The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
52
|
sequence length |
248
|
structure length |
234
|
Chain Sequence |
VRSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVTYDPVSKELTIQPGCSSNALPVTYSNVEPSDFVQTFSRRNGGEATSGFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQVGMYYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRYWGFVPEANLVGRATAIWMSFDLRLSRIGGIH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Hydrolase
|
| molecule keywords |
Signal peptidase I
|
| publication title |
Crystal structure of a bacterial signal peptidase apoenzyme: implications for signal peptide binding and the Ser-Lys dyad mechanism
pubmed doi rcsb |
| source organism |
Escherichia coli k12
|
| total genus |
52
|
| structure length |
234
|
| sequence length |
248
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature |
ec
3.4.21.89: Signal peptidase I. |
| pdb deposition date | 2001-12-18 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00717 | Peptidase_S24 | Peptidase S24-like |
| A | PF10502 | Peptidase_S26 | Signal peptidase, peptidase S26 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Ribbon | Umud Fragment, subunit A | Umud Fragment, subunit A | ||
| Mainly Beta | Beta Complex | Signal Peptidase I; Chain: A, domain 2 | Signal Peptidase I; Chain: A, domain 2 |
#chains in the Genus database with same CATH superfamily 3IIQ A; 1JHH A; 3JSP A; 1JHC A; 3K2Z A; 3BDN A; 2HO0 A; 1JHF A; 1JHE A; 1F39 A; 2HNF A; 4ME8 A; 1KN9 A; 4N31 A; 1B12 A; 4K8W A; 1UMU A; 2FJR A; 2FKD A; 3JSO A; 1AY9 A; 1T7D A; 4NV4 A; 3S04 A; 1I4V A; 1KCA A; #chains in the Genus database with same CATH topology 3IIQ A; 1JHH A; 3JSP A; 1JHC A; 3K2Z A; 3BDN A; 2HO0 A; 1JHF A; 1JHE A; 1F39 A; 2HNF A; 4ME8 A; 1KN9 A; 4N31 A; 1B12 A; 4K8W A; 1UMU A; 2FJR A; 2FKD A; 3JSO A; 1AY9 A; 1T7D A; 4NV4 A; 3S04 A; 1I4V A; 1KCA A; #chains in the Genus database with same CATH homology 3IIQ A; 1JHH A; 3JSP A; 1JHC A; 3K2Z A; 3BDN A; 2HO0 A; 1JHF A; 1JHE A; 1F39 A; 2HNF A; 4ME8 A; 1KN9 A; 4N31 A; 1B12 A; 4K8W A; 1UMU A; 2FJR A; 2FKD A; 3JSO A; 1AY9 A; 1T7D A; 4NV4 A; 3S04 A; 1I4V A; 1KCA A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
