1KN9A

Crystal structure of a bacterial signal peptidase apo-enzyme, implications for signal peptide binding and the ser-lys dyad mechanism.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
248
structure length
234
Chain Sequence
VRSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVTYDPVSKELTIQPGCSSNALPVTYSNVEPSDFVQTFSRRNGGEATSGFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQVGMYYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRYWGFVPEANLVGRATAIWMSFDLRLSRIGGIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a bacterial signal peptidase apoenzyme: implications for signal peptide binding and the Ser-Lys dyad mechanism
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
molecule keywords Signal peptidase I
total genus 52
structure length 234
sequence length 248
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.89: Signal peptidase I.
pdb deposition date 2001-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00717 Peptidase_S24 Peptidase S24-like
A PF10502 Peptidase_S26 Signal peptidase, peptidase S26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.109.10 Mainly Beta Ribbon Umud Fragment, subunit A Umud Fragment, subunit A 1kn9A01
2.170.230.10 Mainly Beta Beta Complex Signal Peptidase I; Chain: A, domain 2 Signal Peptidase I; Chain: A, domain 2 1kn9A02
3IIQA 3BDNA 1JHCA 3K2ZA 4NV4A 3JSPA 1T7DA 1JHEA 3JSOA 1UMUA 3S04A 1I4VA 4N31A 1F39A 4ME8A 4K8WA 2FJRA 1B12A 1KCAA 2FKDA 1JHFA 1KN9A 2HNFA 1AY9A 2HO0A 1JHHA
chains in the Genus database with same CATH superfamily
3IIQA 3BDNA 1JHCA 3K2ZA 4NV4A 3JSPA 1T7DA 1JHEA 3JSOA 1UMUA 3S04A 1I4VA 4N31A 1F39A 4ME8A 4K8WA 2FJRA 1B12A 1KCAA 2FKDA 1JHFA 1KN9A 2HNFA 1AY9A 2HO0A 1JHHA
chains in the Genus database with same CATH topology
3IIQA 3BDNA 1JHCA 3K2ZA 4NV4A 3JSPA 1T7DA 1JHEA 3JSOA 1UMUA 3S04A 1I4VA 4N31A 1F39A 4ME8A 4K8WA 2FJRA 1B12A 1KCAA 2FKDA 1JHFA 1KN9A 2HNFA 1AY9A 2HO0A 1JHHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IIQ A;  3BDN A;  1JHC A;  3K2Z A;  4NV4 A;  3JSP A;  1T7D A;  1JHE A;  3JSO A;  1UMU A;  3S04 A;  1I4V A;  4N31 A;  1F39 A;  4ME8 A;  4K8W A;  2FJR A;  1B12 A;  1KCA A;  2FKD A;  1JHF A;  1KN9 A;  2HNF A;  1AY9 A;  2HO0 A;  1JHH A; 
#chains in the Genus database with same CATH topology
 3IIQ A;  3BDN A;  1JHC A;  3K2Z A;  4NV4 A;  3JSP A;  1T7D A;  1JHE A;  3JSO A;  1UMU A;  3S04 A;  1I4V A;  4N31 A;  1F39 A;  4ME8 A;  4K8W A;  2FJR A;  1B12 A;  1KCA A;  2FKD A;  1JHF A;  1KN9 A;  2HNF A;  1AY9 A;  2HO0 A;  1JHH A; 
#chains in the Genus database with same CATH homology
 3IIQ A;  3BDN A;  1JHC A;  3K2Z A;  4NV4 A;  3JSP A;  1T7D A;  1JHE A;  3JSO A;  1UMU A;  3S04 A;  1I4V A;  4N31 A;  1F39 A;  4ME8 A;  4K8W A;  2FJR A;  1B12 A;  1KCA A;  2FKD A;  1JHF A;  1KN9 A;  2HNF A;  1AY9 A;  2HO0 A;  1JHH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...