1KNEA

Chromo domain of hp1 complexed with histone h3 tail containing trimethyllysine 9
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
52
structure length
52
Chain Sequence
EYAVEKIIDRRVRKGMVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of HP1 chromodomain bound to a lysine 9-methylated histone H3 tail.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Structural protein
molecule keywords HETEROCHROMATIN PROTEIN 1
total genus 10
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2001-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1kneA00
2B2WC 4IUTA 1NAPA 5EKIA 1WTXA 1IKLA 2R3ZA 2NZ1D 4XDXA 1WD1A 1PLFA 2H1EA 3SVMA 5DNFA 1WTOA 4X3TA 1M8AA 2XIWA 4DN4M 1PFBA 2B2UC 4U68A 3DEPA 4XT1B 2K05A 2K03A 4ZAIA 2HDMA 1E0BA 2FHTA 2FJ2A 5D14A 1DONA 2D9UA 2X6GA 2BDNA 1HRJA 2SDFA 1RHPA 1WTQA 4IUQA 1QNKA 3I90A 5T1GA 5CBAE 3Q6SA 1F9QA 1X3QA 1U4LA 2K1BA 2M2LA 2KOLA 1O7ZA 5COYA 3TN2A 2B2YA 1CA6A 3FDTA 1RODA 2B2TA 2L9HA 1DOKA 1HUMA 2DY7A 4HEDA 1WTVA 1XYIA 1AP0A 1HFGA 1U4PA 1B4OA 5EQ0A 1J8IA 1A15A 2N55A 2X69A 1B2TA 5E4XA 5CORA 3IFDA 1HHVA 2B2VA 1RTOA 2KVMA 2NYZD 1G91A 1DOLA 1S4ZA 4CJ0B 2N88A 1WTWA 5D65A 1ILQA 5EPJA 1MGSA 1G2SA 2MPMA 2EOTA 1DOMA 1O7YA 3MTSA 3TZDA 1EOTA 3G7LA 1C8CA 1HUNA 1SAPA 2B2TC 1PFMA 1U4RA 2FFKB 1HA6A 2B2VC 1BO0A 3D6WA 3FPUB 4X3UA 1QE6A 3F2UA 4RA8A 4MHEA 1F9PA 4QUCA 1JICA 1EL0A 1VMCA 5EJWA 2KUMA 1X3PA 1LV9A 4ZKBB 3KUPA 3IL8A 2RA4A 1MSHA 4R9WA 3UI2A 2L11A 2K04A 1XX8A 1AZPA 1U4MA 1B50A 5EPKA 2KECA 3I91A 2KEEA 2Q8RE 1EIHA 1KNEA 1IL8A 1EQTA 1O80A 1WD0A 2EE1A 2J7ZA 1CA5A 3DEOA 2B2WA 2NWGA 1NR4A 2FINB 2CVRA 1ZXTA 4RWSC 2RSNA 1GUWA 2EPBA 2B2UA 3KBXA 3P7JA 4OIKA 4LMQD 4X3SA 1F9SA 4ZKCB 2K28A 3QO2A 2HUGA 4X3KA 2DY8A 4CJ2C 4MN3A 2IL8A 1QG7A 2MJ8A 5T1IA 1SDFA 3I8ZA 5EPLA 3N52A 5CBEE 1RTNA 1RJTA 1TVXA 1SSOA 2HDLA 2RVLA 2B2YC 2HCIA 2KEDA 2L12A 3DM1A 3MWYW 1IKMA 4NW2A 4XT3B 1ESRA 1DZ1A 2X6LA 1MI2A 3LWEA 1PFNA 4ZLTF 5AFWA 4ZK9B 4O42A 1HFNA 5CMDA 2MGSA 1JE4A 1BBXC 2FMMA 1NCVA 1AZQA 3GV6A 4CJ1B 4R8IA 1ML0D 3GV3A 2HCCA 2JYOA 4UAIA 4HAEA 1B53A 4IUUA 1VMPA 5JJZA 1WVLA 1WTRA 1BF4A 1ICWA 2L4NA 4IUPA 5E4WC 1B3AA 2K01A 1G6ZA 3HP3A 1ILPA 2MP1A 2L1BA 3ONAB 4IUVA 2Q8TA 3R93A 4HCSA 3I3CA 1PDQA 1Q3LA 1MSGA 4HSVA 4IURA 4RAUC 1WTPA 1G2TA 1F2LA 1J9OA 2RSOA 4QUFA 3H91A 1F9RA 2VXWA 1CM9A 1KNAA 4OIJA 2JP1A 1X32A 1EIGA 1NR2A 1BNZA
chains in the Genus database with same CATH superfamily
1TS4A 2XVSA 4L5QA 5M3MH 4DR5L 1WD1A 1WTOA 1PTOF 1UAPA 5C4HA 3Q24A 4LUVA 3W1GA 1VQNA 1CQFA 2EDGA 3GTGH 1HNXL 2FHTA 1E2WA 1ZKOA 5C4ZA 2F3IA 5IGCA 3Q23A 2BCOA 4A3KG 4A3MB 5COYA 5IP7H 5IGGA 4RCOA 4LF6Q 5LMUQ 1CZGA 1IHZA 1J8IA 2DNCA 3C1FA 5IOCA 2PQEA 2O2LD 4JBMA 2R93G 5JJLA 3R2IA 2NYZD 2UU9Q 1XPUA 1E2ZA 3IFTA 3X3NA 1NMFA 1P16A 3NSWA 3KJPA 3MVVA 1H9MA 2J0TD 4LF4Q 4ABNA 2AHOB 1PFMA 2OEOA 2RDGA 4N8X1 3IRBA 4DR4L 2FXQA 1EL0A 3MXPA 3H0GH 2CHBD 4OEMB 4JI6Q 1IYVA 1LYLA 4NXMQ 3NHHA 2KCCA 3Q22A 3MAQA 4LF5L 2VQFL 1GD7A 1LTID 3M3YB 3CD6A 4ZCKA 2PQAA 2DJGC 4A3MG 2KA7A 2E5LQ 3CRLC 2IWHA 2ZM6L 5CV8A 1JB7A 4KJNA 1L0YB 2RSNA 2UXCL 1YJNA 3ICEA 2F0FA 2D0OA 4DR1L 4K0KQ 4OIKA 2TSSA 3PIO3 3LX0A 1ICFB 5A2QE 2R7ZG 2NVQH 2DY8A 4BY1G 1S5ED 4MN3A 1RD9D 2HIXA 4A4IA 5CBEE 2VW9A 4P74A 3G6JB 3EN2A 2PMZE 1HTPA 5JVH3 3RN5A 1EYDA 3MXNB 3RZDH 4JVZA 4O42A 3VR5A 5E7NA 3TS2A 4LAAA 4B3TL 4NP5A 3S16B 5J1ZA 3VR2A 4A3CH 3QIAA 1VQLA 2VQFQ 2RCNA 4NXNL 1B3AA 2MO0A 2UUCL 1EUJA 1HH2P 3BU2A 3DWPA 1ILPA 4IUVA 2HQEA 3RLOA 4DUYL 4P2CB 1BCPB 1G2TA 4CKBA 4MNOA 1I3QH 1RDPD 1SE3A 3UDIA 2A69C 2OT2A 4C2MB 4BY7H 1K9MC 5C3WA 1GUTA 2SEBD 1VQBA 2R7DA 1HA5A 2YU9B 3K7AH 2RDFA 2R7ZB 1M8AA 3ND9A 3PIP3 2B2UC 1STNA 4FXGC 1CKOA 4GZYC 4IPGA 1PRTF 4ME5A 5A35A 1IW7C 3J7ZC 1VQOA 1X6OA 1NJIC 3PO3H 3K8AA 3F2BA 1SYBA 4KHZA 4KMUC 1HFGA 2CH4W 1TWGH 4B3TQ 1EQVA 3D4DA 1K8MA 1TS5A 1KRTA 2EJMA 4JI8L 2M00A 1S4ZA 2UUBQ 2F0DA 4FNFA 1OXTA 1U4RA 5FLMH 1B9MA 1EU3A 3TREA 2I46A 5BN5A 4CDFC 3F2UA 2JQOA 2KENA 1F9PA 5K36G 2WINB 1FGBD 2K7VA 5LHY1 5LL6X 2HT1A 1PH6A 5IIFA 1MSHA 1E2VA 2F1MA 2L11A 4A3DH 4DR7L 1EY9A 4JOIC 4RGNA 4G7OC 1HCZA 2KECA 4E6IA 2KEEA 1UUPA 3OTOQ 2D62A 3CCEA 1C4QA 4DK1A 1UE7A 2JA6G 3R2TA 4RKLA 2YTVA 1K0RA 5HGQA 3W5OA 4DAYB 3K0YA 4HIKA 2N78A 1FNWA 3BZDB 4C3HB 1G8ZD 4LMQD 4LF8Q 1E1OA 3OWEB 5J22A 2KJXA 2Z4HA 5DM63 1LTGD 1IYUA 2QILA 4HJ8A 2RHQB 4HN7A 4WRDA 3VYTA 2XTIA 1G291 4KY6A 4HIDA 2Y0SB 5I6YA 4QB4A 3NWSA 4DR6L 3PO2B 3G6EA 2XNAC 4B9XA 4KY5A 1SBBB 5JPNC 4LFAQ 2HCCA 1I6HH 4G7ZC 2NTTA 3A8IE 2PNRC 4LF8L 1PZKD 2AWOA 2C5CA 1B70B 3JAML 5GAEC 1D5MC 1AN8A 2AUKA 4FVMA 4FXDA 4O0AA 1Q1BA 4OWTB 1F2ZA 1NNXA 1QUQA 2F0GA 4IUTA 1IKLA 2NZ1D 3E0JA 3QWNA 4GOPA 3TSSA 2HDMA 3RNUA 4K2KA 1E0BA 2R92B 4OX9L 2SDFA 5LMNQ 3CCSA 3S15H 1JB3A 1D7QA 2LMCB 3U50C 1PZJD 1CA6A 4KHVA 2VQEQ 1YNNC 2NBFA 2QCPX 4DV5Q 1Q46A 4LF4L 2N88A 1LTSD 4RMFA 2ZT9C 5FO9B 5ELBA 1JWSD 4R8NA 1N9WA 4DKAC 1DM0B 1HR0L 4QIWE 1RL2A 1S72A 3RUZA 1E24A 1EIFA 1FD7D 3AFPA 2R92G 3VYSA 5EPKA 4AYBG 3T56B 2F3WA 4ULLA 1EWCA 4BBRB 2E8GA 2J7ZA 2EQSA 4Q0FA 3I72A 1RKNA 1UE1A 2NWGA 3HFZB 2B39A 4H44C 5IYBH 1KRSA 4DV7Q 4QCLA 1GUGA 4DR3L 1YNXA 4POFA 4KK7A 1OXUA 4OO1G 1SDFA 5I4DA 1A63A 4GNXB 1E3PA 2A6EC 1KAAA 4IPDA 4DF7A 5G3LD 1QNUA 4A3EH 3A8JE 1OO9B 2BA0A 1EU4A 3ULPA 2EY1A 3TP6A 5CMDA 2LFNA 1JE4A 1YIJA 1FVIA 1Q7YC 1JMCA 1V9PA 4LNQA 3N6RA 5IE8A 2RDHA 2UUAL 3EROA 4JI7Q 4AQYL 2VZAA 2PYKA 2NZOA 2MP1A 2F0LA 4J1MA 3R93A 3HOXB 2D5DA 4P72A 3S1QB 1V1QA 5IGEA 4DXFA 3H91A 3OOCA 4A3BH 3BDCA 1MJEA 1EIGA 2K5QA 1BNZA 2QA4A 4V190 2R3ZA 1Y14B 1D5ZC 2K33A 1PH2A 4UY8C 1TY0A 3SDZA 3HOXH 4XIGS 3NQIA 2CWAA 4QGUA 5JAVA 1IXRA 4RG1A 1KXLA 3KLSX 4PMCA 2BH2A 5D3IB 4LF9Q 3PO3B 4A3GB 2Q2TA 1XPRA 1ZEQX 4DV3Q 2B2TA 5KEEA 5C3EH 1CHQD 1XMQQ 4JI8Q 4JI1Q 3ULJA 3OWFA 3VA5A 2MNAA 1ZYRC 1L1OC 2A5HA 4DV5L 3BDLA 4GLVB 2JXMB 3G71A 3Q0AA 1B9NA 3AB9A 1HA6A 2NVYB 4JPBW 2Z6KA 1JICA 3H6MA 3HOUB 1IYJB 1E22A 1X3PA 3BVZA 3IAYA 2QW7A 1FL0A 2L15A 1FNVA 5G3LF 1DGSA 1WOCA 3S2HH 2WIIB 1MIUA 1STEA 4ZUIA 1O80A 3PO3G 2VUMH 1UE6A 4N8FA 3K59A 4LF7Q 2RQXA 1NR4A 1TU2B 1I94L 1AE3A 1AFPA 1LTBD 1A2TA 3KDFA 1SYGA 3NTHA 5FO7B 4FF1A 1VQ4A 3I2ZA 1VQPA 1Y8NB 3A5ZB 3ZJYC 1B7YB 4DV0L 1EEID 1YBYA 1F2YA 2NVXH 4KD4A 4BXXG 4IJLA 4OONA 4L8JA 4F8MA 1R9TH 3K5LA 4ZK9B 1WCMG 2B63B 3HOYH 3U4ZA 3HOUG 3VYUA 1IBLQ 4A3DG 4DAPA 1LT4D 3I4NG 1EY7A 2EYPA 4C1NK 1SYFA 3GTMB 2A6HC 2PI2A 2A6HD 1G6ZA 1R9TB 4A3FB 1YJ9A 3CAMA 1BCPC 2VXWA 3TRZA 4JI4L 2KHJA 3NTKA 2HHHL 1NR2A 1LT5D 2K5VA 3F8TA 4XDXA 2H1EA 4IFDH 1SYEA 4K8IA 1N34L 3MXGA 2VL6A 5IWAL 3DEPA 4WJ3M 4ZAIA 3FKIB 1ESFA 5EAYA 3K5MA 4H13C 1SEBD 2X6GA 5D14A 1OXXK 1SE8A 2AWNA 1TWAH 5CBAE 3PIOA 1NY4A 3L3OC 1I3QB 1SNCA 2M2LA 1U4LA 3FDTA 5E3FA 3CQZB 4C3JH 4Z9CB 5DM73 2X69A 1I50H 2UUBL 4C3HH 5M3MB 1RTOA 2KVMA 1M4VA 1K83B 5M5WH 2EYFA 2QEJC 3RR5A 1KDCA 4DR2Q 4YHHQ 3G48A 4LFBL 4ALPA 1HR0Q 1OXSC 3V2TA 3LNNA 3RZDB 3CCRA 5CR3A 1EYGA 3STBD 3SXHA 2LKVA 5EBCA 4LF6L 1T9HA 2AMCB 1XWEA 3H94A 4IN3A 2JK8A 5C3XA 1W6KA 4TKOB 2L55A 2QDBA 5C44G 4POGA 4GNXC 1IL8A 4CDCC 1EEFD 1LACA 3KLRA 1EY0A 4KY7A 1PTOB 3M85A 4DUYQ 2JA5H 2O5IC 3JC66 3H09A 4IALA 5KGUA 5JEAG 4DUZQ 4FO2A 1MHWC 2BH8A 1L2FA 1KD1C 3FRPB 1FJGQ 4X64L 4IFDJ 2VB3X 3N52A 2HQLA 3QOJA 4HJ7A 2B2YC 2HCIA 3J80E 4XT3B 5FJ8H 1ENFA 1ESRA 4LFBQ 5FLXE 3GQBA 3LWEA 2ICEC 4BA2I 1PFNA 3L7ZC 1TWGB 4C3IB 3T53B 4EGVA 4ODGA 1AZQA 3GTLB 4X66Q 2R92H 1J5EL 4A3JH 1OTCA 5LMNW 1ICWA 5E4WC 3EIVA 1XTDA 4K5VA 4K0KL 5BN4A 3KF6B 5I6WA 3LWUA 3GTQH 3C2PA 1VCIA 5AJ3L 1HZBA 1MSGA 3S1RH 1H95A 2DJFC 1DJRD 5ELOA 3QJYA 3RMHA 2OXPA 4DGZA 3CMEA 1SMYD 3OHXC 4A3LG 4X3TA 3S17H 3GTMH 4XT1B 3WWVA 2SNMA 1I4HA 1SYDA 4L6TB 1S5CD 4JYAQ 3F1ZA 2BDNA 1WTQA 4IUQA 1EY5A 4R1JA 1NBWA 3I90A 3OTOL 1Y69U 4DNTB 5GQOA 2K1BA 1O7ZA 2A74C 4ZQ3A 5C0XH 1QWYA 5AJ3Q 2DY7A 4Q5VA 3DWQA 1A15A 5IYDH 4DR3Q 4UHVA 5IT9c 4KI0A 4QY7A 1W2BA 3NP8A 4KKSA 4Y7NH 5GAHC 1G91A 3E5SA 1NE3A 2RCFA 5C0XJ 3DMUA 1HZCA 4KN4C 4A93G 4MTKA 4QMGA 2B2VC 4X64Q 4A3BG 3GP7A 4K14A 4ID6A 5K5PA 3TS0A 3VR6A 1VQJA 4OWXB 3HKZG 3IL8A 1STGA 3E9HA 4EQNA 3GD7A 5IGFA 1X65A 4CKEA 3L9AX 2HD3A 4NKLA 3M3YH 4EVOA 2B8FA 1TS3A 1KLGD 2E2IB 2XWBB 2WKCA 3M4OH 4IOAA 1H9SA 1X3GA 4OHJA 2FINB 2J4XA 5CV7A 2XRSD 2PPBC 4GKJQ 3AEVA 3S16H 5EGTA 5A2QL 4R4OA 3CPFA 4DV0Q 1QG7A 2RVLA 3U9SA 4HTHA 2WKDA 4K5WA 5I9OA 1XJVA 4BBSG 1KQSA 4HIOA 3OSOA 4A3FH 1HNZQ 4B3ML 1HFNA 4WFN3 3H0GG 1BBWA 3HS0C 3I7FA 3BVGA 3F2CA 1BVSA 3HKZB 3GTPB 1Y1VB 2CH4A 1EQQA 1Q1EA 3MFYA 4IUUA 4G7HC 3CRKC 1NSNS 1TWAB 4FF2A 1Z9FA 1V1OA 3I4MG 3HOVG 3S1NB 5GAGC 2JJQA 4OIJA 1X32A 1K28A 1SE2A 4JI6L 4DAYA 1JR0D 2D2CC 4BY1H 1GXDC 4XQJA 2NB0A 2D9UA 1BCPF 1GO3E 2OTJA 5FO8B 1QNKA 2EVBA 2NN6G 4G57A 3RD4A 3SE0A 3GTOH 3S2DB 2B2YA 1P8LA 1WCMH 1RODA 3E3XA 3M7GA 3H0GB 2PNHA 2ZXOA 1AP0A 1B4OA 1EYAA 1QB5D 3EJIA 5E4XA 1Y1WB 4H0LC 1EWIA 1HXYD 1XNRQ 1S5FD 4DR2L 4JI5L 3KF8A 2MPMA 2CFMA 2JEBI 1EOTA 4R4QA 2JN4A 1O7IA 2K50A 3FPUB 1M1KC 1VQGA 4RA8A 3K5NA 2N3SA 3M9BA 1JCKB 3I4LA 3ND8A 3L0OA 1TWHH 2A69D 1Y1VH 1SMXA 2QDLA 1XX8A 2H5XA 2PQAB 4L5TA 2F4IA 4DV7L 3KJOA 4IZ8A 4DK6C 4A3KB 1EY6A 2ZTDA 3EBEA 1N36Q 3HKSA 3OPOA 2OF1A 1EZ6A 1U0LA 4L5SA 1EYCA 1EFWA 1VQ7A 2V1CC 2QEXA 5KRUA 4X3SA 2R93B 3KK7A 4KHPL 3U58A 3J80i 1QVGA 3PIPA 1I4RA 1TVXA 3PF4A 1IKMA 1L0XB 1D2BA 1VQ9A 4A3GH 2WAQG 1MI2A 4HSPA 3CCVA 4DPGA 3I56A 3KYHC 4CDDC 4AH6A 4J6HA 1NMGA 1XMQL 2OQ0A 3KOJA 3UE1A 3CCMA 1BDOA 1VQ5A 4MIUA 1NUCA 1S5DD 2Q2UA 2IT1A 4HSVA 4DFAA 1SFOH 1J9OA 3I73A 5M5XB 2K5WA 1CM9A 5JEAH 1C7YA 2F0TA 1WTXA 4P75A 4Y7NB 4KKUA 2EYJA 3J81L 5ELCA 2ZJRA 3FEWX 4B3RL 1J6QA 4TRDA 1TWFB 2WB1B 3CCQA 1GUOA 5IYCG 2KOLA 5IP7G 3PSIA 2L9HA 1X3EA 1L1OA 1I94Q 2O4XA 2WP8J 2ZJPA 2R93H 2MQHA 1M90C 1AW7A 1QOHA 4QJFA 2R7FA 1H9JA 4UDUC 2IY5B 1MGSA 2Z6KC 1TWCH 4DR6Q 2F0HA 4HR7B 1O7YA 3D4RA 2R6GA 1HUNA 3K5OA 1SAPA 1ASZA 1K8GA 1V43A 3P75A 3GTLH 4MHEA 4JI4Q 2VY3A 2NVYH 1Y8PB 2LY7A 4AQYQ 2ZM6Q 1LV9A 2LS01 1YI2A 2ZXPA 3FP9A 1JWMD 3LGJA 4C2MH 4JI0L 2PMZB 4CKCA 2R61A 1Q82C 1TWCB 2Z8LA 5GROA 4LFCL 2A73B 2F0KA 3MC0B 3BYTB 1K3RA 2AUJD 5JOBA 2JA7G 4A3MH 1IZ6A 1E7ZA 3NBHA 4JBJA 2PCFB 5C0XG 1CA5A 3M4OB 2EYOA 5FK9C 2CVRA 4YY3Q 1PH3A 2EPBA 4QF4A 1FJGL 1F9SA 1X3FA 3RN2A 3NPPA 3PUZA 5KNDA 4GN5A 1JOQA 4GNXA 1XMOL 1PV4A 3QR8A 3DHQA 4NPSA 1SSOA 3J7AF 3WOEA 1T5XD 3S15B 4NXNQ 3SK5A 3X3MA 4ZLTF 4R4CA 4FF3A 3NXWA 1BBXC 2UXBQ 2IHEA 4CJ1B 4R8IA 1ML0D 4BY1B 2JYOA 4A3CG 1KDBA 1DD2A 3C46A 1LM0A 4HCSA 3I3CA 4DV4Q 5D3DA 2NVXB 1WTPA 1SFOB 5IYBG 2F0IA 1KNAA 3BZCA 3IFDA 1JOOA 5EKIA 4LUZA 3M4QA 4DNRB 2UXBL 4OO1H 4U68A 4PMWA 1B8AA 1X56A 3JAMi 2E2HH 1DONA 4A76A 4I7ZC 2DGYA 4JG2A 4KJOA 1U9RA 5DAUA 2GVBA 1PH5A 3PO2G 4A93B 5C3EB 1DOKA 1EIYB 5BN3A 4K2LA 5KNBA 3J80c 3GTKH 2K5HA 4KD3A 3PV0A 4AYBE 1JE5A 3TZUA 5M5YB 1LO5D 4A3IH 1WTWA 1KL9A 1G2SA 3MTSA 1C8CA 4JYAL 5HY6A 5ISRA 3A74A 4IPCA 4IPHA 3HOWG 4X3UA 4J15A 1YNJD 3VDYA 2WACA 3TDQA 1LUZA 1EOVA 5EKLA 3SK6A 1SNMA 4DV2Q 3CW2C 4K6DA 3AMUA 4H02A 3BJUA 3UE0A 3NENA 4GLXA 3ERSX 4OX9Q 3K80C 4UP8A 1VQ8A 2NN6H 1WD0A 1G6PA 2XN9C 2ICIA 5FOBB 2YTXA 2B2WA 1EQRA 5C3EG 3S1QH 1F2MA 5M9OA 3U9OA 4NDXA 4FYDA 2VQEL 3AU7A 4LF5Q 5CC4A 1LTLA 3VR4A 3CF5A 4JI2Q 4H7BA 5J3BA 3S17B 3A7LA 3NEMA 3TEHB 1RJTA 3EFXD 3CC7A 5HGTA 1VDZA 1CZWA 1JQYD 3J7A5 1EY8A 3HOWB 4DR1Q 1CKNA 4F7XA 3DUZA 2QKIC 2D0PA 4B3RQ 1MJCA 3K57A 3I4MB 4GN3B 3H3VI 1SNOA 1N32Q 1HNWQ 2A68D 5JEAJ 4EQ5A 1HNXQ 1QJOA 5JJIA 2AKWB 3FPPA 4V0BA 2EXDA 4IUPA 1U5KA 4KV6A 4A3IB 3D8GA 2K01A 5EKKA 2LSSA 3VA7A 4ILWA 4A3EB 1VQDA 3AYHB 4YCWA 1HRJA 4QUFA 5F2DA 3OMCA 1NAPA 3MXNA 3T13A 5ELFA 5KYIA 3T1HQ 4B3SQ 1JOKA 3ULLA 1TQOA 4C3IH 2V4DA 3B6YA 2K03A 2CCZA 3T1YQ 4EQOA 3GTJB 4F88A 1IL2A 1RCVD 2JEAI 4DV3L 2K32A 5E1FA 2IJ0A 5ELNA 4A3KH 4U673 2MUYA 1IBMQ 1HUMA 3S24A 2I07B 5EQ0A 5DEHA 1HNWL 1WJJA 4KHPQ 1CTMA 2H4OA 2B2VA 4A75A 4B3SL 5H1SE 2YTYA 3DM3A 5DLQE 1ENAA 3S9WA 1CKMA 2I5MX 1I6VC 1DOMA 2XRQD 1KIXA 2E5LL 3KF8B 2EY2A 1QVFA 3HOZB 2KCMA 4TSSA 2BA1A 2VNUD 1QE6A 1QCBD 3K58A 4IQZA 5FKAC 3S1NH 1JORA 1A8VA 5KIXA 2K04A 2A68C 1B50A 4PZ6A 1N32L 4TQUS 3PCOB 2EE1A 5IYCH 4IOCA 2IW3A 2LXKA 4X62Q 2F0WA 3NWTA 2WAQB 4JW0A 1S40A 3NELA 1B3QA 3NK9A 3P7JA 2XWJB 3MEHA 4DAVA 4LUOA 4CJ2C 3TBIB 4L63B 5EPLA 1KAWA 2DNEA 4WORA 3PUXA 5L37A 2RBMA 3J80L 1HJPA 2NZHA 5C4JH 5M3FG 1PYSB 4IUNA 5FLXL 1IBKL 2F3VA 1YITA 1DXMA 1CUKA 4JI3L 3HOYG 3M4PA 2K75A 3UDFA 1SNDA 2G9DA 2NUCA 3D3RA 4RKBA 1KC8C 1Z7TA 3T51B 5JJZA 3I4NH 4ZYSA 1VQMA 2NN6I 1WI5A 2PZUA 1GKHA 3P20A 4HJ9A 1BR9A 4BA1I 2F0NA 4GKKQ 2XSCA 2JP1A 2HIVA 2BE5D 2B2WC 4YWMA 3W3AA 1VQAA 1HTLD 4IFDG 2XIWA 4DN4M 2K05A 4RCNA 1X55A 3HOXG 4L5RC 4DV6L 4K8JA 3HRZC 4CBVA 5M3FB 1STAA 3Q6SA 3T1YL 3EQLC 3TN2A 1AE2A 2DN8A 3V05A 4C3JG 1LTTD 3CHBD 1GVPA 2I5LX 2Z0SA 2N55A 1Q81C 2JSOA 1A3VA 4NMZA 3GTJH 1YJWA 4CJ0B 4OO1I 5D65A 1LABA 5EPJA 5EBDA 4RGTA 1SE4A 3T1HL 1CHPD 2F0SA 4DA2A 3D4WA 2ALYB 2C9OA 2CWPA 3HOZH 3SGIA 4JI7L 2L5TA 1TS2A 3URYA 2OTLA 2F0MA 4LK1C 1PH4A 1LTRD 4RFBA 5K36H 1VQ6A 2UXDL 1HZAA 1TXYA 4YCUA 1QVCA 3K6OA 2IPKD 4XQQA 4DK3C 2SNSA 2G9HD 2EJFC 4B9WA 1EIHA 1TT2A 4IJHA 5C0XI 1RF2D 4HMIA 5CV5A 2Y0SG 4OELB 4C3JB 1TWFH 2JA5G 5HURA 4JI2L 1UE5A 3PUYA 5M3MG 2R7ZH 3QO2A 2F0PA 4PNYA 4BWGB 5I2XA 1LTAD 2ZXRA 3PF5A 2N49A 2WAQE 4TVAB 2HDLA 4NW2A 3NQTA 4DAMA 2PZTA 2X6LA 3RLNA 3R3OA 1WTHA 1O7LA 2MGSA 1JWUD 2PZWA 1MD2D 3K0XA 2F4VL 5C5LA 4LF9L 3E9IA 2JA8G 3BG3A 1CKNB 3KLWA 2K4KA 1JC7A 2ZJQA 4GN4B 4JV5Q 3VR3A 3J81c 4O2DA 1TY2A 1WCMB 3K81C 2B63G 3TP5A 3CMAA 2K6AA 3NE5B 1K73C 4A3DB 4K6LA 5I9PA 4XQNA 2F0OA 4YIJA 4AIMA 5DNFA 3JAME 1PFBA 1G51A 1EZ8A 1Q86C 4IO9A 2IX1A 3CC2A 3BVMA 4BBSH 3OYYA 3CKIB 4NB3A 3RZOB 2E76C 1PYWD 3DXJC 1L1OB 3ZYYX 1VF7A 3NBIA 4YY3L 4F87A 1D1KA 3ERQA 5JVG3 4C3HG 2YU9H 1SLJA 2ID0A 4I65A 1R4QB 1DOLA 1I4QA 4GKKL 1K8OA 4DU9A 1Y8OB 5KYLA 3HKZE 1HNZL 4B3MQ 2F0UA 3S1MH 4AYBB 1ASYA 3GTQB 1C0AA 3CQZH 5FLMG 4A93H 3PMFA 3FMCA 3RLFA 4BBRG 4JBWA 3BYYB 1Z47A 3I70A 1GHKA 5EJWA 4DV6Q 3ER0A 2KCNA 2P5ZX 5M5YH 3KUPA 2KBNA 3K7UC 4R9WA 4JK1C 4JI3Q 2IX0A 4J8QA 4R4IA 4DR5Q 1PRTB 1EQTA 1F77A 1PTOD 5IGBA 3CC4A 1K0SA 3Q8DA 5IGDA 2F0VA 1HQRD 3OIQA 1I5FA 2WV6D 1A3UA 1HR0W 4JI5Q 3OMGA 4BY7G 3KBXA 3I55A 5LL6S 1LT3D 4QL5A 3EA6A 2KQ3A 1Z6HA 2IHFA 3AFQA 3E0EA 3PUWA 5T1IA 5KNCA 5C44B 4IFDI 2E2DC 1SNPA 2CKZB 4DNIA 1PRTC 1TR5A 3CPWA 4GOPB 4FDBA 1XNQL 1TIID 4OXPA 4A3EG 3RZOH 3TQYA 1D6EC 1KLUD 1VQHA 2ZTCA 2PW5A 4YHHL 5CYUA 1CSQA 4PZ7A 1CK1A 3A7AB 4A3JG 5FLXc 3W1BA 1WTRA 2EYMA 1V8QA 1A2UA 1YHAA 3GDEA 3QG1A 3FVQA 3OW2A 3HEJA 2IX3A 4BY7B 2FMCA 4OGQC 1YNND 1K3BC 2ENBA 2E2JH 3J81E 1SN8A 2O5JC 1ENCA 2OWOA 3MZ5A 2EYHA 2EY6A 4X66L 2GVAA 1B1ZA 4MZ9A 4DR4Q 4HCEA 4N9PA 1GUNA 2XGTA 3EVQA 4PMBA 3TP8A 1A6XA 1HPCA 1Q12A 2HHHQ 1PZID 3V96A 1X3QA 3FHWA 2VUMB 1GHJA 1WTVA 1U4PA 3OW7A 1UEAB 1B2TA 1YVCA 4S3SA 2TMPA 3C1EA 2PI2E 2VS1A 4A3JB 2MHVA 4XYOA 4PG3A 1SROA 5C4XH 5IP9H 5BR8L 3SK4A 4Y52H 1STHA 3HOVB 1GOZA 4PQXA 1XMOQ 3D6WA 1CSPA 1S5BD 1JT8A 1PXUA 1A62A 1DYQA 1VMCA 4B08A 2KUMA 5GADC 4ZKBB 4UP7A 1VS0A 2EXZA 4XTCS 1AZPA 4P71A 3J81i 3TMEA 3I91A 4RGOS 2Q8RE 1H9KA 2VUMG 3A54A 3DEOA 1SXTA 2Z6BA 3CCUA 5IWAQ 1BBUA 4RWSC 1VQEA 5C5MA 1GUWA 1QZGA 1BKBA 1JJCB 3WDNA 2UUCQ 3PQIA 3HOYB 3BZKA 2EJGC 2MJ8A 3T16A 3I8ZA 3MA2B 2N8NA 3CP0A 2KEDA 2L12A 5IY0A 3DM1A 3MWYW 4X65Q 4OL7A 2F52A 1YHQA 1PH9A 4A3GG 3S2DH 1RIPA 4A3FG 5AFWA 3HOUH 1EWHA 5LMNL 2FMMA 1I4XA 1SJHD 1UNSA 1VQFA 3GV3A 5ELDA 2NTSA 1XNRL 4ZUJA 3AQQA 3ITPA 2NVTH 4HAEA 1IW7D 1TKWB 1VMPA 4UP9A 2A19A 3QB3A 1X54A 3FKIG 4XXEA 2ES2A 2E2IH 4DXGA 3I4MH 1K8AC 4EQPA 1PDQA 1GM5A 3A55A 4K5XA 4WJWA 1F2LA 2RSOA 3E6ZX 1D8LA 3QOLA 2I0QA 3NUCA 1BQQT 1Q8IA 2JA9A 1ZYRD 4NXML 1V1PA 4RGMA 3NTIA 2FJ2A 1EY4A 4LJZC 3A8KE 4DV2L 1D5XC 1SR3A 3C3LA 3J81j 3S14B 4RHRA 3W2DA 3OIPA 1IBKQ 2F4VQ 3GO5A 2E2JB 1YHBA 2KHSA 3CCJA 2K5DA 4HEDA 5C4JB 1NTGA 5TSSA 2BE5C 1XYIA 1I4GA 4ZRZA 4KTAA 1EFID 1WFQA 1ET9A 2CW0C 2JA8H 4JV5L 1CI3M 5CORA 4PZ8A 3KLSA 1SJED 1YZ6A 1II3A 2A8VA 3PUVA 2EOTA 1V1PB 3TZDA 2B63H 4APVA 1BO0A 1I4PA 4YCVA 1D1IA 2RHSB 1QILA 1Y1WG 5CV6A 1PA6A 3K7AB 2JA5B 5ELEA 2RA4A 1JJ2A 1XXGA 1FNUA 3I4NB 3S14H 3M4YA 3SHLA 3SK8A 5I2YA 5C44H 1PFSA 2CQAA 1SNQA 4CDEC 4LFAL 4DK0A 2EZVA 2K52A 2OQKA 4DV1Q 4ZKCB 2K28A 4M8AA 1W6JA 4FXKC 2LXJA 2MO1A 2JA8B 2KHIA 1SRUA 2AQ2B 3S2HB 4BXXH 3HOWH 1DZ1A 4BBRH 4HJ5A 1AH9A 3IKJA 1KHIA 3MHBA 1N33L 3KFUA 1TWHB 1NCVA 1KDAA 3MEFA 4P73A 1I6HB 1B44D 4M1UB 5CV4A 4X62L 3S1MB 4YWLA 3UDXA 1S3OA 1BOSA 1GUSA 2ZTEA 4OWWB 2L0CA 3A5UA 3CXCA 1E1TA 1WYDA 2EYLA 2JA7B 5C6AA 1VQCA 2L1BA 3ONAB 4GOPC 4RAUC 1HHVA 2E75C 1LT6D 5NUCA 5BR8Q 2BDOA 3BS1A 4R4TA 4CGYB 1PLFA 3SVMA 1H9SB 3D6CA 4LFCQ 1BXTA 1FYCA 1PH8A 1N34Q 4N9TA 4HMJA 2PW7A 1FR3A 5IT9E 2NVQB 2EIFA 2AQ1B 5M5XH 1F9QA 3H3VC 2OCEA 4DUZL 1T5EA 1DCZA 5IT9L 2ATWA 3STBC 4A3BB 2GA4B 2MFIA 1IBLL 3NBHB 2RF4A 4UPAA 1ILQA 3H3VH 2Q2IA 5C4XB 4JOIA 3G7LA 2FFKB 2B2TC 1AEXA 2BOSA 1KTKA 1STBA 4XYQA 2GN5A 1GJXA 4QIWB 1VF5C 4C3IG 2A1AA 1YNJC 3UI2A 4X6AH 1HQMC 5J39A 1U4MA 2PO4A 1KNEA 1L0WA 2JA7H 4DR7Q 3JAMc 4EX5A 4QQBX 1Q8KA 3S1RB 4KLKA 3T4AC 2YV5A 1XPOA 2WB1E 3P1HA 3H15A 1K83H 5M5WB 2IL8A 1W3SA 3U4VA 3G4SA 3KF6A 1KABA 1IBML 5IP9G 5C4XG 2JA6B 2M9VA 2JE6I 4G4KA 3WOFA 4GKJL 5FJ8G 1A0IA 1LLRD 2ASBA 1H9RA 3TP7A 3MXUA 2I5HA 2K5NA 3CU7A 1PTOH 4BS9A 4DV4L 5JJKA 2E74C 1PYBA 2K14A 3MFGA 4MTNA 2QF7A 2NVTB 4UAIA 1N36L 2F0JA 3KBGA 1WVLA 4O1NA 1BF4A 1VQKA 4ME3A 1FGUA 1N8RC 4FF4A 4JI1L 3HP3A 2QGQA 4JC0A 2UXDQ 1UEBA 4C56C 1F9RA 3VYRA 1CQVA 2F03A 2UUAQ 2B3GA 4JBKA 3DWAA 3UDGA 1PHJA 4A3LH 2B29A 3M7NA 1PH7A 3A0JA 2DUDA 4WJ4A 2A6ED 3D31A 4JCVE 1RHPA 2VB2X 1XTCD 5T1GA 4DV1L 3HGBA 2C35B 2JA6H 2B8GA 1STYA 3PO2H 1A3TA 1PVOA 1Q90A 3I4OA 4PV1C 2AQ3B 1O78A 4RH6A 1JJGA 2Z9HA 2F0QA 1BUVT 2WFWA 3CCLA 4A3IG 3FKIH 4X65L 3D0FA 1C9OA 1MKHA 4HJAA 2Q2HA 4C1NI 3KDFB 1XNQQ 1PRTD 4BBSB 3GTPH 1UWVA 4CHTB 2Y0SE 4QUCA 2SOBA 2CQOA 3PGZA 3SR1A 4I7AA 1YEZA 3BDOA 1HZ9A 1Y1VG 4LWCA 1I50B 2E2HB 1N33Q 3HZXA 5CV9A 2YYZA 3O13A 4YWKA 1PMRA 1CFMA 4GLAC 2Z4IA 4FP5D 3A56A 2RKSA 1VQIA 2UXCQ 1C48A 1CT1D 1SMYC 1ONLA 1ZXTA 4LW1A 2B2UA 3GTGB 5CGKA 2KCTA 1SYCA 3DLLA 2HUGA 4HIMA 4X3KA 4KN7C 2CW0D 3HG9A 4LF7L 1RTNA 4GS3A 3F2DA 3GTOB 3J7YW 1BCPD 3HOZG 1J5EQ 5M3FH 3L2PA 1X9NA 1OXVA 1QUQB 1Y1WH 5LMUL 4RHSA 2Z1CA 3J7AV 3GV6A 1QZHA 5IYDG 2EY5A 1B53A 1PH1A 2G5DA 2UU9L 5JPMC 1MBYA 1ET6A 2F0EA 2L4NA 1PTOC 1R4PB 2Q8TA 3HOVH 4KKTA 2Q8IB 1Q3LA 5IODA 4IURA 3R8BA 4JI0Q 3SEBA 2WB1G 3GTKB
chains in the Genus database with same CATH topology
1TS4A 2XVSA 1WD1A 1WTOA 1PTOF 1UAPA 5C4HA 3Q24A 1CQFA 2EDGA 2FHTA 1E2WA 1ZKOA 5C4ZA 5IGCA 3Q23A 2BCOA 4A3MB 5COYA 5IGGA 4RCOA 1CZGA 1IHZA 1J8IA 2DNCA 3C1FA 5IOCA 2PQEA 2O2LD 3R2IA 2NYZD 1E2ZA 3IFTA 3X3NA 3NSWA 3MVVA 1H9MA 2J0TD 4ABNA 1PFMA 2OEOA 2RDGA 1EL0A 3MXPA 2CHBD 1IYVA 3NHHA 2KCCA 3Q22A 3MAQA 1LTID 3M3YB 2KA7A 3CRLC 2IWHA 5CV8A 4KJNA 1L0YB 2RSNA 2F0FA 4OIKA 2TSSA 3PIO3 3LX0A 5A2QE 2DY8A 1S5ED 4MN3A 1RD9D 5CBEE 3G6JB 1HTPA 5JVH3 1EYDA 4O42A 3VR5A 4LAAA 4NP5A 3S16B 5J1ZA 3VR2A 3QIAA 1B3AA 3DWPA 1ILPA 4IUVA 2HQEA 4P2CB 1BCPB 1G2TA 4CKBA 1RDPD 1SE3A 2A69C 2OT2A 4C2MB 5C3WA 1GUTA 2SEBD 2YU9B 1HA5A 2RDFA 2R7ZB 1M8AA 3ND9A 3PIP3 2B2UC 1STNA 4FXGC 4GZYC 1PRTF 4ME5A 5A35A 1IW7C 1SYBA 4KHZA 4KMUC 1HFGA 1EQVA 3D4DA 1K8MA 1TS5A 2EJMA 2M00A 1S4ZA 2F0DA 4FNFA 1OXTA 1U4RA 1B9MA 1EU3A 2I46A 5BN5A 3F2UA 1F9PA 5K36G 2WINB 1FGBD 2K7VA 5LHY1 5LL6X 5IIFA 1MSHA 1E2VA 2F1MA 2L11A 1EY9A 4RGNA 4G7OC 1HCZA 2KECA 4E6IA 2KEEA 1UUPA 2D62A 1C4QA 4DK1A 3R2TA 4RKLA 3K0YA 1FNWA 3BZDB 4C3HB 1G8ZD 4LMQD 3OWEB 5J22A 2KJXA 2Z4HA 5DM63 1LTGD 1IYUA 2QILA 4HN7A 4WRDA 3VYTA 1G291 4KY6A 2Y0SB 5I6YA 4QB4A 3NWSA 3PO2B 2XNAC 4B9XA 4KY5A 1SBBB 5JPNC 2HCCA 4G7ZC 2NTTA 3A8IE 2PNRC 1PZKD 2AWOA 2C5CA 3JAML 1D5MC 1AN8A 2AUKA 4FVMA 4FXDA 1Q1BA 1F2ZA 2F0GA 4IUTA 1IKLA 2NZ1D 3E0JA 3QWNA 3TSSA 2HDMA 4K2KA 1E0BA 2R92B 2SDFA 1JB3A 2LMCB 1PZJD 1CA6A 4KHVA 1YNNC 2NBFA 2QCPX 2N88A 1LTSD 2ZT9C 5FO9B 5ELBA 1JWSD 4R8NA 1DM0B 3RUZA 1FD7D 3VYSA 5EPKA 3T56B 2F3WA 4ULLA 1EWCA 4BBRB 2J7ZA 4Q0FA 3I72A 1RKNA 2NWGA 4H44C 2B39A 4QCLA 1GUGA 4KK7A 1OXUA 4OO1G 1SDFA 5I4DA 2A6EC 1KAAA 4DF7A 5G3LD 1QNUA 3A8JE 1OO9B 2BA0A 1EU4A 2EY1A 3TP6A 5CMDA 2LFNA 1JE4A 3N6RA 2RDHA 3EROA 2PYKA 2MP1A 2F0LA 4J1MA 3R93A 3HOXB 2D5DA 3S1QB 5IGEA 4DXFA 3H91A 3OOCA 3BDCA 1EIGA 2K5QA 1BNZA 4V190 2R3ZA 1D5ZC 2K33A 1TY0A 3SDZA 4XIGS 3NQIA 5JAVA 3KLSX 4PMCA 3PO3B 5D3IB 4A3GB 1ZEQX 2B2TA 5KEEA 1CHQD 3OWFA 3VA5A 1ZYRC 2A5HA 3BDLA 2JXMB 3Q0AA 1B9NA 3AB9A 1HA6A 2NVYB 1JICA 3H6MA 3HOUB 1X3PA 3BVZA 3IAYA 1FNVA 5G3LF 2WIIB 1STEA 4ZUIA 1O80A 3K59A 2RQXA 1NR4A 1TU2B 1AFPA 1LTBD 1A2TA 4FF1A 1SYGA 3NTHA 5FO7B 1Y8NB 1EEID 1F2YA 4KD4A 4L8JA 4F8MA 3K5LA 4ZK9B 2B63B 3VYUA 4DAPA 1LT4D 1EY7A 2EYPA 4C1NK 1SYFA 3GTMB 2A6HC 2A6HD 1G6ZA 1R9TB 4A3FB 1BCPC 2VXWA 3NTKA 1NR2A 1LT5D 4XDXA 2H1EA 4IFDH 1SYEA 4K8IA 3MXGA 3DEPA 4ZAIA 3FKIB 1ESFA 3K5MA 4H13C 1SEBD 2X6GA 5D14A 1OXXK 2AWNA 5CBAE 3L3OC 1I3QB 1SNCA 2M2LA 1U4LA 3FDTA 5E3FA 3CQZB 4Z9CB 5DM73 2X69A 5M3MB 1RTOA 2KVMA 1M4VA 1K83B 2EYFA 2QEJC 1KDCA 1OXSC 3V2TA 3LNNA 3RZDB 5CR3A 3SXHA 2LKVA 5EBCA 1XWEA 3H94A 4IN3A 5C3XA 1W6KA 4TKOB 2L55A 2QDBA 1IL8A 1EEFD 1LACA 3KLRA 1EY0A 4KY7A 1PTOB 3M85A 2O5IC 3H09A 4IALA 5KGUA 5JEAG 4FO2A 3FRPB 4IFDJ 2VB3X 3N52A 3QOJA 2B2YC 2HCIA 3J80E 4XT3B 1ENFA 1ESRA 5FLXE 3GQBA 3LWEA 2ICEC 4BA2I 1PFNA 3L7ZC 1AZQA 1TWGB 4C3IB 3T53B 4ODGA 4EGVA 3GTLB 1ICWA 5E4WC 4K5VA 5BN4A 5I6WA 3LWUA 3C2PA 1VCIA 1MSGA 1DJRD 3QJYA 3RMHA 2OXPA 4DGZA 1SMYD 3OHXC 4X3TA 4XT1B 2SNMA 1I4HA 1SYDA 4L6TB 1S5CD 2BDNA 1WTQA 4IUQA 1EY5A 3I90A 1Y69U 4DNTB 2K1BA 1O7ZA 2A74C 4ZQ3A 5C0XH 1QWYA 2DY7A 4Q5VA 3DWQA 1A15A 4KI0A 3NP8A 4KKSA 1G91A 3E5SA 5C0XJ 3DMUA 4KN4C 4QMGA 2B2VC 3GP7A 4K14A 4ID6A 5K5PA 3VR6A 3IL8A 1STGA 4EQNA 3GD7A 5IGFA 4CKEA 3L9AX 4NKLA 4EVOA 2B8FA 1TS3A 1KLGD 2E2IB 2XWBB 2WKCA 1H9SA 4OHJA 2PPBC 2FINB 2J4XA 5CV7A 2XRSD 5EGTA 5A2QL 1QG7A 2RVLA 3U9SA 4HTHA 2WKDA 4K5WA 5I9OA 3OSOA 1HFNA 4WFN3 3HS0C 3BVGA 3HKZB 3GTPB 1Y1VB 1Q1EA 3MFYA 4IUUA 4G7HC 3CRKC 1NSNS 1TWAB 4FF2A 1V1OA 3S1NB 4OIJA 1X32A 1SE2A 4DAYA 1JR0D 2D2CC 1GXDC 4XQJA 2NB0A 2D9UA 1BCPF 5FO8B 1QNKA 2EVBA 2NN6G 4G57A 3RD4A 3SE0A 3S2DB 2B2YA 1RODA 3M7GA 3H0GB 2ZXOA 1AP0A 1B4OA 1EYAA 1QB5D 3EJIA 5E4XA 1Y1WB 4H0LC 1HXYD 1S5FD 3KF8A 2MPMA 2JEBI 1EOTA 3FPUB 4RA8A 3K5NA 1JCKB 3I4LA 3ND8A 2A69D 1XX8A 2F4IA 4IZ8A 4A3KB 1EY6A 3OPOA 2OF1A 1EZ6A 1EYCA 5KRUA 4X3SA 2R93B 3KK7A 1I4RA 1TVXA 1IKMA 1L0XB 1D2BA 1MI2A 4HSPA 4J6HA 1BDOA 4MIUA 1NUCA 1S5DD 2IT1A 4HSVA 4DFAA 1J9OA 3I73A 5M5XB 2K5WA 1CM9A 5JEAH 2F0TA 1WTXA 4Y7NB 4KKUA 2EYJA 3J81L 5ELCA 3FEWX 4TRDA 1TWFB 2WB1B 1GUOA 2KOLA 2L9HA 2O4XA 2WP8J 1AW7A 1QOHA 1H9JA 4UDUC 1MGSA 2F0HA 1O7YA 3D4RA 4HR7B 2R6GA 1HUNA 3K5OA 1SAPA 1V43A 3P75A 4MHEA 1Y8PB 2LY7A 1LV9A 2LS01 2ZXPA 1JWMD 2PMZB 4CKCA 2R61A 1TWCB 2Z8LA 2A73B 2F0KA 3MC0B 3BYTB 2AUJD 5JOBA 2PCFB 5C0XG 3NBHA 1CA5A 3M4OB 2EYOA 5FK9C 2CVRA 2EPBA 4QF4A 1F9SA 3NPPA 3PUZA 5KNDA 1JOQA 3DHQA 1SSOA 3J7AF 3WOEA 1T5XD 3S15B 3SK5A 3X3MA 4ZLTF 4FF3A 3NXWA 1BBXC 4CJ1B 4R8IA 4BY1B 1ML0D 2JYOA 1KDBA 1DD2A 3C46A 4HCSA 3I3CA 5D3DA 2NVXB 1WTPA 1SFOB 2F0IA 1KNAA 3IFDA 1JOOA 5EKIA 4DNRB 4OO1H 4U68A 4PMWA 1DONA 4I7ZC 4KJOA 1U9RA 5DAUA 4A93B 5C3EB 1DOKA 5BN3A 4K2LA 5KNBA 4KD3A 3PV0A 3TZUA 5M5YB 1LO5D 1WTWA 1G2SA 3MTSA 1C8CA 5ISRA 4X3UA 1YNJD 2WACA 3TDQA 5EKLA 3SK6A 1SNMA 4K6DA 3AMUA 2NN6H 1WD0A 2XN9C 2ICIA 5FOBB 2B2WA 1F2MA 5M9OA 3U9OA 4NDXA 4FYDA 3AU7A 5CC4A 3VR4A 4H7BA 3S17B 3A7LA 1RJTA 3EFXD 5HGTA 1VDZA 1CZWA 1JQYD 3HOWB 1EY8A 4F7XA 3DUZA 2QKIC 3K57A 3I4MB 1SNOA 2A68D 5JEAJ 1QJOA 3FPPA 4V0BA 4IUPA 4KV6A 4A3IB 3D8GA 2K01A 5EKKA 3VA7A 4ILWA 4A3EB 1HRJA 4QUFA 5F2DA 3OMCA 1NAPA 3MXNA 3T13A 5ELFA 5KYIA 1JOKA 1TQOA 2V4DA 2K03A 4EQOA 3GTJB 4F88A 1RCVD 2JEAI 2K32A 5E1FA 2IJ0A 4U673 2MUYA 1HUMA 2I07B 5EQ0A 5DEHA 1CTMA 2H4OA 2B2VA 1ENAA 3S9WA 1I6VC 1DOMA 2XRQD 2EY2A 3HOZB 4TSSA 2BA1A 2VNUD 1QE6A 1QCBD 3K58A 4IQZA 5FKAC 1JORA 5KIXA 2K04A 2A68C 1B50A 4TQUS 2EE1A 2IW3A 2F0WA 3NWTA 2WAQB 3P7JA 3NK9A 2XWJB 3MEHA 4DAVA 4CJ2C 3TBIB 4L63B 5EPLA 2DNEA 4WORA 3PUXA 2RBMA 3J80L 4IUNA 5FLXL 2F3VA 1DXMA 1SNDA 2G9DA 2NUCA 3D3RA 4RKBA 1Z7TA 3T51B 5JJZA 4ZYSA 2NN6I 2PZUA 3P20A 1BR9A 4BA1I 2F0NA 2XSCA 2JP1A 2BE5D 2B2WC 3W3AA 1HTLD 4IFDG 2XIWA 4DN4M 2K05A 4RCNA 4K8JA 3HRZC 4CBVA 5M3FB 1STAA 3Q6SA 3EQLC 3TN2A 2DN8A 3V05A 4C3JG 1LTTD 3CHBD 2N55A 2JSOA 1A3VA 4NMZA 4CJ0B 4OO1I 5D65A 1LABA 5EPJA 5EBDA 4RGTA 1SE4A 1CHPD 2F0SA 4DA2A 3D4WA 2C9OA 2L5TA 1TS2A 3URYA 2F0MA 4LK1C 1LTRD 4RFBA 5K36H 3K6OA 2IPKD 4XQQA 2SNSA 2G9HD 2EJFC 4B9WA 1EIHA 1TT2A 5C0XI 1RF2D 4HMIA 5CV5A 4C3JB 5HURA 3PUYA 3QO2A 2F0PA 4PNYA 4BWGB 5I2XA 1LTAD 2ZXRA 2HDLA 4NW2A 3NQTA 2PZTA 2X6LA 3R3OA 1O7LA 2MGSA 1JWUD 2PZWA 1MD2D 5C5LA 3BG3A 1JC7A 3VR3A 1TY2A 1WCMB 3TP5A 2K6AA 3NE5B 4A3DB 4K6LA 5I9PA 4XQNA 2F0OA 4YIJA 3JAME 5DNFA 1PFBA 1EZ8A 2IX1A 3BVMA 3CKIB 3RZOB 2E76C 1PYWD 3DXJC 3ZYYX 1VF7A 3NBIA 4F87A 1D1KA 3ERQA 5JVG3 4C3HG 2ID0A 4I65A 1R4QB 1DOLA 1I4QA 1K8OA 4DU9A 1Y8OB 5KYLA 2F0UA 4AYBB 3GTQB 3PMFA 3FMCA 3RLFA 1Z47A 3BYYB 4JBWA 3I70A 1GHKA 5EJWA 2KCNA 3KUPA 4R9WA 4JK1C 2IX0A 4J8QA 1PRTB 1EQTA 1F77A 1PTOD 5IGBA 5IGDA 2F0VA 1HQRD 3OIQA 2WV6D 1A3UA 3OMGA 3KBXA 5LL6S 1LT3D 3EA6A 2KQ3A 1Z6HA 3PUWA 5C44B 5T1IA 4IFDI 5KNCA 2E2DC 1SNPA 1PRTC 1TR5A 1TIID 1D6EC 1KLUD 2PW5A 5CYUA 1CK1A 3A7AB 1WTRA 2EYMA 1V8QA 1A2UA 3QG1A 3FVQA 3HEJA 2IX3A 4BY7B 2FMCA 4OGQC 1YNND 2ENBA 3J81E 2O5JC 1ENCA 3MZ5A 2EYHA 2EY6A 1B1ZA 4HCEA 4N9PA 1GUNA 3TP8A 3EVQA 4PMBA 1A6XA 1HPCA 1Q12A 1PZID 3V96A 1X3QA 2VUMB 1GHJA 1WTVA 1U4PA 3OW7A 1UEAB 1B2TA 4S3SA 2TMPA 3C1EA 4A3JB 2MHVA 4XYOA 3SK4A 1STHA 3HOVB 1GOZA 4PQXA 3D6WA 1S5BD 1PXUA 1DYQA 1VMCA 4B08A 2KUMA 4ZKBB 2EXZA 4XTCS 1AZPA 3TMEA 3I91A 4RGOS 2Q8RE 1H9KA 3A54A 3DEOA 1SXTA 4RWSC 1GUWA 5C5MA 3WDNA 3HOYB 2EJGC 2MJ8A 3T16A 3I8ZA 3MA2B 2KEDA 2L12A 3DM1A 3MWYW 4OL7A 5AFWA 1EWHA 2FMMA 1I4XA 1SJHD 1UNSA 3GV3A 5ELDA 2NTSA 4ZUJA 3ITPA 4HAEA 1IW7D 1TKWB 1VMPA 3QB3A 4XXEA 4DXGA 4EQPA 1PDQA 3A55A 4K5XA 4WJWA 1F2LA 2RSOA 3E6ZX 3QOLA 3NUCA 1BQQT 1Q8IA 1ZYRD 1V1PA 4RGMA 3NTIA 2FJ2A 1EY4A 4LJZC 3A8KE 1D5XC 3C3LA 3S14B 4RHRA 3W2DA 3OIPA 3GO5A 2E2JB 2KHSA 2K5DA 4HEDA 1XYIA 5C4JB 5TSSA 2BE5C 1I4GA 4ZRZA 4KTAA 1EFID 1ET9A 2CW0C 5CORA 1CI3M 3KLSA 1SJED 1II3A 3PUVA 2EOTA 1V1PB 3TZDA 1BO0A 1I4PA 1D1IA 1QILA 5CV6A 3K7AB 2JA5B 5ELEA 2RA4A 1XXGA 1FNUA 3I4NB 3M4YA 3SHLA 3SK8A 5I2YA 2CQAA 1SNQA 4DK0A 2EZVA 4ZKCB 2K28A 4M8AA 1W6JA 4FXKC 2JA8B 2AQ2B 3S2HB 1DZ1A 3IKJA 3MHBA 1TWHB 1NCVA 1KDAA 1I6HB 1B44D 4M1UB 5CV4A 3S1MB 1BOSA 1GUSA 2L0CA 2EYLA 2JA7B 5C6AA 2L1BA 3ONAB 4RAUC 1HHVA 2E75C 1LT6D 5NUCA 2BDOA 3BS1A 4CGYB 1PLFA 3SVMA 1H9SB 3D6CA 1BXTA 1FYCA 4N9TA 4HMJA 2PW7A 1FR3A 5IT9E 2NVQB 2AQ1B 1F9QA 3H3VC 1T5EA 1DCZA 5IT9L 4A3BB 2GA4B 1ILQA 5C4XB 3G7LA 2FFKB 2B2TC 1AEXA 2BOSA 1KTKA 1STBA 4XYQA 1GJXA 4QIWB 1VF5C 4C3IG 1YNJC 3UI2A 1HQMC 5J39A 1U4MA 2PO4A 1KNEA 3S1RB 3T4AC 3P1HA 5M5WB 2IL8A 1KABA 2JA6B 2M9VA 2JE6I 4G4KA 3WOFA 1LLRD 1H9RA 3TP7A 3MXUA 3CU7A 1PTOH 4BS9A 2E74C 3MFGA 2NVTB 2QF7A 4UAIA 2F0JA 3KBGA 1WVLA 4O1NA 1BF4A 4FF4A 3HP3A 4C56C 1F9RA 3VYRA 1CQVA 2F03A 3DWAA 3M7NA 2A6ED 3D31A 1RHPA 2VB2X 1XTCD 5T1GA 3HGBA 2B8GA 1STYA 1A3TA 1Q90A 4PV1C 2AQ3B 1O78A 4RH6A 2F0QA 1BUVT 4C1NI 4BBSB 1PRTD 4CHTB 4QUCA 2SOBA 3SR1A 3BDOA 1I50B 2E2HB 3HZXA 5CV9A 2YYZA 3O13A 1PMRA 1CFMA 2Z4IA 4FP5D 3A56A 2RKSA 1C48A 1CT1D 1SMYC 1ONLA 1ZXTA 2B2UA 3GTGB 5CGKA 1SYCA 2HUGA 4X3KA 4KN7C 2CW0D 3HG9A 1RTNA 3GTOB 3J7YW 1BCPD 1OXVA 4RHSA 2Z1CA 3J7AV 3GV6A 2EY5A 1B53A 5JPMC 1MBYA 1ET6A 2F0EA 2L4NA 1PTOC 1R4PB 2Q8TA 4KKTA 2Q8IB 1Q3LA 5IODA 4IURA 3R8BA 3SEBA 3GTKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B2W C;  4IUT A;  1NAP A;  5EKI A;  1WTX A;  1IKL A;  2R3Z A;  2NZ1 D;  4XDX A;  1WD1 A;  1PLF A;  2H1E A;  3SVM A;  5DNF A;  1WTO A;  4X3T A;  1M8A A;  2XIW A;  4DN4 M;  1PFB A;  2B2U C;  4U68 A;  3DEP A;  4XT1 B;  2K05 A;  2K03 A;  4ZAI A;  2HDM A;  1E0B A;  2FHT A;  2FJ2 A;  5D14 A;  1DON A;  2D9U A;  2X6G A;  2BDN A;  1HRJ A;  2SDF A;  1RHP A;  1WTQ A;  4IUQ A;  1QNK A;  3I90 A;  5T1G A;  5CBA E;  3Q6S A;  1F9Q A;  1X3Q A;  1U4L A;  2K1B A;  2M2L A;  2KOL A;  1O7Z A;  5COY A;  3TN2 A;  2B2Y A;  1CA6 A;  3FDT A;  1ROD A;  2B2T A;  2L9H A;  1DOK A;  1HUM A;  2DY7 A;  4HED A;  1WTV A;  1XYI A;  1AP0 A;  1HFG A;  1U4P A;  1B4O A;  5EQ0 A;  1J8I A;  1A15 A;  2N55 A;  2X69 A;  1B2T A;  5E4X A;  5COR A;  3IFD A;  1HHV A;  2B2V A;  1RTO A;  2KVM A;  2NYZ D;  1G91 A;  1DOL A;  1S4Z A;  4CJ0 B;  2N88 A;  1WTW A;  5D65 A;  1ILQ A;  5EPJ A;  1MGS A;  1G2S A;  2MPM A;  2EOT A;  1DOM A;  1O7Y A;  3MTS A;  3TZD A;  1EOT A;  3G7L A;  1C8C A;  1HUN A;  1SAP A;  2B2T C;  1PFM A;  1U4R A;  2FFK B;  1HA6 A;  2B2V C;  1BO0 A;  3D6W A;  3FPU B;  4X3U A;  1QE6 A;  3F2U A;  4RA8 A;  4MHE A;  1F9P A;  4QUC A;  1JIC A;  1EL0 A;  1VMC A;  5EJW A;  2KUM A;  1X3P A;  1LV9 A;  4ZKB B;  3KUP A;  3IL8 A;  2RA4 A;  1MSH A;  4R9W A;  3UI2 A;  2L11 A;  2K04 A;  1XX8 A;  1AZP A;  1U4M A;  1B50 A;  5EPK A;  2KEC A;  3I91 A;  2KEE A;  2Q8R E;  1EIH A;  1KNE A;  1IL8 A;  1EQT A;  1O80 A;  1WD0 A;  2EE1 A;  2J7Z A;  1CA5 A;  3DEO A;  2B2W A;  2NWG A;  1NR4 A;  2FIN B;  2CVR A;  1ZXT A;  4RWS C;  2RSN A;  1GUW A;  2EPB A;  2B2U A;  3KBX A;  3P7J A;  4OIK A;  4LMQ D;  4X3S A;  1F9S A;  4ZKC B;  2K28 A;  3QO2 A;  2HUG A;  4X3K A;  2DY8 A;  4CJ2 C;  4MN3 A;  2IL8 A;  1QG7 A;  2MJ8 A;  5T1I A;  1SDF A;  3I8Z A;  5EPL A;  3N52 A;  5CBE E;  1RTN A;  1RJT A;  1TVX A;  1SSO A;  2HDL A;  2RVL A;  2B2Y C;  2HCI A;  2KED A;  2L12 A;  3DM1 A;  3MWY W;  1IKM A;  4NW2 A;  4XT3 B;  1ESR A;  1DZ1 A;  2X6L A;  1MI2 A;  3LWE A;  1PFN A;  4ZLT F;  5AFW A;  4ZK9 B;  4O42 A;  1HFN A;  5CMD A;  2MGS A;  1JE4 A;  1BBX C;  2FMM A;  1NCV A;  1AZQ A;  3GV6 A;  4CJ1 B;  4R8I A;  1ML0 D;  3GV3 A;  2HCC A;  2JYO A;  4UAI A;  4HAE A;  1B53 A;  4IUU A;  1VMP A;  5JJZ A;  1WVL A;  1WTR A;  1BF4 A;  1ICW A;  2L4N A;  4IUP A;  5E4W C;  1B3A A;  2K01 A;  1G6Z A;  3HP3 A;  1ILP A;  2MP1 A;  2L1B A;  3ONA B;  4IUV A;  2Q8T A;  3R93 A;  4HCS A;  3I3C A;  1PDQ A;  1Q3L A;  1MSG A;  4HSV A;  4IUR A;  4RAU C;  1WTP A;  1G2T A;  1F2L A;  1J9O A;  2RSO A;  4QUF A;  3H91 A;  1F9R A;  2VXW A;  1CM9 A;  1KNA A;  4OIJ A;  2JP1 A;  1X32 A;  1EIG A;  1NR2 A;  1BNZ A; 
#chains in the Genus database with same CATH topology
 1TS4 A;  2XVS A;  4L5Q A;  5M3M H;  4DR5 L;  1WD1 A;  1WTO A;  1PTO F;  1UAP A;  5C4H A;  3Q24 A;  4LUV A;  3W1G A;  1VQN A;  1CQF A;  2EDG A;  3GTG H;  1HNX L;  2FHT A;  1E2W A;  1ZKO A;  5C4Z A;  2F3I A;  5IGC A;  3Q23 A;  2BCO A;  4A3K G;  4A3M B;  5COY A;  5IP7 H;  5IGG A;  4RCO A;  4LF6 Q;  5LMU Q;  1CZG A;  1IHZ A;  1J8I A;  2DNC A;  3C1F A;  5IOC A;  2PQE A;  2O2L D;  4JBM A;  2R93 G;  5JJL A;  3R2I A;  2NYZ D;  2UU9 Q;  1XPU A;  1E2Z A;  3IFT A;  3X3N A;  1NMF A;  1P16 A;  3NSW A;  3KJP A;  3MVV A;  1H9M A;  2J0T D;  4LF4 Q;  4ABN A;  2AHO B;  1PFM A;  2OEO A;  2RDG A;  4N8X 1;  3IRB A;  4DR4 L;  2FXQ A;  1EL0 A;  3MXP A;  3H0G H;  2CHB D;  4OEM B;  4JI6 Q;  1IYV A;  1LYL A;  4NXM Q;  3NHH A;  2KCC A;  3Q22 A;  3MAQ A;  4LF5 L;  2VQF L;  1GD7 A;  1LTI D;  3M3Y B;  3CD6 A;  4ZCK A;  2PQA A;  2DJG C;  4A3M G;  2KA7 A;  2E5L Q;  3CRL C;  2IWH A;  2ZM6 L;  5CV8 A;  1JB7 A;  4KJN A;  1L0Y B;  2RSN A;  2UXC L;  1YJN A;  3ICE A;  2F0F A;  2D0O A;  4DR1 L;  4K0K Q;  4OIK A;  2TSS A;  3PIO 3;  3LX0 A;  1ICF B;  5A2Q E;  2R7Z G;  2NVQ H;  2DY8 A;  4BY1 G;  1S5E D;  4MN3 A;  1RD9 D;  2HIX A;  4A4I A;  5CBE E;  2VW9 A;  4P74 A;  3G6J B;  3EN2 A;  2PMZ E;  1HTP A;  5JVH 3;  3RN5 A;  1EYD A;  3MXN B;  3RZD H;  4JVZ A;  4O42 A;  3VR5 A;  5E7N A;  3TS2 A;  4LAA A;  4B3T L;  4NP5 A;  3S16 B;  5J1Z A;  3VR2 A;  4A3C H;  3QIA A;  1VQL A;  2VQF Q;  2RCN A;  4NXN L;  1B3A A;  2MO0 A;  2UUC L;  1EUJ A;  1HH2 P;  3BU2 A;  3DWP A;  1ILP A;  4IUV A;  2HQE A;  3RLO A;  4DUY L;  4P2C B;  1BCP B;  1G2T A;  4CKB A;  4MNO A;  1I3Q H;  1RDP D;  1SE3 A;  3UDI A;  2A69 C;  2OT2 A;  4C2M B;  4BY7 H;  1K9M C;  5C3W A;  1GUT A;  2SEB D;  1VQB A;  2R7D A;  1HA5 A;  2YU9 B;  3K7A H;  2RDF A;  2R7Z B;  1M8A A;  3ND9 A;  3PIP 3;  2B2U C;  1STN A;  4FXG C;  1CKO A;  4GZY C;  4IPG A;  1PRT F;  4ME5 A;  5A35 A;  1IW7 C;  3J7Z C;  1VQO A;  1X6O A;  1NJI C;  3PO3 H;  3K8A A;  3F2B A;  1SYB A;  4KHZ A;  4KMU C;  1HFG A;  2CH4 W;  1TWG H;  4B3T Q;  1EQV A;  3D4D A;  1K8M A;  1TS5 A;  1KRT A;  2EJM A;  4JI8 L;  2M00 A;  1S4Z A;  2UUB Q;  2F0D A;  4FNF A;  1OXT A;  1U4R A;  5FLM H;  1B9M A;  1EU3 A;  3TRE A;  2I46 A;  5BN5 A;  4CDF C;  3F2U A;  2JQO A;  2KEN A;  1F9P A;  5K36 G;  2WIN B;  1FGB D;  2K7V A;  5LHY 1;  5LL6 X;  2HT1 A;  1PH6 A;  5IIF A;  1MSH A;  1E2V A;  2F1M A;  2L11 A;  4A3D H;  4DR7 L;  1EY9 A;  4JOI C;  4RGN A;  4G7O C;  1HCZ A;  2KEC A;  4E6I A;  2KEE A;  1UUP A;  3OTO Q;  2D62 A;  3CCE A;  1C4Q A;  4DK1 A;  1UE7 A;  2JA6 G;  3R2T A;  4RKL A;  2YTV A;  1K0R A;  5HGQ A;  3W5O A;  4DAY B;  3K0Y A;  4HIK A;  2N78 A;  1FNW A;  3BZD B;  4C3H B;  1G8Z D;  4LMQ D;  4LF8 Q;  1E1O A;  3OWE B;  5J22 A;  2KJX A;  2Z4H A;  5DM6 3;  1LTG D;  1IYU A;  2QIL A;  4HJ8 A;  2RHQ B;  4HN7 A;  4WRD A;  3VYT A;  2XTI A;  1G29 1;  4KY6 A;  4HID A;  2Y0S B;  5I6Y A;  4QB4 A;  3NWS A;  4DR6 L;  3PO2 B;  3G6E A;  2XNA C;  4B9X A;  4KY5 A;  1SBB B;  5JPN C;  4LFA Q;  2HCC A;  1I6H H;  4G7Z C;  2NTT A;  3A8I E;  2PNR C;  4LF8 L;  1PZK D;  2AWO A;  2C5C A;  1B70 B;  3JAM L;  5GAE C;  1D5M C;  1AN8 A;  2AUK A;  4FVM A;  4FXD A;  4O0A A;  1Q1B A;  4OWT B;  1F2Z A;  1NNX A;  1QUQ A;  2F0G A;  4IUT A;  1IKL A;  2NZ1 D;  3E0J A;  3QWN A;  4GOP A;  3TSS A;  2HDM A;  3RNU A;  4K2K A;  1E0B A;  2R92 B;  4OX9 L;  2SDF A;  5LMN Q;  3CCS A;  3S15 H;  1JB3 A;  1D7Q A;  2LMC B;  3U50 C;  1PZJ D;  1CA6 A;  4KHV A;  2VQE Q;  1YNN C;  2NBF A;  2QCP X;  4DV5 Q;  1Q46 A;  4LF4 L;  2N88 A;  1LTS D;  4RMF A;  2ZT9 C;  5FO9 B;  5ELB A;  1JWS D;  4R8N A;  1N9W A;  4DKA C;  1DM0 B;  1HR0 L;  4QIW E;  1RL2 A;  1S72 A;  3RUZ A;  1E24 A;  1EIF A;  1FD7 D;  3AFP A;  2R92 G;  3VYS A;  5EPK A;  4AYB G;  3T56 B;  2F3W A;  4ULL A;  1EWC A;  4BBR B;  2E8G A;  2J7Z A;  2EQS A;  4Q0F A;  3I72 A;  1RKN A;  1UE1 A;  2NWG A;  3HFZ B;  2B39 A;  4H44 C;  5IYB H;  1KRS A;  4DV7 Q;  4QCL A;  1GUG A;  4DR3 L;  1YNX A;  4POF A;  4KK7 A;  1OXU A;  4OO1 G;  1SDF A;  5I4D A;  1A63 A;  4GNX B;  1E3P A;  2A6E C;  1KAA A;  4IPD A;  4DF7 A;  5G3L D;  1QNU A;  4A3E H;  3A8J E;  1OO9 B;  2BA0 A;  1EU4 A;  3ULP A;  2EY1 A;  3TP6 A;  5CMD A;  2LFN A;  1JE4 A;  1YIJ A;  1FVI A;  1Q7Y C;  1JMC A;  1V9P A;  4LNQ A;  3N6R A;  5IE8 A;  2RDH A;  2UUA L;  3ERO A;  4JI7 Q;  4AQY L;  2VZA A;  2PYK A;  2NZO A;  2MP1 A;  2F0L A;  4J1M A;  3R93 A;  3HOX B;  2D5D A;  4P72 A;  3S1Q B;  1V1Q A;  5IGE A;  4DXF A;  3H91 A;  3OOC A;  4A3B H;  3BDC A;  1MJE A;  1EIG A;  2K5Q A;  1BNZ A;  2QA4 A;  4V19 0;  2R3Z A;  1Y14 B;  1D5Z C;  2K33 A;  1PH2 A;  4UY8 C;  1TY0 A;  3SDZ A;  3HOX H;  4XIG S;  3NQI A;  2CWA A;  4QGU A;  5JAV A;  1IXR A;  4RG1 A;  1KXL A;  3KLS X;  4PMC A;  2BH2 A;  5D3I B;  4LF9 Q;  3PO3 B;  4A3G B;  2Q2T A;  1XPR A;  1ZEQ X;  4DV3 Q;  2B2T A;  5KEE A;  5C3E H;  1CHQ D;  1XMQ Q;  4JI8 Q;  4JI1 Q;  3ULJ A;  3OWF A;  3VA5 A;  2MNA A;  1ZYR C;  1L1O C;  2A5H A;  4DV5 L;  3BDL A;  4GLV B;  2JXM B;  3G71 A;  3Q0A A;  1B9N A;  3AB9 A;  1HA6 A;  2NVY B;  4JPB W;  2Z6K A;  1JIC A;  3H6M A;  3HOU B;  1IYJ B;  1E22 A;  1X3P A;  3BVZ A;  3IAY A;  2QW7 A;  1FL0 A;  2L15 A;  1FNV A;  5G3L F;  1DGS A;  1WOC A;  3S2H H;  2WII B;  1MIU A;  1STE A;  4ZUI A;  1O80 A;  3PO3 G;  2VUM H;  1UE6 A;  4N8F A;  3K59 A;  4LF7 Q;  2RQX A;  1NR4 A;  1TU2 B;  1I94 L;  1AE3 A;  1AFP A;  1LTB D;  1A2T A;  3KDF A;  1SYG A;  3NTH A;  5FO7 B;  4FF1 A;  1VQ4 A;  3I2Z A;  1VQP A;  1Y8N B;  3A5Z B;  3ZJY C;  1B7Y B;  4DV0 L;  1EEI D;  1YBY A;  1F2Y A;  2NVX H;  4KD4 A;  4BXX G;  4IJL A;  4OON A;  4L8J A;  4F8M A;  1R9T H;  3K5L A;  4ZK9 B;  1WCM G;  2B63 B;  3HOY H;  3U4Z A;  3HOU G;  3VYU A;  1IBL Q;  4A3D G;  4DAP A;  1LT4 D;  3I4N G;  1EY7 A;  2EYP A;  4C1N K;  1SYF A;  3GTM B;  2A6H C;  2PI2 A;  2A6H D;  1G6Z A;  1R9T B;  4A3F B;  1YJ9 A;  3CAM A;  1BCP C;  2VXW A;  3TRZ A;  4JI4 L;  2KHJ A;  3NTK A;  2HHH L;  1NR2 A;  1LT5 D;  2K5V A;  3F8T A;  4XDX A;  2H1E A;  4IFD H;  1SYE A;  4K8I A;  1N34 L;  3MXG A;  2VL6 A;  5IWA L;  3DEP A;  4WJ3 M;  4ZAI A;  3FKI B;  1ESF A;  5EAY A;  3K5M A;  4H13 C;  1SEB D;  2X6G A;  5D14 A;  1OXX K;  1SE8 A;  2AWN A;  1TWA H;  5CBA E;  3PIO A;  1NY4 A;  3L3O C;  1I3Q B;  1SNC A;  2M2L A;  1U4L A;  3FDT A;  5E3F A;  3CQZ B;  4C3J H;  4Z9C B;  5DM7 3;  2X69 A;  1I50 H;  2UUB L;  4C3H H;  5M3M B;  1RTO A;  2KVM A;  1M4V A;  1K83 B;  5M5W H;  2EYF A;  2QEJ C;  3RR5 A;  1KDC A;  4DR2 Q;  4YHH Q;  3G48 A;  4LFB L;  4ALP A;  1HR0 Q;  1OXS C;  3V2T A;  3LNN A;  3RZD B;  3CCR A;  5CR3 A;  1EYG A;  3STB D;  3SXH A;  2LKV A;  5EBC A;  4LF6 L;  1T9H A;  2AMC B;  1XWE A;  3H94 A;  4IN3 A;  2JK8 A;  5C3X A;  1W6K A;  4TKO B;  2L55 A;  2QDB A;  5C44 G;  4POG A;  4GNX C;  1IL8 A;  4CDC C;  1EEF D;  1LAC A;  3KLR A;  1EY0 A;  4KY7 A;  1PTO B;  3M85 A;  4DUY Q;  2JA5 H;  2O5I C;  3JC6 6;  3H09 A;  4IAL A;  5KGU A;  5JEA G;  4DUZ Q;  4FO2 A;  1MHW C;  2BH8 A;  1L2F A;  1KD1 C;  3FRP B;  1FJG Q;  4X64 L;  4IFD J;  2VB3 X;  3N52 A;  2HQL A;  3QOJ A;  4HJ7 A;  2B2Y C;  2HCI A;  3J80 E;  4XT3 B;  5FJ8 H;  1ENF A;  1ESR A;  4LFB Q;  5FLX E;  3GQB A;  3LWE A;  2ICE C;  4BA2 I;  1PFN A;  3L7Z C;  1TWG B;  4C3I B;  3T53 B;  4EGV A;  4ODG A;  1AZQ A;  3GTL B;  4X66 Q;  2R92 H;  1J5E L;  4A3J H;  1OTC A;  5LMN W;  1ICW A;  5E4W C;  3EIV A;  1XTD A;  4K5V A;  4K0K L;  5BN4 A;  3KF6 B;  5I6W A;  3LWU A;  3GTQ H;  3C2P A;  1VCI A;  5AJ3 L;  1HZB A;  1MSG A;  3S1R H;  1H95 A;  2DJF C;  1DJR D;  5ELO A;  3QJY A;  3RMH A;  2OXP A;  4DGZ A;  3CME A;  1SMY D;  3OHX C;  4A3L G;  4X3T A;  3S17 H;  3GTM H;  4XT1 B;  3WWV A;  2SNM A;  1I4H A;  1SYD A;  4L6T B;  1S5C D;  4JYA Q;  3F1Z A;  2BDN A;  1WTQ A;  4IUQ A;  1EY5 A;  4R1J A;  1NBW A;  3I90 A;  3OTO L;  1Y69 U;  4DNT B;  5GQO A;  2K1B A;  1O7Z A;  2A74 C;  4ZQ3 A;  5C0X H;  1QWY A;  5AJ3 Q;  2DY7 A;  4Q5V A;  3DWQ A;  1A15 A;  5IYD H;  4DR3 Q;  4UHV A;  5IT9 c;  4KI0 A;  4QY7 A;  1W2B A;  3NP8 A;  4KKS A;  4Y7N H;  5GAH C;  1G91 A;  3E5S A;  1NE3 A;  2RCF A;  5C0X J;  3DMU A;  1HZC A;  4KN4 C;  4A93 G;  4MTK A;  4QMG A;  2B2V C;  4X64 Q;  4A3B G;  3GP7 A;  4K14 A;  4ID6 A;  5K5P A;  3TS0 A;  3VR6 A;  1VQJ A;  4OWX B;  3HKZ G;  3IL8 A;  1STG A;  3E9H A;  4EQN A;  3GD7 A;  5IGF A;  1X65 A;  4CKE A;  3L9A X;  2HD3 A;  4NKL A;  3M3Y H;  4EVO A;  2B8F A;  1TS3 A;  1KLG D;  2E2I B;  2XWB B;  2WKC A;  3M4O H;  4IOA A;  1H9S A;  1X3G A;  4OHJ A;  2FIN B;  2J4X A;  5CV7 A;  2XRS D;  2PPB C;  4GKJ Q;  3AEV A;  3S16 H;  5EGT A;  5A2Q L;  4R4O A;  3CPF A;  4DV0 Q;  1QG7 A;  2RVL A;  3U9S A;  4HTH A;  2WKD A;  4K5W A;  5I9O A;  1XJV A;  4BBS G;  1KQS A;  4HIO A;  3OSO A;  4A3F H;  1HNZ Q;  4B3M L;  1HFN A;  4WFN 3;  3H0G G;  1BBW A;  3HS0 C;  3I7F A;  3BVG A;  3F2C A;  1BVS A;  3HKZ B;  3GTP B;  1Y1V B;  2CH4 A;  1EQQ A;  1Q1E A;  3MFY A;  4IUU A;  4G7H C;  3CRK C;  1NSN S;  1TWA B;  4FF2 A;  1Z9F A;  1V1O A;  3I4M G;  3HOV G;  3S1N B;  5GAG C;  2JJQ A;  4OIJ A;  1X32 A;  1K28 A;  1SE2 A;  4JI6 L;  4DAY A;  1JR0 D;  2D2C C;  4BY1 H;  1GXD C;  4XQJ A;  2NB0 A;  2D9U A;  1BCP F;  1GO3 E;  2OTJ A;  5FO8 B;  1QNK A;  2EVB A;  2NN6 G;  4G57 A;  3RD4 A;  3SE0 A;  3GTO H;  3S2D B;  2B2Y A;  1P8L A;  1WCM H;  1ROD A;  3E3X A;  3M7G A;  3H0G B;  2PNH A;  2ZXO A;  1AP0 A;  1B4O A;  1EYA A;  1QB5 D;  3EJI A;  5E4X A;  1Y1W B;  4H0L C;  1EWI A;  1HXY D;  1XNR Q;  1S5F D;  4DR2 L;  4JI5 L;  3KF8 A;  2MPM A;  2CFM A;  2JEB I;  1EOT A;  4R4Q A;  2JN4 A;  1O7I A;  2K50 A;  3FPU B;  1M1K C;  1VQG A;  4RA8 A;  3K5N A;  2N3S A;  3M9B A;  1JCK B;  3I4L A;  3ND8 A;  3L0O A;  1TWH H;  2A69 D;  1Y1V H;  1SMX A;  2QDL A;  1XX8 A;  2H5X A;  2PQA B;  4L5T A;  2F4I A;  4DV7 L;  3KJO A;  4IZ8 A;  4DK6 C;  4A3K B;  1EY6 A;  2ZTD A;  3EBE A;  1N36 Q;  3HKS A;  3OPO A;  2OF1 A;  1EZ6 A;  1U0L A;  4L5S A;  1EYC A;  1EFW A;  1VQ7 A;  2V1C C;  2QEX A;  5KRU A;  4X3S A;  2R93 B;  3KK7 A;  4KHP L;  3U58 A;  3J80 i;  1QVG A;  3PIP A;  1I4R A;  1TVX A;  3PF4 A;  1IKM A;  1L0X B;  1D2B A;  1VQ9 A;  4A3G H;  2WAQ G;  1MI2 A;  4HSP A;  3CCV A;  4DPG A;  3I56 A;  3KYH C;  4CDD C;  4AH6 A;  4J6H A;  1NMG A;  1XMQ L;  2OQ0 A;  3KOJ A;  3UE1 A;  3CCM A;  1BDO A;  1VQ5 A;  4MIU A;  1NUC A;  1S5D D;  2Q2U A;  2IT1 A;  4HSV A;  4DFA A;  1SFO H;  1J9O A;  3I73 A;  5M5X B;  2K5W A;  1CM9 A;  5JEA H;  1C7Y A;  2F0T A;  1WTX A;  4P75 A;  4Y7N B;  4KKU A;  2EYJ A;  3J81 L;  5ELC A;  2ZJR A;  3FEW X;  4B3R L;  1J6Q A;  4TRD A;  1TWF B;  2WB1 B;  3CCQ A;  1GUO A;  5IYC G;  2KOL A;  5IP7 G;  3PSI A;  2L9H A;  1X3E A;  1L1O A;  1I94 Q;  2O4X A;  2WP8 J;  2ZJP A;  2R93 H;  2MQH A;  1M90 C;  1AW7 A;  1QOH A;  4QJF A;  2R7F A;  1H9J A;  4UDU C;  2IY5 B;  1MGS A;  2Z6K C;  1TWC H;  4DR6 Q;  2F0H A;  4HR7 B;  1O7Y A;  3D4R A;  2R6G A;  1HUN A;  3K5O A;  1SAP A;  1ASZ A;  1K8G A;  1V43 A;  3P75 A;  3GTL H;  4MHE A;  4JI4 Q;  2VY3 A;  2NVY H;  1Y8P B;  2LY7 A;  4AQY Q;  2ZM6 Q;  1LV9 A;  2LS0 1;  1YI2 A;  2ZXP A;  3FP9 A;  1JWM D;  3LGJ A;  4C2M H;  4JI0 L;  2PMZ B;  4CKC A;  2R61 A;  1Q82 C;  1TWC B;  2Z8L A;  5GRO A;  4LFC L;  2A73 B;  2F0K A;  3MC0 B;  3BYT B;  1K3R A;  2AUJ D;  5JOB A;  2JA7 G;  4A3M H;  1IZ6 A;  1E7Z A;  3NBH A;  4JBJ A;  2PCF B;  5C0X G;  1CA5 A;  3M4O B;  2EYO A;  5FK9 C;  2CVR A;  4YY3 Q;  1PH3 A;  2EPB A;  4QF4 A;  1FJG L;  1F9S A;  1X3F A;  3RN2 A;  3NPP A;  3PUZ A;  5KND A;  4GN5 A;  1JOQ A;  4GNX A;  1XMO L;  1PV4 A;  3QR8 A;  3DHQ A;  4NPS A;  1SSO A;  3J7A F;  3WOE A;  1T5X D;  3S15 B;  4NXN Q;  3SK5 A;  3X3M A;  4ZLT F;  4R4C A;  4FF3 A;  3NXW A;  1BBX C;  2UXB Q;  2IHE A;  4CJ1 B;  4R8I A;  1ML0 D;  4BY1 B;  2JYO A;  4A3C G;  1KDB A;  1DD2 A;  3C46 A;  1LM0 A;  4HCS A;  3I3C A;  4DV4 Q;  5D3D A;  2NVX B;  1WTP A;  1SFO B;  5IYB G;  2F0I A;  1KNA A;  3BZC A;  3IFD A;  1JOO A;  5EKI A;  4LUZ A;  3M4Q A;  4DNR B;  2UXB L;  4OO1 H;  4U68 A;  4PMW A;  1B8A A;  1X56 A;  3JAM i;  2E2H H;  1DON A;  4A76 A;  4I7Z C;  2DGY A;  4JG2 A;  4KJO A;  1U9R A;  5DAU A;  2GVB A;  1PH5 A;  3PO2 G;  4A93 B;  5C3E B;  1DOK A;  1EIY B;  5BN3 A;  4K2L A;  5KNB A;  3J80 c;  3GTK H;  2K5H A;  4KD3 A;  3PV0 A;  4AYB E;  1JE5 A;  3TZU A;  5M5Y B;  1LO5 D;  4A3I H;  1WTW A;  1KL9 A;  1G2S A;  3MTS A;  1C8C A;  4JYA L;  5HY6 A;  5ISR A;  3A74 A;  4IPC A;  4IPH A;  3HOW G;  4X3U A;  4J15 A;  1YNJ D;  3VDY A;  2WAC A;  3TDQ A;  1LUZ A;  1EOV A;  5EKL A;  3SK6 A;  1SNM A;  4DV2 Q;  3CW2 C;  4K6D A;  3AMU A;  4H02 A;  3BJU A;  3UE0 A;  3NEN A;  4GLX A;  3ERS X;  4OX9 Q;  3K80 C;  4UP8 A;  1VQ8 A;  2NN6 H;  1WD0 A;  1G6P A;  2XN9 C;  2ICI A;  5FOB B;  2YTX A;  2B2W A;  1EQR A;  5C3E G;  3S1Q H;  1F2M A;  5M9O A;  3U9O A;  4NDX A;  4FYD A;  2VQE L;  3AU7 A;  4LF5 Q;  5CC4 A;  1LTL A;  3VR4 A;  3CF5 A;  4JI2 Q;  4H7B A;  5J3B A;  3S17 B;  3A7L A;  3NEM A;  3TEH B;  1RJT A;  3EFX D;  3CC7 A;  5HGT A;  1VDZ A;  1CZW A;  1JQY D;  3J7A 5;  1EY8 A;  3HOW B;  4DR1 Q;  1CKN A;  4F7X A;  3DUZ A;  2QKI C;  2D0P A;  4B3R Q;  1MJC A;  3K57 A;  3I4M B;  4GN3 B;  3H3V I;  1SNO A;  1N32 Q;  1HNW Q;  2A68 D;  5JEA J;  4EQ5 A;  1HNX Q;  1QJO A;  5JJI A;  2AKW B;  3FPP A;  4V0B A;  2EXD A;  4IUP A;  1U5K A;  4KV6 A;  4A3I B;  3D8G A;  2K01 A;  5EKK A;  2LSS A;  3VA7 A;  4ILW A;  4A3E B;  1VQD A;  3AYH B;  4YCW A;  1HRJ A;  4QUF A;  5F2D A;  3OMC A;  1NAP A;  3MXN A;  3T13 A;  5ELF A;  5KYI A;  3T1H Q;  4B3S Q;  1JOK A;  3ULL A;  1TQO A;  4C3I H;  2V4D A;  3B6Y A;  2K03 A;  2CCZ A;  3T1Y Q;  4EQO A;  3GTJ B;  4F88 A;  1IL2 A;  1RCV D;  2JEA I;  4DV3 L;  2K32 A;  5E1F A;  2IJ0 A;  5ELN A;  4A3K H;  4U67 3;  2MUY A;  1IBM Q;  1HUM A;  3S24 A;  2I07 B;  5EQ0 A;  5DEH A;  1HNW L;  1WJJ A;  4KHP Q;  1CTM A;  2H4O A;  2B2V A;  4A75 A;  4B3S L;  5H1S E;  2YTY A;  3DM3 A;  5DLQ E;  1ENA A;  3S9W A;  1CKM A;  2I5M X;  1I6V C;  1DOM A;  2XRQ D;  1KIX A;  2E5L L;  3KF8 B;  2EY2 A;  1QVF A;  3HOZ B;  2KCM A;  4TSS A;  2BA1 A;  2VNU D;  1QE6 A;  1QCB D;  3K58 A;  4IQZ A;  5FKA C;  3S1N H;  1JOR A;  1A8V A;  5KIX A;  2K04 A;  2A68 C;  1B50 A;  4PZ6 A;  1N32 L;  4TQU S;  3PCO B;  2EE1 A;  5IYC H;  4IOC A;  2IW3 A;  2LXK A;  4X62 Q;  2F0W A;  3NWT A;  2WAQ B;  4JW0 A;  1S40 A;  3NEL A;  1B3Q A;  3NK9 A;  3P7J A;  2XWJ B;  3MEH A;  4DAV A;  4LUO A;  4CJ2 C;  3TBI B;  4L63 B;  5EPL A;  1KAW A;  2DNE A;  4WOR A;  3PUX A;  5L37 A;  2RBM A;  3J80 L;  1HJP A;  2NZH A;  5C4J H;  5M3F G;  1PYS B;  4IUN A;  5FLX L;  1IBK L;  2F3V A;  1YIT A;  1DXM A;  1CUK A;  4JI3 L;  3HOY G;  3M4P A;  2K75 A;  3UDF A;  1SND A;  2G9D A;  2NUC A;  3D3R A;  4RKB A;  1KC8 C;  1Z7T A;  3T51 B;  5JJZ A;  3I4N H;  4ZYS A;  1VQM A;  2NN6 I;  1WI5 A;  2PZU A;  1GKH A;  3P20 A;  4HJ9 A;  1BR9 A;  4BA1 I;  2F0N A;  4GKK Q;  2XSC A;  2JP1 A;  2HIV A;  2BE5 D;  2B2W C;  4YWM A;  3W3A A;  1VQA A;  1HTL D;  4IFD G;  2XIW A;  4DN4 M;  2K05 A;  4RCN A;  1X55 A;  3HOX G;  4L5R C;  4DV6 L;  4K8J A;  3HRZ C;  4CBV A;  5M3F B;  1STA A;  3Q6S A;  3T1Y L;  3EQL C;  3TN2 A;  1AE2 A;  2DN8 A;  3V05 A;  4C3J G;  1LTT D;  3CHB D;  1GVP A;  2I5L X;  2Z0S A;  2N55 A;  1Q81 C;  2JSO A;  1A3V A;  4NMZ A;  3GTJ H;  1YJW A;  4CJ0 B;  4OO1 I;  5D65 A;  1LAB A;  5EPJ A;  5EBD A;  4RGT A;  1SE4 A;  3T1H L;  1CHP D;  2F0S A;  4DA2 A;  3D4W A;  2ALY B;  2C9O A;  2CWP A;  3HOZ H;  3SGI A;  4JI7 L;  2L5T A;  1TS2 A;  3URY A;  2OTL A;  2F0M A;  4LK1 C;  1PH4 A;  1LTR D;  4RFB A;  5K36 H;  1VQ6 A;  2UXD L;  1HZA A;  1TXY A;  4YCU A;  1QVC A;  3K6O A;  2IPK D;  4XQQ A;  4DK3 C;  2SNS A;  2G9H D;  2EJF C;  4B9W A;  1EIH A;  1TT2 A;  4IJH A;  5C0X I;  1RF2 D;  4HMI A;  5CV5 A;  2Y0S G;  4OEL B;  4C3J B;  1TWF H;  2JA5 G;  5HUR A;  4JI2 L;  1UE5 A;  3PUY A;  5M3M G;  2R7Z H;  3QO2 A;  2F0P A;  4PNY A;  4BWG B;  5I2X A;  1LTA D;  2ZXR A;  3PF5 A;  2N49 A;  2WAQ E;  4TVA B;  2HDL A;  4NW2 A;  3NQT A;  4DAM A;  2PZT A;  2X6L A;  3RLN A;  3R3O A;  1WTH A;  1O7L A;  2MGS A;  1JWU D;  2PZW A;  1MD2 D;  3K0X A;  2F4V L;  5C5L A;  4LF9 L;  3E9I A;  2JA8 G;  3BG3 A;  1CKN B;  3KLW A;  2K4K A;  1JC7 A;  2ZJQ A;  4GN4 B;  4JV5 Q;  3VR3 A;  3J81 c;  4O2D A;  1TY2 A;  1WCM B;  3K81 C;  2B63 G;  3TP5 A;  3CMA A;  2K6A A;  3NE5 B;  1K73 C;  4A3D B;  4K6L A;  5I9P A;  4XQN A;  2F0O A;  4YIJ A;  4AIM A;  5DNF A;  3JAM E;  1PFB A;  1G51 A;  1EZ8 A;  1Q86 C;  4IO9 A;  2IX1 A;  3CC2 A;  3BVM A;  4BBS H;  3OYY A;  3CKI B;  4NB3 A;  3RZO B;  2E76 C;  1PYW D;  3DXJ C;  1L1O B;  3ZYY X;  1VF7 A;  3NBI A;  4YY3 L;  4F87 A;  1D1K A;  3ERQ A;  5JVG 3;  4C3H G;  2YU9 H;  1SLJ A;  2ID0 A;  4I65 A;  1R4Q B;  1DOL A;  1I4Q A;  4GKK L;  1K8O A;  4DU9 A;  1Y8O B;  5KYL A;  3HKZ E;  1HNZ L;  4B3M Q;  2F0U A;  3S1M H;  4AYB B;  1ASY A;  3GTQ B;  1C0A A;  3CQZ H;  5FLM G;  4A93 H;  3PMF A;  3FMC A;  3RLF A;  4BBR G;  4JBW A;  3BYY B;  1Z47 A;  3I70 A;  1GHK A;  5EJW A;  4DV6 Q;  3ER0 A;  2KCN A;  2P5Z X;  5M5Y H;  3KUP A;  2KBN A;  3K7U C;  4R9W A;  4JK1 C;  4JI3 Q;  2IX0 A;  4J8Q A;  4R4I A;  4DR5 Q;  1PRT B;  1EQT A;  1F77 A;  1PTO D;  5IGB A;  3CC4 A;  1K0S A;  3Q8D A;  5IGD A;  2F0V A;  1HQR D;  3OIQ A;  1I5F A;  2WV6 D;  1A3U A;  1HR0 W;  4JI5 Q;  3OMG A;  4BY7 G;  3KBX A;  3I55 A;  5LL6 S;  1LT3 D;  4QL5 A;  3EA6 A;  2KQ3 A;  1Z6H A;  2IHF A;  3AFQ A;  3E0E A;  3PUW A;  5T1I A;  5KNC A;  5C44 B;  4IFD I;  2E2D C;  1SNP A;  2CKZ B;  4DNI A;  1PRT C;  1TR5 A;  3CPW A;  4GOP B;  4FDB A;  1XNQ L;  1TII D;  4OXP A;  4A3E G;  3RZO H;  3TQY A;  1D6E C;  1KLU D;  1VQH A;  2ZTC A;  2PW5 A;  4YHH L;  5CYU A;  1CSQ A;  4PZ7 A;  1CK1 A;  3A7A B;  4A3J G;  5FLX c;  3W1B A;  1WTR A;  2EYM A;  1V8Q A;  1A2U A;  1YHA A;  3GDE A;  3QG1 A;  3FVQ A;  3OW2 A;  3HEJ A;  2IX3 A;  4BY7 B;  2FMC A;  4OGQ C;  1YNN D;  1K3B C;  2ENB A;  2E2J H;  3J81 E;  1SN8 A;  2O5J C;  1ENC A;  2OWO A;  3MZ5 A;  2EYH A;  2EY6 A;  4X66 L;  2GVA A;  1B1Z A;  4MZ9 A;  4DR4 Q;  4HCE A;  4N9P A;  1GUN A;  2XGT A;  3EVQ A;  4PMB A;  3TP8 A;  1A6X A;  1HPC A;  1Q12 A;  2HHH Q;  1PZI D;  3V96 A;  1X3Q A;  3FHW A;  2VUM B;  1GHJ A;  1WTV A;  1U4P A;  3OW7 A;  1UEA B;  1B2T A;  1YVC A;  4S3S A;  2TMP A;  3C1E A;  2PI2 E;  2VS1 A;  4A3J B;  2MHV A;  4XYO A;  4PG3 A;  1SRO A;  5C4X H;  5IP9 H;  5BR8 L;  3SK4 A;  4Y52 H;  1STH A;  3HOV B;  1GOZ A;  4PQX A;  1XMO Q;  3D6W A;  1CSP A;  1S5B D;  1JT8 A;  1PXU A;  1A62 A;  1DYQ A;  1VMC A;  4B08 A;  2KUM A;  5GAD C;  4ZKB B;  4UP7 A;  1VS0 A;  2EXZ A;  4XTC S;  1AZP A;  4P71 A;  3J81 i;  3TME A;  3I91 A;  4RGO S;  2Q8R E;  1H9K A;  2VUM G;  3A54 A;  3DEO A;  1SXT A;  2Z6B A;  3CCU A;  5IWA Q;  1BBU A;  4RWS C;  1VQE A;  5C5M A;  1GUW A;  1QZG A;  1BKB A;  1JJC B;  3WDN A;  2UUC Q;  3PQI A;  3HOY B;  3BZK A;  2EJG C;  2MJ8 A;  3T16 A;  3I8Z A;  3MA2 B;  2N8N A;  3CP0 A;  2KED A;  2L12 A;  5IY0 A;  3DM1 A;  3MWY W;  4X65 Q;  4OL7 A;  2F52 A;  1YHQ A;  1PH9 A;  4A3G G;  3S2D H;  1RIP A;  4A3F G;  5AFW A;  3HOU H;  1EWH A;  5LMN L;  2FMM A;  1I4X A;  1SJH D;  1UNS A;  1VQF A;  3GV3 A;  5ELD A;  2NTS A;  1XNR L;  4ZUJ A;  3AQQ A;  3ITP A;  2NVT H;  4HAE A;  1IW7 D;  1TKW B;  1VMP A;  4UP9 A;  2A19 A;  3QB3 A;  1X54 A;  3FKI G;  4XXE A;  2ES2 A;  2E2I H;  4DXG A;  3I4M H;  1K8A C;  4EQP A;  1PDQ A;  1GM5 A;  3A55 A;  4K5X A;  4WJW A;  1F2L A;  2RSO A;  3E6Z X;  1D8L A;  3QOL A;  2I0Q A;  3NUC A;  1BQQ T;  1Q8I A;  2JA9 A;  1ZYR D;  4NXM L;  1V1P A;  4RGM A;  3NTI A;  2FJ2 A;  1EY4 A;  4LJZ C;  3A8K E;  4DV2 L;  1D5X C;  1SR3 A;  3C3L A;  3J81 j;  3S14 B;  4RHR A;  3W2D A;  3OIP A;  1IBK Q;  2F4V Q;  3GO5 A;  2E2J B;  1YHB A;  2KHS A;  3CCJ A;  2K5D A;  4HED A;  5C4J B;  1NTG A;  5TSS A;  2BE5 C;  1XYI A;  1I4G A;  4ZRZ A;  4KTA A;  1EFI D;  1WFQ A;  1ET9 A;  2CW0 C;  2JA8 H;  4JV5 L;  1CI3 M;  5COR A;  4PZ8 A;  3KLS A;  1SJE D;  1YZ6 A;  1II3 A;  2A8V A;  3PUV A;  2EOT A;  1V1P B;  3TZD A;  2B63 H;  4APV A;  1BO0 A;  1I4P A;  4YCV A;  1D1I A;  2RHS B;  1QIL A;  1Y1W G;  5CV6 A;  1PA6 A;  3K7A B;  2JA5 B;  5ELE A;  2RA4 A;  1JJ2 A;  1XXG A;  1FNU A;  3I4N B;  3S14 H;  3M4Y A;  3SHL A;  3SK8 A;  5I2Y A;  5C44 H;  1PFS A;  2CQA A;  1SNQ A;  4CDE C;  4LFA L;  4DK0 A;  2EZV A;  2K52 A;  2OQK A;  4DV1 Q;  4ZKC B;  2K28 A;  4M8A A;  1W6J A;  4FXK C;  2LXJ A;  2MO1 A;  2JA8 B;  2KHI A;  1SRU A;  2AQ2 B;  3S2H B;  4BXX H;  3HOW H;  1DZ1 A;  4BBR H;  4HJ5 A;  1AH9 A;  3IKJ A;  1KHI A;  3MHB A;  1N33 L;  3KFU A;  1TWH B;  1NCV A;  1KDA A;  3MEF A;  4P73 A;  1I6H B;  1B44 D;  4M1U B;  5CV4 A;  4X62 L;  3S1M B;  4YWL A;  3UDX A;  1S3O A;  1BOS A;  1GUS A;  2ZTE A;  4OWW B;  2L0C A;  3A5U A;  3CXC A;  1E1T A;  1WYD A;  2EYL A;  2JA7 B;  5C6A A;  1VQC A;  2L1B A;  3ONA B;  4GOP C;  4RAU C;  1HHV A;  2E75 C;  1LT6 D;  5NUC A;  5BR8 Q;  2BDO A;  3BS1 A;  4R4T A;  4CGY B;  1PLF A;  3SVM A;  1H9S B;  3D6C A;  4LFC Q;  1BXT A;  1FYC A;  1PH8 A;  1N34 Q;  4N9T A;  4HMJ A;  2PW7 A;  1FR3 A;  5IT9 E;  2NVQ B;  2EIF A;  2AQ1 B;  5M5X H;  1F9Q A;  3H3V C;  2OCE A;  4DUZ L;  1T5E A;  1DCZ A;  5IT9 L;  2ATW A;  3STB C;  4A3B B;  2GA4 B;  2MFI A;  1IBL L;  3NBH B;  2RF4 A;  4UPA A;  1ILQ A;  3H3V H;  2Q2I A;  5C4X B;  4JOI A;  3G7L A;  2FFK B;  2B2T C;  1AEX A;  2BOS A;  1KTK A;  1STB A;  4XYQ A;  2GN5 A;  1GJX A;  4QIW B;  1VF5 C;  4C3I G;  2A1A A;  1YNJ C;  3UI2 A;  4X6A H;  1HQM C;  5J39 A;  1U4M A;  2PO4 A;  1KNE A;  1L0W A;  2JA7 H;  4DR7 Q;  3JAM c;  4EX5 A;  4QQB X;  1Q8K A;  3S1R B;  4KLK A;  3T4A C;  2YV5 A;  1XPO A;  2WB1 E;  3P1H A;  3H15 A;  1K83 H;  5M5W B;  2IL8 A;  1W3S A;  3U4V A;  3G4S A;  3KF6 A;  1KAB A;  1IBM L;  5IP9 G;  5C4X G;  2JA6 B;  2M9V A;  2JE6 I;  4G4K A;  3WOF A;  4GKJ L;  5FJ8 G;  1A0I A;  1LLR D;  2ASB A;  1H9R A;  3TP7 A;  3MXU A;  2I5H A;  2K5N A;  3CU7 A;  1PTO H;  4BS9 A;  4DV4 L;  5JJK A;  2E74 C;  1PYB A;  2K14 A;  3MFG A;  4MTN A;  2QF7 A;  2NVT B;  4UAI A;  1N36 L;  2F0J A;  3KBG A;  1WVL A;  4O1N A;  1BF4 A;  1VQK A;  4ME3 A;  1FGU A;  1N8R C;  4FF4 A;  4JI1 L;  3HP3 A;  2QGQ A;  4JC0 A;  2UXD Q;  1UEB A;  4C56 C;  1F9R A;  3VYR A;  1CQV A;  2F03 A;  2UUA Q;  2B3G A;  4JBK A;  3DWA A;  3UDG A;  1PHJ A;  4A3L H;  2B29 A;  3M7N A;  1PH7 A;  3A0J A;  2DUD A;  4WJ4 A;  2A6E D;  3D31 A;  4JCV E;  1RHP A;  2VB2 X;  1XTC D;  5T1G A;  4DV1 L;  3HGB A;  2C35 B;  2JA6 H;  2B8G A;  1STY A;  3PO2 H;  1A3T A;  1PVO A;  1Q90 A;  3I4O A;  4PV1 C;  2AQ3 B;  1O78 A;  4RH6 A;  1JJG A;  2Z9H A;  2F0Q A;  1BUV T;  2WFW A;  3CCL A;  4A3I G;  3FKI H;  4X65 L;  3D0F A;  1C9O A;  1MKH A;  4HJA A;  2Q2H A;  4C1N I;  3KDF B;  1XNQ Q;  1PRT D;  4BBS B;  3GTP H;  1UWV A;  4CHT B;  2Y0S E;  4QUC A;  2SOB A;  2CQO A;  3PGZ A;  3SR1 A;  4I7A A;  1YEZ A;  3BDO A;  1HZ9 A;  1Y1V G;  4LWC A;  1I50 B;  2E2H B;  1N33 Q;  3HZX A;  5CV9 A;  2YYZ A;  3O13 A;  4YWK A;  1PMR A;  1CFM A;  4GLA C;  2Z4I A;  4FP5 D;  3A56 A;  2RKS A;  1VQI A;  2UXC Q;  1C48 A;  1CT1 D;  1SMY C;  1ONL A;  1ZXT A;  4LW1 A;  2B2U A;  3GTG B;  5CGK A;  2KCT A;  1SYC A;  3DLL A;  2HUG A;  4HIM A;  4X3K A;  4KN7 C;  2CW0 D;  3HG9 A;  4LF7 L;  1RTN A;  4GS3 A;  3F2D A;  3GTO B;  3J7Y W;  1BCP D;  3HOZ G;  1J5E Q;  5M3F H;  3L2P A;  1X9N A;  1OXV A;  1QUQ B;  1Y1W H;  5LMU L;  4RHS A;  2Z1C A;  3J7A V;  3GV6 A;  1QZH A;  5IYD G;  2EY5 A;  1B53 A;  1PH1 A;  2G5D A;  2UU9 L;  5JPM C;  1MBY A;  1ET6 A;  2F0E A;  2L4N A;  1PTO C;  1R4P B;  2Q8T A;  3HOV H;  4KKT A;  2Q8I B;  1Q3L A;  5IOD A;  4IUR A;  3R8B A;  4JI0 Q;  3SEB A;  2WB1 G;  3GTK B; 
#chains in the Genus database with same CATH homology
 1TS4 A;  2XVS A;  1WD1 A;  1WTO A;  1PTO F;  1UAP A;  5C4H A;  3Q24 A;  1CQF A;  2EDG A;  2FHT A;  1E2W A;  1ZKO A;  5C4Z A;  5IGC A;  3Q23 A;  2BCO A;  4A3M B;  5COY A;  5IGG A;  4RCO A;  1CZG A;  1IHZ A;  1J8I A;  2DNC A;  3C1F A;  5IOC A;  2PQE A;  2O2L D;  3R2I A;  2NYZ D;  1E2Z A;  3IFT A;  3X3N A;  3NSW A;  3MVV A;  1H9M A;  2J0T D;  4ABN A;  1PFM A;  2OEO A;  2RDG A;  1EL0 A;  3MXP A;  2CHB D;  1IYV A;  3NHH A;  2KCC A;  3Q22 A;  3MAQ A;  1LTI D;  3M3Y B;  2KA7 A;  3CRL C;  2IWH A;  5CV8 A;  4KJN A;  1L0Y B;  2RSN A;  2F0F A;  4OIK A;  2TSS A;  3PIO 3;  3LX0 A;  5A2Q E;  2DY8 A;  1S5E D;  4MN3 A;  1RD9 D;  5CBE E;  3G6J B;  1HTP A;  5JVH 3;  1EYD A;  4O42 A;  3VR5 A;  4LAA A;  4NP5 A;  3S16 B;  5J1Z A;  3VR2 A;  3QIA A;  1B3A A;  3DWP A;  1ILP A;  4IUV A;  2HQE A;  4P2C B;  1BCP B;  1G2T A;  4CKB A;  1RDP D;  1SE3 A;  2A69 C;  2OT2 A;  4C2M B;  5C3W A;  1GUT A;  2SEB D;  2YU9 B;  1HA5 A;  2RDF A;  2R7Z B;  1M8A A;  3ND9 A;  3PIP 3;  2B2U C;  1STN A;  4FXG C;  4GZY C;  1PRT F;  4ME5 A;  5A35 A;  1IW7 C;  1SYB A;  4KHZ A;  4KMU C;  1HFG A;  1EQV A;  3D4D A;  1K8M A;  1TS5 A;  2EJM A;  2M00 A;  1S4Z A;  2F0D A;  4FNF A;  1OXT A;  1U4R A;  1B9M A;  1EU3 A;  2I46 A;  5BN5 A;  3F2U A;  1F9P A;  5K36 G;  2WIN B;  1FGB D;  2K7V A;  5LHY 1;  5LL6 X;  5IIF A;  1MSH A;  1E2V A;  2F1M A;  2L11 A;  1EY9 A;  4RGN A;  4G7O C;  1HCZ A;  2KEC A;  4E6I A;  2KEE A;  1UUP A;  2D62 A;  1C4Q A;  4DK1 A;  3R2T A;  4RKL A;  3K0Y A;  1FNW A;  3BZD B;  4C3H B;  1G8Z D;  4LMQ D;  3OWE B;  5J22 A;  2KJX A;  2Z4H A;  5DM6 3;  1LTG D;  1IYU A;  2QIL A;  4HN7 A;  4WRD A;  3VYT A;  1G29 1;  4KY6 A;  2Y0S B;  5I6Y A;  4QB4 A;  3NWS A;  3PO2 B;  2XNA C;  4B9X A;  4KY5 A;  1SBB B;  5JPN C;  2HCC A;  4G7Z C;  2NTT A;  3A8I E;  2PNR C;  1PZK D;  2AWO A;  2C5C A;  3JAM L;  1D5M C;  1AN8 A;  2AUK A;  4FVM A;  4FXD A;  1Q1B A;  1F2Z A;  2F0G A;  4IUT A;  1IKL A;  2NZ1 D;  3E0J A;  3QWN A;  3TSS A;  2HDM A;  4K2K A;  1E0B A;  2R92 B;  2SDF A;  1JB3 A;  2LMC B;  1PZJ D;  1CA6 A;  4KHV A;  1YNN C;  2NBF A;  2QCP X;  2N88 A;  1LTS D;  2ZT9 C;  5FO9 B;  5ELB A;  1JWS D;  4R8N A;  1DM0 B;  3RUZ A;  1FD7 D;  3VYS A;  5EPK A;  3T56 B;  2F3W A;  4ULL A;  1EWC A;  4BBR B;  2J7Z A;  4Q0F A;  3I72 A;  1RKN A;  2NWG A;  4H44 C;  2B39 A;  4QCL A;  1GUG A;  4KK7 A;  1OXU A;  4OO1 G;  1SDF A;  5I4D A;  2A6E C;  1KAA A;  4DF7 A;  5G3L D;  1QNU A;  3A8J E;  1OO9 B;  2BA0 A;  1EU4 A;  2EY1 A;  3TP6 A;  5CMD A;  2LFN A;  1JE4 A;  3N6R A;  2RDH A;  3ERO A;  2PYK A;  2MP1 A;  2F0L A;  4J1M A;  3R93 A;  3HOX B;  2D5D A;  3S1Q B;  5IGE A;  4DXF A;  3H91 A;  3OOC A;  3BDC A;  1EIG A;  2K5Q A;  1BNZ A;  4V19 0;  2R3Z A;  1D5Z C;  2K33 A;  1TY0 A;  3SDZ A;  4XIG S;  3NQI A;  5JAV A;  3KLS X;  4PMC A;  3PO3 B;  5D3I B;  4A3G B;  1ZEQ X;  2B2T A;  5KEE A;  1CHQ D;  3OWF A;  3VA5 A;  1ZYR C;  2A5H A;  3BDL A;  2JXM B;  3Q0A A;  1B9N A;  3AB9 A;  1HA6 A;  2NVY B;  1JIC A;  3H6M A;  3HOU B;  1X3P A;  3BVZ A;  3IAY A;  1FNV A;  5G3L F;  2WII B;  1STE A;  4ZUI A;  1O80 A;  3K59 A;  2RQX A;  1NR4 A;  1TU2 B;  1AFP A;  1LTB D;  1A2T A;  4FF1 A;  1SYG A;  3NTH A;  5FO7 B;  1Y8N B;  1EEI D;  1F2Y A;  4KD4 A;  4L8J A;  4F8M A;  3K5L A;  4ZK9 B;  2B63 B;  3VYU A;  4DAP A;  1LT4 D;  1EY7 A;  2EYP A;  4C1N K;  1SYF A;  3GTM B;  2A6H C;  2A6H D;  1G6Z A;  1R9T B;  4A3F B;  1BCP C;  2VXW A;  3NTK A;  1NR2 A;  1LT5 D;  4XDX A;  2H1E A;  4IFD H;  1SYE A;  4K8I A;  3MXG A;  3DEP A;  4ZAI A;  3FKI B;  1ESF A;  3K5M A;  4H13 C;  1SEB D;  2X6G A;  5D14 A;  1OXX K;  2AWN A;  5CBA E;  3L3O C;  1I3Q B;  1SNC A;  2M2L A;  1U4L A;  3FDT A;  5E3F A;  3CQZ B;  4Z9C B;  5DM7 3;  2X69 A;  5M3M B;  1RTO A;  2KVM A;  1M4V A;  1K83 B;  2EYF A;  2QEJ C;  1KDC A;  1OXS C;  3V2T A;  3LNN A;  3RZD B;  5CR3 A;  3SXH A;  2LKV A;  5EBC A;  1XWE A;  3H94 A;  4IN3 A;  5C3X A;  1W6K A;  4TKO B;  2L55 A;  2QDB A;  1IL8 A;  1EEF D;  1LAC A;  3KLR A;  1EY0 A;  4KY7 A;  1PTO B;  3M85 A;  2O5I C;  3H09 A;  4IAL A;  5KGU A;  5JEA G;  4FO2 A;  3FRP B;  4IFD J;  2VB3 X;  3N52 A;  3QOJ A;  2B2Y C;  2HCI A;  3J80 E;  4XT3 B;  1ENF A;  1ESR A;  5FLX E;  3GQB A;  3LWE A;  2ICE C;  4BA2 I;  1PFN A;  3L7Z C;  1AZQ A;  1TWG B;  4C3I B;  3T53 B;  4ODG A;  4EGV A;  3GTL B;  1ICW A;  5E4W C;  4K5V A;  5BN4 A;  5I6W A;  3LWU A;  3C2P A;  1VCI A;  1MSG A;  1DJR D;  3QJY A;  3RMH A;  2OXP A;  4DGZ A;  1SMY D;  3OHX C;  4X3T A;  4XT1 B;  2SNM A;  1I4H A;  1SYD A;  4L6T B;  1S5C D;  2BDN A;  1WTQ A;  4IUQ A;  1EY5 A;  3I90 A;  1Y69 U;  4DNT B;  2K1B A;  1O7Z A;  2A74 C;  4ZQ3 A;  5C0X H;  1QWY A;  2DY7 A;  4Q5V A;  3DWQ A;  1A15 A;  4KI0 A;  3NP8 A;  4KKS A;  1G91 A;  3E5S A;  5C0X J;  3DMU A;  4KN4 C;  4QMG A;  2B2V C;  3GP7 A;  4K14 A;  4ID6 A;  5K5P A;  3VR6 A;  3IL8 A;  1STG A;  4EQN A;  3GD7 A;  5IGF A;  4CKE A;  3L9A X;  4NKL A;  4EVO A;  2B8F A;  1TS3 A;  1KLG D;  2E2I B;  2XWB B;  2WKC A;  1H9S A;  4OHJ A;  2PPB C;  2FIN B;  2J4X A;  5CV7 A;  2XRS D;  5EGT A;  5A2Q L;  1QG7 A;  2RVL A;  3U9S A;  4HTH A;  2WKD A;  4K5W A;  5I9O A;  3OSO A;  1HFN A;  4WFN 3;  3HS0 C;  3BVG A;  3HKZ B;  3GTP B;  1Y1V B;  1Q1E A;  3MFY A;  4IUU A;  4G7H C;  3CRK C;  1NSN S;  1TWA B;  4FF2 A;  1V1O A;  3S1N B;  4OIJ A;  1X32 A;  1SE2 A;  4DAY A;  1JR0 D;  2D2C C;  1GXD C;  4XQJ A;  2NB0 A;  2D9U A;  1BCP F;  5FO8 B;  1QNK A;  2EVB A;  2NN6 G;  4G57 A;  3RD4 A;  3SE0 A;  3S2D B;  2B2Y A;  1ROD A;  3M7G A;  3H0G B;  2ZXO A;  1AP0 A;  1B4O A;  1EYA A;  1QB5 D;  3EJI A;  5E4X A;  1Y1W B;  4H0L C;  1HXY D;  1S5F D;  3KF8 A;  2MPM A;  2JEB I;  1EOT A;  3FPU B;  4RA8 A;  3K5N A;  1JCK B;  3I4L A;  3ND8 A;  2A69 D;  1XX8 A;  2F4I A;  4IZ8 A;  4A3K B;  1EY6 A;  3OPO A;  2OF1 A;  1EZ6 A;  1EYC A;  5KRU A;  4X3S A;  2R93 B;  3KK7 A;  1I4R A;  1TVX A;  1IKM A;  1L0X B;  1D2B A;  1MI2 A;  4HSP A;  4J6H A;  1BDO A;  4MIU A;  1NUC A;  1S5D D;  2IT1 A;  4HSV A;  4DFA A;  1J9O A;  3I73 A;  5M5X B;  2K5W A;  1CM9 A;  5JEA H;  2F0T A;  1WTX A;  4Y7N B;  4KKU A;  2EYJ A;  3J81 L;  5ELC A;  3FEW X;  4TRD A;  1TWF B;  2WB1 B;  1GUO A;  2KOL A;  2L9H A;  2O4X A;  2WP8 J;  1AW7 A;  1QOH A;  1H9J A;  4UDU C;  1MGS A;  2F0H A;  1O7Y A;  3D4R A;  4HR7 B;  2R6G A;  1HUN A;  3K5O A;  1SAP A;  1V43 A;  3P75 A;  4MHE A;  1Y8P B;  2LY7 A;  1LV9 A;  2LS0 1;  2ZXP A;  1JWM D;  2PMZ B;  4CKC A;  2R61 A;  1TWC B;  2Z8L A;  2A73 B;  2F0K A;  3MC0 B;  3BYT B;  2AUJ D;  5JOB A;  2PCF B;  5C0X G;  3NBH A;  1CA5 A;  3M4O B;  2EYO A;  5FK9 C;  2CVR A;  2EPB A;  4QF4 A;  1F9S A;  3NPP A;  3PUZ A;  5KND A;  1JOQ A;  3DHQ A;  1SSO A;  3J7A F;  3WOE A;  1T5X D;  3S15 B;  3SK5 A;  3X3M A;  4ZLT F;  4FF3 A;  3NXW A;  1BBX C;  4CJ1 B;  4R8I A;  4BY1 B;  1ML0 D;  2JYO A;  1KDB A;  1DD2 A;  3C46 A;  4HCS A;  3I3C A;  5D3D A;  2NVX B;  1WTP A;  1SFO B;  2F0I A;  1KNA A;  3IFD A;  1JOO A;  5EKI A;  4DNR B;  4OO1 H;  4U68 A;  4PMW A;  1DON A;  4I7Z C;  4KJO A;  1U9R A;  5DAU A;  4A93 B;  5C3E B;  1DOK A;  5BN3 A;  4K2L A;  5KNB A;  4KD3 A;  3PV0 A;  3TZU A;  5M5Y B;  1LO5 D;  1WTW A;  1G2S A;  3MTS A;  1C8C A;  5ISR A;  4X3U A;  1YNJ D;  2WAC A;  3TDQ A;  5EKL A;  3SK6 A;  1SNM A;  4K6D A;  3AMU A;  2NN6 H;  1WD0 A;  2XN9 C;  2ICI A;  5FOB B;  2B2W A;  1F2M A;  5M9O A;  3U9O A;  4NDX A;  4FYD A;  3AU7 A;  5CC4 A;  3VR4 A;  4H7B A;  3S17 B;  3A7L A;  1RJT A;  3EFX D;  5HGT A;  1VDZ A;  1CZW A;  1JQY D;  3HOW B;  1EY8 A;  4F7X A;  3DUZ A;  2QKI C;  3K57 A;  3I4M B;  1SNO A;  2A68 D;  5JEA J;  1QJO A;  3FPP A;  4V0B A;  4IUP A;  4KV6 A;  4A3I B;  3D8G A;  2K01 A;  5EKK A;  3VA7 A;  4ILW A;  4A3E B;  1HRJ A;  4QUF A;  5F2D A;  3OMC A;  1NAP A;  3MXN A;  3T13 A;  5ELF A;  5KYI A;  1JOK A;  1TQO A;  2V4D A;  2K03 A;  4EQO A;  3GTJ B;  4F88 A;  1RCV D;  2JEA I;  2K32 A;  5E1F A;  2IJ0 A;  4U67 3;  2MUY A;  1HUM A;  2I07 B;  5EQ0 A;  5DEH A;  1CTM A;  2H4O A;  2B2V A;  1ENA A;  3S9W A;  1I6V C;  1DOM A;  2XRQ D;  2EY2 A;  3HOZ B;  4TSS A;  2BA1 A;  2VNU D;  1QE6 A;  1QCB D;  3K58 A;  4IQZ A;  5FKA C;  1JOR A;  5KIX A;  2K04 A;  2A68 C;  1B50 A;  4TQU S;  2EE1 A;  2IW3 A;  2F0W A;  3NWT A;  2WAQ B;  3P7J A;  3NK9 A;  2XWJ B;  3MEH A;  4DAV A;  4CJ2 C;  3TBI B;  4L63 B;  5EPL A;  2DNE A;  4WOR A;  3PUX A;  2RBM A;  3J80 L;  4IUN A;  5FLX L;  2F3V A;  1DXM A;  1SND A;  2G9D A;  2NUC A;  3D3R A;  4RKB A;  1Z7T A;  3T51 B;  5JJZ A;  4ZYS A;  2NN6 I;  2PZU A;  3P20 A;  1BR9 A;  4BA1 I;  2F0N A;  2XSC A;  2JP1 A;  2BE5 D;  2B2W C;  3W3A A;  1HTL D;  4IFD G;  2XIW A;  4DN4 M;  2K05 A;  4RCN A;  4K8J A;  3HRZ C;  4CBV A;  5M3F B;  1STA A;  3Q6S A;  3EQL C;  3TN2 A;  2DN8 A;  3V05 A;  4C3J G;  1LTT D;  3CHB D;  2N55 A;  2JSO A;  1A3V A;  4NMZ A;  4CJ0 B;  4OO1 I;  5D65 A;  1LAB A;  5EPJ A;  5EBD A;  4RGT A;  1SE4 A;  1CHP D;  2F0S A;  4DA2 A;  3D4W A;  2C9O A;  2L5T A;  1TS2 A;  3URY A;  2F0M A;  4LK1 C;  1LTR D;  4RFB A;  5K36 H;  3K6O A;  2IPK D;  4XQQ A;  2SNS A;  2G9H D;  2EJF C;  4B9W A;  1EIH A;  1TT2 A;  5C0X I;  1RF2 D;  4HMI A;  5CV5 A;  4C3J B;  5HUR A;  3PUY A;  3QO2 A;  2F0P A;  4PNY A;  4BWG B;  5I2X A;  1LTA D;  2ZXR A;  2HDL A;  4NW2 A;  3NQT A;  2PZT A;  2X6L A;  3R3O A;  1O7L A;  2MGS A;  1JWU D;  2PZW A;  1MD2 D;  5C5L A;  3BG3 A;  1JC7 A;  3VR3 A;  1TY2 A;  1WCM B;  3TP5 A;  2K6A A;  3NE5 B;  4A3D B;  4K6L A;  5I9P A;  4XQN A;  2F0O A;  4YIJ A;  3JAM E;  5DNF A;  1PFB A;  1EZ8 A;  2IX1 A;  3BVM A;  3CKI B;  3RZO B;  2E76 C;  1PYW D;  3DXJ C;  3ZYY X;  1VF7 A;  3NBI A;  4F87 A;  1D1K A;  3ERQ A;  5JVG 3;  4C3H G;  2ID0 A;  4I65 A;  1R4Q B;  1DOL A;  1I4Q A;  1K8O A;  4DU9 A;  1Y8O B;  5KYL A;  2F0U A;  4AYB B;  3GTQ B;  3PMF A;  3FMC A;  3RLF A;  1Z47 A;  3BYY B;  4JBW A;  3I70 A;  1GHK A;  5EJW A;  2KCN A;  3KUP A;  4R9W A;  4JK1 C;  2IX0 A;  4J8Q A;  1PRT B;  1EQT A;  1F77 A;  1PTO D;  5IGB A;  5IGD A;  2F0V A;  1HQR D;  3OIQ A;  2WV6 D;  1A3U A;  3OMG A;  3KBX A;  5LL6 S;  1LT3 D;  3EA6 A;  2KQ3 A;  1Z6H A;  3PUW A;  5C44 B;  5T1I A;  4IFD I;  5KNC A;  2E2D C;  1SNP A;  1PRT C;  1TR5 A;  1TII D;  1D6E C;  1KLU D;  2PW5 A;  5CYU A;  1CK1 A;  3A7A B;  1WTR A;  2EYM A;  1V8Q A;  1A2U A;  3QG1 A;  3FVQ A;  3HEJ A;  2IX3 A;  4BY7 B;  2FMC A;  4OGQ C;  1YNN D;  2ENB A;  3J81 E;  2O5J C;  1ENC A;  3MZ5 A;  2EYH A;  2EY6 A;  1B1Z A;  4HCE A;  4N9P A;  1GUN A;  3TP8 A;  3EVQ A;  4PMB A;  1A6X A;  1HPC A;  1Q12 A;  1PZI D;  3V96 A;  1X3Q A;  2VUM B;  1GHJ A;  1WTV A;  1U4P A;  3OW7 A;  1UEA B;  1B2T A;  4S3S A;  2TMP A;  3C1E A;  4A3J B;  2MHV A;  4XYO A;  3SK4 A;  1STH A;  3HOV B;  1GOZ A;  4PQX A;  3D6W A;  1S5B D;  1PXU A;  1DYQ A;  1VMC A;  4B08 A;  2KUM A;  4ZKB B;  2EXZ A;  4XTC S;  1AZP A;  3TME A;  3I91 A;  4RGO S;  2Q8R E;  1H9K A;  3A54 A;  3DEO A;  1SXT A;  4RWS C;  1GUW A;  5C5M A;  3WDN A;  3HOY B;  2EJG C;  2MJ8 A;  3T16 A;  3I8Z A;  3MA2 B;  2KED A;  2L12 A;  3DM1 A;  3MWY W;  4OL7 A;  5AFW A;  1EWH A;  2FMM A;  1I4X A;  1SJH D;  1UNS A;  3GV3 A;  5ELD A;  2NTS A;  4ZUJ A;  3ITP A;  4HAE A;  1IW7 D;  1TKW B;  1VMP A;  3QB3 A;  4XXE A;  4DXG A;  4EQP A;  1PDQ A;  3A55 A;  4K5X A;  4WJW A;  1F2L A;  2RSO A;  3E6Z X;  3QOL A;  3NUC A;  1BQQ T;  1Q8I A;  1ZYR D;  1V1P A;  4RGM A;  3NTI A;  2FJ2 A;  1EY4 A;  4LJZ C;  3A8K E;  1D5X C;  3C3L A;  3S14 B;  4RHR A;  3W2D A;  3OIP A;  3GO5 A;  2E2J B;  2KHS A;  2K5D A;  4HED A;  1XYI A;  5C4J B;  5TSS A;  2BE5 C;  1I4G A;  4ZRZ A;  4KTA A;  1EFI D;  1ET9 A;  2CW0 C;  5COR A;  1CI3 M;  3KLS A;  1SJE D;  1II3 A;  3PUV A;  2EOT A;  1V1P B;  3TZD A;  1BO0 A;  1I4P A;  1D1I A;  1QIL A;  5CV6 A;  3K7A B;  2JA5 B;  5ELE A;  2RA4 A;  1XXG A;  1FNU A;  3I4N B;  3M4Y A;  3SHL A;  3SK8 A;  5I2Y A;  2CQA A;  1SNQ A;  4DK0 A;  2EZV A;  4ZKC B;  2K28 A;  4M8A A;  1W6J A;  4FXK C;  2JA8 B;  2AQ2 B;  3S2H B;  1DZ1 A;  3IKJ A;  3MHB A;  1TWH B;  1NCV A;  1KDA A;  1I6H B;  1B44 D;  4M1U B;  5CV4 A;  3S1M B;  1BOS A;  1GUS A;  2L0C A;  2EYL A;  2JA7 B;  5C6A A;  2L1B A;  3ONA B;  4RAU C;  1HHV A;  2E75 C;  1LT6 D;  5NUC A;  2BDO A;  3BS1 A;  4CGY B;  1PLF A;  3SVM A;  1H9S B;  3D6C A;  1BXT A;  1FYC A;  4N9T A;  4HMJ A;  2PW7 A;  1FR3 A;  5IT9 E;  2NVQ B;  2AQ1 B;  1F9Q A;  3H3V C;  1T5E A;  1DCZ A;  5IT9 L;  4A3B B;  2GA4 B;  1ILQ A;  5C4X B;  3G7L A;  2FFK B;  2B2T C;  1AEX A;  2BOS A;  1KTK A;  1STB A;  4XYQ A;  1GJX A;  4QIW B;  1VF5 C;  4C3I G;  1YNJ C;  3UI2 A;  1HQM C;  5J39 A;  1U4M A;  2PO4 A;  1KNE A;  3S1R B;  3T4A C;  3P1H A;  5M5W B;  2IL8 A;  1KAB A;  2JA6 B;  2M9V A;  2JE6 I;  4G4K A;  3WOF A;  1LLR D;  1H9R A;  3TP7 A;  3MXU A;  3CU7 A;  1PTO H;  4BS9 A;  2E74 C;  3MFG A;  2NVT B;  2QF7 A;  4UAI A;  2F0J A;  3KBG A;  1WVL A;  4O1N A;  1BF4 A;  4FF4 A;  3HP3 A;  4C56 C;  1F9R A;  3VYR A;  1CQV A;  2F03 A;  3DWA A;  3M7N A;  2A6E D;  3D31 A;  1RHP A;  2VB2 X;  1XTC D;  5T1G A;  3HGB A;  2B8G A;  1STY A;  1A3T A;  1Q90 A;  4PV1 C;  2AQ3 B;  1O78 A;  4RH6 A;  2F0Q A;  1BUV T;  4C1N I;  4BBS B;  1PRT D;  4CHT B;  4QUC A;  2SOB A;  3SR1 A;  3BDO A;  1I50 B;  2E2H B;  3HZX A;  5CV9 A;  2YYZ A;  3O13 A;  1PMR A;  1CFM A;  2Z4I A;  4FP5 D;  3A56 A;  2RKS A;  1C48 A;  1CT1 D;  1SMY C;  1ONL A;  1ZXT A;  2B2U A;  3GTG B;  5CGK A;  1SYC A;  2HUG A;  4X3K A;  4KN7 C;  2CW0 D;  3HG9 A;  1RTN A;  3GTO B;  3J7Y W;  1BCP D;  1OXV A;  4RHS A;  2Z1C A;  3J7A V;  3GV6 A;  2EY5 A;  1B53 A;  5JPM C;  1MBY A;  1ET6 A;  2F0E A;  2L4N A;  1PTO C;  1R4P B;  2Q8T A;  4KKT A;  2Q8I B;  1Q3L A;  5IOD A;  4IUR A;  3R8B A;  3SEB A;  3GTK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...