1KN6A

Solution structure of the mouse prohormone convertase 1 pro-domain
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
73
structure length
73
Chain Sequence
FVNEWAAEIPGGQEAASAIAEELGYDLLGQIGSLENHYLFKHKSHPRRSRRSALHITKRLSDDDRVTWAEQQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prohormone Convertase 1
publication title Solution structure of the pro-hormone convertase 1 pro-domain from Mus musculus.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 8
structure length 73
sequence length 73
ec nomenclature ec 3.4.21.93: Proprotein convertase 1.
pdb deposition date 2001-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16470 S8_pro-domain Peptidase S8 pro-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.850 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kn6A00
1KN6A
chains in the Genus database with same CATH superfamily
1LXJA 4KC5A 4OFZA 1U1OA 5A8WB 2IM2A 4M5KA 1FT8A 5ETMA 3I5AA 3QYYA 2ACYA 1X4EA 3BGLA 3HMJG 4HTIA 3RBXA 5LMNF 4DR5F 1RTDA 1GMWD 2AX0A 2YX1A 4OZNA 4I1TA 4RUCA 4F04B 4OJGA 1C1BA 3U27A 2HNZA 4FXDA 4FYVB 4PR6A 4DG1A 1OY8A 2JDJA 2CQBA 1UA1A 1VOMA 4KPCA 1MN7A 4OX7A 2FZGB 4PWDB 2BOPA 3BO4A 2OMLA 2FHMA 3LF0A 1YWXA 1TMMA 2J9CA 1RZMA 3SCKE 3AJ2A 2GS8A 3DYAB 2UU9F 2UVUA 3MEEA 3MPDA 2HHWA 2H5IB 4AT1B 1PYTA 3FMWA 3ETMA 1JXLA 4WIIA 3JAMU 3CNQP 4ECVA 5HBMA 2UP1A 1IKWA 2HFUA 5A8RA 1D9FA 3UVJB 4ANCA 1AROP 5K8NA 1JLEB 3I5CA 4HDGA 5DDRC 2DNKA 4N47A 1DTTB 4M8LA 5EHHA 3PZPA 3CD5A 5GAEI 3DOLA 2CJAA 3TEHB 1KTVA 2LQ8A 3IR7B 2A0FB 5B0BA 3K57A 2DK2A 3DHWC 1LFWA 3IWLA 4BHQA 1DARA 1OPZA 2CQ1A 5DQHA 2DPJA 2M7SA 1BQXA 4DV7J 3D28A 2NSCA 2DXFA 2R7QA 1VLOA 4MMOA 4IH6A 3OJUA 2COLA 4KHMA 3JYTA 2VFRA 4IQMA 3T19A 3M05A 2NLWA 3KLFA 1FDBA 1QY7A 2CQ2A 4OZJA 4V19J 1X8DA 4A8MP 4AL7A 1U6FA 3TWZA 3BN7A 2ATCB 1GH8A 3KJFB 1WTBA 3EWGA 3NY0A 4OZ5A 1BUXA 1PJ6A 2XCAA 5EWEA 2DO0A 2MZQA 1MW7A 1RT4B 1QM9A 1N5SA 4ZCIA 5THWA 3PW0A 5GMDA 2VZ9A 1SKUB 1Y3JA 2OEJA 4M5NA 1NLKL 4NLTA 1YBUA 4OV1A 1S77D 3MCNA 5KFAA 3V6JA 3VAKA 3I0RB 4LF4F 2V6AA 3M32A 3KNGA 3P3DA 3OTOJ 2G1HA 2OEMA 2EKYA 4I2PA 4KV8B 2H48B 7FD1A 3HFZB 3LP0B 3C14B 1EX8A 4JI4J 2YKPA 4FYWB 5CHCB 5D3GB 4F4WA 4EO8A 2DEIA 3D3BJ 1GNKA 4A8OA 4ED6A 4A8SA 3MMBA 2GW8A 3CCLS 1WDTA 1FESA 3CDEA 2G2OA 4ER8A 4YB7A 3JSRA 4CLKA 1XIQA 5J2NA 4NLUA 2LA6A 1X4AA 1AT1B 4CLFA 3UNGC 3HSJA 2FY1A 3RR8A 2CADA 2QSWA 4LF8F 2VG7A 3GP9A 1L3TA 3QRQA 3QO9B 1J5OB 2XM3A 1TL1B 4DFMA 4G1QB 2RF2A 4F4AA 2AYGA 1TK8A 3FBFA 1ZZFA 1O0PA 1FKOA 3PO4A 3VHQA 2DHGA 3Q8PB 3HKWA 4DF4A 2ZBRA 1F9HA 4WU2A 5I3UA 2LFVA 2RS2A 4I67A 3T9NA 1V5IB 2RUSA 1M5KC 4LSZB 4FYXB 4WFBQ 1K8AT 5J1EA 4OZLA 2W24A 1HQ2A 1HNIB 3K5PA 4JI2F 1SI9A 3M2VB 3H4BA 3EJMA 1C4AA 1K0TA 1KVKA 5AT1B 4FBUA 3CCSS 3JSMB 1VQYA 2HBYB 3H40A 5CABA 3R1HA 2G9OA 4R25A 2EFQA 2RUGA 2BUNA 3MMCA 3AB2B 4Q45A 3T1YF 5C2CA 4I6AA 3MM5B 3MR3A 4JI5J 2YNFB 1R6VA 4K4WA 2PA3A 1NMEB 4PWWA 3ELHA 2W2PP 1UJ6A 2XMVA 4UOFA 1N0VC 1U1KA 3GJSB 1MLAA 4X84A 3QAUA 1NK9A 5JVHQ 1YITS 4X64J 4CLZA 1ROFA 3CB4A 2VDHA 5HQ8A 2V2QA 1HNVA 1X9MA 3U7JA 2WK4A 1IKVA 1KVIA 1UZDA 3X1LB 4F4KA 2D69A 4M5GA 3P4UB 5HMXA 3CIZA 2JNJA 4XIUA 1XMQF 2OEKA 2NPIA 4IRKA 2ZH2A 3HX9A 2MQQA 4JI8J 1QAYA 2Z2LA 2D3OR 2IJFA 1UETA 2RE1A 2F4VF 1M5VC 1HNXJ 4JYAF 2H51B 3M2RB 4DR7J 4OQJA 2HFSA 4DL6A 1N48A 4F4XA 5F8JA 3PJ9A 2QMWA 1TZ0A 1W2IA 5KG0A 2LCWA 2IYIA 4ED3A 2OPRA 2R3VA 3RAMA 1NSKL 1S7HA 4J9PA 4AXIA 2B4VA 1KN6A 4B9UA 1T9TA 2V2ZA 3EXYA 5HVHA 1A6LA 3OR2A 4QWAA 2C2KB 4NLXA 1NZAA 3SSRA 1VHIA 3AODA 3FC9A 1T11A 2E7WA 1S97A 4F3OA 4Y2IA 1FNXH 3FRZA 1GK8A 1NCLA 1X4CA 3HHNB 2VQEF 2EK1A 2B7CB 5HMYA 4ZVPB 1HI1A 3N28A 5CZVA 1KWMA 4TKTA 3CGIA 2CXEA 1JLGA 4IRDA 2KXNB 1HL6A 2D9PA 3GU0A 1P6TA 2HKEA 1RT7B 3RB3A 1RB0A 2BEFA 2VBXA 2V8PA 3G9CA 3KLIA 2O3DA 4O4GA 1JXEA 4FNHA 1RT5B 3M2UA 2IM0A 2YNIA 1I3OB 4KBIA 3LTOA 2FLOA 5KT4A 5D0EA 2UXBF 2JFDA 5DM6Q 5L9NA 3WX4A 2CJBA 3CJ2A 1U1NA 3DC2A 1RTIB 5E2QA 3E2EA 4DS5A 3K59A 4YR0A 2WB1D 4YB6A 3TAMB 3RW6A 3RR7A 4Q8FA 3ILLA 4LIRA 3OHBA 2DT9A 3EXCX 4P73A 3UCZP 3VGVA 5JJBA 3OT9A 4UQTA 3NGDA 1RAIB 1YHQS 3PW7A 4Y3CA 3QRRA 2LU1A 2DRDA 3TP2A 3H8YA 2DNHA 1IBKJ 5GAEU 5J2MA 3W2WA 3FRYA 3OLAA 5M2UA 1S1UA 4WZQA 4KKOB 2B8QA 2BQ3A 3SFUA 4EWTA 4TN2A 1N33F 4CO5A 2AD9A 3THTA 2CZ9A 1RTDB 3C16B 5DDPC 4ID8A 1FFGB 1V5VA 2EFOA 5KFWA 3UDEA 2ZH1A 3P5BP 1C1BB 2E1RA 3MPYA 2HNZB 2PC6A 4DG1B 2ZVSA 3EVWA 4Q5VA 2HGMA 2E1MC 5LL6d 1E6YB 2W8LA 2A6OA 2VFUA 1MROA 1KQFB 4XPEA 1GFWB 2BM1A 9ATCB 4Z2XA 4JP8A 2GMHA 5KG7A 4TVAB 4DLEA 4ZA1A 4JI1F 2ALYB 3MEEB 3AJ1A 3DGVA 2ZHOA 2J6TA 4CTAA 4WFNQ 3T5KA 3FSYA 4NZ6A 5HBMB 2Z57B 3CIMA 1IKWB 5A8RB 4RNNA 4WXWA 2HURA 4YOEA 3T6BA 4DX7A 5EX0A 3GV5B 2I1RA 4X4RA 1EIYB 1NK0A 3DOLB 4N56A 2ZHBA 4OYAA 2QLBB 5JXSA 2FJXA 4QIWD 4CO1A 7FDRA 2RQMA 5B0CA 1PC4A 3C8YA 3AFGA 4U7UK 3ZTPA 4G3IA 4LSNA 3D4JA 2MKKA 5C7PA 3ZNUA 1D8ZA 2QLXA 3JYTB 3GV8B 2DNQA 2ZOGA 3PR4A 1MG7A 3IFEA 3KLFB 4QQBA 4C8ZA 5J2QB 3CXCR 2NSBA 3BGUA 5IQ6A 4TLQA 4F2RA 4WJBA 3HT0A 3WIVA 1FJ7A 3MTJA 2DRAA 3Q23A 3CCWA 3QWPA 2LECA 2UV8A 1GX5A 3R9LA 1YJUA 3IMQJ 4YHHJ 3D3CJ 4YR3A 5KFXA 4QCLA 3RYLA 3NNAA 3DLEA 2DHXA 2PIIA 3TQEA 3IP0A 5HATA 3EVMA 1T02A 5ETQA 2MMYA 4KHPJ 3UO0A 4NXNJ 2GVZA 1HNZF 4OLPA 2WZ1A 2N82B 3S7RA 1ZH5A 3M32B 3TJAA 2DRBA 3SIPB 3SQGB 3AJDA 4DCPB 4I2PB 1SCJB 2BJ3A 3CF5Q 4K4TA 2IFXA 4TU8A 1CULA 3M6VA 4CIOA 2PEHA 3M8YA 2YNGA 4CO3A 3IWXA 1P9YA 1B7YB 3POTA 3B78A 3NXZA 2XSJA 4J7CA 2ZH9A 2KHDA 2F63A 4ZJOA 3MMBB 3ILIA 3CJ8A 1HMVB 2Z2ZA 3UE2A 3R8YA 1HWLA 5DG7A 2OPPA 5J2NB 1TL3A 4B9TA 5F8GA 3SV4A 1WOSA 1RHJB 4RW6A 1H6KX 3SYZA 4A8YA 2AF6A 3M6UA 1T8EA 1LWXA 2VG7B 2C3UA 4ZHRA 2PFDA 3ET6A 5FLXU 2DIUA 2D74B 2RF2B 1YRTA 2L9DA 4AL6A 3DLJA 5ETLA 3P49B 4NLDA 5HLFA 2K7JA 2V0NA 3H98A 1U1QA 2Y0BB 2W01A 2BZ2A 4QIGA 1D1UA 1C4CA 1VK3A 2EK6A 5J1EB 1OIAA 4AFFA 3KG0A 5E5NA 3CMAS 3RRGA 3DLBA 4DQIA 1SH3A 1TKZA 4HLBA 4ZK7M 1RKIA 1XC9A 4L74A 2QYGA 3KLGB 1NJIT 2P8IA 1JJCB 1SBRA 1FA0A 1TAUA 1LKZA 3Q8UA 3NRBA 4KAIA 3D54A 3ISNC 4PYDA 2AZ3A 3BYPA 4O4RA 3US5A 4CLPA 1Q5YA 4EK2A 2HRYA 4NLQA 3HM9A 1LWFA 3G2XA 4PAAA 4M5IA 1ZA1B 1S79A 2RU3A 3KG1A 4OX9J 2EWHA 1UWAA 3BEGB 2ADCA 4ZVHA 2P9CA 1HNVB 4J90A 4NOHA 4QIFA 1GQEA 1OSCA 2QGFB 5IWAF 1Q8BA 4DWIA 5E3QA 2R7WA 3NNCA 2BYCA 3IM8A 2HZCA 3VGSA 3KNAA 2V4QA 4C8YA 1Q16B 5DS7A 1RAAB 2Q6BA 1UWBA 2V63A 1UPPA 3A13A 2VKRA 3KK3B 4A8XA 4ZCMA 3J81U 1B7FA 1VBYA 2DR7A 1RISA 3RGIA 2DPIA 1U1PA 4ZVOB 2K06A 2E1CA 2V69A 2M9KA 3VAIA 3QRPA 4ALZA 4OYZA 1KS2A 2DHSA 1OMSA 2J0WA 1EQMA 1WHXA 4ZN1A 1EETB 3EM1A 1YZ6A 5C24A 1RCXB 1X4FA 2CVEA 1YSJA 4LRCA 3IN5A 1VJQA 2IRXA 1NHKL 2MZJA 2MGZA 2NREA 5ETNA 2OPRB 2D3O1 3LOUA 4AQYF 4DEZA 2IDEA 4H4KA 1RBAA 3QIDA 1Q82T 4OHYA 5E3PA 5C2GA 1MMNA 4RWXA 4FNIA 2QRRA 3TUPA 3MHYA 3FFIA 2W2NP 3OR2B 2QC3A 1IR2A 1SVDA 2VA2A 4LFAF 2QL5B 5HQLA 3C6TB 1NDCA 3OR1A 3TNVA 1VQ7S 2IMWP 3OW2R 1AFIA 2Z8QA 3MM7A 1AUSL 5BXIA 3I5BA 1FKPA 1OS5A 3GG0A 2VH7A 3JTOA 4B3SF 2QV6A 2OFGX 3CJ0A 4FZVA 2H9ZA 1FWLA 1JLGB 3V6KA 2QSFA 4ES2A 1EKRA 4C8KA 3GFYA 1U2CA 3AOAA 3VCDA 3CCVS 4DR4F 2IAJA 2VBYA 3DDKA 3RAQA 4QYZK 1F3FA 1N34F 4KO0A 2N4DA 4NLGA 4WKRA 2V94A 1B99A 3RZAA 3KLIB 4LQ9A 4USWA 4O4GB 4PCQA 4G6VB 2FZCB 1UPMB 4DPXA 2HK2A 2UXDJ 1KTQA 1P1LA 3M2UB 3EX7B 1XBWA 1R6YA 4L72B 5B09A 3VGTA 2YNIB 3T1HJ 4W92B 2JC0A 4S0MA 2BQRA 1Q86T 2GVDA 5LT5A 1TL7A 2FZKB 2Y1IA 2QN6B 4LFBF 3CCJS 3BDEA 1X5SA 3UDCA 2KT3A 4U8YA 4DQPA 5KFHA 4NXMJ 1V6HA 4DV3F 4L3NA 5D77A 3OXGA 3B82A 1YTYA 1GTHA 4BDPA 1VQOS 4IG3A 2B7BB 1S76D 4JI6J 1U48A 2NCKL 3FGVA 4OHVA 1R7IA 3FEYB 5EGYA 1TELA 2DGTA 2RQCA 4O44A 5J2MB 4OI4A 3W2WB 1VDHA 1YBTA 2B5JA 4BLGA 3H0PA 1RWKB 1S1UB 1L3VA 1MNEA 2FHKA 2A10A 2BJ9A 1ELOA 3I6PA 1FJGF 1VQMS 3RTVA 2DNMA 3M7VA 4LREA 3TOQA 5AE1A 2R9LA 3F56A 4R0EA 2I5JA 2GAGC 3J80U 2R7VA 2BW2A 2XBPA 5ETRA 3L95X 1FCAA 2KRBA 5JVGQ 4NX9A 1R8AA 2Q6CA 2BXJA 4DFJA 3H4DA 3NG8A 4K2JA 1R8HA 2QFIA 1DURA 4DL0C 3TJ8A 4E0DA 4X2BA 1KLMA 3CD0A 4ELTA 4BS2A 4LF7F 1SIZA 2CPDA 3CT9A 1FERA 1R8PA 3AA8A 3DRPA 1IR1A 2GQCA 5ETOA 1U0HB 2W7OA 4NLVA 5LOQA 4RZRA 3PRBA 2CQGA 1MROB 4K8RA 4DPYA 2OPSA 1DZ5A 4OL8A 3CJQA 3OFFA 4PWUA 1FRKA 2HBQB 2HHUA 5IT9Y 1Y5NB 2XNQA 3IRWP 2QT7A 4ZP8A 1WKLA 1XJWB 3ZZPA 2OP5A 2OJ3A 2QA4G 1DTQB 1T3NA 2KDOA 2AJ2A 1D09B 2XHWA 2HRUA 4CTAB 4ERDA 3HULA 3LP2A 1WOPA 2JLGA 5BYSA 1Q8LA 3BJYA 2MXYA 4X4UA 1R0BG 3KHHA 5F0WA 2OSRA 5IOLA 4X65J 1WSRA 3CDAA 1W7WA 1WG5A 1RKJA 2XMMA 4YN3B 1LXNA 4LSNB 3GFZA 2AU0A 3PVXA 2XLKA 2CZVC 2FJDB 4ELUA 2SXLA 2H1YA 4LRFA 3DRXA 1GXLA 2VICA 2CG4A 4O0NA 4K59A 2AP6A 2J9EA 2AMCB 4URQU 2R42A 2DD8S 3BSOA 1L3KA 3FQLA 4ZN3A 1VK8A 1TFYA 2MZ1A 2F8MA 3GTYX 3LAMA 3BPDA 3PIPQ 3EGVA 1NB2A 2RDDA 3ZXWA 3VGUA 2HVIA 4C9DA 4DV7F 1D9AA 4X4SA 3W1YC 2KFYA 2FB0A 2HQFA 2FDNA 2CWKA 3MD1A 3LPEA 5HAOA 1YK9A 2C2OB 2D41A 4OHZA 5HROA 4OI3A 3BGRA 4H4OA 1Z2LA 1S9EA 2W1BA 4ES3A 4X66J 4DV5J 3NGSA 4ECRA 3DLEB 2FVCA 3DXBA 1MWZA 1QDUB 2PMZD 2Y8YA 4NCBA 2GVZB 4K4UA 3K7RA 4B9SA 4DX5A 4TYAA 3A3NB 2FLNA 3RRHA 2YPZA 4U7CA 2W9BA 1HD1A 2GAHC 3SMZA 4V1Ak 4IOCQ 2IM1A 4K5RA 3L09A 4J9QA 3CCRS 3SCJE 1ZTTA 3HHLA 2JHEA 4FKXA 1XR5A 2HS0A 1CULB 2RVJA 3UD4P 2YNGB 1HQEA 3POTB 1UEVA 3KUHA 4HTJA 4OLOA 2MKYA 5KFDA 2QIFA 5KG2A 2M4MA 4DSJA 2X1AA 4IUFA 1N8RT 4NRTA 1TKXA 1UZHA 1VISA 3IBCB 1Q7YT 1WF2A 2J8SA 3PRVA 4A8QA 1HBUA 3PX6A 3OTOF 1HWJA 4EZ6A 2OPPB 3IGNA 1TL3B 2ZVIA 4R8UA 2ZWOA 1P9QC 5HJXA 4RW6B 3PXGa 1Z1ZA 3AQOA 4JI4F 3HT3A 4PXEA 1HD0A 2C3OA 1JJHA 2XY7A 2YX4A 3PX4A 1IKYA 3ET6B 2K1RA 1WEZA 5HLFB 3DOMA 2KM8C 3OPKA 1IBMJ 2X3DA 1D0EA 2F9DA 2OTJS 5D4OA 5F9LA 4F3MA 4K4XA 1CVJA 3Q24A 4RKUC 1FRIA 3GV7B 1MSWD 1RAFB 1L5UA 2U2FA 4PQUA 4PG8A 3JQMA 3BV8A 3GFHA 4CLWA 1T05A 3GB0A 1FRLA 4YP3A 1NSQA 3VTIA 1TKZB 5FDLA 4DL3A 1TUVA 1K47A 3HF5A 5C25A 4OHXA 3MPVA 1WD6A 4ZVGA 4HDHA 4OJ3A 4ATNA 4LF5J 1BHNA 4LRBA 1WSVA 2W7PA 2FIUA 1LWFB 2OSQA 2FC9A 3UN2A 1EHWA 4KR0B 4P2XA 3FBCA 3C19A 2PO4A 4P10A 3I87A 4KE5A 3DI6A 3UDLA 1RYRA 3Q8YA 1N0UA 2HNDA 4ZJLA 2M2BA 3GPAA 3MMAA 1SL2A 5AJ3J 4JI5F 4I56A 5HJYA 5F8MA 1UWBB 4IFVB 3K58A 2BJ1A 1SKRA 1Y5IB 3D0HE 3W8GA 1XTZA 1T9YA 3EZUA 5HMZA 2KFZA 4ZMMA 2QE5A 3MR2A 4X64F 5KFJA 4MFBA 2VPXB 2OO4A 4LF1A 3MEKA 2CPHA 2MY7A 3D1OA 2Q43A 4F25A 5KFUA 5K8OA 1BD6A 1LWEA 1S0MA 4J9VA 4DR6J 3LA0A 1FEHA 1N5VA 3AHPA 2YXLA 5C24B 2KM8B 3QFWA 4NMLA 2MDAA 3TVYA 3GSIA 3K8VA 4B3TJ 1K1SA 2MGZB 4MIWA 2GCFA 4JI8F 2CPIA 5KOWA 2HQCA 2V5HG 3GILA 1SQGA 1F2GA 4TQRA 2HIQA 4ZVFA 5I3QA 3FFIB 1IXKA 1YZ7A 3WBZA 4DR7F 3OVBA 3NEKA 3NGTA 2CPXA 2BJ7A 1GEHA 1OWXA 1WKKA 1ZAWA 4YDXA 3BZQA 1CQMA 3OR1B 3WIUA 5D4LA 2WAQD 4C0BA 3MM7B 4EI2A 1FKPB 2V2VA 1JXVA 4G65A 2CQDA 3O1LA 4C97A 2FLPA 2MB0B 5BYQA 4JI0J 3MOJB 2CQ3A 3PR5B 3HKZD 2CQPA 3U1MA 3IR5B 1F9EB 3EGWB 1X4BA 3F41A 3C15A 1WC1A 4DPTA 2PGCA 1LFPA 1NRKA 2IAJB 3AH6A 5H9EK 4UY8T 1IWAA 1FI4A 2GJ2A 3BB5A 1SPBP 3KMQA 4KO0B 1T9XA 4OI2A 3TJ9A 4C8NA 2AZ1A 3MGJA 2WBMA 1Y9OA 2WVEA 1KSPA 4I4BA 1FRHA 1FRXA 3AB4B 1KONA 1C2PA 4DSFA 4MH8A 3W62A 3MWBA 4RBUA 3GQCA 3S6EA 3K5OA 2GVDB 3A8IA 4IG0A 1UAWA 2HHVA 1TL7B 4DOZA 2HRTA 1VRQC 2GGPB 4DSIA 2Y1RI 3MDFA 4WZMA 3OXLA 2H54B 2MPUA 3SCLE 4DUYJ 2LKZA 4WFYA 1A9NB 2J6SA 2B0GA 3OBIA 1DTTA 1H7XA 3GJRB 1JQGA 2ZD1B 3EDQB 4IR1A 4IG3B 3KHLA 2KN4A 5GADI 2RHSB 2BRKA 4M95A 2LDIA 4O44B 2CJXB 3GIRA 2B5JB 3OTCA 4FXWA 4DL5A 2OIHA 1NDLA 4P52A 2WCXA 1PGZA 1JMTA 2A2DA 2C2ZB 1T9VA 1QE1A 2HLUA 2I5JB 5MAOA 1VQLS 2X7IA 1NDPA 4FS1A 3R5JB 3VVTA 1S4FA 2DEJA 3I56S 4P74A 1IBKF 3UCUP 5CZXA 3DM2B 3J81j 1IR0A 1KLMB 3JXOA 2CG8A 2Z30B 1DQAA 1QAXA 3DRPB 2PT0A 3BKUA 4X62J 3CJRA 1RT2A 1RT4A 1G1XA 3PX0A 4EO6A 1Z4UA 2NXUA 1G2EA 1F2HA 5G0RA 3TR5A 1Y7PA 3C66A 4C8LA 3OTBA 2ASLA 1NHVA 5D0GA 3HHLC 3AA9A 4RUAA 1FJCA 3PTWA 3GIIA 2GV1A 1RE1B 2DIVA 2D9OA 1REGX 3HD2A 3LP2B 2N7YA 3GFXA 4P2FA 1M5PC 1ZOTA 3LP0A 4RW8A 4GVBA 4AL5A 3GIJA 2FUG9 3CCZA 5D3GA 5L9XA 3MR5A 4EZ9A 3RBDA 3BQ0A 2M8DB 3F0NA 3OSNA 4HT5A 5D4PA 1R3NA 4Y2CA 3H25A 3GYXB 1WC4A 2C3PA 3DLLQ 3BO2A 3H59A 1BE4A 2EBEA 1PG5B 1R89A 4RNFA 1PJ7A 3BH6B 3QSIA 5KFTA 4K2XA 3ENAA 1ZM3A 4Z37A 1UL3A 3GCWP 1AXQA 2ATLA 1WF1A 3CUNA 3J7Z5 3JTNA 3TQ1A 2GJIA 3RB6A 2LXIA 4YFUA 4YUDA 2K3KA 3RJMB 1SB6A 4CT9A 4LF6J 1RGVA 1RP5A 3K0JA 2ZH5A 2GX8A 3A3OB 2DR6A 4AE5A 1ICEB 2BX6A 3H5YA 1NBEB 3J7YI 3GMGA 2ZBIA 4BC9A 5HROB 4NEZA 3BGRB 4KJIA 4H4OB 4JV0A 1S9EB 3BPSP 3FCVA 5KFPA 2XTJP 2GO8A 3HLUA 2N7CA 2XNRA 3RU0A 2YKNA 2R2TA 3O8WA 3MD3A 1RT1A 4KGMA 1UJ5A 5BJRA 1FDAA 2QA4S 2W9BB 2IA0A 1VQSA 2YWEA 3R7SB 3LPYA 2V50A 3VZHA 1WHWA 4YHHF 4Q44A 4V19X 1HNWJ 2QTWA 2IVFB 3QQCD 3HHLB 3HHLD 3AD9C 1CC8A 3BF4A 2AJ1A 5IC6B 1B0VA 3NL0A 3G6VA 4ZCLA 2J8AA 4UOGA 4NXNF 2HS3A 4JV2A 1TKXB 3SEOA 1D3WA 1FDNA 4DN0A 1XNQJ 3K5NA 4NE9C 2BW7A 1YJTA 4WP9A 2GMJA 1HBUB 1DRZA 2VL1A 1WNEA 3G8SA 3JSYA 1RWUA 3AD8C 4D3GA 1TMJA 1RK8A 1VS3A 4R8UB 3KJNB 5GAHI 2JH3A 3UR3C 2HW3A 1UVJA 3FNNA 4CNYA 3DLKA 4B02A 2QEXS 3BBFA 2L08A 1IKYB 1NM2A 2K1RB 3V4MA 2ZJPQ 3NCRA 3KLEA 3HP6A 1MN9A 3D1HA 1UEKA 4RBTA 5DJBA 3KLVA 3DOMB 4M5JA 3SFGA 1OYEA 4UZCA 3PNIA 2AV5A 5LSRA 5A2QY 4DL2A 2AJ0A 1V3ZA 2N4CA 1ZM2A 3W5XA 4CQ1A 3I4PA 3D2WA 4DV4F 2XWYA 3I55S 1URNA 2W2QP 4TY9A 4PKDB 4A46A 2OELA 5CCMA 4UF4A 4MYTA 5CYJA 2XGPA 1AZSB 2X3GA 2W4PA 1DFDA 2HAFA 4DN9A 4PQUB 2L9WA 1T05B 2F40A 5HP1A 3HHEA 3CO9A 2J9DE 4LF4J 4PG6A 5FDLB 3HVRA 1HWUA 3O6QA 3TUJC 4P71A 4RU2A 1HPZA 2E1PA 1U26A 1IQZA 1T9WA 2CFXA 3BQ2A 3ICLA 5SZTA 1RU1A 2V8VA 3IAM9 3ISZA 5B0AA 3LO3A 5CXTA 2HMIA 3BM7A 2KVQE 1ZETA 2G0CA 4ZPDA 3IBWA 2DXEA 4NL5A 3DI6B 3OSPA 1NPRA 4LRDA 3W61A 1A0OB 2HNDB 2ZH7A 1P8GA 4WWSA 4DQSA 3HVAA 1F5BA 4WK1A 1TUWA 1NKEA 1M1HA 3MMAB 2CJ9A 3DNCA 4B3RJ 4W90B 1RTJA 4RNOA 1GXTA 2JEFA 4QJVA 1KD1T 4J9RA 1N56A 1QTNB 3PJWA 4ZPBA 1BMQB 3HHDA 4OX9F 3UW1A 1JLCA 4MFBB 2DH7A 4ANEA 1LW0A 2MSSA 2RT3A 1GTEA 3NCPA 2Y1LB 2OD4A 3QGIA 4FPIA 3TAMA 1T03A 2A6MA 2RAQA 3J7AN 4F36A 4NYOA 2BMBA 4G1PA 4KH1B 3DRRA 3H7HB 2YWFA 2CUYA 3AY0A 1UJ4A 1WKJA 4WXOA 1FE0A 2GQ2A 2E5JA 3ENQA 4L75A 2Q3PA 4I0WA 5GADU 2O67A 3T1YJ 1VQ9S 3BGFA 4X4NA 4MIAA 4ZLPA 2R8GA 4ILLA 1TL5A 1FK9A 4M5DA 3H42A 1E6VA 4PXDA 3G6YA 1ZS6A 4C8OA 4HH1A 1DBDA 1RA6A 2PMWA 1OPIA 3A8EA 2R2UA 1WHVA 3G6ES 3V4IA 2PI5A 4BCAA 3AQPA 3D0GE 1RWNB 5F3TA 3C16A 2Y3YA 2GHWA 5ETVA 3M1VA 3SV3A 1PAUB 2V8GA 4BBYA 1YLXA 2AKWB 5KFVA 2VODA 2WW4A 1TVRA 1UP1A 2HZAA 2XS5A 3ZC4A 2W9AA 1FNOA 3D9BA 4J9LA 3C15B 5E7OB 4J9OA 5IT0A 1XMOJ 2C1EB 3E51A 1VYAA 4W4MA 2ZHAA 1E6YA 1FWPA 3IRXA 3SXLA 3PEHA 5T14A 2DGUA 2B4PA 4QPTA 4PUOA 4OMFG 1HLWA 2KG0A 2CNOB 3R5DA 5K14A 4CM2A 1XMQJ 1ITPA 4DBQA 3ZTSA 2I6WA 4DSLA 1U25A 2HQIA 4LMZA 1JLBB 2FJVA 3HCXA 1XMBA 5MLCV 1F5CA 4YY3J 3KJVA 2AT1B 2LMIA 4IG0B 2F4VJ 3V81A 2HHPA 1RBLA 3DLHA 4TYBA 2E5IA 2EW9A 2HFZA 4CYUA 4ANDA 2WTFA 1Q7LB 1N88A 1YJVA 2IDLA 2HWHA 5A76A 4EFAC 3IBFB 3PM9A 4EU0A 4F2SA 4M5LA 3R7NB 3EDRB 2HVEA 2UXDF 5I42A 2KH9A 4Z7YA 2QA2A 1CBKA 4GKJJ 4A8FA 2R7UA 3OV7A 2YQ3A 3UPFA 4RWWA 2XLIA 4NA1A 2ADBA 1C0TA 4ES1A 4KRWA 4NMXA 1IWGA 4J9KA 4RUHA 5CH7B 1GX6A 4NXMF 2ZH8A 2D1CA 1QE1B 1TTHB 3LP1A 2YWKA 1YI2S 3M8ZA 2XHCA 2LLZA 1GAOA 4J9UE 3KK2A 4FF3A 2RMLA 4JI6F 5IV3A 5DQIA 2IA6A 2XYHB 5J2QA 4QYRA 2B9WA 4FYDA 1LW2A 3HJFA 1LV5A 1G6BA 2Q66A 3CC2S 1VQ8S 4K0KF 2KYXA 5H9FJ 3DDIA 4DFPA 3BDPA 1RAJA 1RT2B 4OYPA 3BKFA 2CQHA 1WJ9A 3J7YU 4NRUA 3QBCA 2VC1A 3W5YA 2LEBA 5G0RB 1X0FA 2EEYA 2HWIA 3HFVA 1KQSR 3CD7A 5L1JA 1WACA 1S0VA 5DZ6A 5CD4A 1FJEB 2J7KA 2H4YB 3DDNA 1PC5A 4DV6F 1PILA 3M8PA 3N5FA 4WK3A 2CJKA 3DLGA 2QO3A 3SQGA 1NK4A 1YJNS 3IWNC 2LDYA 2JLEA 2EFVA 2CA9A 3IO1A 3LGMA 3KLHB 4HACA 4RW8B 3H2UB 4GVBB 1WG4A 2YH0A 4F26A 4B9MA 1S1TA 3OVSA 1B70B 3FMBA 2ZC4A 4CI0B 2ZJQQ 1Y0HA 4XAKA 4N76A 2HIYA 2L41A 3IA0A 1APSA 1HMVA 1FVSA 2JSXA 5FD1A 4HL9A 4I6WA 3OTDA 1X4DA 5HMWA 2KTQA 4LR7A 2HHXA 3UI3A 2P9EA 4Q2LA 2VG5B 4NLYA 1N5TA 2EPIA 3MUVP 5GAHU 4DL7A 1VRUA 4YR2A 3GJTB 3CC4S 3GIMA 4UOCA 4LF9J 2WSEC 2FJEB 4XDDA 4X65F 1RT6B 3KWMA 2NR0A 2NXJA 3W9JA 1WC3A 2AJ4A 4DCOB 4QWEA 2H5EA 3DU6A 3G8TA 2XMUA 5E41A 4CM0A 1NSAA 4ZLNA 4ENOA 1J5EJ 2I38A 2EFPA 2PEBA 2V8DA 2DGSA 2XMAA 5DDQC 4DSEA 2B56A 2RSQA 1Q53A 4IYQA 5IV4A 4ZPAA 2KVIA 2YKNB 3BQ1A 3JSBA 2HHQA 1RT1B 3KLGA 4PABA 4JV1A 3NBPA 5CCLA 3NWGA 2CAJA 1BWVA 1XNRJ 2AEMA 1FNMA 3BN4A 2A18A 4YB5A 2QLFB 2HQDA 4IDKA 4X4VA 2LEAA 4DV5F 4X66F 1Z2ZA 4NZ0A 2F7VA 3TX0A 3W7BA 3Q8VA 3RBZA 3HSZA 3RRKA 3FSXA 3HVTA 5L1KA 1HARA 2WSFC 2HHSA 2JJ4D 1BWEA 2CQ0A 3UQSA 3K8WA 4QR1A 2WSCC 5KOXA 4RPFA 1MWQA 5KAKA 3X3UA 1S0OA 1S9FA 2YWHA 4Y6IA 2DNNA 5B7WA 3DLKB 2XLJA 2YNHA 4ZKAA 2VA3A 2KXFA 2XZDB 4DSKA 1FTRA 3KLEB 4P9SA 3KK3A 4RX6A 2RQKA 5L8RC 2W4CA 1YG0A 3R2DJ 2ZC3A 5IT9U 1Q95G 1PYSB 1R0CB 1SC1B 1S1VA 4AD6A 2MYFA 2E1AA 2K8GA 4KFBA 2XYGB 1DQ8A 2JVRA 1KBRA 3SSSA 2XS2A 3DOKA 1RBOB 4KGKA 4NYPA 1EETA 4TLRA 5KFYA 3ZZ0A 2V68A 4RW4A 3DMJA 2CYYA 3MEDB 3CCUS 1JKHA 2XMTA 2KZMA 2P9GA 4ZPCA 1YKWA 3L7OA 1IBMF 5JMNA 5HP1B 2KT5A 4IRCA 2ZBCA 3HPOA 3I96A 4U7UD 4USTA 3ILJA 1S6UA 1QUPA 2XCPA 1RSCA 1VFJA 5HI7A 4GO5X 1HPZB 3BR8A 2VPZB 3OFGA 2P6TA 4LUBA 5M2RA 4WYLA 1NK5A 3C6TA 1VQPS 3B4MA 3S1TA 3HDSA 3S8SA 1AFJA 4MTPA 4L76A 2CPYA 5SUHA 5C42A 1FRJA 1WEXA 3LW5C 3GONA 4DCJB 1IM6A 2HG4A 2ZE2A 4F02A 2HMIB 3QFHA 3TZWA 1MU2A 5KTQA 2MLZA 1H3DA 3G87A 4USKA 1RHKB 3CJ4A 3G96A 5GMKa 4DZ6A 2HK3A 1NO8A 1T94A 4M5MA 2V4JA 2PN6A 2VV5A 3DKDA 3H5XA 2V67A 1RTJB 2QJ3A 1BQNA 4IOAQ 3NMAA 2GO9A 4MAKA 2J0XA 2ROGA 3DN9A 3ZTRA 5KFKA 1HI0P 4EYHB 2ZM6J 2FYXA 3OL7A 1JLCB 4CCHA 2H4WB 1LW0B 4USMA 1HWIA 1VBKA 4N41A 2LQBA 3TVZA 1YJ9S 1ZTWA 2IC3A 3Q8RB 4LT6A 3SZ2A 1KEKA 4LVOP 1T03B 2EC2A 3HSGA 5AJ3F 1B4SA 3FBEA 1O51A 3DRRB 2X1BA 2G2YA 3PW4A 3NGKA 3FEXB 2QL9B 1KHWA 1DAXA 1GT8A 1LNQA 4KYZA 4DV1J 2HBZB 4AYBD 3VAGA 3DCAA 5H9FK 3KJQB 5KFIA 1VQ4S 1JB0C 1S1XA 1FK9B 4M5DB 1E6VB 3MPWA 4DR6F 2UVRA 1LOUA 5CAAA 2E66A 4QPXA 3V4IB 2ABYA 4P2MA 2E9TA 3I31A 3EVOA 3P45B 3N6NA 2BABA 3O5TB 3M1VB 4GO7X 4QIVA 4DFKA 3SQOP 1I6JA 4EBCA 1TVRB 3PRDA 2JEJA 1SV5B 4FVCA 2M70A 5F9NA 3R6GB 1URRA 2R2RA 2UUTA 2YWGA 1RAHB 3IC1A 1RDRA 1U0HA 4ED1A 3Q2TC 2ZH3A 4LR8A 4ECWA 2XO6A 4XDCA 4DPOA 3IRXB 3HZGA 2BKOA 3BSAA 4PUOB 3G82A 1YJWS 4WP3A 3KUGA 4CRJA 4R5PA 5K14B 4K7QA 4URGA 1ZPWX 2LU2A 3ZZTA 1ZM9A 1JNRB 1DTQA 2G13A 4JI0F 2EG2A 3NOCA 2ZNZA 3KJVB 4Q2MA 3R27A 3A4TA 3V81B 3FKBA 1FE4A 6FDRA 1NK6A 1VJWA 4CYUB 3WQPA 3PV8A 3QLHA 4QYZJ 1WC5A 1FDDA 5DETA 4DS4A 3R6LB 3CDUA 3PFEA 2JL9A 3HZEA 5I42B 1BGXT 1UVLA 5HN0A 2K3IA 3KG4A 4DR3F 3Q2SC 1EZZB 1DLOB 2WVFA 3MAAA 2OFHX 2HPUA 2YBVA 5IM0A 2ZKUA 4DL4A 1C0TB 4ZPVR 4ED2A 2CJQA 3QGGA 5EDWA 3CWJA 4DUYF 2DR8A 1R8BA 4MYUA 3THPA 3LP1B 3M8WA 1UFKA 4UOHA 3KK2B 2CIMA 4WBFA 1U1RA 2Z2YB 2HVDA 5F41A 1LW2B 2MKSA 4Y65A 3TAPA 3C46A 1PCAA 1X0PA 3AD7C 2MTLA 2E5LJ 1ACMB 1X5TA 3J7ZT 1S72S 3NWRA 4O0IA 4E8UA 4ZIWA 1RADB 2DY9A 3I0SA 3LGHA 4ILMA 2VFVA 3TO8A 1V3SA 1VIXA 3IAS9 5KFGA 2M8HA 2KI2A 3FQKA 5CYQA 4ZVUB 4GC7A 1SUQA 3KHGA 1LK5A 3SCIE 1AW0A 1UCNA 2QMUB 3JS9A 4B3MJ 2J6UA 1RWMB 4ZIVA 3CC7S 1NB7A 1CPZA 3AXMA 3QT8A 4DU7A 1FXLA 1IN0A 3MAQA 3VAMA 2LA4A 2IRYA 4YEAA 4ZLLA 2EG1A 1D9DA 2C3MA 3D6HB 5KT5A 1XN9A 3CJ5A 4NASA 1HBMA 3M8PB 2FJWA 4YQWA 3DLGB 2XULA 4X62F 4CH1A 4QU6A 1NH7A 4HACB 2B51A 2VPWB 3FJ2A 1U0SA 2LQ9A 2FD2A 1S1TB 2VBZA 4PEOA 5EX3A 1YDLA 4B9VA 2BKPA 2RRAA 1SJ1A 3CJTA 2B8PA 3D6TB 2LP4A 1RAOA 4GMKA 1NJXA 3QT7A 1WEYA 4QOTA 1TAQA 3NCQA 1FJGJ 1NNDA 2GHPA 2OKQA 2MKCA 1OY9A 2UXCJ 3HSDA 5D6GA 2BQUA 2D3ZA 3EPIA 4FF1A 3DFEA 4WCEQ 1Y3KA 1S12A 2QFJA 1N36J 1VRUB 1G7CB 5BYRA 2MQPA 3SDEA 1CLFA 2V4RA 3V6HA 5CA5A 3PG9A 4LSLB 2MZRA 2DNYA 8ATCB 4F67A 4AUKA 3G71S 3PYEA 4DR1F 3OUYB 5DDOC 2GC8A 1H2UX 2YH1A 4CWBA 1N6QA 4IH7A 2BA9A 1CS4A 4NI2A 4ZVSB 4UUXA 5D0RA 3WC2A 1N52B 2LEPA 5L1IA 1RAGB 4R0JA 1R43A 3KUEA 4LF6F 2EC0A 3W2VB 2VG6A 4O3NA 2PE8A 1T0TV 1ZAXA 3NBPB 2RS8A 4PPZA 1HW9A 2NUUG 3T1AA 3HFKA 4BWJA 4ZLJA 2E5GA 3QMQA 3PY8A 2GJFA 4IDKB 4PYAA 5LXYA 4C0OC 2B9XA 2H65B 1QD1A 1HA1A 1RWWB 4URSA 1VC6A 1KKHA 3FVYA 1HYSA 3NAHA 2I8EA 1Q1KA 1M1GA 2YY3A 3HVTB 3NNHA 2ZITA 3MXHP 1S59A 3N79A 5EWGA 4C3KA 1U47A 2LVWA 2F9JA 4RO0A 3EPGA 5KFNA 5M2PA 4OYXA 4I2QA 3G6XA 3L9ZA 1KFSA 4RJVA 2KL8A 5ETPA 1XR6A 3ENVA 1HNWF 2OAUA 2X1GA 3I4HX 5J1NA 2C2NA 4E2FB 5KFQA 1VRTA 2YNHB 2BV3A 4Y2MA 2KJWA 5B0DA 4IFVA 4X4TA 3H5UA 4ED8A 1XNQF 1NUEA 2E29A 4TNOA 2IY5B 3PKYA 3TZYA 4ZVTB 1Y10A 1NU4A 1S1VB 2JEGA 4KFBB 3RG6A 3THVA 4MKAA 2M5YA 5IZHA 3DOKB 5LSOA 1TK0A 3H20A 2MQ8A 1RJJA 2BJEA 2HNYA 1R8CA 2R4FA 2XEXA 5LMUJ 3R1LA 3WX8A 2VKZG 4RW4B 2VQFJ 3KTQA 3DMJB 1JKHB 1QUVA 4A8WA 2IBOA 2POKA 3R97A 1HHSA 1YBAA 4UTGA 4JI3F 3MCOA 3C2PA 3M6XA 1SQFA 3OFHA 3KOAA 3OFEA 4FVMA 2V9KA 2NXCA 4U96A 3OQ2A 2ILZA 3EUNA 3VVUA 3V2UC 4ZP7A 3A12A 4RU9A 4MK8A 1KQKA 4RW9A 2IJNA 2E7VA 4QU7A 5C42B 4ZDNA 4RNHA 3MM8B 2ZE2B 1QSYA 1MU2B 1FKAF 2WBRA 8AT1B 3CE8A 2AEJA 2GQQA 4CLYA 1S9GA 3ONQA 2FJAB 3FCHA 3FZBA 4TQSA 4IQXA 2EFNA 2RRNA 4F0MA 2V4JB 1PBAA 3T9ZA 3RAXA 4ZVEA 1CJTA 3UN3A 2CNKB 1W26A 5KT2A 1BQNB 4NA3A 5AXKA 1U24A 4QWCA 4J37A 4HVZA 4JI7F 3IM9A 3GLJA 2AGQA 5ITHA 4ZOSA 4EMDA 4ZPWR 2DGVA 4ED4A 2MZSA 3VF0B 4IKAA 1X5OA 5KFMA 1JJ4A 1I94J 2L48A 3KHRA 3K89A 2IC3B 2GGPA 2XZTB 2G2ZA 4DR2J 4K5SA 5AE3A 5K9FA 1JK9B 4XO0A 1SJ3P 2AX1A 4WFXA 4B3RF 5F8NA 4CT8A 2BVZA 2ZD1A 3B6BA 4U67Q 4DV2J 1GMVA 2FJBB 3V6DA 1FTCA 4NCAA 1PIEA 2H5JB 2MEWA 5IT4A 2G4BA 3FUYA 3IS9A 1F0XA 4RBVA 2ZOMA 5KFBA 3VR1A 3ZZYA 5KT6A 3BBCA 2RKIA 1FEEA 1S1XB 1S1WB 2F5GA 5DO2A 1U45A 4I68A 3N6MA 2ZH6A 3OXFA 2CJYB 3JQKA 2QLWA 1DJ0A 1N32J 2EI5A 1KOOA 5HO4A 4F4YA 3TUIC 5DG9A 4EBDA 5K5MA 2JWNA 3FDSA 3U1LA 2UUBF 2XWXA 4LFCJ 2FQQB 1S99A 4RW7A 2MKJA 4IR9A 3DM2A 3J7A1 2RH3A 1VBZA 2P5VA 3A8JA 5GMEA 3C6UA 1HBOA 2RJZA 3A1YG 1ZYQA 5A2QU 4N8OA 1Y5LB 3Q89A 3G82B 2DR9A 1M5OC 5HSPA 4ELVA 4R5PB 2L9NA 3M8QA 1Q81T 5KG3A 4KTQA 2VPYB 2CNNB 1NJWA 2V8HA 4ECTA 1ZPVA 3BGOP 2DGWA 1U1MA 2DGQA 2C2RA 3K5LA 4ED0A 4F7VA 5KFFA 1IJFB 1H98A 1VLYA 1NAQA 5D0HA 1HR0J 4I7FA 1XMOF 3D6MB 2J7UA 5H9EJ 2IVMA 2E44A 3QLHB 1YIJS 2AWZA 2PD1A 5KG4A 2YPYA 2RIJA 3DRYA 3CCTA 4PXBA 2FVRA 2PA8D 4WE1B 5B0GA 4PQAA 2ZJRQ 3M9NB 2DITA 4NCGA 3LQVA 2Q79A 4TY8A 2ZDPA 4NLRA 4YY3F 3MAAB 5IM0B 3CVKA 1Q0NA 4HHUA 3N9UC 2F8HA 2DNRA 1EP4A 2B3TB 2IPOB 3KMSA 3FEZA 2BKNA 4LRAA 1M90T 1WOOA 4MKYA 4EEYA 3W8PA 1WF0A 1SH0A 2B4OA 4DHVA 1Q4RA 1S4EA 4OZ2A 4DLGA 3PHTA 3BSCA 1IBLJ 1T95A 1SC3B 2C2MB 2YQ0A 2AGOA 3OVAA 4GKJF 1BC6A 3MECA 1L3SA 1VQKS 4LIWA 4PXCA 2FVPA 4B08A 1KRPA 3QSYB 5FJ4A 4RUBA 3PW2A 2O66A 2QMXA 1C1CA 1ZAVA 3Q8QB 5EN1A 1D8YA 3I0SB 4OI0A 4P2SA 1HW8A 2BBEA 5IS2A 2E9ZA 1KP6A 4C11A 2N3LA 5CYQB 1SKWA 1SUQB 1DY3A 5GAGI 1LWCA 1BQMB 1N5YA 1Y4ZB 1CJKB 1KLNA 1OYDA 2RDIA 3P6YC 2XG8A 4DPUA 2NYIA 4DV0J 1HBMB 1JLFB 1ZM4A 3GZ7A 1IUJA 4N7TA 2M88A 3NGRA 2PDAA 1S0NA 4OYBA 5IQQA 3QATA 1X4HA 2C28A 1RTHB 1S6QA 4C0HA 2B43A 2DTJA 2RNEA 3BREA 5GVQA 1KNZA 1RAEB 3D67A 1B0PA 2E7XA 2F8EX 1VC5A 1KDNA 2AHOB 2R7SA 3ILOA 2UVVA 2VONA 3NP5A 5AXNA 3MOZA 4A47A 3NLCA 1SKSA 4WTYA 2QA1A 1U2FA 2VFSA 3Q22A 3BKTA 3SDEB 1UVNA 4ECUA 4M1KA 1AUDA 3LWLA 1OQ6A 4HYKA 1HHTP 3NGUA 1LK7A 2HQ3A 3ADAC 4PRFA 1Q78A 2NPFA 2YX7A 4H4KC 4M63A 4Y2AA 2V34A 1O6XA 1N6QB 5B0FA 4C98A 3B54A 1CS4B 4QIEA 3CPWR 4NI2B 1U8WA 1UFWA 1AZSA 2H3EB 3CDWA 4J91A 2DISA 5E0OA 2DO4A 2A2CA 2ILYA 1JIHA 4LF9F 2J0QD 2OI2A 2R7OA 4OIXA 4UY85 3F73A 2VG6B 3CCMS 1U1LA 1NPPA 2BE2A 4D3HA 3MI7X 4HR2A 4ECSA 5D78A 4QZVB 2DNGA 4X4OA 4OYWA 2FGOA 1J5EF 4Y00A 4ZPTR 4NLSA 5F8HA 4RNMA 2P6SA 3HK2A 4B9NA 1U49A 4B3OA 3ENWA 2IMOA 3KDNA 3W60A 1NKCA 4XTTA 3CTRA 1F6TA 2Z58B 1HYSB 3W5ZA 1TFWA 3TVKA 3Q86A 5L46A 4USHA 1RI7A 3GWCA 5IFMA 4YS2A 3R3TA 3E8OA 3TI0A 3R7BB 3EMTA 3VAHA 5J2PA 4I2QB 1XNRF 3CMES 2DY1A 4DJBA 2IVYA 3OL6A 3M6WA 4Z7CA 3H90A 1HWKA 2J76E 3RUBL 3H5SA 1U09A 4LQ3A 1VRTB 3K2YA 2HGLA 4P7VA 4DX8H 1Q5VA 2DBBA 3D68A 5CQGA 1REVA 3SBMA 4CP5A 1NH8A 3LUYA 3PACA 3G8QA 5KT7A 3QGHA 4O3RA 1N54B 2Y0SD 4MT1A 4DF8A 3TA0A 4P6QA 3P5TL 3QT5A 4A8KA 2HNYB 3PYDA 3MUMP 2VD3A 2O1PA 3BSNA 2JC1A 4GKKJ 1PKUA 1WG1A 1RTZA 1WTFA 3H2VE 4WU3A 1XQIA 2J5AA 1HNXF 3QIPA 3VALA 2FTRA 2ZBPA 3CJ3A 3LALA 3CJSA 4CO4A 3D1QA 2HSEB 2BRLA 2UUCJ 1H0HB 5K8MA 1H38A 1VIOA 4RW9B 4I64A 2W8KA 1HFEL 4NA2A 3PO5A 1B64A 2M0GB 1NZ8A 5A0YA 3WZ0A 2NUHA 4HT7A 3VQTA 5HK4A 1F9FA 1S49A 1RHRB 5BR8J 3GIKA 1S9GB 2GFFA 3MR7A 4ECYA 3UNYA 2ZKTA 2VJVA 3U1NA 2HFOA 2ERRA 4MK7A 4XK8C 1SJFA 3FZ2A 1NDKA 1RA7A 5L39A 3Q83A 2VHGA 1H72C 3AAWB 1CJTB 1W25A 1S6PA 4RR5A 2ZZNA 2C3YA 4U9RA 2C2EA 3GR1A 4DI6A 2HFVA 5DLFA 1SXLA 1JLBA 4JOUA 4ED7A 1FX2A 2ZFHA 3ZTOA 2GNKA 2OPQA 3PEJA 4JBCA 3TRGA 3MPUB 1FXRA 4CLUA 4DV4J 1VQ6S 4WFAQ 2JX2A 2ZUAA 2N3OA 3TAQA 2HQGA 2HHHJ 1NSPA 1RUSA 4DUZJ 1FFSB 4DPWA 3MFHA 5T7LA 3M4XA 5KG6A 3U02A 5F8IA 3BR9A 2MLXA 2VFTA 2W7AA 1FKOB 3C3LA 2L3MA 5A6PA 4OYMA 2ZM6F 3V6DB 2JVOA 1U4BA 3KDOA 4QBUA 4Q0BA 4OZ1A 1R27B 3IS9B 5I3UB 4KIAA 4DDFA 2GMLA 2KRRA 2ROPA 4MJKA 1V9OA 1HHQA 2RKIB 1EQ0A 2HS4A 4HEA9 1ULRA 4HI2A 3A8KA 3MM6A 2Q1LA 2BE7D 1PO6A 3GYNA 4OJ1A 1U6BA 1R0AA 4ZVRB 2V9WA 2BE9B 1FVQA 1RLCL 1S57A 1UVKA 4JV5J 3JAMY 1UKUA 4DV1F 2DR5A 5DGBA 1TQLA 4RW7B 1UW9A 4IO9Q 4C3MA 3RB4A 1VC0A 3MMCB 2JEIA 3UD3P 1JLAA 3WC0A 4OI6A 2RD5C 1F60B 3C6UB 2RDJA 1HBOB 4IOBA 1EKSA 1OSDA 2B4UA 2I9SA 5HL7Q 2CPFA 1QVGR 8RUCA 1RU2A 2WVBA 3MTKA 3D5MA 1H7WA 2LQ5A 4CLLA 3ZZRA 5E3AA 2A3JA 3M8QB 3DHXA 2HVZA 2XMWA 3TW0A 4KSEB 5GAGU 1XK8A 3T5LA 3M30A 2ZNYA 1G4CA 1IKVB 4I7FB 1YRUA 5EWFA 1IM4A 3GG1A 4U95A 1TP7A 2CDRB 1WUUA 2HAIA 4DUTA 3KLHA 4NLPA 4O3PA 5AXMA 1HQUA 4DQQA 2UUAJ 1RYSA 5ETSA 3SI8A 3CULA 4JB8B 2R8JA 2HEKA 4NCGB 3KFWX 4TY8B 2CWXA 4FP9A 2MQLA 4E98A 1BLUA 1T9UA 5L1LA 5CYMA 4LJMA 4QW8A 1HKAA 1S10A 3D7SB 3FSIA 1EP4B 2D7SA 4WYWA 4KB7A 2GIFA 1LQ9A 4L73A 2DNZA 1X7VA 2IM3A 2R8KA 2XB2D 2EBGA 2VG5A 4C2MA 5LMNJ 4DR5J 1M5HA 2CPJA 2K7KA 2EVZA 5E3RA 3MURP 4A48A 3CMQA 1VBXA 4O3OA 1RT6A 2RHQB 1X5PA 3MECB 3BH7B 1IKXA 2RQ4A 1VHFA 2XC9A 3ZZUA 3D6FB 2DNLA 1C1CB 4MIBA 3VAJA 3TANA 2FHJA 1FRMA 1PSDA 3E01A 2E5HA 1O8BA 4F8RA 1RWPB 3W3SA 5LSLA 1O5JA 2NQPA 4C11B 4NEYA 4C8MA 1S5ZA 1PJ5A 4FPRA 1NXIA 5JUMA 1LWCB 1N5YB 2KO1A 4LVNP 2MHNA 2QZ8A 2DKOB 2R7XA 2UU9J 1M0SA 4P7TA 1DHMA 3AOCA 2HLTA 2E5LF 4FF2A 3ISND 2DXDA 1ZZNA 3MEGA 4GVLA 2YKMA 4KGZB 3UR0A 1RACB 3T5HA 2RILA 1BY9A 5IXUA 3TA1A 1XWLA 2IBKA 4GRSA 1UW4A 3M8RA 1TKTA 4Y2KA 1I5OB 2AW0A 1X9WA 2AGPA 5E33A 1RHUB 9RUBA 1SH2A 4B3MF 3I9V9 4W98A 3P96A 2DGXA 4KHPF 4QW9A 3G86A 6FD1A 1S6QB 2QLJB 1EJ7L 4NZ7A 4UT4A 1KC8T 1GXUA 1SL0A 3ZTQA 5DGAA 1YJRA 2XI2A 4ZP6A 2W2MP 4Y34A 3LANA 3ZFVA 1JLQA 4L3KA 5KT3A 4X4QA 3N4WA 2W9CA 5AXLA 5DRKA 3EZOA 2UV8G 4CLSA 4FS2A 3QWUA 2VJUA 1RT3A 2BR0A 4K0KJ 2WOMA 1C0UA 1SC6A 2MQOA 4ECZA 2MKHA 2HWTA 2NZCA 1RCOB 1U7LA 1TV6A 1OO0B 5ETTA 2YKQA 2WVCA 1QJHA 2WHOA 1NJZA 1KVJA 2UXCF 2BACA 2ROEA 1UVMA 2KJVA 1N36F 1PBUA 4KQZA 2CQCA 3OL8A 3MF5A 2M3DA 3MEDA 2QL7B 2F1FA 2OLWA 2YKAA 4OYIA 2APOA 1OY6A 2BE2B 4DV6J 4PZVA 4LR9A 4ID5A 3TEGA 5KFEA 2DJWA 2CZ4A 1IBCB 4Q8EA 1YQHA 2ZOFA 2Z56B 4RLEA 2KZZA 4B3OB 2J7WA 1GMUA 4FN5A 1LEOA 2FLLA 2XS7A 3QJLA 3OLBA 4UQGA 1P1TA 2EFGA 2BM0A 4KGXB 2FHOB 3FCWA 2BOAA 4ZVQB 3QZ7A 5LM7E 1RWVB 2D3UA 1UTAA 2IHR1 3O44A 4DXLA 4X4PA 5J2PB 3T5JA 2KFNA 1QSSA 3NS5A 3NAIA 2XMKA 2FGCA 2UZAA 4EUVA 4LF8J 3Q0AA 2F3JA 2IJRA 3EGZA 2HBRB 2VUGA 1SJQA 1WELA 4FDFA 2R2SA 1REVB 2Y9HA 1CSJA 5HVGA 1FFWB 4OX8A 3QT6A 2E9RX 3DRSA 1WHYA 4MK9A 1FX4A 2C42A 4OHWA 2R8HA 2DCUB 3TARA 3B8HA 1K9MT 2JRSA 1UEUA 2MJNA 3Q8SB 4JI2J 3UCGA 3RB0A 3EZ5A 4C7QA 3O3LA 2KU7A 4DQRA 2OTLS 5KFSA 2HVHA 2GIRA 1CJVA 3EGNA 4ZP9A 2LQJA 2MKIA 3QIPB 4HHHA 2HFNA 2XMJA 3LH2S 5DLGA 4HH0A 4WPAA 2MY8A 1TK5A 3LWMA 4YMEA 1IJEB 4MKBA 3KYLA 2B6AA 5LMUF 3IGVA 3V5RA 2VQFF 5HANA 5A0YB 1VQNS 2VU5A 4N5SA 2OH2A 3L4BC 2X51A 1SIWB 2XO7A 1T7PA 1SV5A 1RABB 3D0IE 1U2RA 4OJHA 3R5BA 3ZO7A 3KXDA 3QAEA 3IG1A 2FY8A 2ASJA 4WFZA 2CPEA 3NOGA 2ASYA 3VZIA 2XSJB 4KT0C 1VI7A 4EYIB 1S6PB 3PKMA 4NLWA 1R31A 5FIIA 2ZUGA 2ZEJA 1JWWA 4H54A 2KYZA 3CCQS 5DG8A 3DGPA 3MM9A 2OPQB 1JX4A 4FF4A 4EBEA 1TR0A 3JB9k 2MJUA 5E3CA 3GYGA 5F8LA 4JYAJ 3ULHA 3UDVA 2DYAA 4UZBA 2PSZA 3A3PB 3BS9A 4C3LA 2OHDA 3F44A 4ZHRB 5T7LB 3EE3A 1OQ3A 4XPCA 2IRUA 2MQNA 2FVSA 2EXUA 1XR7A 1CQNA 1VGYA 3T1HF 4ZITA 1H74A 3PFOA 4Q0BB 3I82A 2HZVA 1DLOA 2MLYA 1QLNA 1FD2A 1I94F 1CG2A 2B9YA 2MHEA 2RB7A 4DR2F 2NZ4A 5J1PA 2MQMA 1YGYA 3MM6B 3AOBA 1VR6A 3NS6A 5A8KA 2JZ5A 5KFZA 4A4JA 4I69A 1R0AB 1PYOB 1B0TA 3TUZC 3HXMA 2DNPA 4CO0A 2VQEJ 5I4MA 4DV2F 3CJKA 4F50A 3W63A 3ZNJ1 4ECQA 2NXEA 1JLAB 4H4MA 1QAJA 4NPOA 4YB1P 2I2YA 2YWWA 1QSLA 2BJDA 2ZBQA 3L7PA 4WP8A 3O2IA 1N32F 2BANA 4IFYA 4F0KA 2AJFE 1RHMB 3K5MA 2XY6A 3KK1A 4DMZA 2VOPA 5KG1A 1HBNA 1CJUA 4LFCF 3HD1A 3W9HA 2WONA 4U8VA 2JFKA 3G4SS 2UXBJ 1MWYA 1VQ5S 5LJ3Y 3M30B 4PG4A 2XZWA 2CPZA 3N01A 2CKWA 1SC4B 4ITSA 2VBWA 5K8PA 1KFDA 3M9OB 2KHCA 1KHVA 4CLTA 5U47A 1G3OA 1S48A 1HQUB 3LAKA 5D15A 1QVFR 2BJ8A 1NK7A 1FD8A 1SL1A 2OD6A 4QWDA 2PI4A 1PAEX 3CD6S 4ICLA 2QX0A 4CH0S 4WF9Q 4CNZA 5CYMB 1H2TZ 4ETZA 7AT1B 1HR0F 1Y00A 2ZH4A 1N33J 4OZ0A 1NEEA 3W65A 3QGPA 4C4WA 4FYYB 3D66A 2VOOA 4P72A 2HGNA 3PHEA 3BO3A 2LXUA 1H73A 3ETOA 5KFOA 4PPDA 3QPIA 2OUGA 4DX6A 3ITHA 1AYEA 2DVIA 1IKXB 4KHRA 1MMDA 1FF2A 1K0VA 1AB8A 1W2BR 4LSLA 3PCOB 3N6LA 2FHJD 2JOQA 3R5GA 4ZJQA 3E01B 3DU5A 4TXSA 5A8WA 2NYHA 3OUYA 4Q43A 2AYEA 4NLOA 2ZZMA 5B08A 1TKDA 1GMWA 2CQ4A 1IBLF 2KB2A 2IYGA 2CNLB 1UA0A 4ILRA 3IR6B 3HI9A 4JI1J 5A6WA 1F3VA 1QAIA 5EUHA 1YJ7A 3W2VA 3QJJA 2JLFA 2DHAA 4M5HA 4HHJA 4O3QA 3MEGB 3TA2A 2YKMB 4K4ZA 4PG5A 4USUA 5AE2A 5FLXY 4PWDA 3W64A 2AEFA 1EB0A 1HIYA 4QR0A 3GJQB 1QTMA 1TKTB 2C22A 1NHUA 4WKYA 4USIA 4ZCKA 2W4DA 3SSQA 3DYAA 2VASA 2RU9A 2KKHA 1DQ9A 3OD2A 2ACMA 4DR3J 4ZS6A 1FO1A 4HI1A 5KFCA 3LGNA 2CQIA 2FVQA 5D4NA 1WWHA 4DV0F 1TL4A 3AT1B 2W25A 3GCXP 1WC0A 1FWKA 1WC6A 2YTCA 3WDOA 3UVJA 1JLEA 2YVSA 3M9MB 1BXNA 2OGUA 4P75A 3PYGA 4FBTA 4O23A 2KT2A 3HJVA 5KFRA 1JLQB 1YVFA 4CO2A 1P27B 3W66A 2O5DA 3OTEA 2W9CB 3OL9A 1IQTA 1RT3B 1I1GA 2WOMB 4I6YA 1C0UB 4Y28C 2WRMA 3CW2C 3MCMA 1CC7A 1TV6B 4OV6A 1WI8A 3I9ZA 2DGOA 5IC4B 3N5BA 4OI1A 1K44A 3NMRA 3GSDA 3MCSA 4KGVB 2KG1A 2QYCA 1RWXB 2CRLA 2PMHA 1HNZJ 1RWOB 3TZZA 3VQSA 3JTPA 3PJXA 1SJ4P 1ZBTA 4ID5B 2I0XA 2FC8A 4PG7A 1JNZB 1FHTA 1OJ4A 3BBBA 2PFFB 3J81Y 2VDIA 2OPSB 3P8BB 4Y0FA 3UN5A 3FBBA 2LYVA 3HVWA 2WB4A 1WORA 2VIHA 1KR4A 3MM8A 4M94A 4J9NA 4B9LA 3MR6A 3I32A 1X4GA 3L7UA 4KY3A 4BC7A 1KQGB 2MZTA 4G1IA 3I0RA 5G4DA 3CDBA 3CEDA 3UD5A 4FXVA 4KV8A 4K4SA 3ZZOA 4O3SA 2ZZTA 3DXSX 6AT1B 3C14A 3B4DA 3CO0P 3NKYA 5LXRA 4LF5F 2EKNA 4LBPA 2Z4PA 1U8SA 3NS7B 1X9SA 2ALZA 3TX8A 4USVA 4RL1A 5K20B 2W2OP 3UFCX 3FK4A 4BWMA 3DRSB 2DNOA 4B17A 3MAHA 4F4ZA 4C48A 1S6OA 4DU8A 4DR1J 2GA7A 4FKYA 1AA1B 5LJ5Y 1Q8IA 4F0HA 4IH5A 1RXOB 4QWBA 3QO9A 1U6ZA 1J5OA 1TL1A 4G1QA 2R7TA 1SJRA 3R2CJ 3MUTP 4KH0B 1RLDA 1MMLA 2WVDA 5HQMA 5D8HB 1A7GE 1CJVB 4KPYA 1RQ0A 3JQJA 2HYIB 4K50A 1N4LA 5ADZA 2RRBA 3UWTA 3M8SA 3N0VA 1S1WA 1NJYA 2DHHA 2R7RA 5F0UA 2DH8A 1N5QA 4NWBA 1YX2A 1HNIA 2VB6A 3R5AA 2B6AB 4J9SA 2XSFA 3M2VA 2CVIA 2YQ1A 4B3TF 3RW7A 3EYZA 4IO1A 2WW8A 4ECXA 2XY5A 4GKKF 2HHTA 2GIQA 1KOHA 3JSMA 3R5CA 3TYTA 3MFIA 5F3ZA 4UUWA 4ED5A 1X60A 5IWAJ 4ETXA 3IG1B 3MM5A 5H1SV 2XYPB 3HO1A 2UUCF 1HI8A 2YNFA 4L6V3 1HQEB 4N8NA 2QG9B 3CCES 3QZ8A 2C2DA 1NKBA 3GR0A 3VWSA 2U1AA 1J27A 5RUBA 1K1QA 2OMOA 4WIQA 4F3QA 1F1BB 3DGPB 1UVIA 1XEZA 3L3CA 3MM9B 2LXFA 1UMJA 3J80Y 1M1KT 5T41A 5BR8F 3PDNA 1NPKA 2CDQA 2G0IA 2ZDOA 2K2PA 2FPHX 5CD4H 2VF3A 3EICA 3T6JA 3OHAA 2A1BA 1ZA2B 2NXNA 2BDPA 4WE1A 2Y8WA 1V3RA 1JJ2R 4CH7A 4TU9A 3CSKA 4Q7AA 4U6PA 4UW2A 4AQYJ 1FXDA 4MKVA 4JI3J 4AXJA 2XI3A 2AIRB 1VCTA 2Z2MA 2IIHA 4QR2A 1IVZA 3M2RA 4K4VA 1X31C 2HHHF 4LFAJ 3MMJA 4DUZF 5HVFA 2KXHA 5A8KB 4K4YA 3RBEA 1K73T 4GC6A 2B9EA 3QNWB 4DZDA 3PYFA 4WTOB 3GE9A 2J9DA 3CJKB 1UFLA 4B3SJ 1F5AA 3OJSA 2ZWPA 4YDDB 2NS1B 3H2LA 4OX6A 2MSTA 3VV2B 3ZZZA 4H4MB 1J2VA 5C25B 4DR4J 5KFLA 2M52A 2F65A 1TUGB 3K17A 4NYZA 3WHIA 4J5OA 2GHVC 3IXQA 5ETKA 1N34J 2YKOA 2UUWA 4USJC 2BANB 3BYRA 4IFYB 3HHKA 1BQMA 2P2CB 2Z0GA 2G1DA 3KK1B 2G0JA 4TU7A 2UVWA 4JV5F 2DCLA 4LBHA 4JUZA 4JI7J 1HBNB 1CJUB 1SQEA 3T41A 3W9IA 1CJKA 2WONB 5B0EA 4OYOA 1M5SA 2AYMA 3E3XA 1CEZA 3AXKA 1WDDA 5C5JA 1RT7A 1EARA 3S01A 4LFBJ 1Q79A 3PIOQ 3VAFA 1T3OA 4CZCA 2AJQA 1EAYC 1RHQB 1S7IA 4N77A 3PW5A 3TZXA 2XGQA 5KG5A 1JLFA 2GZOA 4DV3J 5L38A 4HKQA 2XQCA 1H2VZ 3T3FA 1RT5A 1Y11A 2F4FA 2AYBA 2ASDA 1VMBA 4LBIA 1XERA 5DM7Q 3QJPA 1RTHA 4EGLA 2O01C 4LF2A 4ICLB 2DH9A 5DZ7A 2J0SD 1RTIA 2X1FA 1B3TA 1LWEB 4OZ3A 2V2KA 1Q8KA 5I3PA 1I51B 1L3UA 2UUAF 2R8IA 1NK8A 1YRXA 3MZIA 4CDIA 1U02A 2AQ4A 2UUBJ 3ITHB 4J9MA 4C6AA 1TU0B 2VC0A 2Y1JA 4LF7J 2DB1A 4KKOA 5DQGA 3KKFA 1WI6A
chains in the Genus database with same CATH topology
3MEDB 1D9AA 4X4SA 1JKHA 3CCUS 1LXJA 2XMTA 2KFYA 2KZMA 4ED0A 2P9GA 2FB0A 4ZPCA 4OJ1A 4KC5A 1U6BA 4OFZA 1U1OA 3L7OA 2FDNA 2IM2A 5A8WB 1R0AA 1FT8A 3MD1A 1IBMF 3I5AA 3QYYA 5HP1B 2KT5A 4IRCA 2V9WA 2ACYA 2ZBCA 1X4EA 2D41A 3HPOA 1FVQA 3BGLA 3I96A 3HMJG 4HTIA 1UVKA 5LMNF 4DR5F 1RTDA 4OHZA 3JAMY 1UKUA 5HROA 4OI3A 1S6UA 4DV1F 1QUPA 2DR5A 2AX0A 2YX1A 3BGRA 2XCPA 5DGBA 4OZNA 1VFJA 1TQLA 4RW7B 5HI7A 4GO5X 1HPZB 3BR8A 4I1TA 4H4OA 1Z2LA 1S9EA 2VPZB 3OFGA 4ES3A 2P6TA 4IO9Q 4RUCA 4C3MA 3CMES 4LUBA 4OJGA 3RB4A 5M2RA 4ECRA 3MMCB 1VC0A 4WYLA 2JEIA 3UD3P 3DLEB 1JLAA 3WC0A 2FVCA 1C1BA 3U27A 4OI6A 2RD5C 1NK5A 1F60B 3C6TA 2HNZA 1MWZA 3C6UB 3DXBA 2PMZD 1VQPS 4FXDA 3B4MA 4PR6A 3S1TA 4DG1A 1HBOB 2RDJA 3HDSA 4IOBA 4NCBA 2JDJA 3S8SA 1OSDA 2B4UA 1AFJA 2I9SA 2CQBA 2CPFA 4MTPA 5HL7Q 4K4UA 2CPYA 1QVGR 5SUHA 3K7RA 4B9SA 4TYAA 5C42A 1FRJA 3MTKA 1UA1A 1WEXA 1VOMA 3LW5C 3D5MA 1H7WA 4OX7A 2LQ5A 3RRHA 2HG4A 2FLNA 2ZE2A 4F02A 4PWDB 4U7CA 2HMIB 3ZZRA 2W9BA 2BOPA 1HD1A 5E3AA 3SMZA 2A3JA 1MU2A 5KTQA 3M8QB 3BO4A 4IOCQ 3DHXA 2OMLA 1H3DA 2HVZA 2XMWA 2IM1A 3TW0A 2FHMA 4K5RA 4KSEB 5GAGU 1XK8A 3LF0A 3L09A 4J9QA 3CCRS 3T5LA 3SCJE 1YWXA 3HHLA 1ZTTA 2J9CA 2JHEA 3CJ4A 3SCKE 3G96A 1XR5A 2HS0A 3AJ2A 3M30A 5GMKa 2ZNYA 1NO8A 3DYAB 2UU9F 2RVJA 2UVUA 3UD4P 2YNGB 3MEEA 2HHWA 1HQEA 3POTB 1T94A 1UEVA 4HTJA 3FMWA 1IKVB 4OLOA 5KFDA 2QIFA 5KG2A 2M4MA 2V4JA 2PN6A 4DSJA 1JXLA 4I7FB 4WIIA 2X1AA 2VV5A 4IUFA 1YRUA 1N8RT 4NRTA 5EWFA 3H5XA 1TKXA 1IM4A 3GG1A 1Q7YT 1TP7A 1WF2A 1RTJB 4IOAQ 1BQNA 3NMAA 2GO9A 2HAIA 4ECVA 5HBMA 3KLHA 4MAKA 4NLPA 2J0XA 2ROGA 4O3PA 1HBUA 5AXMA 4A8QA 2UP1A 3PX6A 1IKWA 5A8RA 3DN9A 1HQUA 5KFKA 3OTOF 1HWJA 4DQQA 1RYSA 1HI0P 4EYHB 1D9FA 1AROP 5K8NA 1JLEB 3I5CA 4EZ6A 4HDGA 3OL7A 3SI8A 3CULA 5DDRC 2DNKA 2OPPB 1TL3B 3IGNA 2R8JA 4N47A 1DTTB 1JLCB 4M8LA 4NCGB 4R8UA 5EHHA 3PZPA 4CCHA 1P9QC 3KFWX 1LW0B 1HWIA 4RW6B 4TY8B 2LQBA 1Z1ZA 3CD5A 4FP9A 3PXGa 3TVZA 5GAEI 4N41A 2MQLA 3AQOA 3DOLA 1YJ9S 2CJAA 1ZTWA 4JI4F 2IC3A 1KTVA 4E98A 3HT3A 3Q8RB 4LT6A 4PXEA 3SZ2A 3IR7B 1BLUA 1HD0A 2C3OA 1JJHA 2XY7A 2YX4A 1KEKA 4LVOP 5B0BA 3PX4A 5L1LA 5CYMA 3K57A 2DK2A 3DHWC 4LJMA 1T03B 4QW8A 1LFWA 1S10A 1IKYA 2K1RA 3IWLA 4BHQA 5AJ3F 1DARA 1OPZA 2CQ1A 5DQHA 1EP4B 2M7SA 1BQXA 2D7SA 3FSIA 4WYWA 1WEZA 3D28A 1O51A 2NSCA 3DRRB 2X1BA 3PW4A 3NGKA 3FEXB 4KB7A 1LQ9A 5HLFB 2DNZA 1X7VA 2IM3A 1KHWA 2R7QA 3DOMA 4MMOA 3OPKA 2KM8C 2R8KA 2XB2D 2EBGA 2VG5A 4IH6A 1DAXA 4OI0A 3OJUA 1D0EA 4C2MA 2COLA 2F9DA 1GT8A 2OTJS 1M5HA 2CPJA 5D4OA 4KHMA 2K7KA 5F9LA 3JYTA 2EVZA 2VFRA 4IQMA 5E3RA 3T19A 3M05A 3MURP 4A48A 4AYBD 1VBXA 2NLWA 3KLFA 4O3OA 3VAGA 3DCAA 1FDBA 1QY7A 2CQ2A 4F3MA 4K4XA 1RT6A 1X5PA 3MECB 4OZJA 4V19J 1X8DA 5KFIA 1IKXA 2RQ4A 1VQ4S 1JB0C 1VHFA 2XC9A 3ZZUA 4A8MP 4AL7A 1S1XA 1CVJA 1FK9B 1U6FA 2DNLA 3Q24A 4RKUC 1FRIA 4M5DB 3GV7B 1MSWD 1E6VB 3MPWA 4DR6F 1C1CB 3BN7A 2UVRA 4MIBA 1L5UA 3VAJA 2U2FA 3TANA 1LOUA 2FHJA 4PQUA 4PG8A 1GH8A 2E66A 4QPXA 1FRMA 3GFHA 1WTBA 4OZ5A 3V4IB 1PSDA 3GB0A 1FRLA 1T05A 2ABYA 3E01A 4YP3A 2E5HA 2E9TA 3I31A 1O8BA 4F8RA 3VTIA 3W3SA 5LSLA 1O5JA 2XCAA 3N6NA 2NQPA 1TKZB 5EWEA 2DO0A 2BABA 3O5TB 3M1VB 4C11B 4C8MA 4FPRA 4GO7X 2MZQA 5FDLA 4DL3A 1TUVA 1MW7A 1RT4B 1QM9A 1N5SA 5JUMA 4QIVA 1LWCB 4DFKA 3HF5A 4ZCIA 1N5YB 1I6JA 5THWA 1TVRB 4EBCA 3PRDA 2JEJA 2KO1A 4LVNP 1SV5B 2MHNA 2VZ9A 2QZ8A 5C25A 4FVCA 3PW0A 2M70A 5F9NA 2R7XA 4OHXA 1M0SA 1URRA 1DHMA 4P7TA 2R2RA 2UUTA 1Y3JA 3MPVA 2HLTA 1WD6A 2YWGA 4ZVGA 3IC1A 4HDHA 4OJ3A 4ATNA 2E5LF 4FF2A 1RDRA 3ISND 1ZZNA 3MEGA 4NLTA 4ED1A 2YKMA 3Q2TC 4OV1A 2ZH3A 3UR0A 4ECWA 1S77D 2W7PA 4XDCA 5KFAA 3IRXB 2FIUA 4DPOA 1LWFB 3HZGA 3V6JA 2OSQA 3T5HA 2FC9A 3I0RB 3BSAA 3VAKA 2RILA 4LF4F 4PUOB 4KR0B 1BY9A 5IXUA 2PO4A 3M32A 1YJWS 3KNGA 3P3DA 3TA1A 3I87A 1XWLA 4R5PA 5K14B 2IBKA 1UW4A 4URGA 3M8RA 2EKYA 1TKTA 4KE5A 3DI6A 4Y2KA 2AW0A 1ZPWX 3UDLA 1X9WA 2LU2A 4I2PA 2AGPA 4KV8B 3ZZTA 1ZM9A 1JNRB 5E33A 7FD1A 1RYRA 3LP0B 1N0UA 1SH2A 2HNDA 1DTQA 2G13A 4JI0F 3I9V9 2EG2A 4B3MF 3P96A 2DGXA 2M2BA 2YKPA 4KHPF 5CHCB 2ZNZA 3KJVB 5D3GB 4F4WA 4Q2MA 4QW9A 3G86A 4EO8A 3R27A 3V81B 3MMAA 1GNKA 4A8OA 4ED6A 6FD1A 1FE4A 6FDRA 1SL2A 1S6QB 4JI5F 4I56A 1NK6A 4A8SA 1VJWA 3MMBA 3PV8A 2GW8A 3CCLS 4NZ7A 5F8MA 3QLHA 1FESA 1UWBB 4QYZJ 1KC8T 4IFVB 3CDEA 3K58A 1GXUA 1SL0A 1SKRA 4YB7A 1Y5IB 3D0HE 1FDDA 3JSRA 1XTZA 5DETA 3EZUA 5DGAA 5HMZA 4DS4A 2KFZA 4ZMMA 1YJRA 5J2NA 2QE5A 2XI2A 3MR2A 4X64F 4NLUA 2LA6A 1X4AA 3CDUA 3PFEA 2JL9A 5KFJA 4ZP6A 3HZEA 4MFBA 1BGXT 5I42B 2VPXB 2OO4A 4Y34A 3MEKA 3LANA 5HN0A 2K3IA 1UVLA 3ZFVA 1JLQA 2CPHA 3UNGC 3KG4A 5KT3A 4DR3F 2MY7A 2FY1A 3RR8A 3D1OA 3Q2SC 2Q43A 4F25A 1DLOB 5KFUA 2QSWA 3N4WA 5K8OA 4X4QA 4LF8F 1BD6A 2VG7A 1LWEA 5AXLA 5DRKA 2W9CA 2OFHX 2UV8G 2HPUA 4FS2A 3QWUA 5IM0A 1S0MA 2ZKUA 4DL4A 1L3TA 1RT3A 1C0TB 3QO9B 1J5OB 1TL1B 1FEHA 1N5VA 4DFMA 4G1QB 4ZPVR 2BR0A 2WOMA 3AHPA 1C0UA 2CJQA 2RF2A 3QGGA 1SC6A 5C24B 4ED2A 2AYGA 1TK8A 2MQOA 4ECZA 1ZZFA 1O0PA 2MKHA 1FKOA 2KM8B 3PO4A 5EDWA 2HWTA 3CWJA 2DHGA 3Q8PB 3HKWA 1R8BA 1U7LA 4DUYF 4DF4A 2DR8A 4MYUA 4NMLA 4WU2A 2MDAA 3TVYA 3THPA 1TV6A 3LP1B 3K8VA 1OO0B 2YKQA 1K1SA 1QJHA 2WHOA 5I3UA 1NJZA 2MGZB 2BACA 2UXCF 4MIWA 1KVJA 2GCFA 4JI8F 2CPIA 3KK2B 5KOWA 2V5HG 2CIMA 2ROEA 3GILA 2RS2A 1U1RA 1UVMA 4I67A 2KJVA 3T9NA 5F41A 1F2GA 4TQRA 1LW2B 2MKSA 2HIQA 1N36F 4Y65A 4KQZA 3TAPA 1M5KC 3C46A 4ZVFA 5I3QA 2CQCA 3FFIB 1X0PA 4WFBQ 1IXKA 1K8AT 3OL8A 3MF5A 2M3DA 5J1EA 3WBZA 4DR7F 3MEDA 4OZLA 3OVBA 2W24A 1HNIB 1X5TA 2F1FA 3J7ZT 1S72S 4O0IA 3K5PA 2OLWA 4JI2F 2CPXA 1SI9A 4E8UA 3M2VB 2YKAA 1OWXA 3I0SA 3H4BA 4ILMA 1ZAWA 2VFVA 3BZQA 4YDXA 3TO8A 1CQMA 2APOA 3OR1B 2BE2B 1C4AA 1K0TA 1V3SA 5D4LA 2WAQD 1VIXA 3IAS9 5KFGA 2M8HA 3MM7B 2KI2A 4ID5A 3FQKA 4C0BA 4FBUA 5CYQA 3CCSS 5KFEA 2DJWA 3JSMB 1VQYA 1FKPB 3H40A 4GC7A 1SUQA 2CZ4A 3KHGA 3R1HA 2G9OA 4Q8EA 1LK5A 2CQDA 4R25A 3SCIE 2EFQA 2RUGA 2BUNA 1AW0A 3MMCA 3O1LA 4C97A 2FLPA 1YQHA 3AB2B 5BYQA 2ZOFA 2MB0B 4Q45A 3T1YF 3MOJB 2CQ3A 3PR5B 4RLEA 3HKZD 2J6UA 2KZZA 4I6AA 4B3OB 3CC7S 1NB7A 2CQPA 3U1MA 3IR5B 1CPZA 3EGWB 2J7WA 1X4BA 3F41A 1FXLA 1IN0A 4FN5A 3MM5B 3MAQA 3VAMA 2LA4A 3MR3A 2FLLA 2IRYA 2PGCA 1LFPA 4YEAA 2XS7A 3QJLA 3OLBA 1NRKA 2IAJB 3AH6A 2YNFB 2EG1A 4UQGA 2C3MA 1D9DA 5KT5A 1XN9A 4K4WA 4UY8T 2GJ2A 2PA3A 1P1TA 3CJ5A 2EFGA 2BM0A 1HBMA 3BB5A 3M8PB 2FJWA 3KMQA 4YQWA 4KO0B 3DLGB 2FHOB 4OI2A 2XULA 3QZ7A 1UJ6A 2XMVA 4X62F 1N0VC 2D3UA 4C8NA 4CH1A 1U1KA 4QU6A 2IHR1 3MGJA 4X84A 3QAUA 2WBMA 1Y9OA 3O44A 4X4PA 1NK9A 5J2PB 3T5JA 2KFNA 5JVHQ 1QSSA 1YITS 1NH7A 2B51A 1ROFA 1KSPA 2VPWB 3CB4A 3FJ2A 3NS5A 4I4BA 2LQ9A 5HQ8A 1FRHA 1HNVA 3NAIA 2FD2A 1FRXA 1X9MA 3AB4B 1S1TB 2XMKA 2FGCA 1KONA 2UZAA 1C2PA 3U7JA 2WK4A 1IKVA 4EUVA 4DSFA 4MH8A 3MWBA 4RBUA 3GQCA 2VBZA 1KVIA 3X1LB 3S6EA 3Q0AA 3K5OA 2F3JA 4IG0A 5EX3A 1UAWA 4B9VA 2HHVA 2RRAA 1SJ1A 3EGZA 4DOZA 2GGPB 4DSIA 4GMKA 1JJ2R 2Y1RI 4F4KA 2VUGA 1NJXA 1SJQA 3MDFA 4WZMA 5HMXA 1WELA 2R2SA 3CIZA 1REVB 1WEYA 3OXLA 2MPUA 1CSJA 3SCLE 4QOTA 1TAQA 2LKZA 4WFYA 4XIUA 1XMQF 1A9NB 2NPIA 2J6SA 3NCQA 4OX8A 2B0GA 4IRKA 2E9RX 3OBIA 1NNDA 1DTTA 2GHPA 2OKQA 2MKCA 1H7XA 3DRSA 2ZH2A 3HX9A 2ZD1B 1WHYA 2MQQA 4MK9A 4IR1A 5D6GA 2BQUA 4IG3B 2D3ZA 3KHLA 2KN4A 3EPIA 4FF1A 3DFEA 2C42A 1QAYA 2Z2LA 4OHWA 2DCUB 2R8HA 4WCEQ 2D3OR 5GADI 1Y3KA 2BRKA 2IJFA 3TARA 1UETA 2QFJA 2RE1A 4M95A 2LDIA 3B8HA 2F4VF 1VRUB 1G7CB 4O44B 5BYRA 1M5VC 2MQPA 2B5JB 3OTCA 1K9MT 4FXWA 2JRSA 4JYAF 1UEUA 2MJNA 3M2RB 4OQJA 3SDEA 4DL5A 2OIHA 3Q8SB 1CLFA 2V4RA 2WCXA 4DL6A 1N48A 4F4XA 3UCGA 3RB0A 3EZ5A 3V6HA 5CA5A 5F8JA 4C7QA 3O3LA 1PGZA 4LSLB 2KU7A 2QMWA 1JMTA 1TZ0A 2A2DA 2MZRA 4DQRA 2OTLS 1QE1A 1W2IA 2DNYA 2HLUA 2I5JB 5KFSA 5KG0A 2GIRA 4F67A 5MAOA 2HVHA 4AUKA 3EGNA 3G71S 2LCWA 2IYIA 1VQLS 4ED3A 2OPRA 4DR1F 3OUYB 3RAMA 5DDOC 2GC8A 1H2UX 1S7HA 4J9PA 4FS1A 4AXIA 2YH1A 2B4VA 1KN6A 4ZP9A 2LQJA 1N6QA 4IH7A 1S4FA 2BA9A 4B9UA 3I56S 2MKIA 3QIPB 2HFNA 3EXYA 2XMJA 3LH2S 5DLGA 1IBKF 4UUXA 1A6LA 3OR2A 4HH0A 4QWAA 3UCUP 5CZXA 2MY8A 4NLXA 1TK5A 3LWMA 4YMEA 3WC2A 3DM2B 1NZAA 1IJEB 1N52B 2LEPA 4MKBA 1IR0A 2B6AA 1KLMB 3SSRA 3KYLA 5L1IA 5LMUF 1DQAA 4R0JA 1R43A 3IGVA 2E7WA 4LF6F 2EC0A 3V5RA 2VQFF 1S97A 4F3OA 3W2VB 4Y2IA 2VG6A 1QAXA 4O3NA 3DRPB 1FNXH 2PE8A 3FRZA 2PT0A 5A0YB 1VQNS 1X4CA 4N5SA 2OH2A 1ZAXA 3HHNB 1RT2A 3NBPB 2RS8A 1RT4A 4PPZA 1HW9A 2VQEF 2NUUG 1G1XA 2X51A 3T1AA 3PX0A 2EK1A 4EO6A 2B7CB 1SIWB 1Z4UA 2NXUA 3HFKA 5HMYA 2XO7A 1T7PA 4BWJA 1SV5A 1HI1A 2E5GA 1G2EA 3QMQA 3N28A 5G0RA 3PY8A 3TR5A 1Y7PA 3C66A 3D0IE 4IDKB 5CZVA 4C8LA 1U2RA 4OJHA 4TKTA 3OTBA 5LXYA 2ASLA 1NHVA 3R5BA 4C0OC 2B9XA 3CGIA 3QAEA 1HA1A 3IG1A 4URSA 3HHLC 1JLGA 3AA9A 1VC6A 3FVYA 4IRDA 4RUAA 2ASJA 4WFZA 2KXNB 1FJCA 1HL6A 2D9PA 1P6TA 1HYSA 1RT7B 3RB3A 3NAHA 2I8EA 1Q1KA 3GIIA 2CPEA 2YY3A 3HVTB