1KN5A

Solution structure of arid domain of adr6 from saccharomyces cerevisiae
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
102
structure length
102
Chain Sequence
NNKQYELFMKSLIENCKKRNMPLQSIPEIGNRKINLFYLYMLVQKFGGADQVTRTQQWSMVAQRLQISDYQQLESIYFRILLPYERHMISQEGIKETQAKRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1H, 13C and 15N resonance assignments and secondary structure of ADR6 DNA-binding domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
molecule keywords Transcription regulatory protein ADR6
total genus 19
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2001-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 1kn5A00
2CXYA 2KK0A 2LI6A 1IG6A 1RYUA 2JXJA 2EQYA 2YQEA 1KQQA 2RQ5A 2EH9A 2LM1A 2OEHA 5K4LA 5CEHA 1KKXA 1C20A 2JRZA 4LJXA 1KN5A
chains in the Genus database with same CATH superfamily
1MA7A 1K1SA 4MFCA 2ZJ8A 4RUCA 4ECYA 4JK1A 1S77D 2ISPA 4ECSA 2LBOA 3PW7A 4QZDA 2UVRA 4RT2A 1NJYA 2B0CA 5EE9A 1ZQEA 4EEKA 2C28A 1ZQTA 4KTQA 5AI9A 4FZLA 3NVYA 4PJ0U 4OJOA 3ZDCA 5TISU 3D6JA 5AI6A 3H8WA 4Y2TA 2QB0A 4QZEA 5L9XA 1SWWA 5ALRA 1U4BA 2E8PA 1J2MA 1TE2A 1WWVA 2IOFA 1ZQBA 3DV9A 3K1ZA 2YY6A 2MUTB 4YFKA 4F2RA 4CF4A 3WK6A 1S0VA 2MRLA 3RBEA 2HOQA 2FPKA 5KFZA 3C2MA 1YZ7A 2ZJAA 2MSNA 2JGAA 4KLHA 3RJJA 3PNCA 3V7LA 4DLEA 5J2CA 2XCPA 2F77X 1L3VA 2HHQA 3RJFA 2W8KA 2KHVA 5KTQA 4YXJA 4DQSA 3LWLA 4KLJA 3T5HA 4J9NA 3LDAA 3EYZA 3WKAA 3QX7A 4QZFA 1ZJNA 4M6WB 1CUKA 2DGZA 1ZQRA 1VDVA 4KN4A 4C4TA 1S9FA 1UA0A 4ELUA 3N4MB 3UQ2A 1P7DA 4YMOA 1S8OA 4Z6EA 5KG6A 4DFKA 1SXEA 4IS7A 3AEVA 2H3FA 4KLFA 2JEGA 2NO4A 2LYAA 3RR8A 5T14A 1ZQSA 2RP5A 2IHMA 3IRUA 1KFSA 1N2XA 3PSFA 3UXNA 1YT3A 2WFAA 5KT4A 4GIBA 4GXJA 3PW5A 4ED3A 2PFPA 8ICEA 3TANA 2HHVA 5KT2A 4XA5A 3PV8A 1FFVA 2IMWP 4QNLA 1TFRA 1ZJMA 3RH6A 4PZOA 2NRZA 3AN1A 8ICFA 3HT3A 2VJ4A 4EBDA 5F9LA 5G5HA 4P2HA 3LVWA 4DFDA 3PX4A 1ZQCA 1NOMA 4M2YA 1Q8KA 1V85A 2P6RA 1PVRA 4Z6CA 4JV2A 3DEEA 3T3FA 3JPOA 2G5IB 4ECUA 1M6YA 2YMMA 1ZQGA 2H3VA 4FO6A 4M47A 4DL2A 4QWDA 3AQFA 4QZGA 3SYZA 5CB1A 4OJLA 1S76D 4MHVA 2W9CB 3QU2A 4PH5A 1ZXIA 2C2EA 3HKZC 3OJUA 4I28A 5J8YC 1JRPA 4OJPA 1VJ5A 3JPRA 5K4LA 5DB9A 5ALNA 2C22A 2K4HA 4RQ5A 2K8CB 1JALA 3TFSA 5JUMA 2Y1IA 2A1JB 4CF3A 4NL9A 4UBCA 4C8MA 3PO4A 2RLTA 5KG0A 2I5HA 4B9VA 8ICJA 3B0YA 7ICHA 3BZKA 3PZPA 4KLSA 2HHSA 3F5AA 5AM3A 1X2IA 1KQQA 3HPOA 4F8RA 5KG1A 5CWRA 4TQRA 4TUSA 4UBBA 3Q8MA 1S0OA 2A1AA 4YR0A 4F4WA 4PL1A 4FZMA 1BPBA 2YN4A 3SQIA 5HMLA 3TAPA 4P0PB 4PHAA 1QLNA 1MSWD 8ICOA 2XY7A 2FMSA 4CE6A 3KZIU 3QU5A 2RDJA 3Q8LA 5KNIA 4P4MA 5AKZA 1T94A 5KFUA 4RT3A 1RYSA 2HBMA 2NO5A 4FBTA 2BZFA 3AUOA 3RB4A 3TQ1A 4J9RA 4ED7A 4NWIA 5DDMA 3GIMA 2ASLA 1L3TA 2XY5A 4C7YA 3NRZA 4G3IA 1KSPA 3OGUA 2DWQA 8ICZA 4CRXA 2C2DA 3JPSA 4DQPA 5AKLA 1WWUA 2EAOA 1QTMA 1Z4NA 3UXOA 2R18A 3GIJA 1ZQFA 1JUDA 3B0XA 1LKYB 1RQNA 9ICXA 3RB6A 2BKEA 3ZDAA 5KFQA 4JV1A 4UB1A 5J2EA 1DK2A 5AKGA 2JH1A 1MQ3A 3PR4A 5TZVA 3PX0A 3MR2A 2VANA 7ICEA 3F53A 5ALZA 3EW9A 4O5EA 1DGJA 4FZNA 5KFHA 2LMRA 1S97A 3SZ2A 4M9LA 2I9GA 2K4EA 1VLBA 1Z1VA 3EWAA 2W9MA 1NJZA 2ASDA 5AM2A 1Q3VA 2EANA 3FC4A 1NI3A 1Q46A 4KMOB 3GQCA 3BQ1A 4NLCA 1SL2A 2E1FA 4E0DA 2W9BB 7ICIA 4O9MA 4GXIA 5IIOA 4PHPA 5HNKA 3SAFA 2BPFA 8ICTA 3RTVA 3SD7A 5KFJA 4J9PA 5IILA 5KFFA 2E8MA 3PX6A 3N7PD 4DOBA 4OJ6A 2G09A 5DBCA 5ALOA 2UVUA 3RJEA 3THVA 1D8BA 2BCSA 2G5HB 9ICPA 4M9GA 3CW2C 5EWFA 4I27A 4YN4A 4CNQA 4O0IA 2DKZA 2BCUA 2F8LA 4EZ6A 3V7KA 2E8NA 2FDRA 2ZIVA 4JWMA 2QLTA 2OCEA 5KFMA 1QH9A 4BXOB 4OD0A 1FEZA 1URJA 5DG7A 2KJ5A 2KIWA 1RZTA 3ISCA 9ICHA 3LYSA 4NY8A 4QZCA 4QJFB 1KRPA 1ZYQA 2PMZC 2ISOA 1L7MA 2HCFA 1IXRA 2EAPA 3L3FX 1QSYA 4MF2A 1NK7A 4UB3A 1DXSA 1SKRA 2ZXHA 2KSOB 4UAUA 1UPHA 7ICJA 3IP4B 3AQEA 1YZ6A 1NKEA 4EX6A 2BQRA 3JPPA 2W3SA 1PVPA 1KDHA 4B6JA 5CEHA 4QW9A 2QARB 4F71A 4P4PA 1ZQ1C 1OXJA 3M6ZA 3SI8A 2BQ3A 5AKYA 4UB2A 4J9SA 1QSLA 4AYBF 4I29A 2KNJA 4X5VA 8ICYA 4FS1A 2XGQA 5ALYA 3ZDEA 4ZH4A 4TURA 4MF8A 1NJWA 3OSNA 2JR5A 4RPXA 2FI1A 2DKXA 3O0FA 5DG9A 3KZXA 1L5UA 1SKWA 2GLEA 2KJ9A 4I2DA 1HUOA 8ICLA 2DPJA 4Q8EA 1XSPA 4NL9C 2W9AA 1BNPA 4PHEA 1U45A 1C7YA 3C5GA 4QWCA 5DB6A 3H7IA 2MUTA 3RJIA 1WUDA 1X9XA 3PR5B 3C1ZA 1FO4A 1LVHA 5KFBA 2B6GA 3PSTA 2ZIWA 5CP2A 1BNOA 4RZRA 1RQLA 5ALDA 1KW4A 3Q8KA 2JZBA 3H8JA 3MR6A 5KT7A 2G08A 4M9NA 1NK5A 1XSLA 1J97A 3NVVA 4K4HA 3M8SA 1KTQA 4UAYA 4NLKA 4O3SA 4M6WA 1ZQAA 4WJ3B 4C8LA 1JX4A 4B9LA 2R8GA 3UM9A 1PK1B 5KFWA 3K75D 2E8OA 1TAMA 5GTIU 2A3VA 1JIHA 2BCRA 8ICWA 7ICUA 3WKDA 5KAIU 3N7SC 3PY8A 4OO1J 1AROP 4A8EA 4F92B 1ZQJA 3M9OB 3FDSA 2KMDA 3NASA 1S10A 2VJ5A 1T8EA 2K60A 4Y2UA 4O3NA 2ZXIA 2H3IA 4UAZA 1SL1A 4DO9A 4QZIA 1TAQA 5KFLA 3TACB 3BJYA 3ONNA 1U47A 1T7PA 4O3MA 3MR5A 9ICOA 3PMNA 3QEAZ 2H3ZA 4R66A 5DBAA 1F5SA 5DB7A 5J2KA 1T3NA 1UCVA 3SEIA 4F5PA 4DQRA 8ICIA 3AL0B 5J29A 4RQNA 5AKJA 2QB0B 3QU9A 1UT8A 5J0OA 1PK3A 3ORYA 4TQSA 2FMPA 3RFAA 4NM1A 2EAMA 1WCLA 4NXZA 4RQ7A 3WKCA 2JRZA 4JMUA 2HBLA 4UASA 2AQ4A 3C1YA 1TVAA 3HRDD 4F5RA 3IHQB 4B9MA 2NRVA 4Y2XA 1BPYA 2J6TA 3BS5B 3H40A 1KBUA 4ZOHC 1OW5A 5ALLA 3ZI4A 1D8YA 5AM4A 3SAGA 2XC9A 2AHOB 2HW3A 1WYGA 2Q0ZX 4O5CA 2GO7A 9ICEA 1B4FA 1N60A 4F4XA 9ICSA 2DFLA 5DKWA 7ICSA 2F1HA 1XSNA 1MQ2A 9ICFA 2GOLA 2AQ0A 5AKIA 3C21A 3AU6A 5KG2A 8ICMA 4QZ9A 5J2IA 5KT6A 4DS5A 4IL6U 4UQGA 4O3OA 1RYUA 1QQ6A 4YR2A 2FMQA 4MEYA 4DQIA 2P35A 4P4OA 3WKEA 1S5LU 4ACOA 5AM1A 4ELTA 1SV0C 3Q8PB 5J2HA 1IV8A 9ICNA 3OTQA 1ZD4A 1ZQLA 4UAVA 2JEIA 3F2CA 4MFAA 3C28A 2K4PA 2F3NA 4DSJA 2LM4A 5HHIA 4BDPA 1RG6A 2ESEA 2YMLA 3WK8A 2YTUA 4ECVA 9ICGA 4IRCA 2MU2A 4M9JA 2W55A 4DCCA 3IDWA 4C8NA 3ZD9A 3SV3A 4GC6A 4I2CA 2VA2A 4F4YA 5B66U 3HWTA 1TK5A 4I2GA 5CJ7A 8ICRA 1CRXA 2HHWA 3H4DA 2KE7A 2V4QA 4F72A 4R64A 2KG5A 5KFOA 1DRGA 5ALTA 2KICA 2JH7A 1BVSA 2ZIUA 4U7CA 1B0XA 4IQVA 1X42A 5AKKA 3ISBA 3Q8RB 1UHUA 4QIWF 4KX3A 1NK9A 5EWGA 4DL4A 3KHLA 3LK9A 4RU9A 5ALJA 2RRDA 5FP0A 1LB2B 3CNHA 2KFZA 5ALIA 2DQNB 3MR3A 4O3QA 3UXPA 1N62A 2AH5A 2D6FC 5KFIA 3M7DA 4EZ9A 4J03A 1XNSA 4I2IA 3RJHA 5KG5A 2Q4TA 5IIIA 3KHHA 2IA6A 5EE3A 2A19A 7ICRA 4US8A 2ZIXA 2W43A 1AQ6A 2ZUDA 3QEBZ 4FBUA 1NZPA 3PW2A 3GDXA 2KVCA 2YMQA 3TAQA 4UB5A 4J9OA 1NKCA 3RB0A 2LI6A 3C2KA 2MAXA 4C80A 3J81j 3G6VA 4QWBA 3NUQA 3BZCA 2WF6A 4ECTA 4RQ0A 4DF4A 1BPEA 1L7OA 1JROA 3UQ0A 2AJQA 4J9LA 4DSLA 1Z19A 1HJPA 3B9JA 1ZQNA 3D2NA 1XU4A 4BWJA 5HP4A 2OYYA 4M04A 3QNMA 3PVXA 1BGXT 1COOA 5AI8A 5KT3A 4RPYA 1TV9A 2D8CA 5ALFA 4ED8A 8ICKA 4LZDA 2Y1JA 3ETLA 1NKBA 2G0AA 2W7PA 3HILA 5HR6A 2KD1A 4Y2SA 5J2JA 2G06A 1D8LA 4Y2PA 3KKAC 1RDFA 2FE9A 1V9PA 4DQQA 2G07A 2MA1A 2J6SA 1ZQMA 9ICVA 2KZMA 4U6PA 3MC1A 2PFQA 1XO1A 5AK4A 3KBBA 1NK4A 1X9SA 4C4SA 4KLQA 4B9SA 1RPLA 2HBKA 3ETRA 8ICVA 1EXNA 1BPZA 2M0NA 2OHFA 2IOHA 1K5OA 1QCKA 2EDUA 3WK9A 2K89A 3V72A 4F5NA 4K4GA 4Y2VA 3IG8A 3EZ5A 2N1RA 4EEYA 2R8KA 7ICOA 5KAFU 3GU3A 3C23A 4DOAA 2QARA 5KFSA 1JMSA 3NRWA 3WU2U 2I6XA 2E3TA 4USAA 3SAHA 5DLGA 4KLOA 4NLBA 2W7OA 2KSOA 3RJKA 3BQ2A 1QQ7A 4P0QB 5D4BA 1A0PA 5J2BA 9ICTA 3QXGA 4ED1A 4UB4A 4ED2A 4IRDA 4I2EA 5KFRA 5D49A 2E5SA 3E0FA 3ALRA 4IC9A 8ICGA 3RH4A 4YVZA 4O3PA 5AM0A 2QB1A 4YD2A 2K8AA 1MC8A 3H0LB 5J0PA 3QUBA 4ELVA 2ZIVB 3RBDA 3GV7B 2XIDA 3KKAA 4RQ8A 4QZBA 5ALXA 5ALGA 4NLNA 5AKHA 5F3XB 1T4GA 1PVQA 2LYBA 3HP6A 4C8KA 2WF5A 4KITB 4PPXA 3SR6A 3QUQA 2ASJA 1DGSA 4EYHB 5KL8B 1N48A 4DSEA 2PI4A 3H8MA 2WB1C 1NJXA 3M6KA 1PUZA 2QKQA 2F1JA 5KFEA 1ZQIA 2H5XA 2PKEA 5ALVA 1NK6A 2KEYA 1SZHA 2Y9UA 4XRHA 1A76A 3IV6A 4YCXA 7ICLA 3CRXA 1ZQZA 2C2RA 2XO7A 1N63A 1S0MA 4DFPA 4KLMA 2YB1A 3RH5A 3C5FA 3M1YA 4UB6U 2AXTU 1IM4A 4ED0A 3UMGA 1ED1A 3JPTA 2KP7A 1SXDA 4BGDA 2J6UA 4F91B 3LWMA 3WK7A 2KKVA 5KL1B 3F5EA 4QZAA 1JXEA 2NV3A 4EYIB 2UVVA 1DK3A 3K4GA 4ECRA 4CF5A 4DSIA 2YQEA 7ICGA 3GV8B 2NRTA 4Q45A 5CA7A 2PMZF 3MDAA 3N97B 3AU2A 4YD1A 5AK3A 1CEZA 4PL2A 5J0YA 4DSFA 3RRHA 1ZD2P 2RHFA 5EE1A 5CHGA 2XCAA 5BOLA 4YMNA 2IBKA 3TADC 9ICUA 5HMMA 5EE0A 4DWIA 3FYHA 1TAUA 2HHXA 4QWEA 1X9WA 3MABA 9ICKA 2Z7JA 1Z3EB 5EOZA 5DG8A 3UMCA 1Q3UA 4DL3A 1XWLA 3N7RC 2WHEA 2LM1A 4J9KA 3RRGA 2F76X 4GXKA 1HEKA 1ZQYA 2W04A 2AGOA 3BS7A 4F93B 3HW8A 3JPNA 3UPQA 4M9HA 1Z00B 2AU0A 4B9NA 1C20A 3RAQA 1SV0A 2WB1F 1SIJA 5J2DA 3H4BA 4XUSA 4OJ5A 1D9FA 3I76A 7ICFA 1X66A 1Z1BA 4EBCA 2KTQA 4R8UB 2YB4A 4XQ8A 5KFYA 3T5LA 2BQUA 2W8LA 3Q8QB 1JXLA 4RNOA 4RQ4A 4PGQA 4DFJA 5DQIA 2JHDA 2ZUCA 5F9NA 4ECQA 1ZQDA 4KLGA 3QZ8A 3VC8A 2E1EA 2LHTA 3NVZA 2XVTA 5DLFA 3I28A 2BGWA 4NLZA 3GFKB 2EH9A 3MGVA 1N5WA 2BPGA 3F2BA 4RNNA 3ZD8A 5KFTA 2HBJA 5DQGA 4CCHA 4C0ZA 3OJSA 4RQ6A 3E2EA 1N5XA 1KEJA 4MFFA 5KT5A 2F8KA 3CYMA 1X9MA 4RUAA 2W11A 3Q8SB 3PO5A 1Z00A 4TUPA 5CRXA 2WF9A 2IOFK 1V38A 3IG5A 1L7PA 7ICTA 5J2GA 2YX8A 4F4ZA 2Y9TA 2FLNA 2OXOA 5ALQA 2DF4B 5KG7A 3PSIA 3H0RB 5KFGA 4HYKA 3M9NB 1X6IA 1ZQHA 3EUB2 5BPCA 3QU7A 4DOCA 2KZ3A 5DDYA 3MFHA 3DDHA 2Y0SF 1IG6A 3SV4A 2XI9A 2K8BB 3GIIA 3OSPA 1SWVA 3ISDA 2ZJ5A 5KFAA 7ICVA 3BQTA 5ALSA 8ICPA 3LVVA 2R8HA 4C7ZA 1K1QA 3PMLA 3T5JA 4IR9A 2NRXA 1U48A 2R8JA 2OWOA 4P0PA 4NV0A 2RDIA 2LKYA 5AI0A 4IQWA 4ECZA 3KHGA 4AP9A 3TFRA 2XICA 2BDUA 4F5QA 2WF7A 7ICMA 4RQMA 3L5KA 4J9QA 4NLGA 3F2DA 5C0YA 5ALWA 2HDOA 4KLIA 2ODGA 2P66A 1F0MA 2L5YA 2DL0A 4PHDA 2EZXA 1CI4A 1L7NA 1ZQUA 3RF9A 2KHQA 3TKAA 1COKA 4Z6DA 3JPQA 5KG3A 1LV5A 4FS2A 1ZQWA 4OCZA 2R8IA 2CRXA 4P0QA 5DGAA 8ICAA 3RAXA 5J0QA 5L1LA 2VIXA 1OUQA 2HMXA 4Y2RA 3FM9A 4IRKA 5AM5A 2AGPA 3MFIA 5DGBA 2Y0SC 5JU5A 2FPLA 1RYRA 1S0NA 4F3OA 2JEFA 1MN8A 1ZOLA 4KLUA 1ZQVA 5AK5A 4Q8FA 4DF8A 3MDCA 4EENA 2ZTEA 3T79A 5ALHA 3ZDDA 1UQVA 3G6XA 2PXIA 5AI5A 5KFPA 3L4PA 1A6SA 5DB8A 2D3DA 2HI0A 3NS1A 3ED5A 4UAWA 4DS4A 5GTHU 2PI5A 5J2FA 2HOIA 5AHXA 2ZUBA 4GC7A 3NTUA 4DL7A 1KLNA 1L3UA 1KFTA 2HHTA 5KFVA 7ICNA 8ICNA 4YXMA 1ZRNA 4KN7A 3MGIA 1Z4OA 9ICRA 1NNLA 4JB3A 3R9KA 4Y2JA 1FIQA 3D2QA 2F44A 2WF8A 4K4IA 1ZRMA 5IIMA 1D9DA 3TARA 5J0TA 1N56A 3CP8A 3NGDA 1JN3A 1FFUA 3U26A 1ZQOA 9ICCA 2ZG6A 4GLXA 5KFDA 5B5EU 4B9UA 3GILA 2PFNA 4RQ1A 1BPXA 3PSPA 5C5JA 1NZBA 3HX0A 3A0BU 3QUTA 9ICJA 3HJEA 4I2JA 4PZNA 5AIBA 2FLPA 2M9NA 4Z6FA 4LVSA 5J0WA 4CDGA 5L1MA 3BS5A 4HAIA 4F4KA 5AI4A 4I2HA 2ZIXB 2HHUA 3QUCA 2KFNA 3S6JA 4DSKA 3IN5A 9ICQA 4DFMA 1BPDA 4YG2A 1UT5A 3SENA 7ICPA 5IINA 2BCVA 4DL5A 3H0MB 3KFUF 4UW9A 5ALKA 1N61A 3VCBA 2KN7A 3WK4A 1L8OA 4F50A 2KZZA 1KFDA 5CR0A 2F2AB 2KIVA 3K1RB 4ED6A 1T3QA 2NYVA 2BDPA 2KV2A 5EWEA 2VA3A 1ZD5A 5J2AA 2UVWA 9ICWA 4I2BA 4LZGA 4KMUA 5ALMA 3FAHA 5AKXA 4BWMA 1HIWA 4EELA 3MBYA 4KLTA 4TUQA 4QW8A 4Y2QA 1GO3F 1L6NA 4YP3A 1UA1A 5AICA 2GH1A 4KLDA 2XGPA 4EX7A 2KVSA 3ICXA 3BQ7A 4DL6A 4I2AA 1QSSA 4C4RA 2DBYA 4M0AA 2IHNA 2XY6A 3BDPA 1TK0A 5IIKA 3E58A 3PW4A 3N28A 3NVWA 4UARA 4FE3A 9ICIA 2H3QA 2OM6A 3WKBA 1HUZA 5J0SA 2HVHA 4PGYA 8ICSA 5KFCA 3G6YA 4Q44A 5JRTA 2I1QA 1ZETA 1PZNA 4O3RA 4F2SA 2V4RA 5L1JA 4RPZA 3KD3A 1KN5A 2FPMA 5HR7A 3RR7A 2JMGA 3V7JA 3ZDBA 3TI0A 4J9MA 5L1KA 2W9CA 1XC9A 8ICBA 2KKPA 2FLLA 1JI7A 2HSZA 2FJ6A 4DEZA 9ICLA 4Q43A 4YR3A 2W9BA 4QZHA 1XS9D 3C2LA 5KG4A 8ICCA 3SMVA 3OPXA 4MEXA 1SL0A 7ICKA 2NRWA 9ICBA 3EPGA 4ECWA 1ZD3A 2RQ5A 2VA8A 3KOOA 1L8LA 1SGGA 4IQUA 2V9WA 3PW0A 3AMZA 4F5OA 3QU4A 3V6HA 4C8OA 2W54A 5ALPA 1TK8A 3TADA 3KHRA 1J2NA 4KLLA 2P6UA 1A77A 5JTIA 3C29A 2EQYA 3GV5B 1ZQKA 3M9MB 3RB3A 4IQTA 4UATA 1F44A 2ATLA 4RQ2A 4BXOA 3V6KA 1H38A 3I1YA 4DLGA 5HHHA 5KFNA 1SKSA 4JWNA 2AGQA 3GZFA 1U49A 3OHBA 4AYBC 1SV4A 3AM9A 9ICMA 5L1IA 4ECXA 4O5KA 1Y88A 2ZTCA 5J8YA 4KLEA 4R63A 5AK6A 1LKYA 1V97A 2OH2A 2W03A 5A0LA 3IM1A 5J0UA 2BR0A 3QZ7A 3KTQA 1WCNA 1NK8A 4JUZA 1X40A 3WK5A 1ZQXA 8ICHA 3BQ0A 1ZQPA 4BUGA 4CGZA 5G5GA 2ALZA 2LPEA 1KL9A 4NM2A 2HOFA 2JEJA 4RNMA 2BPCA 4ICAA 1KKXA 2WAQF 2PFOA 4QWAA 4UB8U 2ZTDA 4I2FA 1B43A 9ICAA 3V6JA 4BX9C 1TKDA 3T5KA 2DUYA 8ICUA 4YQWA 5AKEA 3H8SA 5J0RA 4FFDA 3D2SA 2W3RA 2EZYA 5H2FU 4PGXA 3M8RA 3A0HU 1QQ5A 1XO0A 1RXVA 1U9LA 5ALEA 4JV0A 2CPRA 4RQ3A 4G9BA 2VKQA 5KFKA 1RM6C 4KX5A 3UMBA 2K4IA 5J0XA 1DOQA 1X6JA 2A1JA 2GWSA 5AIAA 4BJQA 1WG8A 5DQHA 4LJXA 2CN1A 3HKZF 2ES6A 3EPIA 2JZBB 5BOMA 2ZIUB 2YMPA 4YMMA 5ALUA 5KFXA 4QZ8A 3GIKA 4Y2YA 2LYHA 1SB3C 3QYPA 2HVIA 2B21A 5DBBA 8ICXA 1O08A 4GFJA 2F1IA 4R65A 5E79U 1SZPA 1PK1A 1L3SA 8ICQA 1B22A 4R8UA 2JV3A 2WAQC 4QIWC 2KJ8A 2WTFA 1IIPA 3RJGA 1O03A 4EBEA 2BHNA 4B9TA 1ZQQA 7ICQA 2KOBA 1ECWA 2EZZA 1RXWA 5D46A 3MGHA 2OEHA 4US9A 2CXYA 4NJ8A 3OHAA 2JXJA 2ZIWB 4IR1A 1NK0A 2KK0A 2O6KA 2DPIA 5IIJA 3QE9Y 2BCQA
chains in the Genus database with same CATH topology
2CXYA 2KK0A 2LI6A 1IG6A 1RYUA 2JXJA 2EQYA 2YQEA 1KQQA 2RQ5A 2EH9A 2LM1A 2OEHA 5K4LA 5CEHA 1KKXA 1C20A 2JRZA 4LJXA 1KN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CXY A;  2KK0 A;  2LI6 A;  1IG6 A;  1RYU A;  2JXJ A;  2EQY A;  2YQE A;  1KQQ A;  2RQ5 A;  2EH9 A;  2LM1 A;  2OEH A;  5K4L A;  5CEH A;  1KKX A;  1C20 A;  2JRZ A;  4LJX A;  1KN5 A; 
#chains in the Genus database with same CATH topology
 1MA7 A;  1K1S A;  4MFC A;  2ZJ8 A;  4RUC A;  4ECY A;  4JK1 A;  1S77 D;  2ISP A;  4ECS A;  2LBO A;  3PW7 A;  4QZD A;  2UVR A;  4RT2 A;  1NJY A;  2B0C A;  5EE9 A;  1ZQE A;  4EEK A;  2C28 A;  1ZQT A;  4KTQ A;  5AI9 A;  4FZL A;  3NVY A;  4PJ0 U;  4OJO A;  3ZDC A;  5TIS U;  3D6J A;  5AI6 A;  3H8W A;  4Y2T A;  2QB0 A;  4QZE A;  5L9X A;  1SWW A;  5ALR A;  1U4B A;  2E8P A;  1J2M A;  1TE2 A;  1WWV A;  2IOF A;  1ZQB A;  3DV9 A;  3K1Z A;  2YY6 A;  2MUT B;  4YFK A;  4F2R A;  4CF4 A;  3WK6 A;  1S0V A;  2MRL A;  3RBE A;  2HOQ A;  2FPK A;  5KFZ A;  3C2M A;  1YZ7 A;  2ZJA A;  2MSN A;  2JGA A;  4KLH A;  3RJJ A;  3PNC A;  3V7L A;  4DLE A;  5J2C A;  2XCP A;  2F77 X;  1L3V A;  2HHQ A;  3RJF A;  2W8K A;  2KHV A;  5KTQ A;  4YXJ A;  4DQS A;  3LWL A;  4KLJ A;  3T5H A;  4J9N A;  3LDA A;  3EYZ A;  3WKA A;  3QX7 A;  4QZF A;  1ZJN A;  4M6W B;  1CUK A;  2DGZ A;  1ZQR A;  1VDV A;  4KN4 A;  4C4T A;  1S9F A;  1UA0 A;  4ELU A;  3N4M B;  3UQ2 A;  1P7D A;  4YMO A;  1S8O A;  4Z6E A;  5KG6 A;  4DFK A;  1SXE A;  4IS7 A;  3AEV A;  2H3F A;  4KLF A;  2JEG A;  2NO4 A;  2LYA A;  3RR8 A;  5T14 A;  1ZQS A;  2RP5 A;  2IHM A;  3IRU A;  1KFS A;  1N2X A;  3PSF A;  3UXN A;  1YT3 A;  2WFA A;  5KT4 A;  4GIB A;  4GXJ A;  3PW5 A;  4ED3 A;  2PFP A;  8ICE A;  3TAN A;  2HHV A;  5KT2 A;  4XA5 A;  3PV8 A;  1FFV A;  2IMW P;  4QNL A;  1TFR A;  1ZJM A;  3RH6 A;  4PZO A;  2NRZ A;  3AN1 A;  8ICF A;  3HT3 A;  2VJ4 A;  4EBD A;  5F9L A;  5G5H A;  4P2H A;  3LVW A;  4DFD A;  3PX4 A;  1ZQC A;  1NOM A;  4M2Y A;  1Q8K A;  1V85 A;  2P6R A;  1PVR A;  4Z6C A;  4JV2 A;  3DEE A;  3T3F A;  3JPO A;  2G5I B;  4ECU A;  1M6Y A;  2YMM A;  1ZQG A;  2H3V A;  4FO6 A;  4M47 A;  4DL2 A;  4QWD A;  3AQF A;  4QZG A;  3SYZ A;  5CB1 A;  4OJL A;  1S76 D;  4MHV A;  2W9C B;  3QU2 A;  4PH5 A;  1ZXI A;  2C2E A;  3HKZ C;  3OJU A;  4I28 A;  5J8Y C;  1JRP A;  4OJP A;  1VJ5 A;  3JPR A;  5K4L A;  5DB9 A;  5ALN A;  2C22 A;  2K4H A;  4RQ5 A;  2K8C B;  1JAL A;  3TFS A;  5JUM A;  2Y1I A;  2A1J B;  4CF3 A;  4NL9 A;  4UBC A;  4C8M A;  3PO4 A;  2RLT A;  5KG0 A;  2I5H A;  4B9V A;  8ICJ A;  3B0Y A;  7ICH A;  3BZK A;  3PZP A;  4KLS A;  2HHS A;  3F5A A;  5AM3 A;  1X2I A;  1KQQ A;  3HPO A;  4F8R A;  5KG1 A;  5CWR A;  4TQR A;  4TUS A;  4UBB A;  3Q8M A;  1S0O A;  2A1A A;  4YR0 A;  4F4W A;  4PL1 A;  4FZM A;  1BPB A;  2YN4 A;  3SQI A;  5HML A;  3TAP A;  4P0P B;  4PHA A;  1QLN A;  1MSW D;  8ICO A;  2XY7 A;  2FMS A;  4CE6 A;  3KZI U;  3QU5 A;  2RDJ A;  3Q8L A;  5KNI A;  4P4M A;  5AKZ A;  1T94 A;  5KFU A;  4RT3 A;  1RYS A;  2HBM A;  2NO5 A;  4FBT A;  2BZF A;  3AUO A;  3RB4 A;  3TQ1 A;  4J9R A;  4ED7 A;  4NWI A;  5DDM A;  3GIM A;  2ASL A;  1L3T A;  2XY5 A;  4C7Y A;  3NRZ A;  4G3I A;  1KSP A;  3OGU A;  2DWQ A;  8ICZ A;  4CRX A;  2C2D A;  3JPS A;  4DQP A;  5AKL A;  1WWU A;  2EAO A;  1QTM A;  1Z4N A;  3UXO A;  2R18 A;  3GIJ A;  1ZQF A;  1JUD A;  3B0X A;  1LKY B;  1RQN A;  9ICX A;  3RB6 A;  2BKE A;  3ZDA A;  5KFQ A;  4JV1 A;  4UB1 A;  5J2E A;  1DK2 A;  5AKG A;  2JH1 A;  1MQ3 A;  3PR4 A;  5TZV A;  3PX0 A;  3MR2 A;  2VAN A;  7ICE A;  3F53 A;  5ALZ A;  3EW9 A;  4O5E A;  1DGJ A;  4FZN A;  5KFH A;  2LMR A;  1S97 A;  3SZ2 A;  4M9L A;  2I9G A;  2K4E A;  1VLB A;  1Z1V A;  3EWA A;  2W9M A;  1NJZ A;  2ASD A;  5AM2 A;  1Q3V A;  2EAN A;  3FC4 A;  1NI3 A;  1Q46 A;  4KMO B;  3GQC A;  3BQ1 A;  4NLC A;  1SL2 A;  2E1F A;  4E0D A;  2W9B B;  7ICI A;  4O9M A;  4GXI A;  5IIO A;  4PHP A;  5HNK A;  3SAF A;  2BPF A;  8ICT A;  3RTV A;  3SD7 A;  5KFJ A;  4J9P A;  5IIL A;  5KFF A;  2E8M A;  3PX6 A;  3N7P D;  4DOB A;  4OJ6 A;  2G09 A;  5DBC A;  5ALO A;  2UVU A;  3RJE A;  3THV A;  1D8B A;  2BCS A;  2G5H B;  9ICP A;  4M9G A;  3CW2 C;  5EWF A;  4I27 A;  4YN4 A;  4CNQ A;  4O0I A;  2DKZ A;  2BCU A;  2F8L A;  4EZ6 A;  3V7K A;  2E8N A;  2FDR A;  2ZIV A;  4JWM A;  2QLT A;  2OCE A;  5KFM A;  1QH9 A;  4BXO B;  4OD0 A;  1FEZ A;  1URJ A;  5DG7 A;  2KJ5 A;  2KIW A;  1RZT A;  3ISC A;  9ICH A;  3LYS A;  4NY8 A;  4QZC A;  4QJF B;  1KRP A;  1ZYQ A;  2PMZ C;  2ISO A;  1L7M A;  2HCF A;  1IXR A;  2EAP A;  3L3F X;  1QSY A;  4MF2 A;  1NK7 A;  4UB3 A;  1DXS A;  1SKR A;  2ZXH A;  2KSO B;  4UAU A;  1UPH A;  7ICJ A;  3IP4 B;  3AQE A;  1YZ6 A;  1NKE A;  4EX6 A;  2BQR A;  3JPP A;  2W3S A;  1PVP A;  1KDH A;  4B6J A;  5CEH A;  4QW9 A;  2QAR B;  4F71 A;  4P4P A;  1ZQ1 C;  1OXJ A;  3M6Z A;  3SI8 A;  2BQ3 A;  5AKY A;  4UB2 A;  4J9S A;  1QSL A;  4AYB F;  4I29 A;  2KNJ A;  4X5V A;  8ICY A;  4FS1 A;  2XGQ A;  5ALY A;  3ZDE A;  4ZH4 A;  4TUR A;  4MF8 A;  1NJW A;  3OSN A;  2JR5 A;  4RPX A;  2FI1 A;  2DKX A;  3O0F A;  5DG9 A;  3KZX A;  1L5U A;  1SKW A;  2GLE A;  2KJ9 A;  4I2D A;  1HUO A;  8ICL A;  2DPJ A;  4Q8E A;  1XSP A;  4NL9 C;  2W9A A;  1BNP A;  4PHE A;  1U45 A;  1C7Y A;  3C5G A;  4QWC A;  5DB6 A;  3H7I A;  2MUT A;  3RJI A;  1WUD A;  1X9X A;  3PR5 B;  3C1Z A;  1FO4 A;  1LVH A;  5KFB A;  2B6G A;  3PST A;  2ZIW A;  5CP2 A;  1BNO A;  4RZR A;  1RQL A;  5ALD A;  1KW4 A;  3Q8K A;  2JZB A;  3H8J A;  3MR6 A;  5KT7 A;  2G08 A;  4M9N A;  1NK5 A;  1XSL A;  1J97 A;  3NVV A;  4K4H A;  3M8S A;  1KTQ A;  4UAY A;  4NLK A;  4O3S A;  4M6W A;  1ZQA A;  4WJ3 B;  4C8L A;  1JX4 A;  4B9L A;  2R8G A;  3UM9 A;  1PK1 B;  5KFW A;  3K75 D;  2E8O A;  1TAM A;  5GTI U;  2A3V A;  1JIH A;  2BCR A;  8ICW A;  7ICU A;  3WKD A;  5KAI U;  3N7S C;  3PY8 A;  4OO1 J;  1ARO P;  4A8E A;  4F92 B;  1ZQJ A;  3M9O B;  3FDS A;  2KMD A;  3NAS A;  1S10 A;  2VJ5 A;  1T8E A;  2K60 A;  4Y2U A;  4O3N A;  2ZXI A;  2H3I A;  4UAZ A;  1SL1 A;  4DO9 A;  4QZI A;  1TAQ A;  5KFL A;  3TAC B;  3BJY A;  3ONN A;  1U47 A;  1T7P A;  4O3M A;  3MR5 A;  9ICO A;  3PMN A;  3QEA Z;  2H3Z A;  4R66 A;  5DBA A;  1F5S A;  5DB7 A;  5J2K A;  1T3N A;  1UCV A;  3SEI A;  4F5P A;  4DQR A;  8ICI A;  3AL0 B;  5J29 A;  4RQN A;  5AKJ A;  2QB0 B;  3QU9 A;  1UT8 A;  5J0O A;  1PK3 A;  3ORY A;  4TQS A;  2FMP A;  3RFA A;  4NM1 A;  2EAM A;  1WCL A;  4NXZ A;  4RQ7 A;  3WKC A;  2JRZ A;  4JMU A;  2HBL A;  4UAS A;  2AQ4 A;  3C1Y A;  1TVA A;  3HRD D;  4F5R A;  3IHQ B;  4B9M A;  2NRV A;  4Y2X A;  1BPY A;  2J6T A;  3BS5 B;  3H40 A;  1KBU A;  4ZOH C;  1OW5 A;  5ALL A;  3ZI4 A;  1D8Y A;  5AM4 A;  3SAG A;  2XC9 A;  2AHO B;  2HW3 A;  1WYG A;  2Q0Z X;  4O5C A;  2GO7 A;  9ICE A;  1B4F A;  1N60 A;  4F4X A;  9ICS A;  2DFL A;  5DKW A;  7ICS A;  2F1H A;  1XSN A;  1MQ2 A;  9ICF A;  2GOL A;  2AQ0 A;  5AKI A;  3C21 A;  3AU6 A;  5KG2 A;  8ICM A;  4QZ9 A;  5J2I A;  5KT6 A;  4DS5 A;  4IL6 U;  4UQG A;  4O3O A;  1RYU A;  1QQ6 A;  4YR2 A;  2FMQ A;  4MEY A;  4DQI A;  2P35 A;  4P4O A;  3WKE A;  1S5L U;  4ACO A;  5AM1 A;  4ELT A;  1SV0 C;  3Q8P B;  5J2H A;  1IV8 A;  9ICN A;  3OTQ A;  1ZD4 A;  1ZQL A;  4UAV A;  2JEI A;  3F2C A;  4MFA A;  3C28 A;  2K4P A;  2F3N A;  4DSJ A;  2LM4 A;  5HHI A;  4BDP A;  1RG6 A;  2ESE A;  2YML A;  3WK8 A;  2YTU A;  4ECV A;  9ICG A;  4IRC A;  2MU2 A;  4M9J A;  2W55 A;  4DCC A;  3IDW A;  4C8N A;  3ZD9 A;  3SV3 A;  4GC6 A;  4I2C A;  2VA2 A;  4F4Y A;  5B66 U;  3HWT A;  1TK5 A;  4I2G A;  5CJ7 A;  8ICR A;  1CRX A;  2HHW A;  3H4D A;  2KE7 A;  2V4Q A;  4F72 A;  4R64 A;  2KG5 A;  5KFO A;  1DRG A;  5ALT A;  2KIC A;  2JH7 A;  1BVS A;  2ZIU A;  4U7C A;  1B0X A;  4IQV A;  1X42 A;  5AKK A;  3ISB A;  3Q8R B;  1UHU A;  4QIW F;  4KX3 A;  1NK9 A;  5EWG A;  4DL4 A;  3KHL A;  3LK9 A;  4RU9 A;  5ALJ A;  2RRD A;  5FP0 A;  1LB2 B;  3CNH A;  2KFZ A;  5ALI A;  2DQN B;  3MR3 A;  4O3Q A;  3UXP A;  1N62 A;  2AH5 A;  2D6F C;  5KFI A;  3M7D A;  4EZ9 A;  4J03 A;  1XNS A;  4I2I A;  3RJH A;  5KG5 A;  2Q4T A;  5III A;  3KHH A;  2IA6 A;  5EE3 A;  2A19 A;  7ICR A;  4US8 A;  2ZIX A;  2W43 A;  1AQ6 A;  2ZUD A;  3QEB Z;  4FBU A;  1NZP A;  3PW2 A;  3GDX A;  2KVC A;  2YMQ A;  3TAQ A;  4UB5 A;  4J9O A;  1NKC A;  3RB0 A;  2LI6 A;  3C2K A;  2MAX A;  4C80 A;  3J81 j;  3G6V A;  4QWB A;  3NUQ A;  3BZC A;  2WF6 A;  4ECT A;  4RQ0 A;  4DF4 A;  1BPE A;  1L7O A;  1JRO A;  3UQ0 A;  2AJQ A;  4J9L A;  4DSL A;  1Z19 A;  1HJP A;  3B9J A;  1ZQN A;  3D2N A;  1XU4 A;  4BWJ A;  5HP4 A;  2OYY A;  4M04 A;  3QNM A;  3PVX A;  1BGX T;  1COO A;  5AI8 A;  5KT3 A;  4RPY A;  1TV9 A;  2D8C A;  5ALF A;  4ED8 A;  8ICK A;  4LZD A;  2Y1J A;  3ETL A;  1NKB A;  2G0A A;  2W7P A;  3HIL A;  5HR6 A;  2KD1 A;  4Y2S A;  5J2J A;  2G06 A;  1D8L A;  4Y2P A;  3KKA C;  1RDF A;  2FE9 A;  1V9P A;  4DQQ A;  2G07 A;  2MA1 A;  2J6S A;  1ZQM A;  9ICV A;  2KZM A;  4U6P A;  3MC1 A;  2PFQ A;  1XO1 A;  5AK4 A;  3KBB A;  1NK4 A;  1X9S A;  4C4S A;  4KLQ A;  4B9S A;  1RPL A;  2HBK A;  3ETR A;  8ICV A;  1EXN A;  1BPZ A;  2M0N A;  2OHF A;  2IOH A;  1K5O A;  1QCK A;  2EDU A;  3WK9 A;  2K89 A;  3V72 A;  4F5N A;  4K4G A;  4Y2V A;  3IG8 A;  3EZ5 A;  2N1R A;  4EEY A;  2R8K A;  7ICO A;  5KAF U;  3GU3 A;  3C23 A;  4DOA A;  2QAR A;  5KFS A;  1JMS A;  3NRW A;  3WU2 U;  2I6X A;  2E3T A;  4USA A;  3SAH A;  5DLG A;  4KLO A;  4NLB A;  2W7O A;  2KSO A;  3RJK A;  3BQ2 A;  1QQ7 A;  4P0Q B;  5D4B A;  1A0P A;  5J2B A;  9ICT A;  3QXG A;  4ED1 A;  4UB4 A;  4ED2 A;  4IRD A;  4I2E A;  5KFR A;  5D49 A;  2E5S A;  3E0F A;  3ALR A;  4IC9 A;  8ICG A;  3RH4 A;  4YVZ A;  4O3P A;  5AM0 A;  2QB1 A;  4YD2 A;  2K8A A;  1MC8 A;  3H0L B;  5J0P A;  3QUB A;  4ELV A;  2ZIV B;  3RBD A;  3GV7 B;  2XID A;  3KKA A;  4RQ8 A;  4QZB A;  5ALX A;  5ALG A;  4NLN A;  5AKH A;  5F3X B;  1T4G A;  1PVQ A;  2LYB A;  3HP6 A;  4C8K A;  2WF5 A;  4KIT B;  4PPX A;  3SR6 A;  3QUQ A;  2ASJ A;  1DGS A;  4EYH B;  5KL8 B;  1N48 A;  4DSE A;  2PI4 A;  3H8M A;  2WB1 C;  1NJX A;  3M6K A;  1PUZ A;  2QKQ A;  2F1J A;  5KFE A;  1ZQI A;  2H5X A;  2PKE A;  5ALV A;  1NK6 A;  2KEY A;  1SZH A;  2Y9U A;  4XRH A;  1A76 A;  3IV6 A;  4YCX A;  7ICL A;  3CRX A;  1ZQZ A;  2C2R A;  2XO7 A;  1N63 A;  1S0M A;  4DFP A;  4KLM A;  2YB1 A;  3RH5 A;  3C5F A;  3M1Y A;  4UB6 U;  2AXT U;  1IM4 A;  4ED0 A;  3UMG A;  1ED1 A;  3JPT A;  2KP7 A;  1SXD A;  4BGD A;  2J6U A;  4F91 B;  3LWM A;  3WK7 A;  2KKV A;  5KL1 B;  3F5E A;  4QZA A;  1JXE A;  2NV3 A;  4EYI B;  2UVV A;  1DK3 A;  3K4G A;  4ECR A;  4CF5 A;  4DSI A;  2YQE A;  7ICG A;  3GV8 B;  2NRT A;  4Q45 A;  5CA7 A;  2PMZ F;  3MDA A;  3N97 B;  3AU2 A;  4YD1 A;  5AK3 A;  1CEZ A;  4PL2 A;  5J0Y A;  4DSF A;  3RRH A;  1ZD2 P;  2RHF A;  5EE1 A;  5CHG A;  2XCA A;  5BOL A;  4YMN A;  2IBK A;  3TAD C;  9ICU A;  5HMM A;  5EE0 A;  4DWI A;  3FYH A;  1TAU A;  2HHX A;  4QWE A;  1X9W A;  3MAB A;  9ICK A;  2Z7J A;  1Z3E B;  5EOZ A;  5DG8 A;  3UMC A;  1Q3U A;  4DL3 A;  1XWL A;  3N7R C;  2WHE A;  2LM1 A;  4J9K A;  3RRG A;  2F76 X;  4GXK A;  1HEK A;  1ZQY A;  2W04 A;  2AGO A;  3BS7 A;  4F93 B;  3HW8 A;  3JPN A;  3UPQ A;  4M9H A;  1Z00 B;  2AU0 A;  4B9N A;  1C20 A;  3RAQ A;  1SV0 A;  2WB1 F;  1SIJ A;  5J2D A;  3H4B A;  4XUS A;  4OJ5 A;  1D9F A;  3I76 A;  7ICF A;  1X66 A;  1Z1B A;  4EBC A;  2KTQ A;  4R8U B;  2YB4 A;  4XQ8 A;  5KFY A;  3T5L A;  2BQU A;  2W8L A;  3Q8Q B;  1JXL A;  4RNO A;  4RQ4 A;  4PGQ A;  4DFJ A;  5DQI A;  2JHD A;  2ZUC A;  5F9N A;  4ECQ A;  1ZQD A;  4KLG A;  3QZ8 A;  3VC8 A;  2E1E A;  2LHT A;  3NVZ A;  2XVT A;  5DLF A;  3I28 A;  2BGW A;  4NLZ A;  3GFK B;  2EH9 A;  3MGV A;  1N5W A;  2BPG A;  3F2B A;  4RNN A;  3ZD8 A;  5KFT A;  2HBJ A;  5DQG A;  4CCH A;  4C0Z A;  3OJS A;  4RQ6 A;  3E2E A;  1N5X A;  1KEJ A;  4MFF A;  5KT5 A;  2F8K A;  3CYM A;  1X9M A;  4RUA A;  2W11 A;  3Q8S B;  3PO5 A;  1Z00 A;  4TUP A;  5CRX A;  2WF9 A;  2IOF K;  1V38 A;  3IG5 A;  1L7P A;  7ICT A;  5J2G A;  2YX8 A;  4F4Z A;  2Y9T A;  2FLN A;  2OXO A;  5ALQ A;  2DF4 B;  5KG7 A;  3PSI A;  3H0R B;  5KFG A;  4HYK A;  3M9N B;  1X6I A;  1ZQH A;  3EUB 2;  5BPC A;  3QU7 A;  4DOC A;  2KZ3 A;  5DDY A;  3MFH A;  3DDH A;  2Y0S F;  1IG6 A;  3SV4 A;  2XI9 A;  2K8B B;  3GII A;  3OSP A;  1SWV A;  3ISD A;  2ZJ5 A;  5KFA A;  7ICV A;  3BQT A;  5ALS A;  8ICP A;  3LVV A;  2R8H A;  4C7Z A;  1K1Q A;  3PML A;  3T5J A;  4IR9 A;  2NRX A;  1U48 A;  2R8J A;  2OWO A;  4P0P A;  4NV0 A;  2RDI A;  2LKY A;  5AI0 A;  4IQW A;  4ECZ A;  3KHG A;  4AP9 A;  3TFR A;  2XIC A;  2BDU A;  4F5Q A;  2WF7 A;  7ICM A;  4RQM A;  3L5K A;  4J9Q A;  4NLG A;  3F2D A;  5C0Y A;  5ALW A;  2HDO A;  4KLI A;  2ODG A;  2P66 A;  1F0M A;  2L5Y A;  2DL0 A;  4PHD A;  2EZX A;  1CI4 A;  1L7N A;  1ZQU A;  3RF9 A;  2KHQ A;  3TKA A;  1COK A;  4Z6D A;  3JPQ A;  5KG3 A;  1LV5 A;  4FS2 A;  1ZQW A;  4OCZ A;  2R8I A;  2CRX A;  4P0Q A;  5DGA A;  8ICA A;  3RAX A;  5J0Q A;  5L1L A;  2VIX A;  1OUQ A;  2HMX A;  4Y2R A;  3FM9 A;  4IRK A;  5AM5 A;  2AGP A;  3MFI A;  5DGB A;  2Y0S C;  5JU5 A;  2FPL A;  1RYR A;  1S0N A;  4F3O A;  2JEF A;  1MN8 A;  1ZOL A;  4KLU A;  1ZQV A;  5AK5 A;  4Q8F A;  4DF8 A;  3MDC A;  4EEN A;  2ZTE A;  3T79 A;  5ALH A;  3ZDD A;  1UQV A;  3G6X A;  2PXI A;  5AI5 A;  5KFP A;  3L4P A;  1A6S A;  5DB8 A;  2D3D A;  2HI0 A;  3NS1 A;  3ED5 A;  4UAW A;  4DS4 A;  5GTH U;  2PI5 A;  5J2F A;  2HOI A;  5AHX A;  2ZUB A;  4GC7 A;  3NTU A;  4DL7 A;  1KLN A;  1L3U A;  1KFT A;  2HHT A;  5KFV A;  7ICN A;  8ICN A;  4YXM A;  1ZRN A;  4KN7 A;  3MGI A;  1Z4O A;  9ICR A;  1NNL A;  4JB3 A;  3R9K A;  4Y2J A;  1FIQ A;  3D2Q A;  2F44 A;  2WF8 A;  4K4I A;  1ZRM A;  5IIM A;  1D9D A;  3TAR A;  5J0T A;  1N56 A;  3CP8 A;  3NGD A;  1JN3 A;  1FFU A;  3U26 A;  1ZQO A;  9ICC A;  2ZG6 A;  4GLX A;  5KFD A;  5B5E U;  4B9U A;  3GIL A;  2PFN A;  4RQ1 A;  1BPX A;  3PSP A;  5C5J A;  1NZB A;  3HX0 A;  3A0B U;  3QUT A;  9ICJ A;  3HJE A;  4I2J A;  4PZN A;  5AIB A;  2FLP A;  2M9N A;  4Z6F A;  4LVS A;  5J0W A;  4CDG A;  5L1M A;  3BS5 A;  4HAI A;  4F4K A;  5AI4 A;  4I2H A;  2ZIX B;  2HHU A;  3QUC A;  2KFN A;  3S6J A;  4DSK A;  3IN5 A;  9ICQ A;  4DFM A;  1BPD A;  4YG2 A;  1UT5 A;  3SEN A;  7ICP A;  5IIN A;  2BCV A;  4DL5 A;  3H0M B;  3KFU F;  4UW9 A;  5ALK A;  1N61 A;  3VCB A;  2KN7 A;  3WK4 A;  1L8O A;  4F50 A;  2KZZ A;  1KFD A;  5CR0 A;  2F2A B;  2KIV A;  3K1R B;  4ED6 A;  1T3Q A;  2NYV A;  2BDP A;  2KV2 A;  5EWE A;  2VA3 A;  1ZD5 A;  5J2A A;  2UVW A;  9ICW A;  4I2B A;  4LZG A;  4KMU A;  5ALM A;  3FAH A;  5AKX A;  4BWM A;  1HIW A;  4EEL A;  3MBY A;  4KLT A;  4TUQ A;  4QW8 A;  4Y2Q A;  1GO3 F;  1L6N A;  4YP3 A;  1UA1 A;  5AIC A;  2GH1 A;  4KLD A;  2XGP A;  4EX7 A;  2KVS A;  3ICX A;  3BQ7 A;  4DL6 A;  4I2A A;  1QSS A;  4C4R A;  2DBY A;  4M0A A;  2IHN A;  2XY6 A;  3BDP A;  1TK0 A;  5IIK A;  3E58 A;  3PW4 A;  3N28 A;  3NVW A;  4UAR A;  4FE3 A;  9ICI A;  2H3Q A;  2OM6 A;  3WKB A;  1HUZ A;  5J0S A;  2HVH A;  4PGY A;  8ICS A;  5KFC A;  3G6Y A;  4Q44 A;  5JRT A;  2I1Q A;  1ZET A;  1PZN A;  4O3R A;  4F2S A;  2V4R A;  5L1J A;  4RPZ A;  3KD3 A;  1KN5 A;  2FPM A;  5HR7 A;  3RR7 A;  2JMG A;  3V7J A;  3ZDB A;  3TI0 A;  4J9M A;  5L1K A;  2W9C A;  1XC9 A;  8ICB A;  2KKP A;  2FLL A;  1JI7 A;  2HSZ A;  2FJ6 A;  4DEZ A;  9ICL A;  4Q43 A;  4YR3 A;  2W9B A;  4QZH A;  1XS9 D;  3C2L A;  5KG4 A;  8ICC A;  3SMV A;  3OPX A;  4MEX A;  1SL0 A;  7ICK A;  2NRW A;  9ICB A;  3EPG A;  4ECW A;  1ZD3 A;  2RQ5 A;  2VA8 A;  3KOO A;  1L8L A;  1SGG A;  4IQU A;  2V9W A;  3PW0 A;  3AMZ A;  4F5O A;  3QU4 A;  3V6H A;  4C8O A;  2W54 A;  5ALP A;  1TK8 A;  3TAD A;  3KHR A;  1J2N A;  4KLL A;  2P6U A;  1A77 A;  5JTI A;  3C29 A;  2EQY A;  3GV5 B;  1ZQK A;  3M9M B;  3RB3 A;  4IQT A;  4UAT A;  1F44 A;  2ATL A;  4RQ2 A;  4BXO A;  3V6K A;  1H38 A;  3I1Y A;  4DLG A;  5HHH A;  5KFN A;  1SKS A;  4JWN A;  2AGQ A;  3GZF A;  1U49 A;  3OHB A;  4AYB C;  1SV4 A;  3AM9 A;  9ICM A;  5L1I A;  4ECX A;  4O5K A;  1Y88 A;  2ZTC A;  5J8Y A;  4KLE A;  4R63 A;  5AK6 A;  1LKY A;  1V97 A;  2OH2 A;  2W03 A;  5A0L A;  3IM1 A;  5J0U A;  2BR0 A;  3QZ7 A;  3KTQ A;  1WCN A;  1NK8 A;  4JUZ A;  1X40 A;  3WK5 A;  1ZQX A;  8ICH A;  3BQ0 A;  1ZQP A;  4BUG A;  4CGZ A;  5G5G A;  2ALZ A;  2LPE A;  1KL9 A;  4NM2 A;  2HOF A;  2JEJ A;  4RNM A;  2BPC A;  4ICA A;  1KKX A;  2WAQ F;  2PFO A;  4QWA A;  4UB8 U;  2ZTD A;  4I2F A;  1B43 A;  9ICA A;  3V6J A;  4BX9 C;  1TKD A;  3T5K A;  2DUY A;  8ICU A;  4YQW A;  5AKE A;  3H8S A;  5J0R A;  4FFD A;  3D2S A;  2W3R A;  2EZY A;  5H2F U;  4PGX A;  3M8R A;  3A0H U;  1QQ5 A;  1XO0 A;  1RXV A;  1U9L A;  5ALE A;  4JV0 A;  2CPR A;  4RQ3 A;  4G9B A;  2VKQ A;  5KFK A;  1RM6 C;  4KX5 A;  3UMB A;  2K4I A;  5J0X A;  1DOQ A;  1X6J A;  2A1J A;  2GWS A;  5AIA A;  4BJQ A;  1WG8 A;  5DQH A;  4LJX A;  2CN1 A;  3HKZ F;  2ES6 A;  3EPI A;  2JZB B;  5BOM A;  2ZIU B;  2YMP A;  4YMM A;  5ALU A;  5KFX A;  4QZ8 A;  3GIK A;  4Y2Y A;  2LYH A;  1SB3 C;  3QYP A;  2HVI A;  2B21 A;  5DBB A;  8ICX A;  1O08 A;  4GFJ A;  2F1I A;  4R65 A;  5E79 U;  1SZP A;  1PK1 A;  1L3S A;  8ICQ A;  1B22 A;  4R8U A;  2JV3 A;  2WAQ C;  4QIW C;  2KJ8 A;  2WTF A;  1IIP A;  3RJG A;  1O03 A;  4EBE A;  2BHN A;  4B9T A;  1ZQQ A;  7ICQ A;  2KOB A;  1ECW A;  2EZZ A;  1RXW A;  5D46 A;  3MGH A;  2OEH A;  4US9 A;  2CXY A;  4NJ8 A;  3OHA A;  2JXJ A;  2ZIW B;  4IR1 A;  1NK0 A;  2KK0 A;  2O6K A;  2DPI A;  5IIJ A;  3QE9 Y;  2BCQ A; 
#chains in the Genus database with same CATH homology
 2CXY A;  2KK0 A;  2LI6 A;  1IG6 A;  1RYU A;  2JXJ A;  2EQY A;  2YQE A;  1KQQ A;  2RQ5 A;  2EH9 A;  2LM1 A;  2OEH A;  5K4L A;  5CEH A;  1KKX A;  1C20 A;  2JRZ A;  4LJX A;  1KN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...