 2W03A 2JGAA 3PSPA 1MSWD 3KTQA 2W3RA 5L9XA 5C0YA 5ALSA 4C0ZA 5KG3A 2WTFA 3Q8KA 1CRXA 3CW2C 3ZDAA 1V97A 5AKGA 1M6YA 9ICMA 2Y1IA 3QXGA 2GOLA 4G3IA 4M04A 1Q8KA 3HJEA 4EEYA 4Y2RA 1KN5A 1X6IA 3PW4A 4KMOB 2ZIXA 4LVSA 2ASJA 5KFWA 5IIJA 4JK1A 1QQ7A 1ZQZA 1RPLA 3SAFA 3AU6A 1WWUA 5TZVA 2PKEA 3MGHA 5DG7A 8ICWA 3TADA 3A0BU 2KMDA 4YXMA 4YP3A 2ZXIA 4PZNA 4F72A 4KITB 7ICPA 1NKEA 5JRTA 3E58A 3C2LA 1NI3A 2PMZF 4EX6A 4UBCA 4DFMA 1D9DA 3FM9A 1Q3VA 4O3MA 3MC1A 4FZMA 5ALEA 4P0PB 5AKEA 1L3TA 2I6XA 4I28A 4B9UA 2EAOA 4P0PA 2K8CB 1URJA 5KFHA 4F71A 2DF4B 4KLGA 2ATLA 3HKZF 4OJPA 4DS5A 3H4DA 4YMMA 3WK8A 4O9MA 9ICRA 1JIHA 4YR3A 8ICOA 1A6SA 7ICTA 3PR4A 1P7DA 4M0AA 2NRVA 1S77D 3GU3A 2WF7A 4Y2JA 2JEGA 5IIOA 3ZDEA 3J81j 4YMOA 1A76A 4C4TA 3ZDCA 2F76X 2BQUA 1SKRA 1CI4A 1KW4A 5ALLA 1ZQAA 2UVUA 1RYRA 5DBBA 1KFSA 2JZBB 4M6WB 1SV0A 4YXJA 4PL2A 4YD1A 4KLLA 2R8HA 5JU5A 3RJGA 1U48A 3KFUF 2W11A 4ED6A 2H3IA 3LVVA 2VKQA 3FYHA 2JMGA 3RRHA 4A8EA 2I9GA 5BOMA 3E0FA 4RUCA 1D8LA 4MF2A 2YMLA 4C8MA 5IINA 4R8UB 3C1YA 4I2AA 3IV6A 1ZQUA 3WK4A 2Y0SC 4J9SA 3TADC 2KSOB 2WB1F 3AL0B 2EDUA 3F5AA 4E0DA 1T3NA 5KFBA 4F3OA 2EANA 9ICSA 2HHVA 9ICAA 1QSYA 4YCXA 1ZD2P 4QZFA 4YFKA 2NO5A 9ICIA 1KSPA 4FFDA 4O5EA 2AXTU 5KAFU 2OXOA 3OSPA 4MEXA 9ICKA 3PSFA 1L7NA 4UB2A 5DDYA 2PFOA 2KKPA 7ICHA 3B0YA 5T14A 3OPXA 2J6TA 3QNMA 2WHEA 1UA1A 3ONNA 2EZXA 4QWCA 4I2JA 7ICLA 4UQGA 3TFRA 4OJ5A 4O3PA 2BDPA 3WK6A 3TAQA 3U26A 3RTVA 4IQVA 3GILA 5L1JA 4DQRA 1S0NA 1X9MA 4DL6A 5CWRA 3M7DA 5DG9A 1ZRNA 3ZDDA 1BNOA 4DO9A 3RH5A 4EENA 3QU2A 2A1JA 3RB6A 3T5HA 4F5OA 2ES6A 2A1JB 2LHTA 2W3SA 4O3SA 4OJLA 5AI8A 4I2DA 3C1ZA 5AI0A 4BJQA 4GC7A 2K4IA 1PUZA 4EBDA 1PZNA 2RQ5A 4FZNA 4UB6U 2I5HA 2XI9A 3K1ZA 4CF3A 4UB1A 3MBYA 1QLNA 3ED5A 3OGUA 3TANA 3KBBA 4RPZA 2BQRA 3MR6A 4F5NA 4IC9A 3T3FA 2KN7A 4F4WA 3HRDD 2M9NA 4XUSA 4X5VA 5J2AA 1T7PA 3RBEA 1ZQOA 1SB3C 2V4QA 3NVWA 7ICMA 4PHAA 3CRXA 4Q45A 4Q8EA 3FDSA 5D49A 4Y2YA 5AKLA 2A19A 3H8SA 5EE1A 3NTUA 3LDAA 4UASA 4NM2A 3F53A 5F3XB 1XSPA 3OJUA 4Y2VA 5CB1A 3MR2A 2MAXA 2KVSA 4DQPA 3L5KA 3SV3A 2C2EA 3HPOA 2D3DA 1L7PA 2HBJA 4B9LA 4EBCA 3F2DA 4ECRA 2KEYA 2FDRA 4C8LA 4NL9C 1SXEA 3GV8B 3NASA 3QU5A 1X66A 2KG5A 4ELVA 3PSIA 2YMQA 5J2GA 1IIPA 4Y2UA 3QU4A 1S0OA 3SZ2A 5HMMA 3N28A 2JRZA 2KZMA 3Q8PB 5KG2A 1NK7A 1FFUA 1K1SA 3UXPA 4RUAA 8ICHA 2YMMA 3TFSA 1S5LU 1B22A 2ZIWB 1TAMA 2JHDA 3G6VA 3VCBA 1NOMA 5J0XA 2ISOA 1ZQEA 2KSOA 2XY6A 2ZTCA 3MABA 1NJZA 2G5IB 9ICTA 3PZPA 2F44A 2G06A 1B0XA 4C8NA 4NLKA 2HVHA 8ICQA 7ICSA 1NZBA 4RPXA 1T3QA 4JV0A 1WYGA 4KLJA 1T94A 2VA8A 4F50A 2HHTA 4B6JA 1IXRA 5DBAA 3EWAA 4B9MA 1S76D 2CPRA 1BVSA 1PVQA 4NLNA 3RH6A 3B0XA 2KJ5A 1L6NA 2W8LA 1B4FA 3QEAZ 1PVPA 4QJFB 4IR9A 3QUCA 1BPXA 1ZQRA 4YD2A 3WK5A 3JPOA 2NRTA 1SWVA 3E2EA 5KG6A 4KN4A 5KTQA 1F0MA 2ISPA 3HX0A 3GFKB 3N7SC 1X9XA 9ICPA 1ZQYA 2ZUDA 1RZTA 1O03A 4PL1A 4KLMA 4PGYA 3V7JA 4CE6A 4Y2XA 2R8KA 4F5QA 4KLDA 5ALDA 4P0QA 4GC6A 1TK0A 3PMLA 5JTIA 2K8BB 4GXKA 5KFZA 4DF8A 3SR6A 3EPIA 4QW8A 1UCVA 3H0RB 1S0VA 2F8LA 3ISDA 1NZPA 5A0LA 3D6JA 3WKDA 5ALPA 2K4EA 4IQUA 2ZUCA 3PR5B 8ICXA 3TI0A 3PO4A 2BQ3A 3BS5A 4QW9A 4J9KA 3H0MB 1XU4A 4C8OA 4C80A 2W04A 2F8KA 4FS2A 4OCZA 1Z19A 7ICOA 1L3SA 3LYSA 5B66U 9ICJA 4UB4A 3PY8A 3KKAA 2ZUBA 2RDJA 4I2IA 2H5XA 3TARA 3PW2A 4RNOA 4M9HA 3PSTA 1KEJA 3M9NB 3G6YA 3M6ZA 3V7KA 4NV0A 1MQ3A 1V38A 3HKZC 4ECSA 3Q8RB 3D2SA 2DPJA 1UT8A 9ICEA 5J0YA 4QZIA 3M1YA 2DPIA 2KV2A 4P4MA 2CRXA 3WU2U 7ICVA 2HI0A 3DEEA 4JV2A 4XA5A 2ZIVA 3UMGA 4AYBF 3KHRA 3WK9A 1Z00B 3B9JA 2VANA 1ZD5A 2KP7A 2WAQF 8ICTA 4IS7A 1IV8A 4GIBA 4USAA 3IG8A 5KT3A 1A0PA 4FZLA 4M9GA 3HT3A 8ICPA 1XWLA 2XY5A 4ECXA 2QARA 4PPXA 4BDPA 4NLBA 2JH1A 4PHPA 4EYHB 3C23A 4TURA 1ZQXA 4TQRA 3UM9A 4CNQA 2FMQA 4F2RA 1XO0A 4GXJA 3PX6A 1YZ7A 3UXOA 9ICOA 5KFLA 3JPNA 7ICGA 4DLGA 2W43A 2DGZA 3OJSA 1ZQWA 2DBYA 2KOBA 2HHWA 2KFNA 1FIQA 2WF8A 5DLGA 5J0UA 2NRZA 8ICVA 4KTQA 4UB3A 4MEYA 2JV3A 5ALWA 3LK9A 1TAQA 1MA7A 2LM1A 1ECWA 4IQWA 4BWMA 4KMUA 4ECTA 4GLXA 5TISU 3QZ7A 1KDHA 3M8RA 3C2KA 2A1AA 2B6GA 9ICCA 3V6HA 3C29A 4JWMA 5DG8A 1KQQA 3QUTA 2HMXA 2MSNA 4LJXA 5J2JA 4I2EA 4ECWA 7ICFA 1JI7A 4QWEA 1WWVA 1OXJA 2XGPA 4RQNA 3JPQA 4F4YA 1ZOLA 5HR7A 1JMSA 4P4PA 1UA0A 5KT6A 3JPTA 2GWSA 5DB9A 3N4MB 4RT3A 2MRLA 5KFOA 3H7IA 2EQYA 5KT4A 3IM1A 2JEFA 5DBCA 3BDPA 2YQEA 4RQ3A 5KT5A 2Y0SF 5AI6A 1DRGA 3PX0A 5ALXA 1XNSA 3RF9A 4ECUA 5J2KA 1V85A 4CDGA 3PW5A 1Z1VA 2R18A 3BJYA 2QB0B 5AKJA 4DSFA 4FS1A 4XRHA 4QZCA 4NL9A 4MFFA 5EE0A 1L3UA 2QB0A 5J8YA 4DLEA 4I2HA 4J03A 4KLSA 4ED8A 3F2BA 4QWBA 5J2BA 4RNMA 4DQIA 2XVTA 5C5JA 2CN1A 1JROA 2N1RA 4ED3A 3QZ8A 3BQ2A 5AM4A 3RR7A 1VJ5A 3EPGA 3KZIU 3QUQA 4PH5A 3DDHA 2WAQC 4M9LA 2NRXA 1ZD4A
chains in the Genus database with same CATH topology
1RYUA 2JRZA 1KQQA 2RQ5A 2EQYA 2KK0A 5CEHA 2LM1A 2EH9A 2OEHA 1C20A 1IG6A 1KN5A 4LJXA 2JXJA 2CXYA 2YQEA 5K4LA 1KKXA 2LI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RYU A;  2JRZ A;  1KQQ A;  2RQ5 A;  2EQY A;  2KK0 A;  5CEH A;  2LM1 A;  2EH9 A;  2OEH A;  1C20 A;  1IG6 A;  1KN5 A;  4LJX A;  2JXJ A;  2CXY A;  2YQE A;  5K4L A;  1KKX A;  2LI6 A; 
#chains in the Genus database with same CATH topology
 3AEV A;  4G9B A;  4GXI A;  5EOZ A;  2F1I A;  3IRU A;  5ALJ A;  4B9T A;  1HUZ A;  5KG7 A;  2IOH A;  8ICU A;  5KG5 A;  4DQS A;  5HR6 A;  1J97 A;  3V6K A;  1Z4N A;  1YT3 A;  5J0R A;  1BPB A;  3UMC A;  2C2D A;  8ICC A;  3O0F A;  3BZC A;  3GV5 B;  4M2Y A;  2R8J A;  3H40 A;  1ZET A;  4CF4 A;  1ZYQ A;  9ICX A;  4EEL A;  2ESE A;  3PVX A;  5J0Q A;  5ALN A;  3KOO A;  2JH7 A;  3HP6 A;  3V6J A;  4EBE A;  2YB4 A;  5AM3 A;  2W9C A;  2HHQ A;  5KFJ A;  4PGQ A;  2C2R A;  2C22 A;  3S6J A;  4U6P A;  2ZIX B;  2CXY A;  2W9C B;  1SZP A;  5DGB A;  2MA1 A;  4Q8F A;  4K4G A;  4JMU A;  5AK6 A;  3HW8 A;  1RQL A;  4I2B A;  2PMZ C;  4DFD A;  3JPR A;  4DOB A;  4BWJ A;  1QCK A;  1NK4 A;  1LKY A;  2Y1J A;  4IL6 U;  2ZTE A;  4Z6D A;  5CEH A;  4NXZ A;  8ICR A;  1ZQK A;  3N97 B;  3IP4 B;  2FLN A;  2DUY A;  1U47 A;  1L7O A;  2K60 A;  5DGA A;  1KFD A;  4J9Q A;  2E1F A;  2AGO A;  2W7P A;  4J9P A;  3ZI4 A;  5KFD A;  3ORY A;  1S0M A;  5AKZ A;  3SV4 A;  2PFQ A;  5J0S A;  5KG1 A;  1ZD3 A;  4F5P A;  4LZG A;  5DDM A;  2PFP A;  2KHV A;  2F1H A;  3RAQ A;  4K4I A;  2YB1 A;  1SIJ A;  4RT2 A;  4TQS A;  4I2F A;  2K89 A;  2RDI A;  8ICG A;  4FBT A;  3CP8 A;  4CCH A;  2KVC A;  1U9L A;  4P2H A;  3M8S A;  5DQH A;  5J2D A;  4Z6C A;  2HCF A;  4US9 A;  3MFI A;  4F4X A;  2IMW P;  4IRD A;  4NLZ A;  2AGP A;  2K4H A;  1RYU A;  1Z4O A;  2ASL A;  4MFC A;  4GFJ A;  1RYS A;  1N56 A;  5AM1 A;  4TUQ A;  3SAH A;  4QIW F;  4MF8 A;  3WKE A;  4RQ2 A;  2BCR A;  3NVZ A;  1MQ2 A;  4QNL A;  5J0P A;  2G07 A;  3KD3 A;  1S97 A;  1SKW A;  3RRG A;  2AU0 A;  2E5S A;  1L8O A;  4DFJ A;  3ZD8 A;  1SL0 A;  5KL8 B;  3ZD9 A;  1UT5 A;  3BS7 A;  4Y2T A;  1JUD A;  4Y2Q A;  1ZJM A;  3QU7 A;  3FAH A;  1S8O A;  2BCV A;  2YY6 A;  1N60 A;  1ZQG A;  4ICA A;  5D4B A;  2IBK A;  2H3Z A;  4QWA A;  4BXO A;  2P66 A;  4AYB C;  4QZE A;  4KLF A;  5KFN A;  4C4S A;  5ALF A;  4F4Z A;  1TVA A;  3D2Q A;  4BXO B;  4UW9 A;  4QZH A;  3M9O B;  3EW9 A;  4KLU A;  5J8Y C;  2IHN A;  3RB4 A;  3ALR A;  3ZDB A;  2BCU A;  2IOF A;  2L5Y A;  2XIC A;  2LBO A;  4Q43 A;  2PI5 A;  2W9M A;  2RLT A;  3G6X A;  3KHH A;  2W9B B;  3RH4 A;  3I28 A;  1KTQ A;  2NYV A;  3RJF A;  3QU9 A;  2F3N A;  5KFU A;  2W9B A;  4UAU A;  2RP5 A;  3GZF A;  1C7Y A;  5AK4 A;  4ZH4 A;  4RQ4 A;  5DQG A;  1F44 A;  4C4R A;  3F2C A;  3HIL A;  3AUO A;  1DXS A;  2NV3 A;  1N62 A;  1KRP A;  4IRK A;  2A3V A;  5K4L A;  5ALV A;  3WKB A;  2KE7 A;  3UXN A;  4CRX A;  5BPC A;  4J9O A;  2WF6 A;  1PK3 A;  4YR0 A;  1KBU A;  1RXV A;  2HW3 A;  3BQ0 A;  5AM0 A;  1Y88 A;  5EWE A;  1ARO P;  5KFG A;  3MGI A;  1RQN A;  2Q4T A;  4RQM A;  4ACO A;  1WCN A;  5AK5 A;  2KKV A;  4YMN A;  1SWW A;  4PHE A;  3GIK A;  3T5J A;  1ZQS A;  7ICQ A;  1TK5 A;  1COK A;  4ED0 A;  1IM4 A;  3Q8L A;  3R9K A;  3PO5 A;  5DQI A;  4OJO A;  2KJ8 A;  3N7R C;  4DL5 A;  4HAI A;  2LPE A;  4NLC A;  2C28 A;  2R8I A;  1SGG A;  2W8K A;  1NK9 A;  4IR1 A;  5AHX A;  7ICN A;  1COO A;  2JEJ A;  1UPH A;  5BOL A;  3F5E A;  3CNH A;  4JB3 A;  4QZB A;  4RQ0 A;  3PMN A;  2LYB A;  1EXN A;  3CYM A;  1Q46 A;  8ICZ A;  3TAP A;  7ICJ A;  1MC8 A;  4P0Q B;  3I76 A;  4IQT A;  4QZA A;  5KFQ A;  2XGQ A;  2B21 A;  7ICK A;  2J6U A;  2PXI A;  4RQ8 A;  4ECV A;  3UPQ A;  3DV9 A;  2DKZ A;  1CUK A;  2IOF K;  4M9J A;  4UB5 A;  5KFE A;  3WKC A;  3RJH A;  1D8Y A;  2ZIU B;  3Q8M A;  5HNK A;  4ECZ A;  4CGZ A;  3PW0 A;  3LVW A;  3MDC A;  2OM6 A;  5L1M A;  2EZY A;  4NY8 A;  2WB1 C;  4U7C A;  9ICF A;  4DSI A;  3NGD A;  7ICU A;  1BPE A;  5AM2 A;  1NK6 A;  3BQ1 A;  2BPG A;  2ZTD A;  4O5K A;  1TV9 A;  1ZQB A;  4NM1 A;  9ICV A;  5ALM A;  2FI1 A;  4US8 A;  3KHG A;  4UAT A;  2M0N A;  4J9M A;  2KIC A;  4DQQ A;  1MN8 A;  3ISC A;  2Y9U A;  3SYZ A;  3RB3 A;  5HP4 A;  2ALZ A;  2HDO A;  4O3O A;  4XQ8 A;  4F91 B;  5IIL A;  1NJY A;  1Z3E B;  4QZG A;  2W54 A;  2UVW A;  1U4B A;  5KFT A;  2NRW A;  1BPD A;  1ZQQ A;  1KLN A;  2V9W A;  4DSJ A;  1VDV A;  4UB8 U;  1UQV A;  2YX8 A;  4DL2 A;  5GTI U;  3TQ1 A;  7ICR A;  5FP0 A;  4PJ0 U;  2FMS A;  5KFI A;  2EAM A;  5AI9 A;  4DOC A;  3IN5 A;  5CP2 A;  3H8J A;  4TUS A;  1HUO A;  1DK2 A;  1SL1 A;  9ICQ A;  3H4B A;  4YQW A;  7ICI A;  2BGW A;  2GH1 A;  3PV8 A;  1NK8 A;  2ZJA A;  2UVV A;  2IA6 A;  2I1Q A;  3L3F X;  2MUT A;  1KL9 A;  4J9R A;  2LYA A;  3AU2 A;  2OHF A;  4QZ9 A;  3SEN A;  3NRZ A;  4R66 A;  3D2N A;  2FPL A;  2KTQ A;  5ALH A;  4RPY A;  4OO1 J;  5ALU A;  1LVH A;  8ICY A;  3AN1 A;  3GIM A;  2KK0 A;  1ZQC A;  2R8G A;  4I29 A;  2DL0 A;  3LWM A;  3KHL A;  4O3Q A;  2KZ3 A;  5KL1 B;  3IDW A;  1N5W A;  2ASD A;  4BX9 C;  5KFX A;  3GII A;  4UAY A;  3GIJ A;  1TE2 A;  4KLE A;  4DWI A;  4C8K A;  2OWO A;  3H0L B;  2IHM A;  3ICX A;  1NKC A;  5KFF A;  1ZXI A;  4F2S A;  3THV A;  4BUG A;  1LV5 A;  2OEH A;  3KKA C;  2QAR B;  3RJJ A;  4B9N A;  1RXW A;  2DKX A;  1JXL A;  2VJ5 A;  5J0W A;  1NNL A;  4KN7 A;  2FLP A;  3SQI A;  5AK3 A;  5G5G A;  1H38 A;  1SL2 A;  9ICL A;  3MDA A;  4F93 B;  1QQ5 A;  2ZJ5 A;  3RAX A;  1JAL A;  1N5X A;  5DB7 A;  4C7Z A;  3EUB 2;  5III A;  3RFA A;  4DL3 A;  1ZQF A;  4PHD A;  3Q8Q B;  4F92 B;  4ELU A;  3SI8 A;  1K1Q A;  3SEI A;  2XCP A;  1ZQP A;  4O3R A;  2BPC A;  3NVY A;  2ZIU A;  5KT2 A;  1JXE A;  1T4G A;  4PGX A;  2BCQ A;  1SV0 C;  4KLQ A;  4YR2 A;  5J2C A;  5ALO A;  8ICK A;  1PK1 B;  2H3F A;  2O6K A;  2AQ4 A;  2LYH A;  3ISB A;  4Z6E A;  4RQ6 A;  5HHH A;  1PK1 A;  2EH9 A;  3OHB A;  3GV7 B;  2Z7J A;  3WK7 A;  2W7O A;  3A0H U;  3UQ0 A;  4PZO A;  1HEK A;  1L8L A;  2Y9T A;  3FC4 A;  2QB1 A;  4EZ6 A;  2BHN A;  2P35 A;  2OH2 A;  1N48 A;  1X9S A;  5AKK A;  2DFL A;  2B0C A;  1S9F A;  2PI4 A;  2FPM A;  4NLG A;  3L4P A;  5EWG A;  5KFV A;  1IG6 A;  4O3N A;  3Q8S B;  5CRX A;  1OUQ A;  5DKW A;  2H3V A;  2XO7 A;  5J2I A;  5E79 U;  3BZK A;  1ZJN A;  2KNJ A;  1N63 A;  4C7Y A;  5F9N A;  1TFR A;  2P6U A;  2OCE A;  9ICW A;  1B43 A;  1QQ6 A;  1ZQH A;  5ALR A;  1XSN A;  5L1L A;  2DQN B;  2K4P A;  4NJ8 A;  1NKB A;  3K75 D;  4DFP A;  4DSK A;  1Q3U A;  2HHS A;  4UAV A;  3RBD A;  1TAU A;  4O0I A;  1BPZ A;  5AKX A;  5IIK A;  4R8U A;  3C2M A;  4RZR A;  2ZXH A;  5HML A;  1J2N A;  3TAC B;  5AM5 A;  1X40 A;  2V4R A;  9ICG A;  4DOA A;  3GQC A;  3I1Y A;  2BPF A;  3C5F A;  2AQ0 A;  1N61 A;  4MHV A;  1X9W A;  4YG2 A;  4FBU A;  1YZ6 A;  3RJK A;  4J9N A;  2E8P A;  2HOQ A;  3T5L A;  3RB0 A;  5J2H A;  3MR3 A;  1BPY A;  7ICE A;  4YVZ A;  2W55 A;  2NO4 A;  5B5E U;  4DFK A;  2LKY A;  1V9P A;  2KJ9 A;  3K4G A;  4OJ6 A;  2FE9 A;  5KT7 A;  1J2M A;  1DK3 A;  1SV4 A;  2FJ6 A;  3QX7 A;  3PX4 A;  2KD1 A;  3IG5 A;  2G08 A;  5KNI A;  3SAG A;  4DL4 A;  5AIA A;  5KFK A;  4JWN A;  2HBM A;  1BGX T;  2E8M A;  2WFA A;  4UBB A;  2RHF A;  4KLO A;  1XSL A;  3T79 A;  5AKY A;  4ED7 A;  1OW5 A;  3HWT A;  4J9L A;  2ZG6 A;  1RDF A;  5ALY A;  3NUQ A;  3C28 A;  2KHQ A;  3C5G A;  3VC8 A;  3QE9 Y;  3H8W A;  5H2F U;  1QSS A;  1JRP A;  1WG8 A;  2KFZ A;  3BQ7 A;  1FEZ A;  1S10 A;  2JXJ A;  2E1E A;  4F4K A;  2E8N A;  1SXD A;  2GLE A;  5EWF A;  3TKA A;  3QEB Z;  3AQF A;  1JX4 A;  5IIM A;  1ZQD A;  1X42 A;  2OYY A;  2WF5 A;  3N7P D;  3NVV A;  3RJI A;  3RJE A;  5J2F A;  2G09 A;  5KFR A;  1ZQN A;  5CR0 A;  1NJX A;  2UVR A;  1U45 A;  4QIW C;  1XS9 D;  2PFN A;  4YN4 A;  2DWQ A;  4IRC A;  1VLB A;  5KFS A;  5JUM A;  2YMP A;  2YN4 A;  4ED2 A;  1L3V A;  3PNC A;  2AJQ A;  1HJP A;  9ICB A;  2XY7 A;  5EE3 A;  3ETR A;  4LZD A;  4RU9 A;  1KFT A;  3MFH A;  2G5H B;  5KFP A;  5D46 A;  3M9M B;  4BGD A;  4DEZ A;  2ODG A;  5KFM A;  3K1R B;  4ECQ A;  4RQ5 A;  3AM9 A;  1DGS A;  5F9L A;  2F2A B;  4R64 A;  8ICJ A;  3RR8 A;  1QH9 A;  3UMB A;  3QYP A;  1XO1 A;  1ZQ1 C;  4EX7 A;  4WJ3 B;  3NRW A;  3AQE A;  4Y2P A;  2J6S A;  8ICN A;  2RRD A;  2WF9 A;  3NS1 A;  1SZH A;  4KX5 A;  8ICM A;  4Q44 A;  3KZX A;  3EYZ A;  1K5O A;  3AMZ A;  5AI5 A;  1TK8 A;  3SD7 A;  5J29 A;  3OTQ A;  1X2I A;  1QSL A;  4DS4 A;  5L1K A;  2GO7 A;  3QUB A;  1T8E A;  2H3Q A;  4M9N A;  1XC9 A;  5DB8 A;  1N2X A;  1ZQJ A;  2HHX A;  2HSZ A;  1RG6 A;  4HYK A;  3PW7 A;  1LKY B;  2XCA A;  2FPK A;  2QLT A;  5AI4 A;  2ZJ8 A;  5CHG A;  2ZIV B;  4KLH A;  2G0A A;  1A77 A;  1Z00 A;  2KIW A;  2LM4 A;  3MGV A;  3GDX A;  4EYI B;  1ZRM A;  2F1J A;  2E3T A;  3IHQ B;  5J0T A;  2Q0Z X;  3JPP A;  4DL7 A;  2XID A;  4I2C A;  1ZQI A;  2VA2 A;  4KLT A;  1O08 A;  2HVI A;  1L5U A;  5AKI A;  3BQT A;  5J2E A;  1ZQT A;  2EZZ A;  4OD0 A;  4R63 A;  2BKE A;  2D6F C;  2ZIW A;  4QZD A;  1NK5 A;  3BS5 B;  2AGQ A;  3JPS A;  1C20 A;  4P4O A;  5ALK A;  2HBL A;  5GTH U;  5CA7 A;  1L7M A;  4DF4 A;  4ED1 A;  4DCC A;  3OHA A;  1JN3 A;  4ECY A;  4QWD A;  2E8O A;  2VJ4 A;  1AQ6 A;  8ICA A;  8ICF A;  1SKS A;  2HOI A;  4JUZ A;  8ICS A;  3C21 A;  1GO3 F;  3ETL A;  4DSL A;  4QZ8 A;  2BZF A;  3LWL A;  2JR5 A;  5ALG A;  5EE9 A;  4O5C A;  1FFV A;  4DSE A;  9ICU A;  2YTU A;  2XC9 A;  4TUP A;  4FO6 A;  4FE3 A;  4Z6F A;  2F77 X;  2LMR A;  1KKX A;  1ED1 A;  5ALI A;  2QKQ A;  2P6R A;  5L1I A;  5KFA A;  1WUD A;  1CEZ A;  4UAW A;  8ICB A;  4RQ7 A;  4F8R A;  4RQ1 A;  5ALT A;  1U49 A;  3WKA A;  1NJW A;  5CJ7 A;  2FMP A;  5AIC A;  1ZQV A;  4ELT A;  2W9A A;  1FO4 A;  2BCS A;  4JV1 A;  4KLI A;  2JZB A;  4M6W A;  5AIB A;  4KX3 A;  9ICN A;  4K4H A;  5DLF A;  1ZQM A;  3H8M A;  4F5R A;  3SMV A;  2AHO B;  1RM6 C;  4Y2S A;  5KG0 A;  1DOQ A;  9ICH A;  2BDU A;  4R65 A;  4I2G A;  2D8C A;  5KFC A;  5KG4 A;  1DGJ A;  2JEI A;  3MR5 A;  5G5H A;  3M6K A;  5AKH A;  5ALQ A;  3EZ5 A;  8ICL A;  2EAP A;  4CF5 A;  3V72 A;  2VIX A;  4UAZ A;  5KFY A;  4RNN A;  4M47 A;  3OSN A;  4NWI A;  2HBK A;  2HHU A;  1F5S A;  8ICE A;  4EZ9 A;  2MUT B;  1BNP A;  1Z1B A;  1PVR A;  4I27 A;  5HHI A;  5DB6 A;  1QTM A;  1TKD A;  2MU2 A;  2HOF A;  2AH5 A;  4EEK A;  1LB2 B;  4AP9 A;  1ZQL A;  8ICI A;  1UHU A;  2VA3 A;  1D8B A;  3V7L A;  4UAR A;  5ALZ A;  2LI6 A;  4B9V A;  4ZOH C;  2K8A A;  2KZZ A;  2BR0 A;  2FLL A;  1WCL A;  2KIV A;  4MFA A;  5KAI U;  1NK0 A;  3UQ2 A;  5J0O A;  1D9F A;  3T5K A;  4B9S A;  1HIW A;  1X6J A;  2W03 A;  2JGA A;  3PSP A;  1MSW D;  3KTQ A;  2W3R A;  5L9X A;  5C0Y A;  5ALS A;  4C0Z A;  5KG3 A;  2WTF A;  3Q8K A;  1CRX A;  3CW2 C;  3ZDA A;  1V97 A;  5AKG A;  1M6Y A;  9ICM A;  2Y1I A;  3QXG A;  2GOL A;  4G3I A;  4M04 A;  1Q8K A;  3HJE A;  4EEY A;  4Y2R A;  1KN5 A;  1X6I A;  3PW4 A;  4KMO B;  2ZIX A;  4LVS A;  2ASJ A;  5KFW A;  5IIJ A;  4JK1 A;  1QQ7 A;  1ZQZ A;  1RPL A;  3SAF A;  3AU6 A;  1WWU A;  5TZV A;  2PKE A;  3MGH A;  5DG7 A;  8ICW A;  3TAD A;  3A0B U;  2KMD A;  4YXM A;  4YP3 A;  2ZXI A;  4PZN A;  4F72 A;  4KIT B;  7ICP A;  1NKE A;  5JRT A;  3E58 A;  3C2L A;  1NI3 A;  2PMZ F;  4EX6 A;  4UBC A;  4DFM A;  1D9D A;  3FM9 A;  1Q3V A;  4O3M A;  3MC1 A;  4FZM A;  5ALE A;  4P0P B;  5AKE A;  1L3T A;  2I6X A;  4I28 A;  4B9U A;  2EAO A;  4P0P A;  2K8C B;  1URJ A;  5KFH A;  4F71 A;  2DF4 B;  4KLG A;  2ATL A;  3HKZ F;  4OJP A;  4DS5 A;  3H4D A;  4YMM A;  3WK8 A;  4O9M A;  9ICR A;  1JIH A;  4YR3 A;  8ICO A;  1A6S A;  7ICT A;  3PR4 A;  1P7D A;  4M0A A;  2NRV A;  1S77 D;  3GU3 A;  2WF7 A;  4Y2J A;  2JEG A;  5IIO A;  3ZDE A;  3J81 j;  4YMO A;  1A76 A;  4C4T A;  3ZDC A;  2F76 X;  2BQU A;  1SKR A;  1CI4 A;  1KW4 A;  5ALL A;  1ZQA A;  2UVU A;  1RYR A;  5DBB A;  1KFS A;  2JZB B;  4M6W B;  1SV0 A;  4YXJ A;  4PL2 A;  4YD1 A;  4KLL A;  2R8H A;  5JU5 A;  3RJG A;  1U48 A;  3KFU F;  2W11 A;  4ED6 A;  2H3I A;  3LVV A;  2VKQ A;  3FYH A;  2JMG A;  3RRH A;  4A8E A;  2I9G A;  5BOM A;  3E0F A;  4RUC A;  1D8L A;  4MF2 A;  2YML A;  4C8M A;  5IIN A;  4R8U B;  3C1Y A;  4I2A A;  3IV6 A;  1ZQU A;  3WK4 A;  2Y0S C;  4J9S A;  3TAD C;  2KSO B;  2WB1 F;  3AL0 B;  2EDU A;  3F5A A;  4E0D A;  1T3N A;  5KFB A;  4F3O A;  2EAN A;  9ICS A;  2HHV A;  9ICA A;  1QSY A;  4YCX A;  1ZD2 P;  4QZF A;  4YFK A;  2NO5 A;  9ICI A;  1KSP A;  4FFD A;  4O5E A;  2AXT U;  5KAF U;  2OXO A;  3OSP A;  4MEX A;  9ICK A;  3PSF A;  1L7N A;  4UB2 A;  5DDY A;  2PFO A;  2KKP A;  7ICH A;  3B0Y A;  5T14 A;  3OPX A;  2J6T A;  3QNM A;  2WHE A;  1UA1 A;  3ONN A;  2EZX A;  4QWC A;  4I2J A;  7ICL A;  4UQG A;  3TFR A;  4OJ5 A;  4O3P A;  2BDP A;  3WK6 A;  3TAQ A;  3U26 A;  3RTV A;  4IQV A;  3GIL A;  5L1J A;  4DQR A;  1S0N A;  1X9M A;  4DL6 A;  5CWR A;  3M7D A;  5DG9 A;  1ZRN A;  3ZDD A;  1BNO A;  4DO9 A;  3RH5 A;  4EEN A;  3QU2 A;  2A1J A;  3RB6 A;  3T5H A;  4F5O A;  2ES6 A;  2A1J B;  2LHT A;  2W3S A;  4O3S A;  4OJL A;  5AI8 A;  4I2D A;  3C1Z A;  5AI0 A;  4BJQ A;  4GC7 A;  2K4I A;  1PUZ A;  4EBD A;  1PZN A;  2RQ5 A;  4FZN A;  4UB6 U;  2I5H A;  2XI9 A;  3K1Z A;  4CF3 A;  4UB1 A;  3MBY A;  1QLN A;  3ED5 A;  3OGU A;  3TAN A;  3KBB A;  4RPZ A;  2BQR A;  3MR6 A;  4F5N A;  4IC9 A;  3T3F A;  2KN7 A;  4F4W A;  3HRD D;  2M9N A;  4XUS A;  4X5V A;  5J2A A;  1T7P A;  3RBE A;  1ZQO A;  1SB3 C;  2V4Q A;  3NVW A;  7ICM A;  4PHA A;  3CRX A;  4Q45 A;  4Q8E A;  3FDS A;  5D49 A;  4Y2Y A;  5AKL A;  2A19 A;  3H8S A;  5EE1 A;  3NTU A;  3LDA A;  4UAS A;  4NM2 A;  3F53 A;  5F3X B;  1XSP A;  3OJU A;  4Y2V A;  5CB1 A;  3MR2 A;  2MAX A;  2KVS A;  4DQP A;  3L5K A;  3SV3 A;  2C2E A;  3HPO A;  2D3D A;  1L7P A;  2HBJ A;  4B9L A;  4EBC A;  3F2D A;  4ECR A;  2KEY A;  2FDR A;  4C8L A;  4NL9 C;  1SXE A;  3GV8 B;  3NAS A;  3QU5 A;  1X66 A;  2KG5 A;  4ELV A;  3PSI A;  2YMQ A;  5J2G A;  1IIP A;  4Y2U A;  3QU4 A;  1S0O A;  3SZ2 A;  5HMM A;  3N28 A;  2JRZ A;  2KZM A;  3Q8P B;  5KG2 A;  1NK7 A;  1FFU A;  1K1S A;  3UXP A;  4RUA A;  8ICH A;  2YMM A;  3TFS A;  1S5L U;  1B22 A;  2ZIW B;  1TAM A;  2JHD A;  3G6V A;  3VCB A;  1NOM A;  5J0X A;  2ISO A;  1ZQE A;  2KSO A;  2XY6 A;  2ZTC A;  3MAB A;  1NJZ A;  2G5I B;  9ICT A;  3PZP A;  2F44 A;  2G06 A;  1B0X A;  4C8N A;  4NLK A;  2HVH A;  8ICQ A;  7ICS A;  1NZB A;  4RPX A;  1T3Q A;  4JV0 A;  1WYG A;  4KLJ A;  1T94 A;  2VA8 A;  4F50 A;  2HHT A;  4B6J A;  1IXR A;  5DBA A;  3EWA A;  4B9M A;  1S76 D;  2CPR A;  1BVS A;  1PVQ A;  4NLN A;  3RH6 A;  3B0X A;  2KJ5 A;  1L6N A;  2W8L A;  1B4F A;  3QEA Z;  1PVP A;  4QJF B;  4IR9 A;  3QUC A;  1BPX A;  1ZQR A;  4YD2 A;  3WK5 A;  3JPO A;  2NRT A;  1SWV A;  3E2E A;  5KG6 A;  4KN4 A;  5KTQ A;  1F0M A;  2ISP A;  3HX0 A;  3GFK B;  3N7S C;  1X9X A;  9ICP A;  1ZQY A;  2ZUD A;  1RZT A;  1O03 A;  4PL1 A;  4KLM A;  4PGY A;  3V7J A;  4CE6 A;  4Y2X A;  2R8K A;  4F5Q A;  4KLD A;  5ALD A;  4P0Q A;  4GC6 A;  1TK0 A;  3PML A;  5JTI A;  2K8B B;  4GXK A;  5KFZ A;  4DF8 A;  3SR6 A;  3EPI A;  4QW8 A;  1UCV A;  3H0R B;  1S0V A;  2F8L A;  3ISD A;  1NZP A;  5A0L A;  3D6J A;  3WKD A;  5ALP A;  2K4E A;  4IQU A;  2ZUC A;  3PR5 B;  8ICX A;  3TI0 A;  3PO4 A;  2BQ3 A;  3BS5 A;  4QW9 A;  4J9K A;  3H0M B;  1XU4 A;  4C8O A;  4C80 A;  2W04 A;  2F8K A;  4FS2 A;  4OCZ A;  1Z19 A;  7ICO A;  1L3S A;  3LYS A;  5B66 U;  9ICJ A;  4UB4 A;  3PY8 A;  3KKA A;  2ZUB A;  2RDJ A;  4I2I A;  2H5X A;  3TAR A;  3PW2 A;  4RNO A;  4M9H A;  3PST A;  1KEJ A;  3M9N B;  3G6Y A;  3M6Z A;  3V7K A;  4NV0 A;  1MQ3 A;  1V38 A;  3HKZ C;  4ECS A;  3Q8R B;  3D2S A;  2DPJ A;  1UT8 A;  9ICE A;  5J0Y A;  4QZI A;  3M1Y A;  2DPI A;  2KV2 A;  4P4M A;  2CRX A;  3WU2 U;  7ICV A;  2HI0 A;  3DEE A;  4JV2 A;  4XA5 A;  2ZIV A;  3UMG A;  4AYB F;  3KHR A;  3WK9 A;  1Z00 B;  3B9J A;  2VAN A;  1ZD5 A;  2KP7 A;  2WAQ F;  8ICT A;  4IS7 A;  1IV8 A;  4GIB A;  4USA A;  3IG8 A;  5KT3 A;  1A0P A;  4FZL A;  4M9G A;  3HT3 A;  8ICP A;  1XWL A;  2XY5 A;  4ECX A;  2QAR A;  4PPX A;  4BDP A;  4NLB A;  2JH1 A;  4PHP A;  4EYH B;  3C23 A;  4TUR A;  1ZQX A;  4TQR A;  3UM9 A;  4CNQ A;  2FMQ A;  4F2R A;  1XO0 A;  4GXJ A;  3PX6 A;  1YZ7 A;  3UXO A;  9ICO A;  5KFL A;  3JPN A;  7ICG A;  4DLG A;  2W43 A;  2DGZ A;  3OJS A;  1ZQW A;  2DBY A;  2KOB A;  2HHW A;  2KFN A;  1FIQ A;  2WF8 A;  5DLG A;  5J0U A;  2NRZ A;  8ICV A;  4KTQ A;  4UB3 A;  4MEY A;  2JV3 A;  5ALW A;  3LK9 A;  1TAQ A;  1MA7 A;  2LM1 A;  1ECW A;  4IQW A;  4BWM A;  4KMU A;  4ECT A;  4GLX A;  5TIS U;  3QZ7 A;  1KDH A;  3M8R A;  3C2K A;  2A1A A;  2B6G A;  9ICC A;  3V6H A;  3C29 A;  4JWM A;  5DG8 A;  1KQQ A;  3QUT A;  2HMX A;  2MSN A;  4LJX A;  5J2J A;  4I2E A;  4ECW A;  7ICF A;  1JI7 A;  4QWE A;  1WWV A;  1OXJ A;  2XGP A;  4RQN A;  3JPQ A;  4F4Y A;  1ZOL A;  5HR7 A;  1JMS A;  4P4P A;  1UA0 A;  5KT6 A;  3JPT A;  2GWS A;  5DB9 A;  3N4M B;  4RT3 A;  2MRL A;  5KFO A;  3H7I A;  2EQY A;  5KT4 A;  3IM1 A;  2JEF A;  5DBC A;  3BDP A;  2YQE A;  4RQ3 A;  5KT5 A;  2Y0S F;  5AI6 A;  1DRG A;  3PX0 A;  5ALX A;  1XNS A;  3RF9 A;  4ECU A;  5J2K A;  1V85 A;  4CDG A;  3PW5 A;  1Z1V A;  2R18 A;  3BJY A;  2QB0 B;  5AKJ A;  4DSF A;  4FS1 A;  4XRH A;  4QZC A;  4NL9 A;  4MFF A;  5EE0 A;  1L3U A;  2QB0 A;  5J8Y A;  4DLE A;  4I2H A;  4J03 A;  4KLS A;  4ED8 A;  3F2B A;  4QWB A;  5J2B A;  4RNM A;  4DQI A;  2XVT A;  5C5J A;  2CN1 A;  1JRO A;  2N1R A;  4ED3 A;  3QZ8 A;  3BQ2 A;  5AM4 A;  3RR7 A;  1VJ5 A;  3EPG A;  3KZI U;  3QUQ A;  4PH5 A;  3DDH A;  2WAQ C;  4M9L A;  2NRX A;  1ZD4 A; 
#chains in the Genus database with same CATH homology
 1RYU A;  2JRZ A;  1KQQ A;  2RQ5 A;  2EQY A;  2KK0 A;  5CEH A;  2LM1 A;  2EH9 A;  2OEH A;  1C20 A;  1IG6 A;  1KN5 A;  4LJX A;  2JXJ A;  2CXY A;  2YQE A;  5K4L A;  1KKX A;  2LI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...