1KNEA

Chromo domain of hp1 complexed with histone h3 tail containing trimethyllysine 9
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
52
structure length
52
Chain Sequence
EYAVEKIIDRRVRKGMVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HETEROCHROMATIN PROTEIN 1
publication title Structure of HP1 chromodomain bound to a lysine 9-methylated histone H3 tail.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Structural protein
total genus 10
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2001-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1kneA00
1QNKA 1SAPA 4OIJA 4DN4M 2M2LA 2NYZD 2EPBA 3FPUB 2KECA 1IL8A 3F2UA 1DZ1A 1M8AA 2EOTA 4MN3A 4IUVA 1HUNA 2DY7A 2NWGA 3ONAB 5EPLA 1SSOA 1DOLA 1AZQA 1U4PA 4HSVA 1CA6A 1B4OA 1C8CA 3MWYW 1EIHA 2RSOA 3R93A 1ZXTA 1XYIA 1DOKA 1ILPA 5E4WC 4XDXA 2KUMA 1G91A 4O42A 1WTVA 4NW2A 1RHPA 2B2WC 2DY8A 1F9SA 3P7JA 1MI2A 1BF4A 1NR4A 2B2VC 1DONA 1ICWA 1XX8A 3D6WA 5E4XA 1U4MA 3HP3A 1DOMA 4IUUA 3GV6A 1VMCA 2VXWA 4U68A 2B2TA 5DNFA 4ZLTF 1QG7A 2K05A 1RJTA 3DEPA 1F9QA 1B53A 1PFMA 2D9UA 1MGSA 1G2TA 1SDFA 1J9OA 1GUWA 1HFNA 1MSGA 4XT3B 1BO0A 4RA8A 1ESRA 5EJWA 2FINB 3MTSA 1HUMA 1WD1A 1BNZA 1G6ZA 1HFGA 2N88A 2JYOA 1EOTA 5COYA 5T1GA 1BBXC 3QO2A 1HHVA 1KNAA 1PFNA 2J7ZA 1QE6A 4IUPA 5EPJA 1F9RA 4LMQD 2H1EA 4ZKCB 3G7LA 1KNEA 1U4LA 1WTXA 2L9HA 1NR2A 4CJ0B 2K03A 1B2TA 5T1IA 4QUCA 4R9WA 3SVMA 2X6GA 2MPMA 2X69A 1Q3LA 1RODA 2HCCA 5EQ0A 3DEOA 4HCSA 2MP1A 1JICA 5CBEE 1X3QA 4X3UA 2B2YA 1O7YA 2X6LA 2MGSA 4XT1B 1CA5A 1PFBA 2HDMA 5CMDA 2RVLA 1PLFA 3I3CA 4HAEA 5JJZA 2K28A 2HDLA 4CJ2C 1G2SA 2L12A 1WTQA 1WTWA 4UAIA 2B2TC 2BDNA 4IUTA 5EPKA 4X3KA 2RSNA 4CJ1B 4OIKA 1EL0A 4ZK9B 1S4ZA 3UI2A 2N55A 1WTRA 3Q6SA 1NCVA 4MHEA 3FDTA 1E0BA 2R3ZA 4HEDA 1B50A 2Q8TA 2MJ8A 1HA6A 3H91A 3IFDA 1EQTA 1CM9A 1TVXA 1JE4A 1PDQA 2CVRA 2KOLA 2L4NA 1X3PA 2KEDA 2XIWA 1NAPA 2KVMA 1IKMA 1WTOA 4ZKBB 3DM1A 3I91A 3KBXA 1U4RA 2L1BA 1O7ZA 3I8ZA 4IUQA 1J8IA 2FJ2A 2B2UA 2FHTA 4RWSC 4X3SA 1RTNA 1X32A 2RA4A 1EIGA 2K1BA 2L11A 2HCIA 1A15A 1MSHA 1WTPA 3TN2A 2FMMA 1AZPA 2B2YC 1ML0D 4IURA 5D65A 1F2LA 2B2WA 2B2UC 5CORA 2NZ1D 3TZDA 2B2VA 1LV9A 5EKIA 2HUGA 2EE1A 3N52A 2K01A 4QUFA 3KUPA 1F9PA 2KEEA 2FFKB 4X3TA 4R8IA 5AFWA 1B3AA 1VMPA 1IKLA 1O80A 2Q8RE 2SDFA 2K04A 3IL8A 3LWEA 5D14A 1WVLA 1WD0A 2JP1A 3I90A 1HRJA 2IL8A 5CBAE 4RAUC 1AP0A 3GV3A 1RTOA 4ZAIA 1ILQA
chains in the Genus database with same CATH superfamily
3MXPA 2I0QA 1N33L 2WACA 1N8RC 4X65Q 4MN3A 3F2BA 4LUOA 1BVSA 2DY7A 2NWGA 1TS3A 1SSOA 1XNRQ 5D3IB 1HXYD 4GN3B 2WIIB 2K5WA 2NBFA 1Z6HA 1GUSA 1G91A 2I46A 4P74A 2CCZA 3NTHA 3I55A 1PRTF 3AMUA 2R6GA 3D6WA 2Z9HA 3ERQA 2B2TA 5CV9A 4L5TA 2EYHA 1HNXQ 2BCOA 2F4VL 1OXVA 5JPNC 1JB3A 2UUAL 3KFUA 3A56A 1BNZA 3RD4A 1QE6A 2A19A 2F0SA 1F9RA 4DFAA 1VQIA 1Y14B 2R92G 4DV0Q 3H15A 2R92B 2BA0A 2OEOA 4HCSA 1EY6A 3KF6A 4ILWA 5LMNW 1O7YA 3QIAA 3WDNA 2HDMA 3T53B 4IN3A 2M00A 1D5XC 1LT3D 4P73A 3EJIA 5IP9G 2UU9L 4J6HA 3FMCA 3UI2A 1SN8A 4KLKA 1WFQA 3JAME 1IBKQ 2BA1A 5D3DA 3TP7A 3R3OA 1IBML 2IHEA 4LF9Q 2F0NA 1Y8OB 5EAYA 1JT8A 4UHVA 3I8ZA 4A3CG 3SE0A 3OMCA 1J8IA 1VQ8A 2FHTA 2K1BA 4RCNA 5GAGC 3TN2A 2BDOA 1ML0D 3NQIA 1VQKA 1F77A 4A3MB 1NBWA 3FHWA 2EY6A 2B63H 4A3IH 4NXNL 1GOZA 2MHVA 2UXCL 4DK6C 2GA4B 3PUVA 2RHSB 5D14A 2ZJQA 2K6AA 2DJGC 3EQLC 1R9TB 1L1OC 1N33Q 3BYYB 1KQSA 2QGQA 3I70A 4K5VA 4C56C 3DWAA 4OIJA 2K5VA 3I2ZA 4KY7A 4WJ4A 2GN5A 2K5HA 1DOLA 1EIFA 4BY1H 2IX1A 4HSVA 4IUNA 2QDLA 1XMQQ 2RHQB 4B3TQ 1BKBA 4DV4L 4DUZQ 1TWAB 2B2WC 4NP5A 4JCVE 3E6ZX 3IKJA 1VS0A 3O13A 2D0OA 4FNFA 2WKDA 1S72A 3GTOH 2UUAQ 1VQPA 4HMJA 3PQIA 1R4QB 1OXSC 5COYA 2R93G 2BE5C 3D4WA 1N34Q 5IOCA 1S40A 1XWEA 3ER0A 4X62L 3PSIA 2R93B 3HEJA 1U4LA 4LFAL 1TWCB 4G57A 1Q90A 3SHLA 3I73A 5HURA 5CV7A 1X3GA 3NE5B 1HR0W 4ZCKA 1PLFA 2IX0A 3CW2C 4Y52H 4PG3A 2PQAB 3OWFA 1KAAA 1I4QA 2RSNA 5M5YH 1EU4A 5FLXc 3G6JB 4XQJA 3G4SA 1A2TA 5JJLA 3EN2A 4FO2A 2CH4W 3MHBA 3OWEB 3J80E 4HTHA 1BBUA 3HOWH 1SBBB 4UP8A 3CC4A 4RHRA 4A93H 3Q0AA 1N32Q 2MNAA 1G6PA 3OW2A 3RLNA 3MVVA 5C0XJ 1HZBA 1TS4A 2PI2E 3CP0A 1GUGA 3HOYH 1F2LA 2GVAA 1I4PA 3T56B 2NVQH 1SYCA 1TY0A 1JOOA 1AH9A 3OOCA 3STBC 3PUZA 1EWHA 2Q8RE 4QGUA 5M3MH 1NE3A 4DA2A 3PF5A 1QJOA 3ZYYX 5CBAE 5M5WH 2F0WA 4V0BA 1DYQA 2R7DA 3T13A 4ZAIA 1QNKA 5IODA 4A3JH 1JWSD 1SNOA 1T5XD 2CFMA 3EBEA 1V8QA 2F0IA 1STBA 1GJXA 1B9NA 5L37A 3CF5A 2EIFA 2OCEA 1RF2D 3U9SA 2XN9C 4IUVA 3I4MG 1B8AA 4RFBA 2KENA 4GOPA 2J4XA 4DV4Q 1B44D 2IWHA 1ILPA 4XDXA 4YY3L 2ES2A 4QCLA 4QL5A 1JC7A 1F9SA 1MI2A 4FF1A 4F7XA 4DR4L 4HJ9A 1K0RA 2ZTCA 1YNXA 4JBMA 1P16A 4HJAA 1QB5D 1HNZL 2E74C 1JOQA 2RDGA 3MXNB 2OTJA 1V1PA 1XNQL 4FXGC 2FINB 4POGA 3PO2H 4IUPA 1AFPA 1K83H 2DNCA 2N78A 4N9TA 5EBCA 1LO5D 1DXMA 3W2DA 2WB1G 3K0YA 3NSWA 5EQ0A 4HIKA 2WB1B 4A3DH 4MIUA 4X66L 1SLJA 1JB7A 2HHHL 4B3MQ 4UAIA 4GKJL 4R4CA 3BDOA 4FXDA 3KDFA 4DV5L 3KLSA 3E9HA 1CSPA 1Y1WH 1UUPA 4EQOA 2V4DA 1V1OA 1CT1D 3AU7A 1PDQA 4FF3A 1X3PA 4DR2L 2LXJA 5F2DA 5FOBB 3OW7A 4KTAA 3TQYA 3SGIA 5EGTA 4JI4L 1A15A 3CCVA 3J80c 1PRTC 4ME5A 4A3IG 3U9OA 2B63B 4RGNA 3A8IE 3PIPA 4A3IB 4J15A 1UE1A 3N52A 2XNAC 4YHHQ 3NHHA 1WCMH 4X64Q 1V1QA 2KEEA 4X3TA 2XWJB 4R4OA 5C0XH 4LF5L 3PO3H 5LMNL 3H3VI 1WD0A 2JA7H 2BH2A 4FXKC 2NTSA 3M4YA 3J81E 4C3IH 3CXCA 4EX5A 4CDCC 4KHZA 1DZ1A 1CHPD 4BY1G 4JI2L 3CKIB 1N36L 2C9OA 3RLOA 1VQGA 1TS5A 2WV6D 4BY1B 2YTVA 4YY3Q 1FVIA 2G9DA 4DR4Q 2KCNA 4KHPL 1KL9A 1MHWC 3KF8B 3VA5A 4ALPA 1EYGA 2VXWA 2Z1CA 4LFCQ 2A69C 1PA6A 1PH3A 3GTOB 3CPFA 1V43A 5BR8L 3ND8A 3SK5A 2UXBQ 3OYYA 4B9XA 2N88A 1LYLA 4OO1H 4DV1Q 2PCFB 4OEMB 1D5MC 4NXML 5KYIA 4RKLA 2EY1A 4FP5D 3QOJA 1KC8C 1DM0B 1NR2A 4PMBA 1RIPA 3U50C 1RODA 4ID6A 4JI5Q 3RZOH 1VQJA 1EY0A 3CCSA 1KLUD 1CA5A 1VQ6A 4JK1C 1PYWD 3CC7A 5IE8A 2L12A 4KJOA 2K7VA 4K6DA 1WTWA 4KKSA 5JVH3 1H95A 1I4GA 1TU2B 3GTLH 5M5YB 4RGTA 4ABNA 3PGZA 3T1YL 1G51A 1D8LA 1RCVD 2E2DC 4UY8C 1HA6A 1KAWA 3AB9A 2Q8TA 4JVZA 2NVXH 2M9VA 3ZJYC 3HOWG 3S14H 1QNUA 3HOWB 3WWVA 5IYCH 3UDGA 4A93G 3F2DA 3I4LA 5DEHA 3GTGH 2B2UA 5IT9L 5C44H 1YHAA 2HCIA 1AZPA 1WTPA 5C4ZA 2YTXA 4DF7A 4IURA 4DPGA 2KCTA 3S1RH 3A7AB 2TSSA 4RH6A 3HOYB 4RCOA 4DXFA 2VQFQ 3BS1A 3ND9A 3TMEA 2NVQB 2RDFA 5IWAQ 2UUCQ 2WAQE 5M3MG 2FFKB 4ZYSA 3E5SA 5M3MB 3SK8A 3K0XA 1C48A 1F2YA 4DK0A 5M5WB 1GKHA 4K8IA 4YCWA 4A3JG 2NTTA 2R7FA 1EWIA 3A55A 4A3JB 3UE0A 1B7YB 2NYZD 3FPUB 3F2UA 1V1PB 3I7FA 5FO8B 4X6AH 2Y0SE 4JBWA 5JOBA 1CA6A 4YWLA 4KHPQ 1JR0D 2RSOA 3R93A 3J81c 2KUMA 1YZ6A 2Q2IA 5IGEA 4IJHA 5ELOA 3U4VA 1STGA 3BG3A 4BY7H 1JQYD 2NN6I 3FKIH 4DUYL 4ZQ3A 3CC2A 1L0XB 3AFQA 2PMZE 3CD6A 1GM5A 5A35A 1EUJA 4DAMA 5A2QL 1H9KA 1M1KC 4XT3B 2EYJA 5M3FH 1S5ED 3P75A 3HS0C 3ULJA 3PO2B 1SYEA 4X65L 3ULLA 3KDFB 2IHFA 1LTAD 1K83B 2F0OA 3G7LA 3NBHA 1FNUA 5EBDA 2WFWA 1XNRL 5T1IA 1IZ6A 1CUKA 2B8FA 4DNIA 1II3A 4A3DG 3DEOA 4L5SA 1X3QA 4XYOA 4A3DB 2L0CA 1MJEA 2EJFC 1ZEQX 3ULPA 3HOVH 1Q8KA 1SMYD 1HNXL 2QCPX 3AFPA 1HZAA 4IUTA 3LGJA 3E9IA 4ZUJA 4HJ7A 1IBLL 1KDCA 1STHA 1Y1WG 2J0TD 3CCUA 2E76C 2ZJRA 4L5QA 1Y1WB 4CDDC 1GO3E 3OMGA 3X3NA 3J7AV 2RKSA 4DV0L 3U4ZA 4A75A 3GTPH 2Q2TA 4JC0A 3HGBA 4ZKBB 1NJIC 1U4RA 4RMFA 1IW7C 3TP5A 1CQVA 2FMMA 4XYQA 1YNND 2B2WA 5CORA 4BWGB 1RDPD 5C3EH 4HIDA 4GZYC 2EZVA 3C3LA 1A8VA 5C0XG 5M9OA 3PO3G 1WCMB 1CKMA 1S5DD 2MO0A 4LWCA 3PO3B 5JJKA 3RR5A 2JA7G 4KY5A 2ENBA 5KGUA 4A3KH 3GQBA 2JA7B 1MJCA 4U673 4C3IG 4LF9L 4C3IB 1QZGA 2F3WA 2PQAA 1IYUA 4ZRZA 3EVQA 1BCPC 2JE6I 2AQ1B 1BBWA 3ONAB 1HQMC 3SXHA 4GN5A 3D4RA 1S3OA 1VF5C 1L0YB 1NNXA 3KJOA 4O42A 4P71A 2LXKA 2JJQA 1U4MA 4A76A 1PFSA 4YIJA 4U68A 4A3LH 5DM63 2Q8IB 4JI1Q 3TS2A 2CW0D 1HH2P 1A2UA 1MGSA 3M3YH 2F4IA 1J9OA 2MO1A 1AE2A 1TKWB 4PZ7A 4OO1G 1HZ9A 2JYOA 1KRSA 1YVCA 5FO9B 1KNAA 1CKNB 1SFOH 1JORA 2MQHA 2OXPA 2XGTA 1CZWA 1YI2A 3G48A 5E7NA 2F0MA 4TKOB 1J5EQ 1XMQL 1SE8A 5ELNA 4QQBX 4B3TL 3RZOB 2SNMA 4DV3Q 2PQEA 4DUZL 4IPGA 3EFXD 1EEID 3FEWX 4TVAB 4ULLA 5KNCA 1E1TA 1ET6A 1SYFA 4R8NA 1ZYRD 2AKWB 1IBLQ 1SNMA 1SE3A 3T16A 4OIKA 3GTLB 2ZXOA 3RUZA 3W5OA 2V1CC 5C4JH 1AW7A 1XJVA 1Z47A 3TRZA 3Q6SA 4DV7Q 4KI0A 1N34L 5CV6A 4NKLA 4ZUIA 2NVXB 4TRDA 2K5DA 3S14B 1FNWA 2UUBL 1TVXA 5IYCG 1HA5A 4JI8Q 1D5ZC 1E24A 4UP9A 2G9HD 5C44G 1YNJC 3M9BA 3GTGB 4HMIA 3MXNA 5C44B 1QUQB 1Z7TA 4KD3A 4IFDJ 3NUCA 2XSCA 1GVPA 1V9PA 3S1RB 3WOFA 4JI7Q 3SEBA 1LTID 2ZXPA 2HUGA 1E7ZA 1BQQT 2LS01 1NUCA 4C3JH 4JG2A 2GVBA 2N3SA 1TQOA 2PO4A 1WVLA 1N9WA 1UEBA 3RN2A 1I6VC 1X3EA 3PIOA 5IY0A 5IT9E 5I9OA 3A0JA 4MNOA 1T5EA 2EPBA 3KLRA 4A3MG 1XTDA 4OONA 4GKKQ 1N32L 4C2MH 1U0LA 3PMFA 1Q8IA 4S3SA 3S1NH 4IALA 3NBHB 3PCOB 5JJIA 1WI5A 4IZ8A 2F0LA 3FKIG 1CFMA 3J80i 1VQNA 4BY7B 2PPBC 3FKIB 4MTNA 1STEA 2EJMA 1RJTA 4KHVA 2DNEA 3WOEA 2CWAA 2PZUA 3CRLC 3DMUA 3FPPA 5M3FG 1JJGA 3PUXA 4I7ZC 4KV6A 1HUMA 3TP6A 1HFGA 3KLSX 4TQUS 5M3FB 4IPDA 2FMCA 4AH6A 4EVOA 5IYBH 1QCBD 1HHVA 1VQBA 1EFID 1PTOF 4L8JA 5GAEC 3DHQA 5G3LD 1L1OB 3K6OA 4APVA 1Q3LA 1HNWL 3BDCA 1FYCA 4DNRB 2EXDA 4RGOS 2F0TA 4O2DA 4L6TB 5CMDA 5A2QE 3I3CA 2VB3X 3DWPA 1KABA 3HOVB 3RMHA 2Z0SA 5AJ3Q 4KN4C 1KIXA 4K6LA 2C35B 5ELEA 4ZK9B 5C6AA 2N8NA 1WTHA 4JI6Q 2CQAA 2UUBQ 3IFDA 1A3TA 1VQ9A 2KCMA 3KF8A 2ASBA 5JEAH 4H7BA 3A8KE 3S1QH 3GTPB 3C1EA 2ICEC 4DAVA 4HJ5A 1MIUA 1FR3A 4X3SA 3BU2A 4OGQC 3E3XA 5C3EG 4B3ML 5C3EB 1E2VA 2EE1A 5LMUQ 3ICEA 3RZDH 4IFDH 4N8X1 3CAMA 5FK9C 1EYDA 1SRUA 5AFWA 1IKLA 4A3KG 1PH2A 1PH5A 2I5MX 1HRJA 4B3RL 5TSSA 5J3BA 4A3KB 2L55A 3BZCA 4QIWE 4HCEA 2BE5D 3GTJH 1KTKA 4M8AA 1C9OA 4DR6Q 3JAMc 2F0KA 5IP7H 1AEXA 1OXXK 4C1NI 3G71A 1U4PA 5K36H 2A73B 1WTVA 4ME3A 2DY8A 4KD4A 4YHHL 4X64L 2IJ0A 3ITPA 2PW7A 4A3LG 2G5DA 1O7LA 1VF7A 1L0WA 1PHJA 4NMZA 4BBSH 4KKUA 1ICFB 1VQCA 3M3YB 1SXTA 2D5DA 3NQTA 1QVGA 4G7ZC 1JWMD 3S16H 3BYTB 5T1GA 1PYBA 3D8GA 1QOHA 4L63B 1SFOB 3GP7A 2H1EA 3HOUH 1KNEA 1HNWQ 2Z6KC 2YV5A 1Q82C 1QVFA 4JOIA 2A6ED 2OTLA 4QJFA 2F0HA 3PUWA 3QG1A 1PFBA 3OPOA 3K80C 2AUKA 3J81i 1WTQA 4LFCL 2RDHA 3STBD 1U5KA 3HG9A 2E2HH 4I7AA 1YJNA 4CJ1B 2QDBA 2HIVA 1PV4A 2E2JH 2UXBL 5C4JB 2XWBB 3R2IA 4DV1L 1K8OA 4MHEA 3MXUA 5GADC 1XMOQ 1EZ8A 1BCPF 2KEDA 3URYA 1VQAA 4JI5L 2L1BA 5NUCA 5GROA 4JV5Q 3MA2B 1EIGA 3F8TA 2L15A 3VR6A 1MKHA 1Y8PB 3MFYA 4K0KQ 2OWOA 5D65A 3M85A 1YJ9A 2BOSA 4R1JA 1XTCD 3K8AA 4C3JG 4QUFA 3EA6A 3KUPA 3E0EA 4C3JB 3DM3A 1JJ2A 4B3RQ 2LY7A 1L2FA 3LWEA 1E3PA 2D62A 4B3SQ 3W1GA 1LTSD 5CV4A 5EKKA 3OIQA 1AN8A 5C3XA 3K5LA 2F0VA 3NTKA 3H3VH 1IL8A 1K3RA 1VQEA 2B63G 4TSSA 3GTKH 2NVYH 1EZ6A 4C2MB 1C0AA 3VYSA 3P1HA 1GUNA 1VQOA 3S1NB 2VQFL 1BF4A 1Q12A 1MD2D 4P2CB 3F2CA 2QILA 2B2VC 5IWAL 2UUCL 1YEZA 3BDLA 1AE3A 1XX8A 4LF6Q 1VMCA 1PRTB 2AWOA 3K7AB 1KXLA 1D1KA 2A68D 1BO0A 3H0GH 5IYBG 4AQYQ 1C7YA 1H9JA 2KHJA 5JPMC 4RGMA 1VCIA 1CQFA 4QUCA 1BOSA 2ZXRA 2CKZB 3HFZB 5LL6X 4KK7A 1PRTD 4X3UA 1QWYA 2RBMA 3HKZE 2F03A 4HAEA 5JJZA 3HKZB 4RHSA 1X6OA 2ID0A 4IQZA 1X56A 2QW7A 2VL6A 2EYMA 4OWXB 3ERSX 3M4QA 1CSQA 4PMCA 5IGGA 1S4ZA 1Q86C 2N55A 5DLQE 2B8GA 3HOXB 4K2LA 3R2TA 5JEAG 1CM9A 2KOLA 3P20A 4L5RC 1NAPA 3HZXA 3S1QB 3I91A 5BN3A 2CWPA 5C5LA 4HJ8A 3BVZA 2E5LQ 1DONA 3J7AF 2KCCA 2I5HA 5JVG3 4OWTB 4IOAA 2O4XA 4FDBA 1CKNA 2O2LD 1GD7A 4IFDG 3LNNA 5IGFA 2AHOB 3RZDB 2A69D 1SEBD 4R4TA 5FLMH 1X55A 1LT5D 2K04A 5LHY1 3MXGA 2ZM6Q 3VYUA 1K0SA 5FLXL 3E0JA 1HPCA 1LTGD 1YHBA 3KOJA 1K73C 1ILQA 1M4VA 1PTOC 2IT1A 4GLAC 1DCZA 4OXPA 5IP7G 3GTJB 1HZCA 4IPHA 3R8BA 3I56A 4H13C 3QWNA 3HOYG 4LFBQ 3DWQA 1FD7D 1BR9A 1WYDA 5J1ZA 1W2BA 1A6XA 5K36G 1TWHH 1ASYA 1I4RA 1PZJD 2F0DA 2WAQG 2R7ZH 3VYTA 1HQRD 2WAQB 1ICWA 2XRQD 3CCJA 1DOMA 4BBSG 1ESFA 1OXUA 1XPRA 4CHTB 4BBSB 1TR5A 1B53A 1I5FA 4O0AA 1GUWA 4E6IA 1QUQA 4A3FH 3K59A 4JBJA 3KBGA 4A3EH 5BN5A 2VQEQ 1JMCA 3S16B 2NN6H 3AYHB 3T1HL 3KK7A 1A62A 3HOUG 2EXZA 2A6HC 2Y0SG 3HOUB 2K03A 2Y0SB 1SJED 2HCCA 3T4AC 3NXWA 1EYAA 2NUCA 2JQOA 3PUYA 2X6LA 1RD9D 1IL2A 3M4OH 2K28A 1T9HA 4V190 1SR3A 1VQDA 1G2SA 1E2WA 2WINB 2PMZB 3OTOQ 4JI1L 1EEFD 2E2HB 3M7NA 3PO2G 2E2JB 3EIVA 5I2XA 1LLRD 2R3ZA 1PH8A 1B50A 2MJ8A 3H91A 1PXUA 1E1OA 1EQTA 1HJPA 3SK6A 4R4IA 1EQQA 2L4NA 4JW0A 3Q22A 1DGSA 5FO7B 1J5EL 1UAPA 2LMCB 2Z4HA 1EIYB 4DV3L 4RKBA 4PQXA 2FJ2A 4RWSC 1JJCB 1X32A 1O7IA 2ZT9C 4UDUC 1LT6D 3NWSA 3FP9A 4XTCS 2NZ1D 3TZDA 3TS0A 3S17H 4WJ3M 1BUVT 2CH4A 4CDEC 1EY5A 3H3VC 1EY4A 5CV8A 1L1OA 1QILA 1GHJA 4DV7L 3CPWA 2JP1A 4C3HB 2A5HA 4DKAC 4EQPA 4YCVA 4GLVB 1FJGQ 4JI8L 3RLFA 1SE4A 3PF4A 5J22A 3GTMH 4HSPA 3TSSA 1OXTA 4QMGA 3RN5A 4A4IA 3Q8DA 2F52A 1FGUA 1S5BD 3GTKB 2NVYB 5ELDA 1SJHD 3IFTA 1PH1A 1IYVA 1EQRA 1B4OA 1WCMG 4JI7L 2RQXA 4DXGA 5IYDH 4JYAQ 5E4WC 3HKSA 2FXQA 4NW2A 1FL0A 2F0UA 3J80L 3I72A 2RCFA 4H02A 3GV6A 4EGVA 3GDEA 2K05A 3H0GG 3T1HQ 1HTLD 1EQVA 1ESRA 3H0GB 4BA1I 2ZJPA 2IY5B 3NENA 2QA4A 2YU9H 2J7ZA 4GKKL 1I6HH 3AQQA 5ELBA 4DV2Q 2PW5A 2WP8J 1HR0Q 1CI3M 4CJ0B 3NTIA 5CYUA 1LACA 4XQQA 3W1BA 1IW7D 3SVMA 2QKIC 3JAMi 3M7GA 4LK1C 1LT4D 1NMGA 2PYKA 2PZTA 5CBEE 2VNUD 2MGSA 1YITA 1BCPB 4DK3C 1K8GA 3HOZH 4P72A 1PZKD 1LABA 1Y8NB 1SNCA 4CBVA 3NEMA 2AMCB 3K57A 4K2KA 2D0PA 2TMPA 1EL0A 3L3OC 2PI2A 4DR1Q 4RG1A 3L0OA 1E0BA 4AYBE 2DGYA 1G291 4JBKA 3NPPA 1JE4A 2SNSA 2A8VA 2A1AA 2EVBA 1ASZA 2KVMA 3S15H 2D2CC 2JA9A 1K28A 4ZLTF 1IHZA 4K14A 5I2YA 4YWMA 1PVOA 1IYJB 1D7QA 2B2UC 5IGBA 3I4MH 2EY2A 5JEAJ 5AJ3L 4KKTA 5FLMG 1EU3A 4A3GH 5E1FA 4EQNA 4DR5Q 1S5FD 1B3AA 3VR5A 1O80A 4JI6L 2L5TA 1E22A 2IL8A 2JA6H 4RAUC 5IIFA 3TBIB 1TWFH 2QEXA 2ZTEA 4CGYB 4KJNA 2VB2X 1M8AA 1YBYA 2Z6KA 5KNDA 3S24A 5IGCA 4POFA 1GUTA 2B3GA 3BZKA 1TWHB 3H94A 2WKCA 4G4KA 1VQ4A 2MUYA 2R7ZG 4LUVA 5M5XH 2R7ZB 4I65A 2F0FA 4DR7L 5LMUL 1KDAA 5FLXE 1RL2A 1YHQA 3IRBA 3KJPA 2F3IA 1BDOA 4A3FG 1F2MA 1H9SB 1NSNS 4OELB 4A3EG 1HFNA 2JK8A 2NN6G 3C46A 4A3FB 1Q1BA 4A3EB 3MTSA 4DR6L 1BBXC 1STAA 3NWTA 2VUMH 1Y69U 1LUZA 1BXTA 4LF7Q 4ZKCB 1EY8A 4A3BH 2Q2UA 3VR2A 1ET9A 2H5XA 1YNJD 4R9WA 3TP8A 2AQ2B 1K8AC 2VS1A 1JWUD 3IAYA 4BY7G 5KNBA 4LJZC 2JN4A 2MP1A 3MFGA 1WOCA 2Z4IA 2PNHA 4QB4A 3C1FA 4GNXC 2OF1A 3A8JE 4ODGA 2RVLA 1TY2A 4LUZA 3M4OB 2HDLA 4CJ2C 3J81L 1Y1VH 3K7AH 1D2BA 2R61A 2JEAI 2I5LX 1J6QA 5EPKA 1OTCA 4Q0FA 2KJXA 4Z9CB 5CGKA 4LF8L 1RKNA 1NCVA 3FDTA 4GNXB 2HD3A 2DUDA 1B1ZA 2CVRA 3V96A 2XIWA 1NY4A 1IKMA 1WTOA 3DM1A 3KBXA 1CHQD 1D1IA 3CCEA 1O7ZA 2AQ3B 2IX3A 1I4XA 1RTNA 3HOVG 1Z9FA 2B2YC 1H9MA 3CU7A 5LL6S 3GO5A 1FGBD 2B2VA 3S17B 4OL7A 1W6JA 2K01A 1VQ7A 3HOXH 1K9MC 3IL8A 3I90A 2E75C 3D3RA 2F4VQ 2Q2HA 5FJ8H 4BXXH 1XMOL 3LX0A 2F1MA 3GTMB 3VDYA 1SAPA 2M2LA 2KECA 4JV5L 4EQ5A 2LSSA 4K0KL 1I3QH 3PIP3 3A5ZB 5IYDG 4Y7NH 5C3WA 4DR7Q 4DAYA 2CQOA 1PH7A 5FKAC 1I4HA 3P7JA 4LF4L 5E4XA 5IGDA 1ZKOA 1PYSB 3DEPA 4B3SL 1JCKB 4O1NA 1G8ZD 2K5QA 1G2TA 1SDFA 2UU9Q 4Q5VA 4QIWB 1GXDC 3K58A 1WD1A 1G6ZA 3OSOA 5BN4A 2F0PA 2K33A 5C4XH 2K50A 5ISRA 4QF4A 1CZGA 2YU9B 5EPJA 2C5CA 1I6HB 1IBMQ 4IPCA 3JC66 5IT9c 1B2TA 1A3VA 1UNSA 1PTOH 3H09A 4K5XA 1B70B 2X69A 1LTBD 3CCLA 2Z6BA 4JI3L 2MFIA 1HCZA 1R4PB 5E3FA 1JICA 5HY6A 4HIMA 1PZID 1UEAB 3SDZA 1I50H 4BBRH 4LF6L 3HOZG 2YTYA 4IFDI 2A6EC 3HOZB 2B2TC 4X3KA 4LF8Q 4LNQA 5CR3A 4NXNQ 3S2HH 2XVSA 2UXCQ 1UE5A 4AQYL 1PH9A 3CMEA 2QF7A 2IPKD 2F0JA 1D6EC 3K5OA 5J39A 2K5NA 4PZ6A 4HIOA 3PV0A 3TDQA 1XXGA 2LKVA 2P5ZX 3S2DH 3S15B 4PV1C 3K7UC 1B9MA 4DK1A 2B29A 4F87A 2VZAA 3J81j 4CKBA 4IUQA 2AWNA 2JXMB 2IW3A 4R4QA 1XPOA 4F88A 1SYDA 4HN7A 4B9WA 2NZHA 3J7A5 3I4MB 3MEHA 4A3GG 3FVQA 2VW9A 3K5MA 1UE7A 3CCQA 2UXDL 4XIGS 4A3GB 3QB3A 4R8IA 1I94L 2F0EA 3VR3A 2JA6G 3CHBD 2HT1A 4JPBW 3KF6B 2JA6B 1RTOA 1VQ5A 4LW1A 1Q46A 1TWFB 4IO9A 2EYFA 4DN4M 4H44C 1X3FA 2EOTA 2E5LL 2K4KA 3BJUA 4X62Q 3BZDB 5EPLA 4LFAQ 2RCNA 3LWUA 1LTRD 3QJYA 1XYIA 1DOKA 1Q1EA 5M5XB 2WB1E 1CKOA 4LF4Q 1NR4A 4GS3A 4C3HH 4IUUA 3L7ZC 1UWVA 4XXEA 2DJFC 1Q81C 1QG7A 2ZM6L 5KEEA 1SE2A 4YCUA 1SNDA 5I6YA 1A0IA 1ENFA 4F8MA 3K5NA 3H6MA 1EYCA 3Q24A 4RA8A 3GTQH 2VUMG 1EOTA 1VQMA 2ZTDA 1PFNA 2JA5H 4A3BG 2VUMB 4LFBL 2HIXA 2PNRC 4DV6L 2A68C 4A3BB 1WTXA 2L9HA 2EQSA 4JI3Q 4K5WA 1S5CD 2MPMA 3V05A 3CQZH 3KLWA 2K14A 2JA8H 2BH8A 3B6YA 4DR3L 2KHSA 3BVGA 1Y1VG 5EKLA 1HTPA 1Y1VB 4FF2A 3A7LA 2Z8LA 3A74A 2N49A 3UDFA 4KMUC 3DUZA 1EY9A 1SROA 3K81C 4N8FA 2VQEL 3J7YW 3UDXA 5I4DA 1TIID 5KIXA 5K5PA 3A5UA 2HQEA 2O5IC 2K32A 3J7ZC 3TREA 1A63A 1ONLA 4M1UB 3T51B 3A54A 1W6KA 3TEHB 3HKZG 2VY3A 1B3QA 1PMRA 4MZ9A 3I4NH 4CKEA 4OHJA 5C0XI 1SMXA 2UXDQ 3DXJC 3OTOL 4KN7C 1LV9A 1H9RA 1STNA 3M4PA 2E8GA 3HOXG 1I94Q 5KRUA 1F9PA 4DAPA 4DAYB 1TS2A 2NVTH 2E2IH 1QZHA 1LTTD 1TWGH 4C1NK 1HNZQ 5FJ8G 3S1MH 4BXXG 1AP0A 3GV3A 4FYDA 2XRSD 4NPSA 2EYLA 4K8JA 4WORA 1XNQQ 1KHIA 5C4HA 1O78A 1P8LA 1YIJA 1HUNA 4P75A 2EY5A 1I3QB 2H4OA 5G3LF 1EIHA 1PH6A 4Y7NB 1TT2A 2ALYB 3GD7A 4X66Q 3MZ5A 2DN8A 3NP8A 2SEBD 1STYA 3HP3A 1GUOA 1CK1A 2SOBA 2HHHQ 4OO1I 5ELFA 3D0FA 3Q23A 3L2PA 1ENCA 1PFMA 4CDFC 1UE6A 3G6EA 4GKJQ 4LAAA 1FJGL 3X3MA 4PMWA 3I4OA 5C4XG 5EJWA 3BVMA 4DV5Q 3KYHC 2JEBI 4DV6Q 4OWWB 5C4XB 4HR7B 4LMQD 2XTIA 3VR4A 4JI0L 3W3AA 3JAML 4DR2Q 1PTOB 4DR3Q 2R92H 4GOPC 4JYAL 1QVCA 4BBRG 2A74C 4JI4Q 1I50B 4DU9A 4BBRB 5HGTA 1DJRD 4JOIC 4A93B 4FF4A 1YJWA 3V2TA 3SR1A 1TXYA 1X9NA 3S2HB 5ELCA 4GOPB 5IP9H 4LF5Q 2O5JC 2K52A 5LMNQ 5I9PA 1PTOD 4HEDA 1VQLA 3MEFA 3D4DA 3D6CA 5JAVA 4DV2L 1HR0L 1EY7A 2F0GA 3S2DB 1KDBA 3S9WA 3VA7A 3CMAA 1H9SA 4A3CH 4JI2Q 1JOKA 2L11A 1N36Q 1MSHA 4J1MA 3CRKC 2CHBD 4A3MH 2OQKA 1IXRA 3VYRA 4IJLA 1A3UA 5CV5A 1XPUA 2HQLA 4IOCA 1EFWA 5EKIA 5H1SE 1LM0A 1PH4A 4UP7A 1SNPA 4J8QA 2QEJC 1SMYC 4WJWA 1MBYA 3MAQA 1VMPA 2PZWA 5C5MA 5I6WA 4DR1L 1R9TH 1NTGA 2F3VA 2LFNA 4NDXA 1Q7YC 2YYZA 4OX9L 2F0QA 5BR8Q 1JE5A 5DM73 1SNQA 3UE1A 2A6HD 4NXMQ 4WFN3 4H0LC 1OO9B 4UPAA 1CTMA 2EYOA 3QOLA 4BS9A 3EROA 2K75A 2KBNA 1AZQA 3CCMA 5GAHC 4GLXA 1LTLA 1SYBA 1C8CA 3MWYW 1ZXTA 4GNXA 3FRPB 2OQ0A 1TWAH 1RHPA 3D31A 4G7HC 1YNNC 4C3HG 4YWKA 1KD1C 2EYPA 4G7OC 4AIMA 2KA7A 4MTKA 4DR5L 3NELA 5DNFA 1F9QA 2D9UA 3PIO3 1MSGA 2RF4A 3U58A 3GTQB 3OHXC 3NBIA 3T1YQ 2JA5G 3QO2A 4JI0Q 2KHIA 2JA5B 2EDGA 2OT2A 2R93H 5DAUA 3DLLA 1TWCH 4WRDA 1W3SA 1U9RA 2X6GA 1F2ZA 1K3BC 3L9AX 5HGQA 2JA8G 3CQZB 5GQOA 2JSOA 2AUJD 1EOVA 2JA8B 4DGZA 4QY7A 2B2YA 4B08A 4XT1B 3OIPA 2ATWA 2EJGC 2KQ3A 4PNYA 4N9PA 3NK9A 4XQNA 2BDNA 4PZ8A 1VDZA 1EWCA 3MC0B 4CKCA 5KYLA 2CW0C 1M90C 1X54A 4FVMA 3CCRA 1KRTA 1KLGD 4LF7L 1IBKL 1K8MA 1C4QA 3RNUA 1DD2A 1FNVA 1WJJA 3F1ZA 3UDIA 4GN4B 3I4NG 2B39A 2RA4A 1E2ZA 1VQHA 3I4NB 4BA2I 3QR8A 2I07B 1ENAA 3C2PA 2NZOA 1SYGA 4DNTB 3SK4A 2ICIA 3N6RA 1ZYRC 4DUYQ 4AYBG 1WTRA 2SDFA 3TZUA 2NVTB 2E2IB 3HRZC 4OX9Q 1TWGB 4KY6A 1NMFA 4NB3A 4AYBB 3AEVA 1VQFA 1X65A 2NB0A 3S1MB 5CC4A 1BCPD 1GHKA
chains in the Genus database with same CATH topology
3MXPA 2WACA 4MN3A 2DY7A 2NWGA 1TS3A 1SSOA 5D3IB 1HXYD 2WIIB 2K5WA 2NBFA 1Z6HA 1GUSA 1G91A 2I46A 3NTHA 1PRTF 3AMUA 2R6GA 3D6WA 3ERQA 2B2TA 5CV9A 2EYHA 2BCOA 1OXVA 5JPNC 1JB3A 3A56A 1BNZA 3RD4A 1QE6A 2F0SA 4DFAA 1F9RA 2R92B 2BA0A 2OEOA 4HCSA 1EY6A 4ILWA 1O7YA 3QIAA 3WDNA 2HDMA 3T53B 4IN3A 2M00A 1D5XC 1LT3D 3EJIA 4J6HA 3FMCA 3UI2A 3JAME 2BA1A 5D3DA 3TP7A 3R3OA 2F0NA 1Y8OB 3I8ZA 3SE0A 3OMCA 1J8IA 2FHTA 2K1BA 4RCNA 3TN2A 2BDOA 1ML0D 3NQIA 1F77A 4A3MB 2EY6A 1GOZA 2MHVA 2GA4B 3PUVA 5D14A 2K6AA 1R9TB 3EQLC 3BYYB 3I70A 4K5VA 4C56C 3DWAA 4OIJA 4KY7A 1DOLA 2IX1A 4HSVA 4IUNA 1TWAB 2B2WC 4NP5A 3E6ZX 3IKJA 3O13A 4FNFA 2WKDA 4HMJA 1R4QB 1OXSC 5COYA 2BE5C 3D4WA 5IOCA 1XWEA 2R93B 3HEJA 1U4LA 1TWCB 4G57A 1Q90A 3SHLA 3I73A 5HURA 5CV7A 3NE5B 1PLFA 2IX0A 3OWFA 1KAAA 1I4QA 2RSNA 1EU4A 3G6JB 4XQJA 1A2TA 4FO2A 3MHBA 3OWEB 3J80E 4HTHA 1SBBB 4RHRA 3Q0AA 3MVVA 5C0XJ 1TS4A 1GUGA 1F2LA 1I4PA 3T56B 1SYCA 1TY0A 1JOOA 3OOCA 3PUZA 1EWHA 2Q8RE 4DA2A 1QJOA 3ZYYX 5CBAE 2F0WA 4V0BA 1DYQA 3T13A 4ZAIA 1QNKA 5IODA 1JWSD 1SNOA 1T5XD 1V8QA 2F0IA 1STBA 1GJXA 1B9NA 1RF2D 3U9SA 2XN9C 4IUVA 4RFBA 2J4XA 1B44D 2IWHA 1ILPA 4XDXA 4QCLA 1JC7A 1F9SA 1MI2A 4FF1A 4F7XA 1QB5D 2E74C 1JOQA 2RDGA 1V1PA 4FXGC 2FINB 4IUPA 1AFPA 2DNCA 4N9TA 5EBCA 1LO5D 1DXMA 3W2DA 3K0YA 3NSWA 5EQ0A 2WB1B 4MIUA 4UAIA 3BDOA 4FXDA 3KLSA 1UUPA 4EQOA 2V4DA 1V1OA 1CT1D 3AU7A 1PDQA 4FF3A 1X3PA 5F2DA 5FOBB 3OW7A 4KTAA 5EGTA 1A15A 1PRTC 4ME5A 3U9OA 2B63B 4RGNA 3A8IE 4A3IB 3N52A 2XNAC 3NHHA 2KEEA 5C0XH 4X3TA 2XWJB 1WD0A 4FXKC 2NTSA 3M4YA 3J81E 4KHZA 1DZ1A 1CHPD 3CKIB 2C9OA 1TS5A 2WV6D 4BY1B 2G9DA 2KCNA 3VA5A 2VXWA 2Z1CA 2A69C 3GTOB 1V43A 3ND8A 3SK5A 4B9XA 2N88A 4OO1H 2PCFB 1D5MC 5KYIA 4RKLA 2EY1A 4FP5D 3QOJA 1DM0B 1NR2A 4PMBA 1RODA 4ID6A 1EY0A 1KLUD 1CA5A 4JK1C 1PYWD 2L12A 4KJOA 2K7VA 4K6DA 1WTWA 4KKSA 5JVH3 1I4GA 1TU2B 5M5YB 4RGTA 4ABNA 1RCVD 2E2DC 1HA6A 3AB9A 2Q8TA 2M9VA 1QNUA 3HOWB 3I4LA 5DEHA 2B2UA 5IT9L 2HCIA 1AZPA 1WTPA 5C4ZA 4DF7A 4IURA 3A7AB 2TSSA 4RH6A 3HOYB 4RCOA 4DXFA 3BS1A 3ND9A 3TMEA 2NVQB 2RDFA 2FFKB 4ZYSA 3E5SA 5M3MB 3SK8A 1C48A 1F2YA 4DK0A 5M5WB 4K8IA 2NTTA 3A55A 4A3JB 2NYZD 3FPUB 3F2UA 1V1PB 5FO8B 4JBWA 5JOBA 1CA6A 1JR0D 2RSOA 3R93A 2KUMA 5IGEA 1STGA 3BG3A 1JQYD 2NN6I 4ZQ3A 1L0XB 5A35A 5A2QL 1H9KA 4XT3B 2EYJA 1S5ED 3P75A 3HS0C 3PO2B 1SYEA 1LTAD 1K83B 2F0OA 3G7LA 3NBHA 1FNUA 5EBDA 5T1IA 2B8FA 1II3A 3DEOA 1X3QA 4XYOA 4A3DB 2L0CA 2EJFC 1ZEQX 1SMYD 2QCPX 4IUTA 4ZUJA 1KDCA 1STHA 2J0TD 2E76C 1Y1WB 3OMGA 3X3NA 3J7AV 2RKSA 3HGBA 4ZKBB 1U4RA 1IW7C 3TP5A 1CQVA 2FMMA 4XYQA 1YNND 2B2WA 5CORA 4BWGB 1RDPD 4GZYC 2EZVA 3C3LA 5C0XG 5M9OA 1WCMB 1S5DD 3PO3B 4KY5A 2ENBA 5KGUA 3GQBA 2JA7B 4U673 4C3IG 4C3IB 2F3WA 1IYUA 4ZRZA 1BCPC 3EVQA 2JE6I 2AQ1B 3ONAB 1HQMC 3SXHA 3D4RA 1VF5C 1L0YB 4O42A 1U4MA 4YIJA 4U68A 5DM63 2Q8IB 2CW0D 1A2UA 1MGSA 2F4IA 1J9OA 1TKWB 4OO1G 2JYOA 5FO9B 1KNAA 1JORA 2OXPA 1CZWA 2F0MA 4TKOB 3RZOB 2SNMA 2PQEA 3EFXD 1EEID 3FEWX 5KNCA 4ULLA 1ET6A 1SYFA 4R8NA 1ZYRD 1SNMA 1SE3A 3T16A 4OIKA 3GTLB 2ZXOA 3RUZA 1AW7A 1Z47A 3Q6SA 4KI0A 5CV6A 4NKLA 4ZUIA 2NVXB 4TRDA 2K5DA 3S14B 1FNWA 1TVXA 1HA5A 1D5ZC 2G9HD 1YNJC 3GTGB 4HMIA 3MXNA 5C44B 1Z7TA 4KD3A 4IFDJ 3NUCA 2XSCA 3S1RB 3WOFA 3SEBA 1LTID 2ZXPA 2HUGA 1BQQT 2LS01 1NUCA 1TQOA 2PO4A 1WVLA 1I6VC 5IT9E 5I9OA 1T5EA 2EPBA 3KLRA 3PMFA 1Q8IA 4S3SA 4IALA 4IZ8A 2F0LA 1CFMA 4BY7B 2PPBC 3FKIB 1STEA 2EJMA 1RJTA 4KHVA 2DNEA 3WOEA 2PZUA 3CRLC 3DMUA 3FPPA 3PUXA 4I7ZC 4KV6A 1HUMA 3TP6A 1HFGA 3KLSX 4TQUS 5M3FB 2FMCA 4EVOA 1HHVA 1QCBD 1EFID 1PTOF 4L8JA 3DHQA 5G3LD 3K6OA 1Q3LA 3BDCA 1FYCA 4DNRB 4RGOS 2F0TA 4L6TB 5CMDA 5A2QE 3I3CA 2VB3X 3DWPA 1KABA 3HOVB 3RMHA 4KN4C 4K6LA 5ELEA 4ZK9B 5C6AA 2CQAA 3IFDA 1A3TA 3KF8A 5JEAH 4H7BA 3A8KE 3GTPB 3C1EA 2ICEC 4DAVA 1FR3A 4X3SA 4OGQC 5C3EB 1E2VA 2EE1A 4IFDH 5FK9C 1EYDA 5AFWA 1IKLA 1HRJA 5TSSA 4A3KB 2L55A 4HCEA 2BE5D 1KTKA 4M8AA 2F0KA 1AEXA 1OXXK 4C1NI 1U4PA 5K36H 2A73B 1WTVA 2DY8A 4KD4A 2IJ0A 3ITPA 2PW7A 1O7LA 1VF7A 4NMZA 4KKUA 3M3YB 1SXTA 2D5DA 3NQTA 4G7ZC 1JWMD 3BYTB 5T1GA 3D8GA 1QOHA 4L63B 1SFOB 3GP7A 2H1EA 1KNEA 2A6ED 2F0HA 3PUWA 3QG1A 1PFBA 3OPOA 2AUKA 1WTQA 2RDHA 3HG9A 4CJ1B 2QDBA 5C4JB 2XWBB 3R2IA 1K8OA 4MHEA 3MXUA 1EZ8A 1BCPF 2KEDA 3URYA 2L1BA 5NUCA 3MA2B 1EIGA 3VR6A 3MFYA 1Y8PB 5D65A 3M85A 2BOSA 1XTCD 4C3JG 4QUFA 3EA6A 3KUPA 4C3JB 2LY7A 3LWEA 2D62A 1LTSD 5CV4A 5EKKA 3OIQA 1AN8A 5C3XA 3K5LA 2F0VA 3NTKA 1IL8A 4TSSA 1EZ6A 4C2MB 3VYSA 3P1HA 1GUNA 3S1NB 1BF4A 1Q12A 1MD2D 4P2CB 2QILA 2B2VC 3BDLA 1XX8A 1VMCA 1PRTB 2AWOA 3K7AB 1D1KA 2A68D 1BO0A 1H9JA 5JPMC 4RGMA 1VCIA 1CQFA 4QUCA 1BOSA 2ZXRA 5LL6X 4KK7A 1PRTD 4X3UA 1QWYA 2RBMA 2F03A 4HAEA 5JJZA 3HKZB 4RHSA 2ID0A 4IQZA 2EYMA 4PMCA 5IGGA 1S4ZA 2N55A 2B8GA 3HOXB 4K2LA 3R2TA 5JEAG 1CM9A 2KOLA 3P20A 1NAPA 3HZXA 3S1QB 3I91A 5BN3A 5C5LA 3BVZA 1DONA 3J7AF 2KCCA 5JVG3 2O4XA 2O2LD 4IFDG 3LNNA 5IGFA 3RZDB 2A69D 1SEBD 1LT5D 2K04A 5LHY1 3MXGA 3VYUA 5FLXL 3E0JA 1HPCA 1LTGD 1ILQA 1PTOC 1M4VA 2IT1A 1DCZA 3GTJB 3R8BA 4H13C 3QWNA 3DWQA 1FD7D 1BR9A 5J1ZA 1A6XA 5K36G 1I4RA 1PZJD 2F0DA 3VYTA 1HQRD 2WAQB 1ICWA 2XRQD 1DOMA 1ESFA 1OXUA 4CHTB 4BBSB 1TR5A 1B53A 1GUWA 4E6IA 3K59A 3KBGA 5BN5A 3S16B 2NN6H 3KK7A 2EXZA 2A6HC 3HOUB 2K03A 2Y0SB 1SJED 2HCCA 3T4AC 3NXWA 1EYAA 2NUCA 3PUYA 2X6LA 1RD9D 2K28A 4V190 1G2SA 1E2WA 2WINB 2PMZB 1EEFD 2E2HB 3M7NA 2E2JB 5I2XA 1LLRD 2R3ZA 1B50A 2MJ8A 3H91A 1PXUA 1EQTA 3SK6A 2L4NA 3Q22A 5FO7B 1UAPA 2LMCB 2Z4HA 4RKBA 4PQXA 2FJ2A 4RWSC 1X32A 2ZT9C 4UDUC 1LT6D 3NWSA 4XTCS 2NZ1D 3TZDA 1BUVT 3H3VC 1EY5A 1EY4A 5CV8A 1QILA 1GHJA 2JP1A 4C3HB 2A5HA 4EQPA 3RLFA 1SE4A 5J22A 4HSPA 3TSSA 1OXTA 4QMGA 3GTKB 1S5BD 2NVYB 5ELDA 1SJHD 3IFTA 1IYVA 1B4OA 2RQXA 4DXGA 5E4WC 4NW2A 2F0UA 3J80L 3I72A 3GV6A 4EGVA 2K05A 1HTLD 1EQVA 1ESRA 3H0GB 4BA1I 2J7ZA 5ELBA 2PW5A 2WP8J 1CI3M 4CJ0B 3NTIA 5CYUA 1LACA 4XQQA 3SVMA 1IW7D 2QKIC 3M7GA 4LK1C 1LT4D 2PYKA 2PZTA 5CBEE 2VNUD 2MGSA 1BCPB 1PZKD 1LABA 1Y8NB 1SNCA 4CBVA 3K57A 4K2KA 2TMPA 1EL0A 3L3OC 1E0BA 1G291 3NPPA 1JE4A 2SNSA 2EVBA 2KVMA 2D2CC 4ZLTF 1IHZA 4K14A 5I2YA 2B2UC 5IGBA 2EY2A 5JEAJ 4KKTA 1EU3A 5E1FA 4EQNA 1S5FD 1B3AA 3VR5A 1O80A 2L5TA 2IL8A 4RAUC 5IIFA 3TBIB 4CGYB 4KJNA 2VB2X 1M8AA 5KNDA 5IGCA 1GUTA 1TWHB 3H94A 2WKCA 4G4KA 2MUYA 2R7ZB 4I65A 2F0FA 1KDAA 5FLXE 1BDOA 1F2MA 1H9SB 1NSNS 1HFNA 2NN6G 3C46A 4A3FB 1Q1BA 4A3EB 3MTSA 1BBXC 1STAA 3NWTA 1Y69U 1BXTA 4ZKCB 1EY8A 3VR2A 1ET9A 1YNJD 4R9WA 3TP8A 2AQ2B 1JWUD 3IAYA 5KNBA 4LJZC 2MP1A 3MFGA 2Z4IA 4QB4A 3C1FA 2OF1A 3A8JE 4ODGA 2RVLA 1TY2A 3M4OB 2HDLA 4CJ2C 3J81L 1D2BA 2R61A 2JEAI 5EPKA 4Q0FA 2KJXA 4Z9CB 5CGKA 1RKNA 1NCVA 3FDTA 1B1ZA 2CVRA 3V96A 2XIWA 1IKMA 1WTOA 3DM1A 3KBXA 1CHQD 1D1IA 1O7ZA 2AQ3B 2IX3A 1I4XA 1RTNA 2B2YC 1H9MA 3CU7A 5LL6S 3GO5A 1FGBD 2B2VA 3S17B 4OL7A 1W6JA 2K01A 3IL8A 3I90A 2E75C 3D3RA 3LX0A 2F1MA 3GTMB 1SAPA 2M2LA 2KECA 3PIP3 5C3WA 4DAYA 5FKAC 1I4HA 3P7JA 5E4XA 5IGDA 1ZKOA 3DEPA 1JCKB 4O1NA 1G8ZD 2K5QA 1G2TA 1SDFA 4Q5VA 4QIWB 1GXDC 3K58A 1WD1A 1G6ZA 3OSOA 5BN4A 2F0PA 2K33A 5ISRA 4QF4A 1CZGA 2YU9B 5EPJA 2C5CA 1I6HB 1B2TA 1A3VA 1UNSA 1PTOH 3H09A 4K5XA 2X69A 1LTBD 1HCZA 1R4PB 5E3FA 1JICA 1PZID 1UEAB 3SDZA 4IFDI 2A6EC 3HOZB 2B2TC 4X3KA 5CR3A 2XVSA 2QF7A 2IPKD 2F0JA 1D6EC 3K5OA 5J39A 3PV0A 3TDQA 1XXGA 2LKVA 3S15B 4PV1C 1B9MA 4DK1A 4F87A 4CKBA 4IUQA 2AWNA 2JXMB 2IW3A 4F88A 1SYDA 4HN7A 4B9WA 3I4MB 3MEHA 3FVQA 3K5MA 4XIGS 4A3GB 3QB3A 4R8IA 2F0EA 3VR3A 3CHBD 2JA6B 1RTOA 1TWFB 2EYFA 4DN4M 4H44C 2EOTA 3BZDB 5EPLA 3LWUA 1LTRD 3QJYA 1XYIA 1DOKA 1Q1EA 5M5XB 1NR4A 4IUUA 3L7ZC 4XXEA 1QG7A 5KEEA 1SE2A 1SNDA 5I6YA 1ENFA 4F8MA 3K5NA 3H6MA 1EYCA 3Q24A 4RA8A 1EOTA 1PFNA 2VUMB 2PNRC 2A68C 4A3BB 1WTXA 2L9HA 4K5WA 1S5CD 2MPMA 3V05A 2KHSA 3BVGA 5EKLA 1HTPA 1Y1VB 4FF2A 3A7LA 2Z8LA 4KMUC 3DUZA 1EY9A 3J7YW 5I4DA 1TIID 5KIXA 5K5PA 2HQEA 2O5IC 2K32A 1ONLA 4M1UB 3T51B 3A54A 1W6KA 1PMRA 4CKEA 4OHJA 5C0XI 3DXJC 4KN7C 1LV9A 1H9RA 1STNA 5KRUA 1F9PA 4DAPA 1TS2A 1LTTD 4C1NK 1AP0A 3GV3A 4FYDA 2XRSD 2EYLA 4K8JA 4WORA 5C4HA 1O78A 1HUNA 2EY5A 1I3QB 2H4OA 5G3LF 1EIHA 4Y7NB 1TT2A 3GD7A 3MZ5A 2DN8A 3NP8A 2SEBD 1STYA 3HP3A 1GUOA 1CK1A 2SOBA 4OO1I 5ELFA 3Q23A 1ENCA 1PFMA 4LAAA 3X3MA 4PMWA 5EJWA 3BVMA 2JEBI 5C4XB 4HR7B 4LMQD 3VR4A 3W3AA 3JAML 1PTOB 2A74C 1I50B 4DU9A 4BBRB 5HGTA 1DJRD 4A93B 4FF4A 3V2TA 3SR1A 3S2HB 5ELCA 2O5JC 5I9PA 1PTOD 4HEDA 3D4DA 3D6CA 5JAVA 1EY7A 2F0GA 3S2DB 1KDBA 3S9WA 3VA7A 1H9SA 1JOKA 2L11A 1MSHA 4J1MA 3CRKC 2CHBD 3VYRA 1A3UA 5CV5A 5EKIA 1SNPA 4J8QA 2QEJC 1SMYC 4WJWA 1MBYA 3MAQA 1VMPA 2PZWA 5C5MA 5I6WA 2F3VA 2LFNA 4NDXA 2YYZA 2F0QA 5DM73 1SNQA 2A6HD 4WFN3 4H0LC 1OO9B 1CTMA 2EYOA 3QOLA 4BS9A 3EROA 1AZQA 1SYBA 1C8CA 3MWYW 1ZXTA 3FRPB 1RHPA 3D31A 4G7HC 1YNNC 4C3HG 2EYPA 4G7OC 2KA7A 5DNFA 1F9QA 2D9UA 3PIO3 1MSGA 3GTQB 3OHXC 3NBIA 3QO2A 2JA5B 2EDGA 2OT2A 5DAUA 4WRDA 1U9RA 2X6GA 1F2ZA 3L9AX 3CQZB 2JSOA 2AUJD 2JA8B 4DGZA 2B2YA 4B08A 4XT1B 3OIPA 2EJGC 2KQ3A 4PNYA 4N9PA 3NK9A 4XQNA 2BDNA 1VDZA 1EWCA 3MC0B 4CKCA 5KYLA 2CW0C 4FVMA 1KLGD 1K8MA 1C4QA 1DD2A 1FNVA 2B39A 2RA4A 1E2ZA 3I4NB 4BA2I 2I07B 1ENAA 3C2PA 1SYGA 4DNTB 3SK4A 2ICIA 3N6RA 1ZYRC 1WTRA 2SDFA 3TZUA 2NVTB 2E2IB 3HRZC 1TWGB 4KY6A 4AYBB 2NB0A 3S1MB 5CC4A 1BCPD 1GHKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QNK A;  1SAP A;  4OIJ A;  4DN4 M;  2M2L A;  2NYZ D;  2EPB A;  3FPU B;  2KEC A;  1IL8 A;  3F2U A;  1DZ1 A;  1M8A A;  2EOT A;  4MN3 A;  4IUV A;  1HUN A;  2DY7 A;  2NWG A;  3ONA B;  5EPL A;  1SSO A;  1DOL A;  1AZQ A;  1U4P A;  4HSV A;  1CA6 A;  1B4O A;  1C8C A;  3MWY W;  1EIH A;  2RSO A;  3R93 A;  1ZXT A;  1XYI A;  1DOK A;  1ILP A;  5E4W C;  4XDX A;  2KUM A;  1G91 A;  4O42 A;  1WTV A;  4NW2 A;  1RHP A;  2B2W C;  2DY8 A;  1F9S A;  3P7J A;  1MI2 A;  1BF4 A;  1NR4 A;  2B2V C;  1DON A;  1ICW A;  1XX8 A;  3D6W A;  5E4X A;  1U4M A;  3HP3 A;  1DOM A;  4IUU A;  3GV6 A;  1VMC A;  2VXW A;  4U68 A;  2B2T A;  5DNF A;  4ZLT F;  1QG7 A;  2K05 A;  1RJT A;  3DEP A;  1F9Q A;  1B53 A;  1PFM A;  2D9U A;  1MGS A;  1G2T A;  1SDF A;  1J9O A;  1GUW A;  1HFN A;  1MSG A;  4XT3 B;  1BO0 A;  4RA8 A;  1ESR A;  5EJW A;  2FIN B;  3MTS A;  1HUM A;  1WD1 A;  1BNZ A;  1G6Z A;  1HFG A;  2N88 A;  2JYO A;  1EOT A;  5COY A;  5T1G A;  1BBX C;  3QO2 A;  1HHV A;  1KNA A;  1PFN A;  2J7Z A;  1QE6 A;  4IUP A;  5EPJ A;  1F9R A;  4LMQ D;  2H1E A;  4ZKC B;  3G7L A;  1KNE A;  1U4L A;  1WTX A;  2L9H A;  1NR2 A;  4CJ0 B;  2K03 A;  1B2T A;  5T1I A;  4QUC A;  4R9W A;  3SVM A;  2X6G A;  2MPM A;  2X69 A;  1Q3L A;  1ROD A;  2HCC A;  5EQ0 A;  3DEO A;  4HCS A;  2MP1 A;  1JIC A;  5CBE E;  1X3Q A;  4X3U A;  2B2Y A;  1O7Y A;  2X6L A;  2MGS A;  4XT1 B;  1CA5 A;  1PFB A;  2HDM A;  5CMD A;  2RVL A;  1PLF A;  3I3C A;  4HAE A;  5JJZ A;  2K28 A;  2HDL A;  4CJ2 C;  1G2S A;  2L12 A;  1WTQ A;  1WTW A;  4UAI A;  2B2T C;  2BDN A;  4IUT A;  5EPK A;  4X3K A;  2RSN A;  4CJ1 B;  4OIK A;  1EL0 A;  4ZK9 B;  1S4Z A;  3UI2 A;  2N55 A;  1WTR A;  3Q6S A;  1NCV A;  4MHE A;  3FDT A;  1E0B A;  2R3Z A;  4HED A;  1B50 A;  2Q8T A;  2MJ8 A;  1HA6 A;  3H91 A;  3IFD A;  1EQT A;  1CM9 A;  1TVX A;  1JE4 A;  1PDQ A;  2CVR A;  2KOL A;  2L4N A;  1X3P A;  2KED A;  2XIW A;  1NAP A;  2KVM A;  1IKM A;  1WTO A;  4ZKB B;  3DM1 A;  3I91 A;  3KBX A;  1U4R A;  2L1B A;  1O7Z A;  3I8Z A;  4IUQ A;  1J8I A;  2FJ2 A;  2B2U A;  2FHT A;  4RWS C;  4X3S A;  1RTN A;  1X32 A;  2RA4 A;  1EIG A;  2K1B A;  2L11 A;  2HCI A;  1A15 A;  1MSH A;  1WTP A;  3TN2 A;  2FMM A;  1AZP A;  2B2Y C;  1ML0 D;  4IUR A;  5D65 A;  1F2L A;  2B2W A;  2B2U C;  5COR A;  2NZ1 D;  3TZD A;  2B2V A;  1LV9 A;  5EKI A;  2HUG A;  2EE1 A;  3N52 A;  2K01 A;  4QUF A;  3KUP A;  1F9P A;  2KEE A;  2FFK B;  4X3T A;  4R8I A;  5AFW A;  1B3A A;  1VMP A;  1IKL A;  1O80 A;  2Q8R E;  2SDF A;  2K04 A;  3IL8 A;  3LWE A;  5D14 A;  1WVL A;  1WD0 A;  2JP1 A;  3I90 A;  1HRJ A;  2IL8 A;  5CBA E;  4RAU C;  1AP0 A;  3GV3 A;  1RTO A;  4ZAI A;  1ILQ A; 
#chains in the Genus database with same CATH topology
 3MXP A;  2I0Q A;  1N33 L;  2WAC A;  1N8R C;  4X65 Q;  4MN3 A;  3F2B A;  4LUO A;  1BVS A;  2DY7 A;  2NWG A;  1TS3 A;  1SSO A;  1XNR Q;  5D3I B;  1HXY D;  4GN3 B;  2WII B;  2K5W A;  2NBF A;  1Z6H A;  1GUS A;  1G91 A;  2I46 A;  4P74 A;  2CCZ A;  3NTH A;  3I55 A;  1PRT F;  3AMU A;  2R6G A;  3D6W A;  2Z9H A;  3ERQ A;  2B2T A;  5CV9 A;  4L5T A;  2EYH A;  1HNX Q;  2BCO A;  2F4V L;  1OXV A;  5JPN C;  1JB3 A;  2UUA L;  3KFU A;  3A56 A;  1BNZ A;  3RD4 A;  1QE6 A;  2A19 A;  2F0S A;  1F9R A;  4DFA A;  1VQI A;  1Y14 B;  2R92 G;  4DV0 Q;  3H15 A;  2R92 B;  2BA0 A;  2OEO A;  4HCS A;  1EY6 A;  3KF6 A;  4ILW A;  5LMN W;  1O7Y A;  3QIA A;  3WDN A;  2HDM A;  3T53 B;  4IN3 A;  2M00 A;  1D5X C;  1LT3 D;  4P73 A;  3EJI A;  5IP9 G;  2UU9 L;  4J6H A;  3FMC A;  3UI2 A;  1SN8 A;  4KLK A;  1WFQ A;  3JAM E;  1IBK Q;  2BA1 A;  5D3D A;  3TP7 A;  3R3O A;  1IBM L;  2IHE A;  4LF9 Q;  2F0N A;  1Y8O B;  5EAY A;  1JT8 A;  4UHV A;  3I8Z A;  4A3C G;  3SE0 A;  3OMC A;  1J8I A;  1VQ8 A;  2FHT A;  2K1B A;  4RCN A;  5GAG C;  3TN2 A;  2BDO A;  1ML0 D;  3NQI A;  1VQK A;  1F77 A;  4A3M B;  1NBW A;  3FHW A;  2EY6 A;  2B63 H;  4A3I H;  4NXN L;  1GOZ A;  2MHV A;  2UXC L;  4DK6 C;  2GA4 B;  3PUV A;  2RHS B;  5D14 A;  2ZJQ A;  2K6A A;  2DJG C;  3EQL C;  1R9T B;  1L1O C;  1N33 Q;  3BYY B;  1KQS A;  2QGQ A;  3I70 A;  4K5V A;  4C56 C;  3DWA A;  4OIJ A;  2K5V A;  3I2Z A;  4KY7 A;  4WJ4 A;  2GN5 A;  2K5H A;  1DOL A;  1EIF A;  4BY1 H;  2IX1 A;  4HSV A;  4IUN A;  2QDL A;  1XMQ Q;  2RHQ B;  4B3T Q;  1BKB A;  4DV4 L;  4DUZ Q;  1TWA B;  2B2W C;  4NP5 A;  4JCV E;  3E6Z X;  3IKJ A;  1VS0 A;  3O13 A;  2D0O A;  4FNF A;  2WKD A;  1S72 A;  3GTO H;  2UUA Q;  1VQP A;  4HMJ A;  3PQI A;  1R4Q B;  1OXS C;  5COY A;  2R93 G;  2BE5 C;  3D4W A;  1N34 Q;  5IOC A;  1S40 A;  1XWE A;  3ER0 A;  4X62 L;  3PSI A;  2R93 B;  3HEJ A;  1U4L A;  4LFA L;  1TWC B;  4G57 A;  1Q90 A;  3SHL A;  3I73 A;  5HUR A;  5CV7 A;  1X3G A;  3NE5 B;  1HR0 W;  4ZCK A;  1PLF A;  2IX0 A;  3CW2 C;  4Y52 H;  4PG3 A;  2PQA B;  3OWF A;  1KAA A;  1I4Q A;  2RSN A;  5M5Y H;  1EU4 A;  5FLX c;  3G6J B;  4XQJ A;  3G4S A;  1A2T A;  5JJL A;  3EN2 A;  4FO2 A;  2CH4 W;  3MHB A;  3OWE B;  3J80 E;  4HTH A;  1BBU A;  3HOW H;  1SBB B;  4UP8 A;  3CC4 A;  4RHR A;  4A93 H;  3Q0A A;  1N32 Q;  2MNA A;  1G6P A;  3OW2 A;  3RLN A;  3MVV A;  5C0X J;  1HZB A;  1TS4 A;  2PI2 E;  3CP0 A;  1GUG A;  3HOY H;  1F2L A;  2GVA A;  1I4P A;  3T56 B;  2NVQ H;  1SYC A;  1TY0 A;  1JOO A;  1AH9 A;  3OOC A;  3STB C;  3PUZ A;  1EWH A;  2Q8R E;  4QGU A;  5M3M H;  1NE3 A;  4DA2 A;  3PF5 A;  1QJO A;  3ZYY X;  5CBA E;  5M5W H;  2F0W A;  4V0B A;  1DYQ A;  2R7D A;  3T13 A;  4ZAI A;  1QNK A;  5IOD A;  4A3J H;  1JWS D;  1SNO A;  1T5X D;  2CFM A;  3EBE A;  1V8Q A;  2F0I A;  1STB A;  1GJX A;  1B9N A;  5L37 A;  3CF5 A;  2EIF A;  2OCE A;  1RF2 D;  3U9S A;  2XN9 C;  4IUV A;  3I4M G;  1B8A A;  4RFB A;  2KEN A;  4GOP A;  2J4X A;  4DV4 Q;  1B44 D;  2IWH A;  1ILP A;  4XDX A;  4YY3 L;  2ES2 A;  4QCL A;  4QL5 A;  1JC7 A;  1F9S A;  1MI2 A;  4FF1 A;  4F7X A;  4DR4 L;  4HJ9 A;  1K0R A;  2ZTC A;  1YNX A;  4JBM A;  1P16 A;  4HJA A;  1QB5 D;  1HNZ L;  2E74 C;  1JOQ A;  2RDG A;  3MXN B;  2OTJ A;  1V1P A;  1XNQ L;  4FXG C;  2FIN B;  4POG A;  3PO2 H;  4IUP A;  1AFP A;  1K83 H;  2DNC A;  2N78 A;  4N9T A;  5EBC A;  1LO5 D;  1DXM A;  3W2D A;  2WB1 G;  3K0Y A;  3NSW A;  5EQ0 A;  4HIK A;  2WB1 B;  4A3D H;  4MIU A;  4X66 L;  1SLJ A;  1JB7 A;  2HHH L;  4B3M Q;  4UAI A;  4GKJ L;  4R4C A;  3BDO A;  4FXD A;  3KDF A;  4DV5 L;  3KLS A;  3E9H A;  1CSP A;  1Y1W H;  1UUP A;  4EQO A;  2V4D A;  1V1O A;  1CT1 D;  3AU7 A;  1PDQ A;  4FF3 A;  1X3P A;  4DR2 L;  2LXJ A;  5F2D A;  5FOB B;  3OW7 A;  4KTA A;  3TQY A;  3SGI A;  5EGT A;  4JI4 L;  1A15 A;  3CCV A;  3J80 c;  1PRT C;  4ME5 A;  4A3I G;  3U9O A;  2B63 B;  4RGN A;  3A8I E;  3PIP A;  4A3I B;  4J15 A;  1UE1 A;  3N52 A;  2XNA C;  4YHH Q;  3NHH A;  1WCM H;  4X64 Q;  1V1Q A;  2KEE A;  4X3T A;  2XWJ B;  4R4O A;  5C0X H;  4LF5 L;  3PO3 H;  5LMN L;  3H3V I;  1WD0 A;  2JA7 H;  2BH2 A;  4FXK C;  2NTS A;  3M4Y A;  3J81 E;  4C3I H;  3CXC A;  4EX5 A;  4CDC C;  4KHZ A;  1DZ1 A;  1CHP D;  4BY1 G;  4JI2 L;  3CKI B;  1N36 L;  2C9O A;  3RLO A;  1VQG A;  1TS5 A;  2WV6 D;  4BY1 B;  2YTV A;  4YY3 Q;  1FVI A;  2G9D A;  4DR4 Q;  2KCN A;  4KHP L;  1KL9 A;  1MHW C;  3KF8 B;  3VA5 A;  4ALP A;  1EYG A;  2VXW A;  2Z1C A;  4LFC Q;  2A69 C;  1PA6 A;  1PH3 A;  3GTO B;  3CPF A;  1V43 A;  5BR8 L;  3ND8 A;  3SK5 A;  2UXB Q;  3OYY A;  4B9X A;  2N88 A;  1LYL A;  4OO1 H;  4DV1 Q;  2PCF B;  4OEM B;  1D5M C;  4NXM L;  5KYI A;  4RKL A;  2EY1 A;  4FP5 D;  3QOJ A;  1KC8 C;  1DM0 B;  1NR2 A;  4PMB A;  1RIP A;  3U50 C;  1ROD A;  4ID6 A;  4JI5 Q;  3RZO H;  1VQJ A;  1EY0 A;  3CCS A;  1KLU D;  1CA5 A;  1VQ6 A;  4JK1 C;  1PYW D;  3CC7 A;  5IE8 A;  2L12 A;  4KJO A;  2K7V A;  4K6D A;  1WTW A;  4KKS A;  5JVH 3;  1H95 A;  1I4G A;  1TU2 B;  3GTL H;  5M5Y B;  4RGT A;  4ABN A;  3PGZ A;  3T1Y L;  1G51 A;  1D8L A;  1RCV D;  2E2D C;  4UY8 C;  1HA6 A;  1KAW A;  3AB9 A;  2Q8T A;  4JVZ A;  2NVX H;  2M9V A;  3ZJY C;  3HOW G;  3S14 H;  1QNU A;  3HOW B;  3WWV A;  5IYC H;  3UDG A;  4A93 G;  3F2D A;  3I4L A;  5DEH A;  3GTG H;  2B2U A;  5IT9 L;  5C44 H;  1YHA A;  2HCI A;  1AZP A;  1WTP A;  5C4Z A;  2YTX A;  4DF7 A;  4IUR A;  4DPG A;  2KCT A;  3S1R H;  3A7A B;  2TSS A;  4RH6 A;  3HOY B;  4RCO A;  4DXF A;  2VQF Q;  3BS1 A;  3ND9 A;  3TME A;  2NVQ B;  2RDF A;  5IWA Q;  2UUC Q;  2WAQ E;  5M3M G;  2FFK B;  4ZYS A;  3E5S A;  5M3M B;  3SK8 A;  3K0X A;  1C48 A;  1F2Y A;  4DK0 A;  5M5W B;  1GKH A;  4K8I A;  4YCW A;  4A3J G;  2NTT A;  2R7F A;  1EWI A;  3A55 A;  4A3J B;  3UE0 A;  1B7Y B;  2NYZ D;  3FPU B;  3F2U A;  1V1P B;  3I7F A;  5FO8 B;  4X6A H;  2Y0S E;  4JBW A;  5JOB A;  1CA6 A;  4YWL A;  4KHP Q;  1JR0 D;  2RSO A;  3R93 A;  3J81 c;  2KUM A;  1YZ6 A;  2Q2I A;  5IGE A;  4IJH A;  5ELO A;  3U4V A;  1STG A;  3BG3 A;  4BY7 H;  1JQY D;  2NN6 I;  3FKI H;  4DUY L;  4ZQ3 A;  3CC2 A;  1L0X B;  3AFQ A;  2PMZ E;  3CD6 A;  1GM5 A;  5A35 A;  1EUJ A;  4DAM A;  5A2Q L;  1H9K A;  1M1K C;  4XT3 B;  2EYJ A;  5M3F H;  1S5E D;  3P75 A;  3HS0 C;  3ULJ A;  3PO2 B;  1SYE A;  4X65 L;  3ULL A;  3KDF B;  2IHF A;  1LTA D;  1K83 B;  2F0O A;  3G7L A;  3NBH A;  1FNU A;  5EBD A;  2WFW A;  1XNR L;  5T1I A;  1IZ6 A;  1CUK A;  2B8F A;  4DNI A;  1II3 A;  4A3D G;  3DEO A;  4L5S A;  1X3Q A;  4XYO A;  4A3D B;  2L0C A;  1MJE A;  2EJF C;  1ZEQ X;  3ULP A;  3HOV H;  1Q8K A;  1SMY D;  1HNX L;  2QCP X;  3AFP A;  1HZA A;  4IUT A;  3LGJ A;  3E9I A;  4ZUJ A;  4HJ7 A;  1IBL L;  1KDC A;  1STH A;  1Y1W G;  2J0T D;  3CCU A;  2E76 C;  2ZJR A;  4L5Q A;  1Y1W B;  4CDD C;  1GO3 E;  3OMG A;  3X3N A;  3J7A V;  2RKS A;  4DV0 L;  3U4Z A;  4A75 A;  3GTP H;  2Q2T A;  4JC0 A;  3HGB A;  4ZKB B;  1NJI C;  1U4R A;  4RMF A;  1IW7 C;  3TP5 A;  1CQV A;  2FMM A;  4XYQ A;  1YNN D;  2B2W A;  5COR A;  4BWG B;  1RDP D;  5C3E H;  4HID A;  4GZY C;  2EZV A;  3C3L A;  1A8V A;  5C0X G;  5M9O A;  3PO3 G;  1WCM B;  1CKM A;  1S5D D;  2MO0 A;  4LWC A;  3PO3 B;  5JJK A;  3RR5 A;  2JA7 G;  4KY5 A;  2ENB A;  5KGU A;  4A3K H;  3GQB A;  2JA7 B;  1MJC A;  4U67 3;  4C3I G;  4LF9 L;  4C3I B;  1QZG A;  2F3W A;  2PQA A;  1IYU A;  4ZRZ A;  3EVQ A;  1BCP C;  2JE6 I;  2AQ1 B;  1BBW A;  3ONA B;  1HQM C;  3SXH A;  4GN5 A;  3D4R A;  1S3O A;  1VF5 C;  1L0Y B;  1NNX A;  3KJO A;  4O42 A;  4P71 A;  2LXK A;  2JJQ A;  1U4M A;  4A76 A;  1PFS A;  4YIJ A;  4U68 A;  4A3L H;  5DM6 3;  2Q8I B;  4JI1 Q;  3TS2 A;  2CW0 D;  1HH2 P;  1A2U A;  1MGS A;  3M3Y H;  2F4I A;  1J9O A;  2MO1 A;  1AE2 A;  1TKW B;  4PZ7 A;  4OO1 G;  1HZ9 A;  2JYO A;  1KRS A;  1YVC A;  5FO9 B;  1KNA A;  1CKN B;  1SFO H;  1JOR A;  2MQH A;  2OXP A;  2XGT A;  1CZW A;  1YI2 A;  3G48 A;  5E7N A;  2F0M A;  4TKO B;  1J5E Q;  1XMQ L;  1SE8 A;  5ELN A;  4QQB X;  4B3T L;  3RZO B;  2SNM A;  4DV3 Q;  2PQE A;  4DUZ L;  4IPG A;  3EFX D;  1EEI D;  3FEW X;  4TVA B;  4ULL A;  5KNC A;  1E1T A;  1ET6 A;  1SYF A;  4R8N A;  1ZYR D;  2AKW B;  1IBL Q;  1SNM A;  1SE3 A;  3T16 A;  4OIK A;  3GTL B;  2ZXO A;  3RUZ A;  3W5O A;  2V1C C;  5C4J H;  1AW7 A;  1XJV A;  1Z47 A;  3TRZ A;  3Q6S A;  4DV7 Q;  4KI0 A;  1N34 L;  5CV6 A;  4NKL A;  4ZUI A;  2NVX B;  4TRD A;  2K5D A;  3S14 B;  1FNW A;  2UUB L;  1TVX A;  5IYC G;  1HA5 A;  4JI8 Q;  1D5Z C;  1E24 A;  4UP9 A;  2G9H D;  5C44 G;  1YNJ C;  3M9B A;  3GTG B;  4HMI A;  3MXN A;  5C44 B;  1QUQ B;  1Z7T A;  4KD3 A;  4IFD J;  3NUC A;  2XSC A;  1GVP A;  1V9P A;  3S1R B;  3WOF A;  4JI7 Q;  3SEB A;  1LTI D;  2ZXP A;  2HUG A;  1E7Z A;  1BQQ T;  2LS0 1;  1NUC A;  4C3J H;  4JG2 A;  2GVB A;  2N3S A;  1TQO A;  2PO4 A;  1WVL A;  1N9W A;  1UEB A;  3RN2 A;  1I6V C;  1X3E A;  3PIO A;  5IY0 A;  5IT9 E;  5I9O A;  3A0J A;  4MNO A;  1T5E A;  2EPB A;  3KLR A;  4A3M G;  1XTD A;  4OON A;  4GKK Q;  1N32 L;  4C2M H;  1U0L A;  3PMF A;  1Q8I A;  4S3S A;  3S1N H;  4IAL A;  3NBH B;  3PCO B;  5JJI A;  1WI5 A;  4IZ8 A;  2F0L A;  3FKI G;  1CFM A;  3J80 i;  1VQN A;  4BY7 B;  2PPB C;  3FKI B;  4MTN A;  1STE A;  2EJM A;  1RJT A;  4KHV A;  2DNE A;  3WOE A;  2CWA A;  2PZU A;  3CRL C;  3DMU A;  3FPP A;  5M3F G;  1JJG A;  3PUX A;  4I7Z C;  4KV6 A;  1HUM A;  3TP6 A;  1HFG A;  3KLS X;  4TQU S;  5M3F B;  4IPD A;  2FMC A;  4AH6 A;  4EVO A;  5IYB H;  1QCB D;  1HHV A;  1VQB A;  1EFI D;  1PTO F;  4L8J A;  5GAE C;  3DHQ A;  5G3L D;  1L1O B;  3K6O A;  4APV A;  1Q3L A;  1HNW L;  3BDC A;  1FYC A;  4DNR B;  2EXD A;  4RGO S;  2F0T A;  4O2D A;  4L6T B;  5CMD A;  5A2Q E;  3I3C A;  2VB3 X;  3DWP A;  1KAB A;  3HOV B;  3RMH A;  2Z0S A;  5AJ3 Q;  4KN4 C;  1KIX A;  4K6L A;  2C35 B;  5ELE A;  4ZK9 B;  5C6A A;  2N8N A;  1WTH A;  4JI6 Q;  2CQA A;  2UUB Q;  3IFD A;  1A3T A;  1VQ9 A;  2KCM A;  3KF8 A;  2ASB A;  5JEA H;  4H7B A;  3A8K E;  3S1Q H;  3GTP B;  3C1E A;  2ICE C;  4DAV A;  4HJ5 A;  1MIU A;  1FR3 A;  4X3S A;  3BU2 A;  4OGQ C;  3E3X A;  5C3E G;  4B3M L;  5C3E B;  1E2V A;  2EE1 A;  5LMU Q;  3ICE A;  3RZD H;  4IFD H;  4N8X 1;  3CAM A;  5FK9 C;  1EYD A;  1SRU A;  5AFW A;  1IKL A;  4A3K G;  1PH2 A;  1PH5 A;  2I5M X;  1HRJ A;  4B3R L;  5TSS A;  5J3B A;  4A3K B;  2L55 A;  3BZC A;  4QIW E;  4HCE A;  2BE5 D;  3GTJ H;  1KTK A;  4M8A A;  1C9O A;  4DR6 Q;  3JAM c;  2F0K A;  5IP7 H;  1AEX A;  1OXX K;  4C1N I;  3G71 A;  1U4P A;  5K36 H;  2A73 B;  1WTV A;  4ME3 A;  2DY8 A;  4KD4 A;  4YHH L;  4X64 L;  2IJ0 A;  3ITP A;  2PW7 A;  4A3L G;  2G5D A;  1O7L A;  1VF7 A;  1L0W A;  1PHJ A;  4NMZ A;  4BBS H;  4KKU A;  1ICF B;  1VQC A;  3M3Y B;  1SXT A;  2D5D A;  3NQT A;  1QVG A;  4G7Z C;  1JWM D;  3S16 H;  3BYT B;  5T1G A;  1PYB A;  3D8G A;  1QOH A;  4L63 B;  1SFO B;  3GP7 A;  2H1E A;  3HOU H;  1KNE A;  1HNW Q;  2Z6K C;  2YV5 A;  1Q82 C;  1QVF A;  4JOI A;  2A6E D;  2OTL A;  4QJF A;  2F0H A;  3PUW A;  3QG1 A;  1PFB A;  3OPO A;  3K80 C;  2AUK A;  3J81 i;  1WTQ A;  4LFC L;  2RDH A;  3STB D;  1U5K A;  3HG9 A;  2E2H H;  4I7A A;  1YJN A;  4CJ1 B;  2QDB A;  2HIV A;  1PV4 A;  2E2J H;  2UXB L;  5C4J B;  2XWB B;  3R2I A;  4DV1 L;  1K8O A;  4MHE A;  3MXU A;  5GAD C;  1XMO Q;  1EZ8 A;  1BCP F;  2KED A;  3URY A;  1VQA A;  4JI5 L;  2L1B A;  5NUC A;  5GRO A;  4JV5 Q;  3MA2 B;  1EIG A;  3F8T A;  2L15 A;  3VR6 A;  1MKH A;  1Y8P B;  3MFY A;  4K0K Q;  2OWO A;  5D65 A;  3M85 A;  1YJ9 A;  2BOS A;  4R1J A;  1XTC D;  3K8A A;  4C3J G;  4QUF A;  3EA6 A;  3KUP A;  3E0E A;  4C3J B;  3DM3 A;  1JJ2 A;  4B3R Q;  2LY7 A;  1L2F A;  3LWE A;  1E3P A;  2D62 A;  4B3S Q;  3W1G A;  1LTS D;  5CV4 A;  5EKK A;  3OIQ A;  1AN8 A;  5C3X A;  3K5L A;  2F0V A;  3NTK A;  3H3V H;  1IL8 A;  1K3R A;  1VQE A;  2B63 G;  4TSS A;  3GTK H;  2NVY H;  1EZ6 A;  4C2M B;  1C0A A;  3VYS A;  3P1H A;  1GUN A;  1VQO A;  3S1N B;  2VQF L;  1BF4 A;  1Q12 A;  1MD2 D;  4P2C B;  3F2C A;  2QIL A;  2B2V C;  5IWA L;  2UUC L;  1YEZ A;  3BDL A;  1AE3 A;  1XX8 A;  4LF6 Q;  1VMC A;  1PRT B;  2AWO A;  3K7A B;  1KXL A;  1D1K A;  2A68 D;  1BO0 A;  3H0G H;  5IYB G;  4AQY Q;  1C7Y A;  1H9J A;  2KHJ A;  5JPM C;  4RGM A;  1VCI A;  1CQF A;  4QUC A;  1BOS A;  2ZXR A;  2CKZ B;  3HFZ B;  5LL6 X;  4KK7 A;  1PRT D;  4X3U A;  1QWY A;  2RBM A;  3HKZ E;  2F03 A;  4HAE A;  5JJZ A;  3HKZ B;  4RHS A;  1X6O A;  2ID0 A;  4IQZ A;  1X56 A;  2QW7 A;  2VL6 A;  2EYM A;  4OWX B;  3ERS X;  3M4Q A;  1CSQ A;  4PMC A;  5IGG A;  1S4Z A;  1Q86 C;  2N55 A;  5DLQ E;  2B8G A;  3HOX B;  4K2L A;  3R2T A;  5JEA G;  1CM9 A;  2KOL A;  3P20 A;  4L5R C;  1NAP A;  3HZX A;  3S1Q B;  3I91 A;  5BN3 A;  2CWP A;  5C5L A;  4HJ8 A;  3BVZ A;  2E5L Q;  1DON A;  3J7A F;  2KCC A;  2I5H A;  5JVG 3;  4OWT B;  4IOA A;  2O4X A;  4FDB A;  1CKN A;  2O2L D;  1GD7 A;  4IFD G;  3LNN A;  5IGF A;  2AHO B;  3RZD B;  2A69 D;  1SEB D;  4R4T A;  5FLM H;  1X55 A;  1LT5 D;  2K04 A;  5LHY 1;  3MXG A;  2ZM6 Q;  3VYU A;  1K0S A;  5FLX L;  3E0J A;  1HPC A;  1LTG D;  1YHB A;  3KOJ A;  1K73 C;  1ILQ A;  1M4V A;  1PTO C;  2IT1 A;  4GLA C;  1DCZ A;  4OXP A;  5IP7 G;  3GTJ B;  1HZC A;  4IPH A;  3R8B A;  3I56 A;  4H13 C;  3QWN A;  3HOY G;  4LFB Q;  3DWQ A;  1FD7 D;  1BR9 A;  1WYD A;  5J1Z A;  1W2B A;  1A6X A;  5K36 G;  1TWH H;  1ASY A;  1I4R A;  1PZJ D;  2F0D A;  2WAQ G;  2R7Z H;  3VYT A;  1HQR D;  2WAQ B;  1ICW A;  2XRQ D;  3CCJ A;  1DOM A;  4BBS G;  1ESF A;  1OXU A;  1XPR A;  4CHT B;  4BBS B;  1TR5 A;  1B53 A;  1I5F A;  4O0A A;  1GUW A;  4E6I A;  1QUQ A;  4A3F H;  3K59 A;  4JBJ A;  3KBG A;  4A3E H;  5BN5 A;  2VQE Q;  1JMC A;  3S16 B;  2NN6 H;  3AYH B;  3T1H L;  3KK7 A;  1A62 A;  3HOU G;  2EXZ A;  2A6H C;  2Y0S G;  3HOU B;  2K03 A;  2Y0S B;  1SJE D;  2HCC A;  3T4A C;  3NXW A;  1EYA A;  2NUC A;  2JQO A;  3PUY A;  2X6L A;  1RD9 D;  1IL2 A;  3M4O H;  2K28 A;  1T9H A;  4V19 0;  1SR3 A;  1VQD A;  1G2S A;  1E2W A;  2WIN B;  2PMZ B;  3OTO Q;  4JI1 L;  1EEF D;  2E2H B;  3M7N A;  3PO2 G;  2E2J B;  3EIV A;  5I2X A;  1LLR D;  2R3Z A;  1PH8 A;  1B50 A;  2MJ8 A;  3H91 A;  1PXU A;  1E1O A;  1EQT A;  1HJP A;  3SK6 A;  4R4I A;  1EQQ A;  2L4N A;  4JW0 A;  3Q22 A;  1DGS A;  5FO7 B;  1J5E L;  1UAP A;  2LMC B;  2Z4H A;  1EIY B;  4DV3 L;  4RKB A;  4PQX A;  2FJ2 A;  4RWS C;  1JJC B;  1X32 A;  1O7I A;  2ZT9 C;  4UDU C;  1LT6 D;  3NWS A;  3FP9 A;  4XTC S;  2NZ1 D;  3TZD A;  3TS0 A;  3S17 H;  4WJ3 M;  1BUV T;  2CH4 A;  4CDE C;  1EY5 A;  3H3V C;  1EY4 A;  5CV8 A;  1L1O A;  1QIL A;  1GHJ A;  4DV7 L;  3CPW A;  2JP1 A;  4C3H B;  2A5H A;  4DKA C;  4EQP A;  4YCV A;  4GLV B;  1FJG Q;  4JI8 L;  3RLF A;  1SE4 A;  3PF4 A;  5J22 A;  3GTM H;  4HSP A;  3TSS A;  1OXT A;  4QMG A;  3RN5 A;  4A4I A;  3Q8D A;  2F52 A;  1FGU A;  1S5B D;  3GTK B;  2NVY B;  5ELD A;  1SJH D;  3IFT A;  1PH1 A;  1IYV A;  1EQR A;  1B4O A;  1WCM G;  4JI7 L;  2RQX A;  4DXG A;  5IYD H;  4JYA Q;  5E4W C;  3HKS A;  2FXQ A;  4NW2 A;  1FL0 A;  2F0U A;  3J80 L;  3I72 A;  2RCF A;  4H02 A;  3GV6 A;  4EGV A;  3GDE A;  2K05 A;  3H0G G;  3T1H Q;  1HTL D;  1EQV A;  1ESR A;  3H0G B;  4BA1 I;  2ZJP A;  2IY5 B;  3NEN A;  2QA4 A;  2YU9 H;  2J7Z A;  4GKK L;  1I6H H;  3AQQ A;  5ELB A;  4DV2 Q;  2PW5 A;  2WP8 J;  1HR0 Q;  1CI3 M;  4CJ0 B;  3NTI A;  5CYU A;  1LAC A;  4XQQ A;  3W1B A;  1IW7 D;  3SVM A;  2QKI C;  3JAM i;  3M7G A;  4LK1 C;  1LT4 D;  1NMG A;  2PYK A;  2PZT A;  5CBE E;  2VNU D;  2MGS A;  1YIT A;  1BCP B;  4DK3 C;  1K8G A;  3HOZ H;  4P72 A;  1PZK D;  1LAB A;  1Y8N B;  1SNC A;  4CBV A;  3NEM A;  2AMC B;  3K57 A;  4K2K A;  2D0P A;  2TMP A;  1EL0 A;  3L3O C;  2PI2 A;  4DR1 Q;  4RG1 A;  3L0O A;  1E0B A;  4AYB E;  2DGY A;  1G29 1;  4JBK A;  3NPP A;  1JE4 A;  2SNS A;  2A8V A;  2A1A A;  2EVB A;  1ASZ A;  2KVM A;  3S15 H;  2D2C C;  2JA9 A;  1K28 A;  4ZLT F;  1IHZ A;  4K14 A;  5I2Y A;  4YWM A;  1PVO A;  1IYJ B;  1D7Q A;  2B2U C;  5IGB A;  3I4M H;  2EY2 A;  5JEA J;  5AJ3 L;  4KKT A;  5FLM G;  1EU3 A;  4A3G H;  5E1F A;  4EQN A;  4DR5 Q;  1S5F D;  1B3A A;  3VR5 A;  1O80 A;  4JI6 L;  2L5T A;  1E22 A;  2IL8 A;  2JA6 H;  4RAU C;  5IIF A;  3TBI B;  1TWF H;  2QEX A;  2ZTE A;  4CGY B;  4KJN A;  2VB2 X;  1M8A A;  1YBY A;  2Z6K A;  5KND A;  3S24 A;  5IGC A;  4POF A;  1GUT A;  2B3G A;  3BZK A;  1TWH B;  3H94 A;  2WKC A;  4G4K A;  1VQ4 A;  2MUY A;  2R7Z G;  4LUV A;  5M5X H;  2R7Z B;  4I65 A;  2F0F A;  4DR7 L;  5LMU L;  1KDA A;  5FLX E;  1RL2 A;  1YHQ A;  3IRB A;  3KJP A;  2F3I A;  1BDO A;  4A3F G;  1F2M A;  1H9S B;  1NSN S;  4OEL B;  4A3E G;  1HFN A;  2JK8 A;  2NN6 G;  3C46 A;  4A3F B;  1Q1B A;  4A3E B;  3MTS A;  4DR6 L;  1BBX C;  1STA A;  3NWT A;  2VUM H;  1Y69 U;  1LUZ A;  1BXT A;  4LF7 Q;  4ZKC B;  1EY8 A;  4A3B H;  2Q2U A;  3VR2 A;  1ET9 A;  2H5X A;  1YNJ D;  4R9W A;  3TP8 A;  2AQ2 B;  1K8A C;  2VS1 A;  1JWU D;  3IAY A;  4BY7 G;  5KNB A;  4LJZ C;  2JN4 A;  2MP1 A;  3MFG A;  1WOC A;  2Z4I A;  2PNH A;  4QB4 A;  3C1F A;  4GNX C;  2OF1 A;  3A8J E;  4ODG A;  2RVL A;  1TY2 A;  4LUZ A;  3M4O B;  2HDL A;  4CJ2 C;  3J81 L;  1Y1V H;  3K7A H;  1D2B A;  2R61 A;  2JEA I;  2I5L X;  1J6Q A;  5EPK A;  1OTC A;  4Q0F A;  2KJX A;  4Z9C B;  5CGK A;  4LF8 L;  1RKN A;  1NCV A;  3FDT A;  4GNX B;  2HD3 A;  2DUD A;  1B1Z A;  2CVR A;  3V96 A;  2XIW A;  1NY4 A;  1IKM A;  1WTO A;  3DM1 A;  3KBX A;  1CHQ D;  1D1I A;  3CCE A;  1O7Z A;  2AQ3 B;  2IX3 A;  1I4X A;  1RTN A;  3HOV G;  1Z9F A;  2B2Y C;  1H9M A;  3CU7 A;  5LL6 S;  3GO5 A;  1FGB D;  2B2V A;  3S17 B;  4OL7 A;  1W6J A;  2K01 A;  1VQ7 A;  3HOX H;  1K9M C;  3IL8 A;  3I90 A;  2E75 C;  3D3R A;  2F4V Q;  2Q2H A;  5FJ8 H;  4BXX H;  1XMO L;  3LX0 A;  2F1M A;  3GTM B;  3VDY A;  1SAP A;  2M2L A;  2KEC A;  4JV5 L;  4EQ5 A;  2LSS A;  4K0K L;  1I3Q H;  3PIP 3;  3A5Z B;  5IYD G;  4Y7N H;  5C3W A;  4DR7 Q;  4DAY A;  2CQO A;  1PH7 A;  5FKA C;  1I4H A;  3P7J A;  4LF4 L;  5E4X A;  5IGD A;  1ZKO A;  1PYS B;  3DEP A;  4B3S L;  1JCK B;  4O1N A;  1G8Z D;  2K5Q A;  1G2T A;  1SDF A;  2UU9 Q;  4Q5V A;  4QIW B;  1GXD C;  3K58 A;  1WD1 A;  1G6Z A;  3OSO A;  5BN4 A;  2F0P A;  2K33 A;  5C4X H;  2K50 A;  5ISR A;  4QF4 A;  1CZG A;  2YU9 B;  5EPJ A;  2C5C A;  1I6H B;  1IBM Q;  4IPC A;  3JC6 6;  5IT9 c;  1B2T A;  1A3V A;  1UNS A;  1PTO H;  3H09 A;  4K5X A;  1B70 B;  2X69 A;  1LTB D;  3CCL A;  2Z6B A;  4JI3 L;  2MFI A;  1HCZ A;  1R4P B;  5E3F A;  1JIC A;  5HY6 A;  4HIM A;  1PZI D;  1UEA B;  3SDZ A;  1I50 H;  4BBR H;  4LF6 L;  3HOZ G;  2YTY A;  4IFD I;  2A6E C;  3HOZ B;  2B2T C;  4X3K A;  4LF8 Q;  4LNQ A;  5CR3 A;  4NXN Q;  3S2H H;  2XVS A;  2UXC Q;  1UE5 A;  4AQY L;  1PH9 A;  3CME A;  2QF7 A;  2IPK D;  2F0J A;  1D6E C;  3K5O A;  5J39 A;  2K5N A;  4PZ6 A;  4HIO A;  3PV0 A;  3TDQ A;  1XXG A;  2LKV A;  2P5Z X;  3S2D H;  3S15 B;  4PV1 C;  3K7U C;  1B9M A;  4DK1 A;  2B29 A;  4F87 A;  2VZA A;  3J81 j;  4CKB A;  4IUQ A;  2AWN A;  2JXM B;  2IW3 A;  4R4Q A;  1XPO A;  4F88 A;  1SYD A;  4HN7 A;  4B9W A;  2NZH A;  3J7A 5;  3I4M B;  3MEH A;  4A3G G;  3FVQ A;  2VW9 A;  3K5M A;  1UE7 A;  3CCQ A;  2UXD L;  4XIG S;  4A3G B;  3QB3 A;  4R8I A;  1I94 L;  2F0E A;  3VR3 A;  2JA6 G;  3CHB D;  2HT1 A;  4JPB W;  3KF6 B;  2JA6 B;  1RTO A;  1VQ5 A;  4LW1 A;  1Q46 A;  1TWF B;  4IO9 A;  2EYF A;  4DN4 M;  4H44 C;  1X3F A;  2EOT A;  2E5L L;  2K4K A;  3BJU A;  4X62 Q;  3BZD B;  5EPL A;  4LFA Q;  2RCN A;  3LWU A;  1LTR D;  3QJY A;  1XYI A;  1DOK A;  1Q1E A;  5M5X B;  2WB1 E;  1CKO A;  4LF4 Q;  1NR4 A;  4GS3 A;  4C3H H;  4IUU A;  3L7Z C;  1UWV A;  4XXE A;  2DJF C;  1Q81 C;  1QG7 A;  2ZM6 L;  5KEE A;  1SE2 A;  4YCU A;  1SND A;  5I6Y A;  1A0I A;  1ENF A;  4F8M A;  3K5N A;  3H6M A;  1EYC A;  3Q24 A;  4RA8 A;  3GTQ H;  2VUM G;  1EOT A;  1VQM A;  2ZTD A;  1PFN A;  2JA5 H;  4A3B G;  2VUM B;  4LFB L;  2HIX A;  2PNR C;  4DV6 L;  2A68 C;  4A3B B;  1WTX A;  2L9H A;  2EQS A;  4JI3 Q;  4K5W A;  1S5C D;  2MPM A;  3V05 A;  3CQZ H;  3KLW A;  2K14 A;  2JA8 H;  2BH8 A;  3B6Y A;  4DR3 L;  2KHS A;  3BVG A;  1Y1V G;  5EKL A;  1HTP A;  1Y1V B;  4FF2 A;  3A7L A;  2Z8L A;  3A74 A;  2N49 A;  3UDF A;  4KMU C;  3DUZ A;  1EY9 A;  1SRO A;  3K81 C;  4N8F A;  2VQE L;  3J7Y W;  3UDX A;  5I4D A;  1TII D;  5KIX A;  5K5P A;  3A5U A;  2HQE A;  2O5I C;  2K32 A;  3J7Z C;  3TRE A;  1A63 A;  1ONL A;  4M1U B;  3T51 B;  3A54 A;  1W6K A;  3TEH B;  3HKZ G;  2VY3 A;  1B3Q A;  1PMR A;  4MZ9 A;  3I4N H;  4CKE A;  4OHJ A;  5C0X I;  1SMX A;  2UXD Q;  3DXJ C;  3OTO L;  4KN7 C;  1LV9 A;  1H9R A;  1STN A;  3M4P A;  2E8G A;  3HOX G;  1I94 Q;  5KRU A;  1F9P A;  4DAP A;  4DAY B;  1TS2 A;  2NVT H;  2E2I H;  1QZH A;  1LTT D;  1TWG H;  4C1N K;  1HNZ Q;  5FJ8 G;  3S1M H;  4BXX G;  1AP0 A;  3GV3 A;  4FYD A;  2XRS D;  4NPS A;  2EYL A;  4K8J A;  4WOR A;  1XNQ Q;  1KHI A;  5C4H A;  1O78 A;  1P8L A;  1YIJ A;  1HUN A;  4P75 A;  2EY5 A;  1I3Q B;  2H4O A;  5G3L F;  1EIH A;  1PH6 A;  4Y7N B;  1TT2 A;  2ALY B;  3GD7 A;  4X66 Q;  3MZ5 A;  2DN8 A;  3NP8 A;  2SEB D;  1STY A;  3HP3 A;  1GUO A;  1CK1 A;  2SOB A;  2HHH Q;  4OO1 I;  5ELF A;  3D0F A;  3Q23 A;  3L2P A;  1ENC A;  1PFM A;  4CDF C;  1UE6 A;  3G6E A;  4GKJ Q;  4LAA A;  1FJG L;  3X3M A;  4PMW A;  3I4O A;  5C4X G;  5EJW A;  3BVM A;  4DV5 Q;  3KYH C;  2JEB I;  4DV6 Q;  4OWW B;  5C4X B;  4HR7 B;  4LMQ D;  2XTI A;  3VR4 A;  4JI0 L;  3W3A A;  3JAM L;  4DR2 Q;  1PTO B;  4DR3 Q;  2R92 H;  4GOP C;  4JYA L;  1QVC A;  4BBR G;  2A74 C;  4JI4 Q;  1I50 B;  4DU9 A;  4BBR B;  5HGT A;  1DJR D;  4JOI C;  4A93 B;  4FF4 A;  1YJW A;  3V2T A;  3SR1 A;  1TXY A;  1X9N A;  3S2H B;  5ELC A;  4GOP B;  5IP9 H;  4LF5 Q;  2O5J C;  2K52 A;  5LMN Q;  5I9P A;  1PTO D;  4HED A;  1VQL A;  3MEF A;  3D4D A;  3D6C A;  5JAV A;  4DV2 L;  1HR0 L;  1EY7 A;  2F0G A;  3S2D B;  1KDB A;  3S9W A;  3VA7 A;  3CMA A;  1H9S A;  4A3C H;  4JI2 Q;  1JOK A;  2L11 A;  1N36 Q;  1MSH A;  4J1M A;  3CRK C;  2CHB D;  4A3M H;  2OQK A;  1IXR A;  3VYR A;  4IJL A;  1A3U A;  5CV5 A;  1XPU A;  2HQL A;  4IOC A;  1EFW A;  5EKI A;  5H1S E;  1LM0 A;  1PH4 A;  4UP7 A;  1SNP A;  4J8Q A;  2QEJ C;  1SMY C;  4WJW A;  1MBY A;  3MAQ A;  1VMP A;  2PZW A;  5C5M A;  5I6W A;  4DR1 L;  1R9T H;  1NTG A;  2F3V A;  2LFN A;  4NDX A;  1Q7Y C;  2YYZ A;  4OX9 L;  2F0Q A;  5BR8 Q;  1JE5 A;  5DM7 3;  1SNQ A;  3UE1 A;  2A6H D;  4NXM Q;  4WFN 3;  4H0L C;  1OO9 B;  4UPA A;  1CTM A;  2EYO A;  3QOL A;  4BS9 A;  3ERO A;  2K75 A;  2KBN A;  1AZQ A;  3CCM A;  5GAH C;  4GLX A;  1LTL A;  1SYB A;  1C8C A;  3MWY W;  1ZXT A;  4GNX A;  3FRP B;  2OQ0 A;  1TWA H;  1RHP A;  3D31 A;  4G7H C;  1YNN C;  4C3H G;  4YWK A;  1KD1 C;  2EYP A;  4G7O C;  4AIM A;  2KA7 A;  4MTK A;  4DR5 L;  3NEL A;  5DNF A;  1F9Q A;  2D9U A;  3PIO 3;  1MSG A;  2RF4 A;  3U58 A;  3GTQ B;  3OHX C;  3NBI A;  3T1Y Q;  2JA5 G;  3QO2 A;  4JI0 Q;  2KHI A;  2JA5 B;  2EDG A;  2OT2 A;  2R93 H;  5DAU A;  3DLL A;  1TWC H;  4WRD A;  1W3S A;  1U9R A;  2X6G A;  1F2Z A;  1K3B C;  3L9A X;  5HGQ A;  2JA8 G;  3CQZ B;  5GQO A;  2JSO A;  2AUJ D;  1EOV A;  2JA8 B;  4DGZ A;  4QY7 A;  2B2Y A;  4B08 A;  4XT1 B;  3OIP A;  2ATW A;  2EJG C;  2KQ3 A;  4PNY A;  4N9P A;  3NK9 A;  4XQN A;  2BDN A;  4PZ8 A;  1VDZ A;  1EWC A;  3MC0 B;  4CKC A;  5KYL A;  2CW0 C;  1M90 C;  1X54 A;  4FVM A;  3CCR A;  1KRT A;  1KLG D;  4LF7 L;  1IBK L;  1K8M A;  1C4Q A;  3RNU A;  1DD2 A;  1FNV A;  1WJJ A;  3F1Z A;  3UDI A;  4GN4 B;  3I4N G;  2B39 A;  2RA4 A;  1E2Z A;  1VQH A;  3I4N B;  4BA2 I;  3QR8 A;  2I07 B;  1ENA A;  3C2P A;  2NZO A;  1SYG A;  4DNT B;  3SK4 A;  2ICI A;  3N6R A;  1ZYR C;  4DUY Q;  4AYB G;  1WTR A;  2SDF A;  3TZU A;  2NVT B;  2E2I B;  3HRZ C;  4OX9 Q;  1TWG B;  4KY6 A;  1NMF A;  4NB3 A;  4AYB B;  3AEV A;  1VQF A;  1X65 A;  2NB0 A;  3S1M B;  5CC4 A;  1BCP D;  1GHK A; 
#chains in the Genus database with same CATH homology
 3MXP A;  2WAC A;  4MN3 A;  2DY7 A;  2NWG A;  1TS3 A;  1SSO A;  5D3I B;  1HXY D;  2WII B;  2K5W A;  2NBF A;  1Z6H A;  1GUS A;  1G91 A;  2I46 A;  3NTH A;  1PRT F;  3AMU A;  2R6G A;  3D6W A;  3ERQ A;  2B2T A;  5CV9 A;  2EYH A;  2BCO A;  1OXV A;  5JPN C;  1JB3 A;  3A56 A;  1BNZ A;  3RD4 A;  1QE6 A;  2F0S A;  4DFA A;  1F9R A;  2R92 B;  2BA0 A;  2OEO A;  4HCS A;  1EY6 A;  4ILW A;  1O7Y A;  3QIA A;  3WDN A;  2HDM A;  3T53 B;  4IN3 A;  2M00 A;  1D5X C;  1LT3 D;  3EJI A;  4J6H A;  3FMC A;  3UI2 A;  3JAM E;  2BA1 A;  5D3D A;  3TP7 A;  3R3O A;  2F0N A;  1Y8O B;  3I8Z A;  3SE0 A;  3OMC A;  1J8I A;  2FHT A;  2K1B A;  4RCN A;  3TN2 A;  2BDO A;  1ML0 D;  3NQI A;  1F77 A;  4A3M B;  2EY6 A;  1GOZ A;  2MHV A;  2GA4 B;  3PUV A;  5D14 A;  2K6A A;  1R9T B;  3EQL C;  3BYY B;  3I70 A;  4K5V A;  4C56 C;  3DWA A;  4OIJ A;  4KY7 A;  1DOL A;  2IX1 A;  4HSV A;  4IUN A;  1TWA B;  2B2W C;  4NP5 A;  3E6Z X;  3IKJ A;  3O13 A;  4FNF A;  2WKD A;  4HMJ A;  1R4Q B;  1OXS C;  5COY A;  2BE5 C;  3D4W A;  5IOC A;  1XWE A;  2R93 B;  3HEJ A;  1U4L A;  1TWC B;  4G57 A;  1Q90 A;  3SHL A;  3I73 A;  5HUR A;  5CV7 A;  3NE5 B;  1PLF A;  2IX0 A;  3OWF A;  1KAA A;  1I4Q A;  2RSN A;  1EU4 A;  3G6J B;  4XQJ A;  1A2T A;  4FO2 A;  3MHB A;  3OWE B;  3J80 E;  4HTH A;  1SBB B;  4RHR A;  3Q0A A;  3MVV A;  5C0X J;  1TS4 A;  1GUG A;  1F2L A;  1I4P A;  3T56 B;  1SYC A;  1TY0 A;  1JOO A;  3OOC A;  3PUZ A;  1EWH A;  2Q8R E;  4DA2 A;  1QJO A;  3ZYY X;  5CBA E;  2F0W A;  4V0B A;  1DYQ A;  3T13 A;  4ZAI A;  1QNK A;  5IOD A;  1JWS D;  1SNO A;  1T5X D;  1V8Q A;  2F0I A;  1STB A;  1GJX A;  1B9N A;  1RF2 D;  3U9S A;  2XN9 C;  4IUV A;  4RFB A;  2J4X A;  1B44 D;  2IWH A;  1ILP A;  4XDX A;  4QCL A;  1JC7 A;  1F9S A;  1MI2 A;  4FF1 A;  4F7X A;  1QB5 D;  2E74 C;  1JOQ A;  2RDG A;  1V1P A;  4FXG C;  2FIN B;  4IUP A;  1AFP A;  2DNC A;  4N9T A;  5EBC A;  1LO5 D;  1DXM A;  3W2D A;  3K0Y A;  3NSW A;  5EQ0 A;  2WB1 B;  4MIU A;  4UAI A;  3BDO A;  4FXD A;  3KLS A;  1UUP A;  4EQO A;  2V4D A;  1V1O A;  1CT1 D;  3AU7 A;  1PDQ A;  4FF3 A;  1X3P A;  5F2D A;  5FOB B;  3OW7 A;  4KTA A;  5EGT A;  1A15 A;  1PRT C;  4ME5 A;  3U9O A;  2B63 B;  4RGN A;  3A8I E;  4A3I B;  3N52 A;  2XNA C;  3NHH A;  2KEE A;  5C0X H;  4X3T A;  2XWJ B;  1WD0 A;  4FXK C;  2NTS A;  3M4Y A;  3J81 E;  4KHZ A;  1DZ1 A;  1CHP D;  3CKI B;  2C9O A;  1TS5 A;  2WV6 D;  4BY1 B;  2G9D A;  2KCN A;  3VA5 A;  2VXW A;  2Z1C A;  2A69 C;  3GTO B;  1V43 A;  3ND8 A;  3SK5 A;  4B9X A;  2N88 A;  4OO1 H;  2PCF B;  1D5M C;  5KYI A;  4RKL A;  2EY1 A;  4FP5 D;  3QOJ A;  1DM0 B;  1NR2 A;  4PMB A;  1ROD A;  4ID6 A;  1EY0 A;  1KLU D;  1CA5 A;  4JK1 C;  1PYW D;  2L12 A;  4KJO A;  2K7V A;  4K6D A;  1WTW A;  4KKS A;  5JVH 3;  1I4G A;  1TU2 B;  5M5Y B;  4RGT A;  4ABN A;  1RCV D;  2E2D C;  1HA6 A;  3AB9 A;  2Q8T A;  2M9V A;  1QNU A;  3HOW B;  3I4L A;  5DEH A;  2B2U A;  5IT9 L;  2HCI A;  1AZP A;  1WTP A;  5C4Z A;  4DF7 A;  4IUR A;  3A7A B;  2TSS A;  4RH6 A;  3HOY B;  4RCO A;  4DXF A;  3BS1 A;  3ND9 A;  3TME A;  2NVQ B;  2RDF A;  2FFK B;  4ZYS A;  3E5S A;  5M3M B;  3SK8 A;  1C48 A;  1F2Y A;  4DK0 A;  5M5W B;  4K8I A;  2NTT A;  3A55 A;  4A3J B;  2NYZ D;  3FPU B;  3F2U A;  1V1P B;  5FO8 B;  4JBW A;  5JOB A;  1CA6 A;  1JR0 D;  2RSO A;  3R93 A;  2KUM A;  5IGE A;  1STG A;  3BG3 A;  1JQY D;  2NN6 I;  4ZQ3 A;  1L0X B;  5A35 A;  5A2Q L;  1H9K A;  4XT3 B;  2EYJ A;  1S5E D;  3P75 A;  3HS0 C;  3PO2 B;  1SYE A;  1LTA D;  1K83 B;  2F0O A;  3G7L A;  3NBH A;  1FNU A;  5EBD A;  5T1I A;  2B8F A;  1II3 A;  3DEO A;  1X3Q A;  4XYO A;  4A3D B;  2L0C A;  2EJF C;  1ZEQ X;  1SMY D;  2QCP X;  4IUT A;  4ZUJ A;  1KDC A;  1STH A;  2J0T D;  2E76 C;  1Y1W B;  3OMG A;  3X3N A;  3J7A V;  2RKS A;  3HGB A;  4ZKB B;  1U4R A;  1IW7 C;  3TP5 A;  1CQV A;  2FMM A;  4XYQ A;  1YNN D;  2B2W A;  5COR A;  4BWG B;  1RDP D;  4GZY C;  2EZV A;  3C3L A;  5C0X G;  5M9O A;  1WCM B;  1S5D D;  3PO3 B;  4KY5 A;  2ENB A;  5KGU A;  3GQB A;  2JA7 B;  4U67 3;  4C3I G;  4C3I B;  2F3W A;  1IYU A;  4ZRZ A;  1BCP C;  3EVQ A;  2JE6 I;  2AQ1 B;  3ONA B;  1HQM C;  3SXH A;  3D4R A;  1VF5 C;  1L0Y B;  4O42 A;  1U4M A;  4YIJ A;  4U68 A;  5DM6 3;  2Q8I B;  2CW0 D;  1A2U A;  1MGS A;  2F4I A;  1J9O A;  1TKW B;  4OO1 G;  2JYO A;  5FO9 B;  1KNA A;  1JOR A;  2OXP A;  1CZW A;  2F0M A;  4TKO B;  3RZO B;  2SNM A;  2PQE A;  3EFX D;  1EEI D;  3FEW X;  5KNC A;  4ULL A;  1ET6 A;  1SYF A;  4R8N A;  1ZYR D;  1SNM A;  1SE3 A;  3T16 A;  4OIK A;  3GTL B;  2ZXO A;  3RUZ A;  1AW7 A;  1Z47 A;  3Q6S A;  4KI0 A;  5CV6 A;  4NKL A;  4ZUI A;  2NVX B;  4TRD A;  2K5D A;  3S14 B;  1FNW A;  1TVX A;  1HA5 A;  1D5Z C;  2G9H D;  1YNJ C;  3GTG B;  4HMI A;  3MXN A;  5C44 B;  1Z7T A;  4KD3 A;  4IFD J;  3NUC A;  2XSC A;  3S1R B;  3WOF A;  3SEB A;  1LTI D;  2ZXP A;  2HUG A;  1BQQ T;  2LS0 1;  1NUC A;  1TQO A;  2PO4 A;  1WVL A;  1I6V C;  5IT9 E;  5I9O A;  1T5E A;  2EPB A;  3KLR A;  3PMF A;  1Q8I A;  4S3S A;  4IAL A;  4IZ8 A;  2F0L A;  1CFM A;  4BY7 B;  2PPB C;  3FKI B;  1STE A;  2EJM A;  1RJT A;  4KHV A;  2DNE A;  3WOE A;  2PZU A;  3CRL C;  3DMU A;  3FPP A;  3PUX A;  4I7Z C;  4KV6 A;  1HUM A;  3TP6 A;  1HFG A;  3KLS X;  4TQU S;  5M3F B;  2FMC A;  4EVO A;  1HHV A;  1QCB D;  1EFI D;  1PTO F;  4L8J A;  3DHQ A;  5G3L D;  3K6O A;  1Q3L A;  3BDC A;  1FYC A;  4DNR B;  4RGO S;  2F0T A;  4L6T B;  5CMD A;  5A2Q E;  3I3C A;  2VB3 X;  3DWP A;  1KAB A;  3HOV B;  3RMH A;  4KN4 C;  4K6L A;  5ELE A;  4ZK9 B;  5C6A A;  2CQA A;  3IFD A;  1A3T A;  3KF8 A;  5JEA H;  4H7B A;  3A8K E;  3GTP B;  3C1E A;  2ICE C;  4DAV A;  1FR3 A;  4X3S A;  4OGQ C;  5C3E B;  1E2V A;  2EE1 A;  4IFD H;  5FK9 C;  1EYD A;  5AFW A;  1IKL A;  1HRJ A;  5TSS A;  4A3K B;  2L55 A;  4HCE A;  2BE5 D;  1KTK A;  4M8A A;  2F0K A;  1AEX A;  1OXX K;  4C1N I;  1U4P A;  5K36 H;  2A73 B;  1WTV A;  2DY8 A;  4KD4 A;  2IJ0 A;  3ITP A;  2PW7 A;  1O7L A;  1VF7 A;  4NMZ A;  4KKU A;  3M3Y B;  1SXT A;  2D5D A;  3NQT A;  4G7Z C;  1JWM D;  3BYT B;  5T1G A;  3D8G A;  1QOH A;  4L63 B;  1SFO B;  3GP7 A;  2H1E A;  1KNE A;  2A6E D;  2F0H A;  3PUW A;  3QG1 A;  1PFB A;  3OPO A;  2AUK A;  1WTQ A;  2RDH A;  3HG9 A;  4CJ1 B;  2QDB A;  5C4J B;  2XWB B;  3R2I A;  1K8O A;  4MHE A;  3MXU A;  1EZ8 A;  1BCP F;  2KED A;  3URY A;  2L1B A;  5NUC A;  3MA2 B;  1EIG A;  3VR6 A;  3MFY A;  1Y8P B;  5D65 A;  3M85 A;  2BOS A;  1XTC D;  4C3J G;  4QUF A;  3EA6 A;  3KUP A;  4C3J B;  2LY7 A;  3LWE A;  2D62 A;  1LTS D;  5CV4 A;  5EKK A;  3OIQ A;  1AN8 A;  5C3X A;  3K5L A;  2F0V A;  3NTK A;  1IL8 A;  4TSS A;  1EZ6 A;  4C2M B;  3VYS A;  3P1H A;  1GUN A;  3S1N B;  1BF4 A;  1Q12 A;  1MD2 D;  4P2C B;  2QIL A;  2B2V C;  3BDL A;  1XX8 A;  1VMC A;  1PRT B;  2AWO A;  3K7A B;  1D1K A;  2A68 D;  1BO0 A;  1H9J A;  5JPM C;  4RGM A;  1VCI A;  1CQF A;  4QUC A;  1BOS A;  2ZXR A;  5LL6 X;  4KK7 A;  1PRT D;  4X3U A;  1QWY A;  2RBM A;  2F03 A;  4HAE A;  5JJZ A;  3HKZ B;  4RHS A;  2ID0 A;  4IQZ A;  2EYM A;  4PMC A;  5IGG A;  1S4Z A;  2N55 A;  2B8G A;  3HOX B;  4K2L A;  3R2T A;  5JEA G;  1CM9 A;  2KOL A;  3P20 A;  1NAP A;  3HZX A;  3S1Q B;  3I91 A;  5BN3 A;  5C5L A;  3BVZ A;  1DON A;  3J7A F;  2KCC A;  5JVG 3;  2O4X A;  2O2L D;  4IFD G;  3LNN A;  5IGF A;  3RZD B;  2A69 D;  1SEB D;  1LT5 D;  2K04 A;  5LHY 1;  3MXG A;  3VYU A;  5FLX L;  3E0J A;  1HPC A;  1LTG D;  1ILQ A;  1PTO C;  1M4V A;  2IT1 A;  1DCZ A;  3GTJ B;  3R8B A;  4H13 C;  3QWN A;  3DWQ A;  1FD7 D;  1BR9 A;  5J1Z A;  1A6X A;  5K36 G;  1I4R A;  1PZJ D;  2F0D A;  3VYT A;  1HQR D;  2WAQ B;  1ICW A;  2XRQ D;  1DOM A;  1ESF A;  1OXU A;  4CHT B;  4BBS B;  1TR5 A;  1B53 A;  1GUW A;  4E6I A;  3K59 A;  3KBG A;  5BN5 A;  3S16 B;  2NN6 H;  3KK7 A;  2EXZ A;  2A6H C;  3HOU B;  2K03 A;  2Y0S B;  1SJE D;  2HCC A;  3T4A C;  3NXW A;  1EYA A;  2NUC A;  3PUY A;  2X6L A;  1RD9 D;  2K28 A;  4V19 0;  1G2S A;  1E2W A;  2WIN B;  2PMZ B;  1EEF D;  2E2H B;  3M7N A;  2E2J B;  5I2X A;  1LLR D;  2R3Z A;  1B50 A;  2MJ8 A;  3H91 A;  1PXU A;  1EQT A;  3SK6 A;  2L4N A;  3Q22 A;  5FO7 B;  1UAP A;  2LMC B;  2Z4H A;  4RKB A;  4PQX A;  2FJ2 A;  4RWS C;  1X32 A;  2ZT9 C;  4UDU C;  1LT6 D;  3NWS A;  4XTC S;  2NZ1 D;  3TZD A;  1BUV T;  3H3V C;  1EY5 A;  1EY4 A;  5CV8 A;  1QIL A;  1GHJ A;  2JP1 A;  4C3H B;  2A5H A;  4EQP A;  3RLF A;  1SE4 A;  5J22 A;  4HSP A;  3TSS A;  1OXT A;  4QMG A;  3GTK B;  1S5B D;  2NVY B;  5ELD A;  1SJH D;  3IFT A;  1IYV A;  1B4O A;  2RQX A;  4DXG A;  5E4W C;  4NW2 A;  2F0U A;  3J80 L;  3I72 A;  3GV6 A;  4EGV A;  2K05 A;  1HTL D;  1EQV A;  1ESR A;  3H0G B;  4BA1 I;  2J7Z A;  5ELB A;  2PW5 A;  2WP8 J;  1CI3 M;  4CJ0 B;  3NTI A;  5CYU A;  1LAC A;  4XQQ A;  3SVM A;  1IW7 D;  2QKI C;  3M7G A;  4LK1 C;  1LT4 D;  2PYK A;  2PZT A;  5CBE E;  2VNU D;  2MGS A;  1BCP B;  1PZK D;  1LAB A;  1Y8N B;  1SNC A;  4CBV A;  3K57 A;  4K2K A;  2TMP A;  1EL0 A;  3L3O C;  1E0B A;  1G29 1;  3NPP A;  1JE4 A;  2SNS A;  2EVB A;  2KVM A;  2D2C C;  4ZLT F;  1IHZ A;  4K14 A;  5I2Y A;  2B2U C;  5IGB A;  2EY2 A;  5JEA J;  4KKT A;  1EU3 A;  5E1F A;  4EQN A;  1S5F D;  1B3A A;  3VR5 A;  1O80 A;  2L5T A;  2IL8 A;  4RAU C;  5IIF A;  3TBI B;  4CGY B;  4KJN A;  2VB2 X;  1M8A A;  5KND A;  5IGC A;  1GUT A;  1TWH B;  3H94 A;  2WKC A;  4G4K A;  2MUY A;  2R7Z B;  4I65 A;  2F0F A;  1KDA A;  5FLX E;  1BDO A;  1F2M A;  1H9S B;  1NSN S;  1HFN A;  2NN6 G;  3C46 A;  4A3F B;  1Q1B A;  4A3E B;  3MTS A;  1BBX C;  1STA A;  3NWT A;  1Y69 U;  1BXT A;  4ZKC B;  1EY8 A;  3VR2 A;  1ET9 A;  1YNJ D;  4R9W A;  3TP8 A;  2AQ2 B;  1JWU D;  3IAY A;  5KNB A;  4LJZ C;  2MP1 A;  3MFG A;  2Z4I A;  4QB4 A;  3C1F A;  2OF1 A;  3A8J E;  4ODG A;  2RVL A;  1TY2 A;  3M4O B;  2HDL A;  4CJ2 C;  3J81 L;  1D2B A;  2R61 A;  2JEA I;  5EPK A;  4Q0F A;  2KJX A;  4Z9C B;  5CGK A;  1RKN A;  1NCV A;  3FDT A;  1B1Z A;  2CVR A;  3V96 A;  2XIW A;  1IKM A;  1WTO A;  3DM1 A;  3KBX A;  1CHQ D;  1D1I A;  1O7Z A;  2AQ3 B;  2IX3 A;  1I4X A;  1RTN A;  2B2Y C;  1H9M A;  3CU7 A;  5LL6 S;  3GO5 A;  1FGB D;  2B2V A;  3S17 B;  4OL7 A;  1W6J A;  2K01 A;  3IL8 A;  3I90 A;  2E75 C;  3D3R A;  3LX0 A;  2F1M A;  3GTM B;  1SAP A;  2M2L A;  2KEC A;  3PIP 3;  5C3W A;  4DAY A;  5FKA C;  1I4H A;  3P7J A;  5E4X A;  5IGD A;  1ZKO A;  3DEP A;  1JCK B;  4O1N A;  1G8Z D;  2K5Q A;  1G2T A;  1SDF A;  4Q5V A;  4QIW B;  1GXD C;  3K58 A;  1WD1 A;  1G6Z A;  3OSO A;  5BN4 A;  2F0P A;  2K33 A;  5ISR A;  4QF4 A;  1CZG A;  2YU9 B;  5EPJ A;  2C5C A;  1I6H B;  1B2T A;  1A3V A;  1UNS A;  1PTO H;  3H09 A;  4K5X A;  2X69 A;  1LTB D;  1HCZ A;  1R4P B;  5E3F A;  1JIC A;  1PZI D;  1UEA B;  3SDZ A;  4IFD I;  2A6E C;  3HOZ B;  2B2T C;  4X3K A;  5CR3 A;  2XVS A;  2QF7 A;  2IPK D;  2F0J A;  1D6E C;  3K5O A;  5J39 A;  3PV0 A;  3TDQ A;  1XXG A;  2LKV A;  3S15 B;  4PV1 C;  1B9M A;  4DK1 A;  4F87 A;  4CKB A;  4IUQ A;  2AWN A;  2JXM B;  2IW3 A;  4F88 A;  1SYD A;  4HN7 A;  4B9W A;  3I4M B;  3MEH A;  3FVQ A;  3K5M A;  4XIG S;  4A3G B;  3QB3 A;  4R8I A;  2F0E A;  3VR3 A;  3CHB D;  2JA6 B;  1RTO A;  1TWF B;  2EYF A;  4DN4 M;  4H44 C;  2EOT A;  3BZD B;  5EPL A;  3LWU A;  1LTR D;  3QJY A;  1XYI A;  1DOK A;  1Q1E A;  5M5X B;  1NR4 A;  4IUU A;  3L7Z C;  4XXE A;  1QG7 A;  5KEE A;  1SE2 A;  1SND A;  5I6Y A;  1ENF A;  4F8M A;  3K5N A;  3H6M A;  1EYC A;  3Q24 A;  4RA8 A;  1EOT A;  1PFN A;  2VUM B;  2PNR C;  2A68 C;  4A3B B;  1WTX A;  2L9H A;  4K5W A;  1S5C D;  2MPM A;  3V05 A;  2KHS A;  3BVG A;  5EKL A;  1HTP A;  1Y1V B;  4FF2 A;  3A7L A;  2Z8L A;  4KMU C;  3DUZ A;  1EY9 A;  3J7Y W;  5I4D A;  1TII D;  5KIX A;  5K5P A;  2HQE A;  2O5I C;  2K32 A;  1ONL A;  4M1U B;  3T51 B;  3A54 A;  1W6K A;  1PMR A;  4CKE A;  4OHJ A;  5C0X I;  3DXJ C;  4KN7 C;  1LV9 A;  1H9R A;  1STN A;  5KRU A;  1F9P A;  4DAP A;  1TS2 A;  1LTT D;  4C1N K;  1AP0 A;  3GV3 A;  4FYD A;  2XRS D;  2EYL A;  4K8J A;  4WOR A;  5C4H A;  1O78 A;  1HUN A;  2EY5 A;  1I3Q B;  2H4O A;  5G3L F;  1EIH A;  4Y7N B;  1TT2 A;  3GD7 A;  3MZ5 A;  2DN8 A;  3NP8 A;  2SEB D;  1STY A;  3HP3 A;  1GUO A;  1CK1 A;  2SOB A;  4OO1 I;  5ELF A;  3Q23 A;  1ENC A;  1PFM A;  4LAA A;  3X3M A;  4PMW A;  5EJW A;  3BVM A;  2JEB I;  5C4X B;  4HR7 B;  4LMQ D;  3VR4 A;  3W3A A;  3JAM L;  1PTO B;  2A74 C;  1I50 B;  4DU9 A;  4BBR B;  5HGT A;  1DJR D;  4A93 B;  4FF4 A;  3V2T A;  3SR1 A;  3S2H B;  5ELC A;  2O5J C;  5I9P A;  1PTO D;  4HED A;  3D4D A;  3D6C A;  5JAV A;  1EY7 A;  2F0G A;  3S2D B;  1KDB A;  3S9W A;  3VA7 A;  1H9S A;  1JOK A;  2L11 A;  1MSH A;  4J1M A;  3CRK C;  2CHB D;  3VYR A;  1A3U A;  5CV5 A;  5EKI A;  1SNP A;  4J8Q A;  2QEJ C;  1SMY C;  4WJW A;  1MBY A;  3MAQ A;  1VMP A;  2PZW A;  5C5M A;  5I6W A;  2F3V A;  2LFN A;  4NDX A;  2YYZ A;  2F0Q A;  5DM7 3;  1SNQ A;  2A6H D;  4WFN 3;  4H0L C;  1OO9 B;  1CTM A;  2EYO A;  3QOL A;  4BS9 A;  3ERO A;  1AZQ A;  1SYB A;  1C8C A;  3MWY W;  1ZXT A;  3FRP B;  1RHP A;  3D31 A;  4G7H C;  1YNN C;  4C3H G;  2EYP A;  4G7O C;  2KA7 A;  5DNF A;  1F9Q A;  2D9U A;  3PIO 3;  1MSG A;  3GTQ B;  3OHX C;  3NBI A;  3QO2 A;  2JA5 B;  2EDG A;  2OT2 A;  5DAU A;  4WRD A;  1U9R A;  2X6G A;  1F2Z A;  3L9A X;  3CQZ B;  2JSO A;  2AUJ D;  2JA8 B;  4DGZ A;  2B2Y A;  4B08 A;  4XT1 B;  3OIP A;  2EJG C;  2KQ3 A;  4PNY A;  4N9P A;  3NK9 A;  4XQN A;  2BDN A;  1VDZ A;  1EWC A;  3MC0 B;  4CKC A;  5KYL A;  2CW0 C;  4FVM A;  1KLG D;  1K8M A;  1C4Q A;  1DD2 A;  1FNV A;  2B39 A;  2RA4 A;  1E2Z A;  3I4N B;  4BA2 I;  2I07 B;  1ENA A;  3C2P A;  1SYG A;  4DNT B;  3SK4 A;  2ICI A;  3N6R A;  1ZYR C;  1WTR A;  2SDF A;  3TZU A;  2NVT B;  2E2I B;  3HRZ C;  1TWG B;  4KY6 A;  4AYB B;  2NB0 A;  3S1M B;  5CC4 A;  1BCP D;  1GHK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...