1KNZA

Recognition of the rotavirus mrna 3' consensus by an asymmetric nsp3 homodimer
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
157
structure length
154
Chain Sequence
TQQMAVSIINSSFEAAVVAATSALENMGIEYDYQDIYSRVKNKFDFVMDDSGVKNNPIGKAITIDQALNNKFGSAIRNRNWLADTSRPAKLDEDVNKLRMMLGIDQKMRVLNACFSVKRIPGKSSSIIKCTKLMRDKLERGEVEVDDSFVDEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*UP*GP*AP*CP*C)-3'
publication title Recognition of the rotavirus mRNA 3' consensus by an asymmetric NSP3 homodimer.
pubmed doi rcsb
source organism Simian rotavirus a/sa11
molecule tags Viral protein/rna
total genus 52
structure length 154
sequence length 157
chains with identical sequence B, C, D, I, J, M, N
ec nomenclature
pdb deposition date 2001-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.550 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1knzA01
3.30.70.1610 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1knzA02
1KNZA
chains in the Genus database with same CATH superfamily
4KR0B 4LMKA 4NLQA 2IBKA 2XWXA 2BJDA 2ZH4A 2ZNZA 3LQVA 5CJ5A 1WOSA 3VAFA 3EWGA 5C7PA 1UVNA 5FP3A 3A13A 3FEZA 2B3TB 4AXPA 3HLUA 2KFYA 4C8ZA 3O1LA 2HHVA 3POTA 2K5BB 4B3OA 2W2QP 2MKSA 4IHJE 3IBWA 2A1BA 1LVFA 3MK7C 1U1OA 2Q9QB 5F3JA 1BY9A 4MIAA 4ETXA 3CSKA 2X0HA 1XJWB 4C0BA 2WB1D 3RRHA 1HQUB 1QAXA 3L7UA 4XTTA 4NXMT 1Y5IB 1PCAA 4UZBA 1XNQJ 3NBXX 4CLSA 3OTEA 3CJKB 4J5OA 2W9AA 4S0MA 1VBKA 4DBRA 3ZMZB 3CQXC 4DR7T 3MMAA 3PDNA 3DLEA 1TP7A 5LSOA 2CQIA 1RLCL 5L3GB 2Q66A 3MEKA 3ZNUA 2V5HG 1KR4A 4RW8B 2D0UA 3QNWB 4N7TA 2CQCA 2LKGA 4QZVB 1YJVA 4P1NA 4UOHA 1D0YA 5JDFA 3C15A 2N9DA 3EGWB 2HLUA 1OYEA 1YDLA 2AJQA 1S48A 4WFZA 3N9PA 4JI8F 2VKJA 3RIAA 4R5PA 2OEJA 4CM2A 3PG9A 4DR5T 2C3YA 4ZLLA 3HKCE 3MPVA 3R2DJ 2N1GA 3RAMA 5A1LA 5DM6Q 4DSEA 1WC4A 2LP4A 3OTOJ 1RI7A 4GKJJ 3WQPA 1JJCB 2B51A 1Y01A 3T1YT 2VPXB 3CJSA 3TLUA 2ZM8A 4O3NA 2XQ3A 3EGZA 4QWDA 4N78D 4PYAA 2DGOA 2CMRA 3D7SB 1FESA 5HN0A 2K06A 5LXYA 4H9OC 1JLFB 3BJYA 2OTJS 4I2PA 2XQ7A 4DN0A 3GP9A 4E8UA 2HGNA 2ACMA 2QL9B 3AHPA 4MKAA 4M95A 2WVCA 2VBWA 4CN4A 4Y2KA 4IUFA 2X1BA 2W2PP 4B3TJ 4DMWA 4C97A 1IWAA 2OKQA 3M1VB 4LFBF 4YR3A 4NI2B 1X5PA 4YSZA 1I94F 1QE1A 4WYLA 3MM7A 3I55S 2NW9A 5D4PA 5L4EA 2NWBA 2GVZB 5KFEA 3MMBA 4RW4B 1ZEEA 5HL7Q 3MOZA 3ZEFB 2BG9B 1RBOB 2IC3B 2H88A 2AJFE 2LEBA 2WW8A 3UVJB 4LF9T 2JRSA 2RQMA 2YKMA 1KVIA 1XWMA 5ETPA 1FD8A 1FJGJ 2MYSA 4AXJA 3GV7B 2FVCA 4O4LE 2IM1A 2EEYA 2ZZNA 2G9OA 1Q4RA 2FJDB 3DM2B 3ITHA 4BCAA 1HBMB 2N82B 4JP8A 5DETA 1WF2A 2M9KA 2M8HA 2V4JB 2ABYA 3HKEE 1H2UX 3BK9A 1Q8LA 2ZLYA 3MCOA 3PKMA 4XO0A 2H5JB 2RAQA 3ZN0B 4EZ6A 2VPZB 4JI4F 2ERRA 4ZDNA 2Y48B 2CXFA 3OLBA 3PTWA 3VU7H 3BPSP 2WVDA 1EIYB 4RBVA 4TWHA 1NM2A 3UU3A 5HLFA 5F5WA 1XMQF 3BGUA 4RLEA 3M32A 2QL5B 3I9YA 3IM8A 4HEA9 5KG5A 1MROA 4NLSA 4DR2T 5AQQB 4C0HA 2C42A 4ZVFA 4F4YA 2DHHA 3NNCA 4RO0A 4U9RA 2OPRB 3OUYA 1N5QA 5G0RA 4J9RA 3NG8A 2WVFA 2CQHA 2HFZA 3H5UA 3R7BB 1URNA 1Y11A 5K14A 5IWAJ 4P09A 4R8UA 2XY8B 1HBUA 2BQUA 1M1GA 4DQIA 4TU9A 2HVIA 3KG4A 5FY7A 2JJ9A 2W9CA 4E2FB 1LOUA 1NPKA 3UDLA 4PNIA 3DGPA 3Q86A 4GVLA 1OEDB 2J6SA 3BQLA 4ZK7M 4ZPAA 1SC6A 3JTOA 3RB4A 1WOOA 4NXMF 2RNEA 2DHSA 3HVTA 2QA7A 1Y00A 5J1GA 1BQMB 3N5FA 2KN4A 3BDPA 4OJ1A 3GFXA 3KJVA 4EZ4A 2ODUA 2ZJQQ 2PC6A 4NX9A 3E01A 3J7YU 2FYXA 3WZ0A 4ES1A 2ALYB 3PXGa 4ZHRB 1FDNA 4J9KA 3T1HT 4I55E 1S1XB 1ZV4X 3ZSTA 2V2QA 3AE9A 1X8DA 3W61A 3AJ1A 1JXEA 1B3TA 4EU0A 1FNMA 2NPIA 4U2ZA 3NRYA 4DR5F 1QSSA 3LFMA 4EBCA 3PHEA 1JLGA 2JSXA 3EXYA 4IDPA 2HHHT 2IDLA 4KV8A 2LJLA 3T1YF 3O2IA 2Z0GA 4OX8A 2PFDA 4UF0A 1FRJA 3SOLA 4NXNT 5JH7E 1UJ6A 3GN5A 3VGVA 1UL3A 3NGDA 1U1MA 4YHHT 4DX7A 1QTNB 2WW4A 4B3RT 2PBIA 3BKTA 4K8RA 4H9QC 3C8YA 5FIIA 4ERDA 2J0WA 2J9CA 2OLTA 4ZN3A 1MLAA 3G8TA 2YQ1A 1WR6A 2D41A 5AQPB 2P9GA 1M5KC 1BR4A 2OIHA 3AXJB 3T5JA 3KKFA 3EAMA 4MK7A 2Z8QA 3TO8A 4TVAB 3VGUA 1CJUB 1N33F 1KNZA 2QMWA 3L7OA 4RUCA 2JEGA 2DNYA 2NTYA 3CX6B 1KQGB 2MQ8A 5B09A 2MQPA 5THWA 3SQGA 5KFHA 3MM5B 2UZAA 2VASA 3GFYA 1WG4A 4ZI2D 1R31A 1Q1KA 4O4GB 4X64T 1FXDA 1DU2A 2DR8A 3FSIA 3L95X 4DUTA 1D8ZA 3HVRA 2Y8WA 1S0NA 2JH3A 5A8RB 3EPGA 2ASJA 2KM8B 3CCTA 1AZSB 4ANJA 2NSCA 1LQ9A 1NK6A 2WOMB 3PIPQ 2G2ZA 3C4XA 2LM9A 3HKZD 4DCOB 2XHWA 2BZBA 3KK3B 1VIXA 4WFNQ 1VQPS 1U1PA 5KMGP 4DQSA 3TLTA 2KLQA 3NAIA 2HQFA 2W8KA 1Z2ZA 3Q2MA 2FJWA 2GGPB 2E7WA 1RT5B 2B8QA 3JXOA 3DLKB 3WC0A 4OQJA 5A8KA 3EHZA 5JDHA 2CM0A 3DMJB 4M5KA 4DUZT 4U67Q 3MFHA 3I5AA 2QT7A 4FDFA 4IRCA 2ZDPA 4A8FA 3HHLD 3MOJB 3VHQA 2E5GA 3GIKA 1RTDB 4DF8A 2ZC3A 2CPJA 3DC2A 3N5BA 3SXLA 3UQ4A 3ZTQA 1NO8A 5GAHU 1BLUA 4QPTA 4RNHA 3KHLA 1WRDA 3ZZUA 2R8GA 3NBPA 4ED4A 4JV0A 3TOQA 1LFWA 3CJ3A 1VJWA 3IO1A 3QT6A 3AEFA 4F02A 3TKLB 3BO4A 2F4VF 4YB6A 3HKWA 3BBBA 1MMLA 5HJXA 1TKXA 6FDRA 3NS6A 1A6LA 2V9KA 5J1NA 4J91A 5HP1A 2MHEA 3AE8A 2VG7A 2EKYA 3AAAB 2VKZG 3V6DB 3CULA 3HSJA 4EZ9A 1RAJA 3M8RA 4K4WA 1J1JA 2IIHA 1S1VB 3RHWA 4DSFA 2ODVA 5HVHA 2Z6EA 2XS7A 2M70A 4DPOA 2WSCC 4U7UD 3PUXF 2NR0A 4E7SA 2BJ7A 3M4XA 4OI3A 1TAUA 1TL3B 4C6AA 5HXHA 3SS1A 1RJJA 2DNNA 2WHOA 5C8YE 2A2DA 2FHOB 2NOXA 4U33A 2D5UA 4UZCA 1R0BG 3R3TA 4PK5A 2FZCB 3ENWA 1S6PA 4DI6A 3HA4A 5L1IA 1SJFA 3OXGA 2L9QA 2ZHOA 1MMDA 4NXNF 5JRCA 2YKQA 2AGOA 4AQYJ 4USTA 1IN0A 2UXXB 4MYUA 3QBCA 3AOAA 2A18A 5B0AA 2CYYA 4HLBA 3VWSA 4YHHF 4CH7A 2W00A 2GHWA 3K89A 4DQRA 1XR6A 4F0HA 4C8YA 1RT4B 1X4FA 3DU5A 4G6VB 4LRDA 5IXUA 3C19A 5J2NB 4XZCA 3AEGA 1Y5LB 3H20A 2YX4A 2UUBT 1KOHA 4RNNA 1KS2A 1B70B 4HN9A 1ZAXA 4DFPA 3NGUA 1IBKF 4NCBA 3E0ZA 1FE0A 3GPAA 3MR5A 1HI8A 2MTLA 3HHLB 1S0MA 5K8PA 4GO7X 4JI7F 2QA4G 2HWHA 3RIFA 1HG2A 2YEVC 1NH8A 3MFIA 3K17A 4ZIVA 1JLQA 2DR5A 1DZ5A 3O44A 1UA0A 1FDDA 5ITHA 3N4WA 3CB4A 2WONB 2AIRB 3TEHB 3RB6A 2CPXA 3F31A 4KE5A 4RZRA 4OL8A 1U1RA 4WF9Q 4WKRA 3EI0A 1HQEA 1NRKA 4FI5A 4F50A 1X4HA 1IKYA 1OIAA 2PFVA 2WDVA 2VL0A 3CJTA 3CIRA 2V1DB 2JFDA 2HSEB 1FVQA 2DBBA 3PKYA 4KKOA 3RRCA 2OD6A 3PYGA 4CLTA 2BVZA 1TL7A 4DR7J 1RZMA 5FXVA 5HBMA 2FLPA 1VQ5S 1V5VA 2IMLA 2GVDB 3D54A 4Q2MA 3PJXA 2UUTA 1RGVA 2MGZB 5KT7A 4QCLA 2PJQA 3FBLA 1RAFB 1UETA 4IOAQ 1OY9A 4EMDA 3FBBA 4K4VA 1YJTA 4NLWA 2XBPA 1Y7PA 3MM8B 3KHHA 2M3DA 3US5A 4DV4T 5T41A 2XHEB 2HVDA 4DUZF 4HWHA 2OPSA 2HPUA 1TL5A 5D8HB 3GYGA 3J7AN 4HH1A 1XR7A 2LDIA 2E1RA 4F2SA 1B0PA 1Q5YA 3MMCB 4C0OC 5L3FB 5FVLA 1YVFA 4YMEA 4JI5F 2CWXA 3JQJA 1EB0A 5LMUT 1WG5A 4MKYA 2WSEC 1R0CB 3G86A 1KFDA 2DRBA 2DHXA 4H9NC 5M2PA 1YK9A 4QJVA 2N3OA 4ZCKA 1BR1A 2LXFA 4KAIA 5SUHA 3X1LB 4DQPA 4L0RA 4E0DA 1VQLS 2NCKL 3J80Y 4ETZA 2GQ2A 3M8QA 4QWCA 2BOAA 2F8MA 1UZDA 2E5HA 1B64A 3AE3A 3W65A 3NRBA 4FS1A 1EZZB 4KQZA 1R8AA 3QIPA 2HS3A 4RBTA 2XQ8A 2YNIB 2GZOA 2KKHA 3GFZA 1D0XA 2HQIA 1ZTWA 4NWBA 2XNRA 2H7OA 1JX4A 4PRFA 2B4UA 3QMQA 2VJUA 1RHUB 5E5NA 4EXTA 1X5OA 1BQNA 1SUQA 2E1MC 3D6HB 4ILCA 5E7OB 4MIWA 5A6PA 5KXJA 2OPQB 1KDNA 2BR0A 2R7TA 3PFOA 3BSNA 1A0OB 1RT2B 1UK5A 4X65T 4MAKA 3TZZA 3MXZA 3ILLA 2F8EX 4DV0J 5IUXA 1X0PA 4RWWA 3EDQB 1FF2A 1S9GA 1RAOA 4D3HA 3FRZA 2QMUB 4NIQA 3ZYMA 4FF4A 3OV7A 2BA9A 2KRBA 1NNDA 2LQBA 4FVMA 2LXIA 3Q89A 1G3OA 3TZWA 4DV2T 5KFXA 2DRAA 3W9IA 3CD0A 1SIZA 2E9XB 4ED1A 4QH5A 1RISA 3RRWA 4V19X 1BR2A 3KLVA 4HL9A 2YKAA 2J6TA 2Z58B 3GCXP 4WJBA 3H59A 1Q0NA 5C2GA 5AQFB 4PWDB 3QO9B 2Q9QC 1S1WB 4NA2A 2QG9B 2KJVA 5FJ4A 2RPAA 4DR2J 1SH3A 3SWHA 2WDQA 4HFEA 4URGA 1EP4B 4ZITA 4U31A 3DFEA 2DR9A 5SZTA 3MM6A 2E29A 3G82B 2WB5A 3HX9A 2E8IA 5LA6E 4J2CA 4HT7A 5EDWA 2HS0A 5KT6A 4OHZA 3WBZA 2BW2A 4EUVA 5HJYA 2A6MA 5KDMC 5K20B 4DL0C 4OX7A 3HPOA 2ZH3A 3P45B 4J9QA 3LH2S 4M1KA 2X3GA 4KIAA 1T7SA 1FEEA 1NJXA 2GQQA 4ZLNA 5C25A 4DR4J 3ZT7A 2VC0A 1KOOA 3D3BJ 3J81U 1FKOA 2HNZA 3TW0A 3VCDA 1GTEA 2AYMA 2ZC4A 1IJ6A 1JXLA 2R6GF 2BOPA 3NCQA 1S6OA 3OR2B 4LSZB 3RZAA 3BKUA 4G3IA 2JMKA 1HNWJ 1S10A 4B9VA 4AXIA 2YX1A 2V26A 3T1HJ 4YY3T 1WF0A 5FXZA 3E22E 1TV6B 1B0TA 5T7LA 5KFTA 3CQGB 5HEOA 2PN6A 4RU2A 2YKNA 1AW0A 4O8SA 3HR0A 4O4RA 2CHOA 5CYMA 3I0SB 4BC9A 4YSXA 1PSDA 4HFHA 4P2MA 1ULRA 4KUMB 1P9YA 3CVRA 4FF2A 5LMUF 1Q95G 1PYOB 3GSIA 3H37A 4YLHA 5DLGA 1W2BR 4YP3A 2GAHC 3P96A 4WE1B 4EO6A 2BRLA 1F1BB 1HI0P 1XDPA 5CCMA 2HHHJ 1WI8A 1NZAA 2XO6A 1IM6A 4NYZA 4FYWB 4ZPWR 3AA0B 3O1JA 5AQNB 1FK9B 3QJLA 1D9DA 2H48B 4LSLB 2ILZA 1TUVA 4ECRA 1T03A 3ILJA 5I3UA 5LMNJ 3QRRA 4F0MA 4B3RJ 1U8SA 3LGMA 3UE2A 3OT9A 2BS3A 1REVA 3AB2B 3FKBA 4TU8A 1S77D 3LK42 1RHKB 5DG7A 2YU1A 4O23A 4IL9A 1YBAA 3H7HB 4ECYA 3KK2A 3J7Z5 5DGBA 2ZD1B 2BJ9A 3D0HE 3KBTA 2NTXA 2GV1A 1M0SA 4A47A 4YFSA 1SL0A 3QATA 1VFJA 2VL1A 3CCJS 2RDDA 5KT4A 2BS4A 1YHQS 3F73A 1VC6A 5IM0A 2J7UA 3LP0B 4X64J 3CD5A 3VGSA 4ZVPB 3V5RA 4LQ9A 1JLCB 3IAS9 1RWKB 2RF2A 2AZ3A 4UW2A 4F3MA 2CA9A 2JVOA 4IREA 1Z2LA 4I7FA 2LEPA 4GMKA 1N0UA 4LIWA 3NZPA 4OHYA 5JR9C 3IGNA 4QPXA 3DYAA 4DV2F 1H98A 4TV9E 2HNYA 4LF6J 1RAIB 3K3NA 2QYWA 2JDJA 1XN9A 4OX9J 4MFBB 1ZS6A 3OYZA 4JYAT 2YBVA 3KK1A 2YH0A 4ID5B 3RR8A 3ZJ1A 2C2EA 1R8HA 2Y1RI 3W5XA 2YWFA 2YKPA 2KWIB 4IDZA 2QA1A 2XYPB 2CJKA 2LDYA 3SZ2A 3ILOA 3EZUA 2DNZA 5DDQC 1QVFR 4ZCIA 3MCMA 3HVWA 1NK7A 1OEDC 3K0JA 3G9CA 3AA8A 3NNAA 3UR3C 5HCMA 4XK8C 3JADA 3MUVP 5KX5E 3AE2A 2PA8D 4OYMA 1HNXT 1FJCA 4IT4A 2PI4A 2M88A 4H9SE 2XQ5A 4C11A 3U02A 4N41A 2G1DA 3FCWA 3CMAS 1RCXB 1U1LA 1QLNA 4Y2CA 3I1AA 2BJ8A 2AD9A 2UXDF 4LF5T 5L1JA 1P6TA 4CXWA 1M5OC 3KVBA 3ETOA 1SUMB 1HNZT 4DEZA 2HGLA 4WBFA 2QC3A 2CZ9A 3IBPA 2BABA 2B5JA 2W67A 4K50A 3P8BB 4AE5A 4M5IA 4LF4J 3PX6A 1PG5B 4NYOA 3MKDA 4CLLA 5BR8T 5F8GA 2NXNA 2XZDB 1UEKA 1W0AA 3R5JB 3VR9A 2ASDA 1KVJA 2UXBT 3JTPA 1AB8A 3TLSA 5ABGA 2NXEA 3DRSA 2V8GA 3ISZA 2C5JA 2J47A 1F9FA 2VV5A 4WP8A 5KFGA 1XK8A 1HARA 5AFUL 3DGVA 2KG0A 4YTNA 2Q9QA 3OTDA 4P10A 3J9X1 1BXNA 4PQUB 4QH4A 2M0GB 1N5SA 2EPIA 2UV8A 2KT5A 1HQUA 4DCJB 1EETA 3JQKA 2DWGA 4P72A 4PEOA 4OMFG 1U02A 1SL2A 1HBNB 3RRGA 4KB7A 3AAWB 3CJKA 2JPFA 4FF3A 4ZZBA 3LTOA 2RSQA 1O5JA 3CO0P 3GIMA 2LEHA 2HPJA 1U0SA 3V4IB 2A6OA 1JQGA 3FBCA 3FFIA 2U2FA 2CPEA 1RT6B 3QT8A 4DU7A 5KFOA 2C0SA 4JI0F 4DV3F 2WB4A 4GKKF 4LFAT 4P0BA 2JMHA 3OFGA 4WIIA 1X4GA 2BYCA 1LV5A 4B3MT 4KGXB 2FVRA 4X66J 3H4DA 3DDNA 1VQNS 1X31C 2DGTA 1WC0A 2DB1A 3DTOA 2C2OB 2VFVA 1IBLJ 2VKOA 3RI5A 3P7IA 5LGNB 1VC5A 3LO3A 4RPFA 2KZZA 3POTB 2ZWOA 4B3OB 1N56A 1ZOYA 3R97A 1NJWA 2WZIA 4DV1J 5HMXA 3N28A 1JLAA 5JVDE 1KKHA 3M8SA 2UU9T 2VG5A 1X5SA 4DV7J 2ZM6T 1ZH5A 1FNOA 5IQQA 2FJBA 2CPYA 2MEWA 4MLKA 4N8OA 1NBEB 2EFOA 2MPUA 3GLJA 2IVFB 4PZVA 4B9NA 1IBMT 2NQPA 4QBUA 5LGUB 1CJTA 4KHRA 2N4DA 4OYXA 3TRGA 2CNNB 4QIGA 1JLFA 2FY8A 2D69A 2M52A 3ZJ2A 3MMAB 4UV8B 3DLEB 4CLZA 5F8NA 1X60A 2GIQA 1SH2A 4P0AA 2YWWA 4IR1A 2FLLA 1MIVA 3AEDA 3BREA 3C15B 2IRXA 2YDQA 1S6QA 3ZMUB 3T9NA 5HQMA 3RYIE 5IT9U 4K0KF 1VCTA 3CC7S 2VDHA 1WF1A 3TP2A 2MAWA 3IBFB 1L0VA 9RUBA 2VQFF 4YB1P 4ZLPA 4R5PB 3BGOP 4USIA 4DV4J 1O51A 2DNOA 2IC3A 3UD3P 1K44A 3WI3A 3M05A 4OLPA 5ETWA 3KHRA 1FWPA 2UXCT 1O6XA 4K4ZA 3RIUC 3EDRB 1S9FA 2LSGA 3MZKB 3BO3A 2GO9A 4ER8A 1VQ7S 2BE9B 2CQ3A 2GIRA 1SQGA 2RH3A 2LT3A 1TMMA 4HFIA 3KHGA 2BE7D 1TUWA 1F5BA 2CAJA 1HNXF 3I9ZA 1VQ6S 2M6IA 4I2PB 2CEAA 3FB2A 1TZ0A 1CJKA 3GQCA 4Q45A 3GA8A 4CO0A 4B3ST 1UJ4A 2HHTA 5HXRA 3MDFA 3HDSA 4ZI2C 2HQGA 2LHRA 2LLYA 4BA9A 4I64A 2DPIA 5JR9A 1WDTA 1QE1B 3MM7B 1YSJA 3KV9A 5FL1A 3Q5EA 5BR8F 3HSGA 4CTAA 2MQOA 4KJIA 3MMBB 1FMVA 3VGTA 3UN3A 1U4QA 5D4OA 4WP3A 5AQRB 4NOHA 4JV5T 1RWXB 1E6YB 2DCLA 5E41A 5CGMA 2C1EB 2DISA 2YKMB 1AYEA 3R5CA 2E1AA 1H38A 4GO5X 3ITHB 4USJC 4KSEB 3F0NA 1QSYA 3MPDA 1ZAWA 1OEDA 3BQKA 1IKXA 2CDRB 1I6ZA 2V5CA 3CMQA 1TELA 2Y6XA 2Y1IA 3KLHA 4CI1B 3J81j 3MEDA 1VQKS 1RADB 4MALA 3S8SA 3FEYB 1TFWA 4LIRA 3U78A 4ES2A 4KHPT 2V63A 3M2RA 1H7CA 2GFFA 3KUEA 1GK8A 1PC4A 2W7AA 2E44A 3HHLC 1S94A 5K8OA 3EICA 1J5EJ 3W8GA 4H9RC 5F8PA 1R8CA 2G13A 4YJ2E 2D1CA 3Q8UA 3M32B 2BX6A 2ACXA 3VVUA 2MDAA 1MROB 5D77A 1S0VA 3UU5A 4C4WA 5AT1B 4CWBA 2F9DA 2A72A 1RT7A 2C5IT 3Q9DA 1GMUA 2E66A 2DWKA 3QQCD 3OUYB 5JXSA 3AA9A 5G0RB 1W25A 1M62A 1TKTA 2KI2A 4A8SA 5CAAA 4UY8T 4HFDA 2ZFHA 5K14B 4R8UB 2IUBA 1W26A 1HBUB 3I56S 3H5YA 2QN6B 2BW7A 1SI9A 2W9CB 3LGHA 4K4UA 2QLFB 3DGPB 4PG8A 4ZVRB 2XAGB 5LJ5Y 1H72C 3NXZA 1JIHA 4WWSA 3HXMA 2W25A 2EK6A 2VFUA 3V6HA 3DLGA 2QEXS 3R1LA 3NOCA 3HVTB 1NSAA 5AXMA 1FKAF 2R7WA 2P6TA 3KJVB 3RC8A 3ENVA 3E01B 5JUMA 4MTPA 2UVRA 3VF0B 1S9EA 2KT9A 2HFSA 3MCNA 3ONLC 5DO2A 3U1LA 1LWCA 3MTKA 4HWFA 4YY3J 2RKIA 2D0TA 4J9OA 5KG1A 3NWIA 4I0UA 2JOQA 4NCGA 3LOUA 1CG2A 3TLVA 2WTFA 3ONXA 2IJNA 4KTQA 4PG4A 2RRAA 4NZ6A 4L74A 1SL1A 3B54A 1SXLA 3CC2S 1JLGB 3ZKRA 4UEMA 2W4PA 3TYTA 3D5MA 2DNPA 2BBEA 1RTHB 3HM9A 4B6XA 5A8RA 1WUUA 2FHKA 3CDWA 4KV8B 1NKBA 4UF0B 5IOLA 3NS5A 3ZTOA 4TQRA 3GN5B 2Y0SD 1YD8G 1NK8A 3T8OA 5EN1A 3MEGA 4NMLA 2GW8A 1OQ6A 2MXYA 4CP5A 4DG1A 4Z2XA 5ETMA 4PQAA 4LSNA 2CPDA 2JVRA 4ILLA 2QLBB 4AKRB 1A9NB 4IE0A 1OMSA 1SC3B 1NU4A 3D68A 1NK0A 2GGPA 1U1NA 3MD1A 1OYDA 5DS7A 1KNRA 4B3SF 3GMGA 3HO1A 3S01A 2HHXA 4IYQA 3KV5A 5GADU 1EARA 2F8HA 4TYAA 4NUVA 4F36A 5E3QA 3NGSA 2BV3A 4FBUA 2WAUA 1TK8A 3SQGB 3OJSA 4H9PC 2MKIA 3QSYB 4QU7A 1Y9OA 2GK9A 1EJ7L 3JC6D 3MMJA 3PU8A 3VALA 2BANB 3FNNA 5FMNA 3OL7A 1UW4A 1N36F 3VQSA 4IIJE 1N34T 1Q82T 5D3GA 3KDSE 4ED6A 1OJ4A 1MWQA 3UQSA 1YITS 1YQ4A 2IPOB 3KMSA 4CN1A 5LJMA 1VR6A 2CRBA 3MPWA 2IHR1 3KINB 2XCPA 2OH2A 1WSRA 1WC1A 4DL2A 4J9SA 4U96A 2I0XA 1B7TA 3FBEA 4DF4A 3TUPA 2YXLA 1UFWA 1IVZA 2C2RA 4ZHQE 4HKQA 2XEXA 1ZYQA 4KHZF 1T94A 5A8KB 5EWFA 3MJXA 1XBWA 4PABA 2B4PA 4OYJA 4DR3F 1Y10A 3M6VA 4JI6F 1U5PA 2LVWA 3DOMA 4WBOA 1DQ9A 1VLOA 2Z2MA 2JQKA 4DPWA 2HMIA 5DM7Q 4NLYA 3N6LA 4ED8A 3MPYA 3QWPA 2QLWA 1CEZA 1EAYC 4JI3T 4DV6F 3NBPB 1M90T 2NYHA 1UVMA 3Q0AA 1N32T 2V7LA 3CC4S 3TWZA 5HEHA 3RBXA 2R7SA 5LOVE 2IC9A 2M8DB 1K8AT 3VHLA 4F3OA 1TKXB 5H9EK 3UD5A 3GR0A 1SA0E 3ANWA 5HP1B 2N7CA 1RT4A 2VG7B 1SJ1A 2RHQB 1MMGA 4K4XA 3T3FA 3QFWA 2IRUA 1Q8BA 2F4FA 4Q5VA 2R8JA 3AE7A 4AL6A 4IDQA 1C1CA 3EVOA 2BJ1A 3TNVA 2AYGA 1Y0HA 1JNRA 5FKYA 1VQSA 3KFWX 4CO2A 2KZMA 5J2TE 3H2VE 1SVDA 1M5HA 4EO8A 2IVYA 5T14A 3G06A 1PJ7A 3LPEA 1S6PB 2CE7A 3IRXA 3MZIA 4I1TA 2FJEA 1XNQT 5JREA 3Q5XA 3VKHA 5HCJA 3HP6A 3E51A 4MK8A 4PFPA 3NRXA 1YQ3A 5JRCB 3BGLA 2QLXA 1G6BA 2ZH2A 5KFMA 4Z7CA 4WTOB 4NCAA 3KMQA 3PCOB 3SRZA 5C24A 1VK8A 1M7KA 1YKWA 3IR6B 2F4VJ 4QYZJ 5CZVA 3BH6B 5L3CB 5HWXA 4B9SA 1ZA2B 3JSYA 3PACA 3RJMB 1JLBB 1Z4UA 3I31A 1KC8T 4M94A 1D09B 5IS2A 4HHUA 5CFBA 1XQIA 4QYRA 1FRLA 1A7GE 4F8RA 3MMCA 1UURA 3SYZA 2MQNA 3OTOT 4GKJT 2EC2A 2ZBIA 5KFUA 4DS5A 1XTZA 2VA2A 2XULA 2GMHA 1HQEB 1F0XA 2P9EA 5KFZA 2K48A 4OZ1A 4O3OA 1IKYB 4HHHA 2MZ1A 3O1IA 5LM7E 1K9MT 2FUG9 3K7RA 3D67A 2VIHA 2HK2A 3T5LA 2HZAA 1RHRB 4KKOB 2YNGA 1RK8A 1K1SA 4G2AA 2FLOA 5ETVA 3TR5A 5D0HA 1TL7B 4B3TT 2NUHA 2BUNA 3D2WA 5HBMB 3J7A1 4NZ7A 1FDBA 3WAJA 1EQMA 2CIMA 3CX7B 2XM1A 2CJAA 4EBDA 1OSDA 1HF8A 4I2QA 3PURA 1FFGB 3AVRA 2AEFA 3FCVA 4A8KA 3W64A 3CE8A 2EFNA 1YBTA 2NXUA 1L3TA 2V2VA 3MPUB 1WYBA 1KN6A 4CLPA 4DV5J 4KMCA 3QFHA 1S1TA 1SIWB 1YRUA 3CDAA 4OJGA 2OPSB 3FMBA 3UCGA 5HMZA 1ZTTA 5I4MA 2FZGB 2DNXA 3X3UA 2WRMA 2D9PA 1YG0A 5D4NA 4ZS3A 1IBKJ 1FJGT 4D3GA 4HI2A 3CJ0A 3ICLA 3IEEA 3RRKA 4Z91A 3TAPA 4ZOSA 1PILA 1FE4A 3ZXWA 2F40A 2CJ9A 4JI3F 3TJ9A 1SKWA 3TUZC 2GHPA 3RAXA 4NA3A 4PXDA 4CNZA 1Q53A 1N32F 5JDLA 1NAFA 2QRXA 3K5LA 3TEGA 4Y2IA 2R3VA 3M8QB 3HFVA 3H0PA 2RVJA 4HKAA 4K2JA 3MA9A 1HS7A 2KG1A 2LXUA 5AE3A 4WU2A 3QIPB 1X5TA 2Z30B 2B6AA 1T02A 4YUDA 4CYUA 5DDOC 1ZKEA 2H89A 1G4CA 4BWMA 4HFCA 2XQ9A 1BQNB 1SUQB 4OLOA 1F5AA 3AA1B 2A2CA 1WI6A 1KWMA 2B4OA 3SSRA 1WKKA 3SV4A 2CNKB 2VKDA 5IWAT 3V6KA 4X62J 1HG5A 1FTRA 2DXEA 2FUPA 2HIYA 4JI5J 1T3OA 4OI4A 2CJBA 1XNRJ 3AE4A 5FLXY 1S9GB 4DOZA 4IG0B 1NJYA 1HR0F 2K3KA 2N4CA 1XNQF 2AGPA 2EHOD 5DABA 1I6JA 4PXCA 1FRIA 4IFVA 1E7PA 4QR1A 2DY9A 3R6NA 2XMAA 4R0EA 4HTIA 2B8PA 4WFAQ 1P1TA 4HWDA 1QM9A 3I0RA 4YR0A 2AQ4A 2X66A 3K5MA 2LE8A 4QXCB 4ZS2A 4NA1A 4WXWA 1VGYA 1YWXA 1HHQA 3LAMA 1YJUA 2VG6A 1RDRA 4PWWA 1Q86T 2FZKB 1LW2A 1GH8A 3HD2A 4A46A 2UXNB 2KFZA 3BPDA 1TL1A 2ZBQA 5L3DB 5LJ3Y 2XJ7A 5B0BA 2AGQA 5FXWA 4KPCA 2AZ1A 3KG0A 3CJ4A 3MM6B 2WBMA 3ZMSB 1FRKA 1MNEA 3OTOF 4DR6T 2I6WA 3UNGC 4QR0A 2B43A 3N6MA 3NOGA 3PR5B 1I3OB 1LK7A 1FK9A 4UTGA 2AJ0A 2ZH9A 4PWUA 4LSLA 4CZZB 3QYYA 1BR0A 5AQOB 2V69A 5HQ8A 2MTQA 2RS8A 1FEHA 1LNQA 5JJBA 2IAKA 3ULHA 5KFRA 1U4BA 1FKOB 1K1QA 2HNZB 5A0YA 4TY8A 4DR1J 2CXLA 3PE0A 2MY7A 4TZ4C 3BO2A 2JIWA 3LJCA 3PVXA 2RJZA 3QPIA 3CMES 4UOGA 1IQZA 1P9QC 4UOFA 5T7LB 4M1PA 5HXSA 2YKNB 5K8MA 1T9TA 5CYMB 2P8IA 2MJNA 4IR9A 2CPHA 3OKQA 2HN2A 1AJ3A 5D0EA 3ET6A 4ZPVR 5ETLA 1RYSA 5HWYA 2LFVA 2VOPA 3H2UB 3K8VA 2OPPB 1E1HB 3CCVS 4J37A 1V3SA 5HK4A 3MAQA 3C46A 1WYCA 3KJFB 3VR1A 1DLOA 2NXCA 1HNIA 5L38A 5GAEI 1S6UA 3ENQA 1YZ7A 1RWPB 3R8YA 5KFIA 1BC6A 3D1QA 4OYBA 2DO0A 4OI0A 2UVVA 2KO1A 2Q3PA 1REVB 4OV1A 4X2BA 4ECSA 2PEBA 4ID5A 3TQEA 4KC5A 3EVYA 2F9JA 3H2LA 4LBPA 3KK2B 3LBXB 2R2SA 3DP7A 1JNZB 3DJBA 4ZCLA 3OFFA 1U8WA 4ZXLA 3S6EA 4C8NA 3VR8A 1C2PA 1EX8A 3NP5A 3PX4A 2MYFA 3AOBA 3NWRA 2DIVA 2BM0A 4F7VA 1W0BA 5IM0B 3NZQA 4AKGA 3GIJA 1GXTA 2DNGA 3KVAA 2HS4A 2DEJA 2WM9A 4AIUA 2EWHA 4ZCMA 3AE5A 4QIVA 3HFZB 2A10A 2RF2B 1NDCA 1NK5A 3O4XE 1KFYA 1U24A 5KFVA 1N34J 3ZLIA 3PFEA 5HANA 3NY0A 2ROEA 4I7FB 1LKXA 4QOTA 3QC9A 4TX5A 3SEOA 4X4VA 4FYDA 3QB5A 2V68A 2PMZD 2KXNB 3NCPA 1N5VA 1TQLA 3AOCA 3DYAB 4JV1A 1C1BA 1NDPA 2HNYB 4LT6A 4DL3A 2OV9A 3PO4A 3OL9A 4M5HA 1HFAA 3KK1B 2MSTA 4KBIA 4P74A 4JUYA 5F8JA 2UUCT 3P8CD 4DPTA 3H3AA 2HFVA 5ETTA 4F4XA 4ZLJA 2OMLA 1NCLA 1FMWA 1NMEB 4AFFA 1T05A 3EUHA 4I67A 4PR6A 3EXCX 1KQFB 5KFAA 1V9OA 3DDKA 2KFNA 2G2OA 4TLRA 2ZITA 2FC9A 2E5LJ 2XG8A 2HBQB 2VWAA 2AKWB 2DHGA 2DNRA 4USWA 1IKVA 3E3XA 4C11B 3EJMA 1MMNA 4AQYT 5KFDA 5K9FA 4G1QA 4PJNA 3H5SA 4GVBA 2NREA 2ROPA 3NGTA 3R7SB 2QX0A 4F0KA 2ZKUA 2X51A 3ISND 4F3QA 3ZTRA 3F57A 5GMKa 2OI2A 4A5XA 3AD9C 3D0GE 3W63A 3N9LA 3MAHA 1AUSL 4B08A 3RW7A 2DPJA 1YJNS 1X9WA 2CUYA 2W2UA 2QA4S 4TXSA 5H9EJ 4V19J 1FRXA 2FGOA 3FRYA 2KJWA 2APOA 1VRBA 2H3RA 3KLGA 5LXRA 4I68A 4H63V 2QFIA 2QV6A 2QZ8A 4JV2A 2EG1A 3KLEA 2IDOB 3DRSB 4TKTA 2HHUA 1X9MA 4U2YA 4YR2A 3KJQB 1XMOJ 2VB6A 2KXFA 1HWJA 1SPBP 5LNKA 4IE5A 1NHKL 3JS9A 4FYVB 3P4SA 4YB7A 2HNDA 1QUUA 2X68A 3KUGA 4A8WA 5D0RA 3AJDA 1EETB 4CO5A 1AFJA 2OJ3A 2LEAA 4LFCF 3S7RA 3AT1B 3SSQA 2V8HA 1KONA 4LMJA 1FNXH 4KGZB 3QRQA 3QUJA 3DRXA 3Q8SB 2PGCA 3FFIB 5AE2A 2VBYA 3R5AA 2PA3A 5IYZE 1D1BA 2YK0A 3CNQP 3TZYA 4R25A 3I6PA 2ZWPA 4L72B 3U7JA 2AT1B 4I0WA 2UXDJ 2ASLA 2CJQA 2BACA 3KNAA 3M65A 4QXHB 2HQDA 2AU0A 5KOXA 3UU6A 4JBCA 1WHXA 3UDVA 2MZQA 3AVSA 2BQ3A 1XZYA 2LSIA 2HWIA 5L4HA 3LK2B 2JC0A 3BZQA 3FVYA 5ABFA 4HR2A 1JLAB 2R2UA 2ZM2A 1SV5A 2VG5B 1FD2A 5ETKA 4AUKA 5CYJA 3CXCR 2L3MA 1UP1A 3NMRA 1YIJS 2FJBB 3DLHA 2XY7A 1KLMA 4HVZA 4TNVA 1CJTB 2BJEA 4BBYA 2ZBRA 2PE8A 1UJ5A 3OBVE 1Q78A 3P4UB 4ED3A 4H4KC 1FA0A 2RILA 4DVDA 5KAKA 4O2AE 1D0EA 3BV8A 2CKWA 4GOUA 2W2MP 1T98A 4C2MA 4OHVA 1MG7A 1FEWA 2W4DA 3P50A 1RACB 3OL6A 4ZP8A 4ATNA 3M8PA 4WZMA 1S6QB 3MUMP 1X4AA 1VBYA 5IT4A 2WSSV 3AEBA 3AECA 3AE1A 2MBGA 2DHRA 3AA6B 4JI1F 5DQIA 3J80U 4IFYA 1CBKA 4MBQA 4LF8J 4DV3J 4UVAB 4GKKJ 3T9ZA 3HHNB 4Q8EA 3MR3A 1E6YA 3NEKA 4QX7B 4USUA 3ZZOA 1RWMB 4DV0T 2RP4A 3OXLA 2DJWA 3A8YC 4CO4A 3P4WA 4ELTA 1BE4A 4C7QA 2ZZMA 3K3OA 3QGPA 2F5GA 3GFHA 4L5GA 1L3KA 4Q8FA 1HKAA 1MU2A 3P5TL 4Q25A 1BD6A 3BSCA 4OYKA 2K1RA 4DZ6A 1WEXA 3C98B 5J1EB 2MPKA 4TYBA 1CJKB 3SFUA 5ETNA 3GJRB 3UULA 1AROP 5AQJB 1GX5A 3QRPA 1ZBTA 4MH8A 5J0ZA 1T8BA 1S59A 3JC6C 2ASYA 5JR9B 2XASB 4UUWA 2HAIA 3IHRA 4DS4A 3NCRA 1RT3A 2H4WB 1RAEB 1N4LA 3NNHA 4CTAB 1RBAA 3R5GA 4RKUC 3PYEA 2CPTA 1QUVA 2E5IA 1GNKA 5LXTE 4FF1A 2ZDOA 4OZ3A 4K0KJ 3OVBA 3BDEA 3HSZA 2VQFJ 3HHKA 4X1YE 3G6XA 4A4JA 5KFLA 4KI0F 3QGHA 3RQUA 2I0MA 3BBCA 1MN9A 2J6UA 1VQ4S 1IKXB 4EV6A 1PAEX 4FBTA 3KLHB 2ZNYA 2HLTA 4O2BE 3MEDB 2HRUA 1DTTA 2DNQA 3UNYA 1SC1B 2LLZA 4DR4T 2C3UA 1GEHA 4QWBA 1N88A 1PYTA 3LWMA 5L3BB 3TA0A 1U26A 2R7VA 3U1NA 4DR7F 4RU9A 1UVJA 2KMFA 3M2RB 1JWWA 1GQEA 3CEDA 3JSRA 3BEGB 3T6BA 2O1PA 1U6BA 5AJ3J 2WY2A 1HNWT 4URSA 3EUNA 3OPCA 3CD7A 2ZH5A 2W62A 4HWCA 1V3RA 4K4SA 4ZOLE 4PJLA 1TTHB 1V5IB 4EIWA 2I5JA 3PW4A 2DT9A 4ECTA 3RKOA 1RT7B 2L9DA 3TLWA 3K3QC 2MLZA 2JC1A 3IM9A 2Y0BB 2HQ3A 2NS1B 2VJVA 1FJEB 1TKTB 2CFXA 3G71S 3PU3A 3LGNA 1RTHA 5K8NA 2PEHA 4DR6J 2OEKA 3EM1A 3V5SA 2W9BA 1C0TA 4NLXA 1IR1A 3JB9k 2YPZA 1VHIA 2VFTA 3DLGB 5LMNT 2YPYA 1KEYA 4H54A 5E3CA 1HW9A 3PJWA 5A2QY 4ZZCA 2C3OA 5LBQB 2M2BA 3RG6A 2DHAA 2CJYB 2RS2A 4EZHA 1S9EB 4UV9B 2HBYB 1LWCB 2BMBA 1CQNA 4P6QA 1E6VA 2J9EA 4L73A 2RKIB 3CCRS 4KO0B 5M2RA 4NCGB 2V2ZA 5F3ZA 2RDIA 4DUYJ 4ZPTR 1TK5A 2HYIB 3D6MB 4IOCQ 2OHDA 2YDSA 1L3UA 4M5JA 2BANA 5HVFA 2LRLA 3FXEB 2GAGC 4LF9F 2AWZA 3SFDA 2ZZTA 4MYTA 4UT4A 2IRYA 1NDLA 1U47A 3W8PA 2HGMA 4M8LA 1KQSR 3M9MB 3HHDA 3RAQA 4CCHA 1TKDA 3IA0A 3SCJE 4YDDB 5F9NA 5KFSA 4PPZA 3F56A 3TVYA 2R2RA 2DR6A 3MEGB 1F9EB 1QVGR 4EBEA 4DG1B 2IA6A 4LF6T 4LSNB 5CHCB 4LF7J 4OX9T 3CMLA 2DGQA 1UEUA 3GR1A 3TA1A 4J9VA 4CLKA 2A9UA 4H4KA 3QAEA 3AB3B 4YN3B 4ED2A 2K7KA 2NR4A 1UCUA 2G0UA 3PR4A 4ALZA 3KLFA 1K73T 4QXBB 4DR2F 2J9DE 5EK2A 4XAKA 3N9UC 4J9NA 2AX1A 3C64A 1VISA 1F60B 2J5AA 2CQPA 3RBEA 3W9JA 3WAKA 1N5TA 2ZH7A 3IBCB 4NLUA 1UA1A 4WU3A 4Q44A 1TAQA 3AD8C 5C42B 2MJUA 5D3GB 4UF4A 3IFEA 2PTFA 3R7NB 4LRFA 3J7Yq 2KB2A 2YWEA 4BDPA 3DNCA 2GHVC 3CGIA 4J9MA 4IH5A 2ADBA 4WZXA 3TZXA 4BWJA 3CTRA 4EK2A 2VKRA 5D6GA 2DH9A 1NZ8A 1RWWB 3IG1A 4DR4F 5CYQA 1SH0A 3D28A 3SMZA 1KVKA 5LP6E 3OL8A 1OS5A 4PXEA 1YGYA 2LSYA 1DQAA 4LF4T 2FC8A 3KG1A 4NLPA 4X4PA 4KBMB 1HNWF 2XZEA 2DIUA 2FGCA 5CA0E 5CA1E 1H7XA 2B4VA 2QYCA 1YW0A 3ZZTA 2Z2LA 2C2KB 5KT3A 2Y1JA 3T1HF 2V2KA 2UUCJ 1RQ0A 3MR2A 2F7VA 1RKIA 4GIWA 1Z8UA 3DOMB 2H7VC 5E0OA 3DN9A 5ETRA 2IC6A 5ABHA 2HMIB 4K59A 5I3PA 3PZPA 4LRCA 1U45A 4LMZA 2B56A 3T5HA 4XPCA 5F9LA 1S5ZA 4PXBA 3QWUA 4JEHB 5ADXL 4YHJA 3GCWP 4TU7A 2Q1LA 1ZPVA 5F41A 4OHFA 3QGGA 5A6WA 4OI6A 2EFPA 3UUMA 1HCIA 2HHHF 3AJ2A 2XM3A 3SFEA 3AD7C 2WVBA 5JDQA 3OFHA 1S79A 4ECVA 3H25A 2ZMAA 1VRTB 4TNOA 1HX1B 2HVHA 2GNKA 3PY8A 4V1Av 5LMNF 3C66A 3IN5A 1IJEB 4B3RF 2AEMA 3ANWB 2WZ1A 3A3NB 5E3RA 3LK3B 2OFHX 4ADZA 4UIGA 4FZVA 4RL1A 3ETVA 1JLBA 4PCQA 1DY3A 2LYVA 3SCKE 4CNYA 1IKWA 3LW5C 1C1CB 5IZHA 4JLEA 2K24A 4X66T 4NZ0A 2X7IA 3RUBL 4PJJA 5I42A 5JMNA 3THTA 3LUYA 1IBLT 1T9UA 4WFXA 1H73A 1RE1B 2CVIA 1JNRB 1FXRA 2CWKA 2IM0A 4OZ0A 2RE1A 3CKDA 1QD1A 4JI6J 4DSJA 3DKDA 4DV1T 2EHOC 2XMMA 4DV7T 2DGWA 4X64F 2VBXA 4A48A 1KF6A 1Q16B 2X0YA 3T1AA 3H5XA 2V7MA 2CZ4A 4LBIA 2EK1A 1QLBA 1WCRA 4E7ZA 3T19A 2EKNA 1U25A 2U1AA 3IRXB 4KGKA 2FJEB 1T9XA 2I2YA 1JJHA 4Q7AA 1WC5A 1XC9A 2PI5A 2KVIA 4DV6J 2LQ8A 2OELA 1ZM9A 2DGUA 4M63A 3VZHA 2VD3A 4QIEA 3N01A 1U48A 1X0FA 4A8OA 2DLRA 1VCSA 1YTYA 1MWYA 5C24B 3GJTB 4ZVOB 4F4ZA 2DR7A 1NSQA 3A4TA 5JTGA 3FUYA 3BF4A 2O67A 1S4FA 2MQLA 2WK4A 3CJ5A 5FYMA 2M4MA 2BG9E 4K4YA 4BS2A 4RJVA 4TLQA 3Q83A 1KK7A 3G96A 5G4DA 3MXHP 3CIMA 3QT5A 4G63A 4A8QA 1GXLA 3UTKA 3LPYA 2KHDA 4Y28C 1PAUB 2JWNA 1Z0PA 3JSBA 5L3EB 2E7XA 3Q2TC 5IC6B 1B0VA 4C3MA 2YNFA 6AT1B 4KX6A 1VQMS 4IO1A 1MIWA 4ZP9A 2XSBA 3AEAA 1RTJA 3PUSA 2ZVSA 1SQFA 2FB0A 4N5SA 4P73A 1ZPWX 2AYEA 1UWBB 3BQ2A 3M7VA 2JQ9A 3CCLS 3I4PA 1N5YA 3D0IE 2IAJA 2CQGA 3RKGA 2PG8A 2QRRA 4GK5E 2XY5A 2YKOA 1PYSB 4DLGA 2YNGB 1EHWA 2UUAJ 2GS8A 3R6LB 2KZ7B 3D4JA 2K3IA 3IWNC 4AKIA 5L1KA 4DX8H 3FZKB 5KG3A 1FDAA 3HSDA 3DLBA 4EB6E 1VQYA 3OYXA 3L39A 4I2QB 3H98A 1TVRA 5ADZA 4LF4F 1DBDA 3IAM9 4ICLA 4I56A 2K8GA 4ZJOA 1HBOA 1XR5A 2DL1A 1S1TB 3BQ1A 3RW6A 1BGXT 7AT1B 1HYSB 2CADA 2WCXA 2DO4A 2ZKTA 2O3DA 3VVTA 3OVSA 1RSCA 2DGVA 2UUWA 2M5YA 2L9NA 3HD1A 4JI8T 4DDFA 1CC8A 2OEMA 2DVIA 3OR1B 2ACYA 2FVPA 4F8HA 3HL6A 3B57A 4F4AA 3RGIA 5AQUB 4CO1A 3PJAJ 3JAMY 4NUUA 4RW6A 1XEZA 1KRPA 4IG0A 3RF1A 1NXIA 1AT1B 2ADCA 3PUZF 1LWEB 2GMLA 3C51A 3B78A 3AFGA 2RU3A 1TFYA 1J2VA 4EFAC 3Q2SC 3OD2A 2ZOFA 4XDDA 2J0XA 3FXDB 2NYIA 3ZTPA 1J5ET 4YDXA 2B6AB 2HAFA 4LVOP 5KFKA 5IV4A 4P7TA 1O8BA 4CYUB 4KP3C 3ETMA 3HJVA 4KH0B 5H1SV 4TV8E 3A8KA 2CQBA 2UUBF 2DTJA 1VIOA 2ZOMA 3JCFA 3HI9A 1Q7YT 1I94T 3V6JA 5DQWA 4X66F 1UTAA 1MN7A 2NW7A 1FX4A 4FXWA 2B9WA 1U2CA 1WDDA 3WHIA 1HA1A 1RCOB 1AXQA 4DN9A 3HT0A 2HBZB 1X7VA 3IR5B 4YJ3E 1S0OA 4NMXA 5HXCA 2KSRA 2HHPA 2KDOA 4I69A 3OLAA 4K5SA 2YWHA 4KH1B 2R7UA 1OO0B 5GVQA 4ZI3D 2VDIA 4IG3A 4ZVUB 4RWXA 2BJ3A 2XNQA 3RC3A 1UVLA 3UU8A 4IFVB 3BN4A 4LRAA 4NE9C 4L6V3 1RA6A 3D9BA 4EGLA 3I0RB 4WBNE 4ZVHA 4JI4T 2WWUA 2YNHB 4ED5A 4QH1A 3AXKA 1B7FA 4H4MA 2EFGA 4X4QA 1WHVA 2VG6B 2BM1A 1XMQT 5BYQA 1LW2B 3WC2A 3IS9A 4OK0A 2RHSB 3H4BA 4DV4F 2E2AA 3MF5A 4ED0A 1FVSA 1FI4A 5CQGA 2RQCA 1TL1B 4LRBA 1FKPA 3B5MA 2DNHA 5HEJA 2C2ZB 5B08A 3PW0A 1SJ4P 3QT7A 3DI6A 2OPPA 2XMVA 4PFOA 1OY6A 3M30B 3ISNC 3KYLA 3Q5DA 4U7CA 1NENA 2LCWA 2J0QD 4YB5A 3Q23A 4A98A 2QYGA 3CDEA 2XQCA 1HD1A 4MKVA 1D3WA 1FX2A 3G6ES 2V9WA 2EHOA 1B99A 2Z4PA 5EK4A 3TQ1A 5L46A 2G0CA 2ZBPA 3W15B 1KHWA 4NLGA 1T3NA 4J7CA 5LL6d 3C14A 3IF8B 1HR0J 3KXDA 3S1TA 3PX0A 3MURP 4J90A 1YXRA 2MKYA 5A0YB 4TY8B 1VOMA 2CPIA 2DD8S 2HURA 4YEAA 3ZCIA 4P71A 5KFYA 3UDCA 3LBXA 2XAFB 2XSAA 3CCQS 2YTCA 3L4BC 1ZP0A 5KG2A 1K47A 1JNZA 2E5JA 4GYSA 1HWLA 5IV3A 1Q5VA 2W8LA 3RYHE 2K3WA 3SCLE 3CCWA 4LREA 3VAJA 4YQWA 3KBUA 1S76D 1TL4A 4I4TE 4FPRA 4P7VA 1T9YA 3ET6B 4K2XA 4QWAA 2BVLA 3FDSA 5HI7A 4RW7A 1VDHA 2VQEJ 4PUOA 3CCZA 1RT1A 4X65F 2CA5A 3ZT6A 1DLOB 3GILA 3BN7A 1HNIB 2RRBA 1PGZA 3B6BA 4L3KA 1CULA 3EVMA 3N9MA 1SQEA 4TNWA 1QDUB 2GQCA 1F9HA 2D3ZA 2W2OP 2DH8A 3V4MA 4CN6A 5AQLB 4PG7A 4ZKAA 2XTLA 2X9XA 1J5EF 5LCYA 2Y8DA 2RD5C 2V8DA 3IP0A 2QGFB 4LR9A 1YZ6A 3OSPA 3ZZ0A 4O4JE 2VA3A 1PKUA 1LXJA 4LQ3A 3GV5B 2OTLS 4CIOA 3NVOA 5DRKA 2XZWA 1ZAVA 3SFGA 4NPOA 3MECA 1N33T 5TAOA 2DYAA 3ZYLA 1F3FA 4ANEA 2DH7A 1NH7A 1UFKA 2C3PA 4UY85 2DITA 3HJFA 4I50E 1IBCB 4ZI7E 3ONJA 4JBWF 5D4LA 2B7CB 5IHYA 5GAEU 1DAXA 3KTQA 2Q6CA 5LB7B 2Q43A 2FY1A 5FVKA 5HAXA 4WKYA 2FD2A 5HO4A 1CVJA 2YY3A 2G1HA 3Q22A 4OJ3A 2GMJA 2D9OA 2WBLA 2UVWA 1XWLA 2XPKA 3BQIA 2ZH1A 4C8LA 3K5NA 1CLFA 4DX6A 2O66A 2OA5A 3N79A 2KNDA 4GYRA 2L08A 3VRAA 1V3ZA 2CQ0A 1C1BB 4DX5A 2EVZA 1T0TV 3M9OB 2XHCA 5KT2A 4ISTA 1NEKA 2AEJA 3EE3A 3BGRA 1IJ5A 3GG0A 2HN1A 4YY3F 1ZA1B 2QO3A 3N5LA 2YX7A 2KHCA 2H9ZA 4TY9A 1T05B 1B4SA 3W2VA 1S99A 5AXNA 3SQOP 2V34A 1I5OB 5KFFA 2VOOA 3U3IA 3UI3A 5C2TA 4C98A 4J9PA 1RYRA 3GG1A 2J0SD 3R27A 4OJHA 4F4KA 1F5CA 2VFRA 1BMQB 1IKVB 3K5PA 2IBOA 2BVMA 2QA2A 4G1QB 4UQGA 5FDLA 5IT0A 2QVAA 1ZM3A 2DNMA 3PW7A 4GVBB 2CJXB 4M5LA 3IMQJ 2X0LB 1MIYA 2WBRA 2F4VT 4OX6A 3FZHB 3L3CA 2LU1A 1I1GA 2MMYA 1M1HA 1PO6A 2B9YA 3SDEA 2NLWA 3AQOA 4O3SA 4MFRA 2F1FA 3HHEA 4C90A 3CF5Q 1ZM4A 2NSBA 4ECUA 2V8VA 1J5OA 1X9BA 5AQKB 1F3VA 1RAGB 4OV6A 3ZT5A 1YRTA 4L76A 1O0PA 1WNEA 3UUXB 2R8IA 2OUGA 4A8YA 4ZPDA 3MHYA 1HHSA 2CZVC 4ZJQA 4UVCB 2L3LA 4AL7A 3LP2A 4DL7A 3KLGB 4RUBA 3MACA 2XMKA 4HHJA 3KLEB 2L48A 1GMWD 3E2EA 3D6TB 4A8XA 5EX3A 3B8HA 4RW9A 3JSMA 5GADI 3NKZA 2W7OA 4QKNA 2HNDB 2FVQA 3HF5A 4RNOA 4B9MA 4LJMA 3ZMTB 2HFOA 1HWKA 3THPA 4O3PA 5LOQA 5LG4A 1VRUB 2H51B 3M6WA 3IR7B 1Y5NB 3ONQA 2G4BA 2HHSA 1SJ3P 3DXSX 1UVIA 5DDRC 4CLWA 4BJMA 3ETUA 4JI2J 2YQ0A 2DGXA 3BR8A 2F3JA 5I3QA 3TAQA 3PYFA 2PMHA 1X9SA 4H63H 3ADAC 4M5DA 4DV5T 3HFKA 3ZFVA 4JYAF 2YOEA 5J2QA 2LQ5A 2W1BA 1IZNB 4OHWA 3PW2A 4IQXA 4ECQA 2EC0A 3TVZA 1HI1A 2RRNA 3PHTA 1IBKT 2BE2A 4OYZA 2LSKA 1RHQB 4I6WA 2CBIA 1TKZB 4JI7T 4X4UA 4DZDA 5ABFB 4F67A 1SV5B 3AODA 3DU6A 4X1KE 1VBXA 1JMTA 4P2SA 3OW2R 2ZM0A 2YN6A 1XIQA 2ZH8A 1CJVA 3IC1A 2XQ4A 1KLMB 3SBMA 1HLWA 3F44A 4JUZA 3M8YA 4FJOA 2XTJP 1SKSA 4L3NA 2NP9A 5J1EA 1NKCA 3UUNA 1U7LA 4TUYE 1NK4A 4LFCJ 2J8SA 3VAGA 4LF5F 1S4EA 4C8KA 3OBIA 4WK3A 1WOPA 1S49A 1HNZF 4OIXA 4KRWA 4ZVQB 4KFBA 7FDRA 3M8PB 2XMTA 1KQKA 5H6QB 3FGVA 1UX4A 3RYCE 3OVAA 4IFYB 1VK3A 1WTFA 1TUGB 5A8WA 1DQ8A 1HMVA 1XMBA 1K0VA 5FD1A 2GC8A 2UXBF 1XDOA 1T11A 1HFEL 3FZ2A 1SE7A 1U09A 2HRYA 4JI8J 3Q5WA 4X62T 4Y34A 4F25A 4XIUA 2V6YA 2AV5A 4UUXA 1S1UB 2XS5A 1R7IA 2HBRB 4JI5T 1UKUA 2PSZA 1XNRT 5F8IA 1F2HA 4DSIA 1VS3A 2MLYA 3H40A 1D9FA 3OJUA 3O3LA 2WS3A 5E3PA 3CWZB 2QSFA 5IFMA 5HEGA 2PDAA 1NK9A 3A3PB 1MU2B 2PD1A 4Z37A 4ILUA 2KL8A 4QIFA 3D6FB 3W2WB 2K1RB 4AKLA 1R0AB 2V6XA 1IUJA 1YJ9S 3ZZRA 1WORA 3P4RA 5BJRA 1NHUA 3TUIC 4H4OA 1VHFA 5GAGI 4FVCA 1IM4A 3GE9A 5D15A 3T41A 3I9V9 4ZA1A 5KFJA 1QY7A 4LF1A 4K0UA 5FLXU 1MMAA 3IXQA 3RX6A 4XAXB 4LFAF 1RT3B 1LW0A 4LFBJ 2WSFC 3H90A 4FN5A 3GYXB 4F04B 4B3MF 1I94J 3QAUA 1DJ0A 4JI1J 4G65A 4WP9A 2VK9A 3KOAA 4EOZB 5AQIB 2YVSA 5AQVB 2J7KA 2CPZA 1RU1A 2UU9F 2JX2A 3VKGA 2ZM6F 1CS4A 2ATCB 4BC7A 4OYPA 3A8IA 2VVSA 1IBMF 4C8OA 1DTTB 2B0GA 4PW8A 5HXEA 4QR2A 4CO3A 3IWXA 2I9SA 1NKEA 2GO8A 1Y64B 2GJ2A 3JYTA 4DR1T 3FBFA 2AXDS 2ES0A 3DRPB 5FXXA 4JI4J 5EK3A 3I5BA 1NB2A 3PUQA 1AA1B 2B7BB 2ZOGA 4DIDB 2XM2A 3TX8A 4CH1A 4DV5F 2VF3A 1FHTA 3W5ZA 3P4QA 2B9EA 2FPHX 2XI2A 4CXYA 4USHA 1RXOB 2I5JB 4DWIA 4KO0A 1V9DA 1XMQJ 5A76A 4GRSA 3LAKA 4QHOA 1H7WA 2V67A 5HVGA 2XCAA 1C4AA 1HL6A 4LMLA 3BB5A 2CQDA 1OPIA 2UXCF 2JFKA 5J1PA 1RWUA 1AFIA 1JKHA 2ZUAA 2P6SA 3ZYKA 3RQWA 2YU2A 3FZLB 1I51B 3TANA 2W9BB 3N2GE 1C0TB 4HACB 3CD6S 1LWFA 4A97A 2XB2D 2DGSA 3RR7A 2FQQB 1YLXA 3UFEA 2IM2A 2VZ9A 3L9ZA 4RNFA 2V8PA 1U6ZA 3OSNA 3K2YA 1UWAA 1CQMA 4WW0A 1D1AA 2OP5A 1E2AA 4OI2A 2CBJA 2CPFA 2CQ4A 2X3DA 2JLFA 4EEBA 3D3CJ 4NXMJ 4NLTA 4QU6A 2CG4A 2Y3YA 3M8ZA 2E9XD 2XSJA 2D7SA 2KINB 4HTEA 1RABB 3HULA 1NJIT 1E6VB 4IE6A 4ASKA 1FCAA 4U8VA 3QNUA 2XQ6A 1HNVA 4PG6A 2UVUA 3C4WA 2K9AA 3E08A 1CSJA 4JV5F 4ECXA 2X1AA 4X62F 1FO1A 3QLHA 2EBEA 3CPWR 3HVAA 4HYKA 3E8OA 1VYAA 5C42A 4DR5J 2XI3A 1XNRF 3PUYF 2RIJA 3PNIA 4ZJLA 3UFCX 5FY0A 1VQ8S 1U6FA 3M9NB 2SXLA 2XY6A 3V81A 5KFCA 3DOLA 1TR0A 2FIUA 1SCJB 3T1YJ 1YQHA 1LXNA 2BKNA 5B0GA 2IJRA 1P1LA 2WWVA 2IVMA 1OY8A 2VFSA 4C8MA 4EEYA 1JLEA 4KHPF 1U1KA 1U2FA 3VAIA 4QWNB 2CRLA 4ILBA 2UV8G 3ZO7A 1N6QA 4DQQA 2Y8YA 4DL5A 3TJ8A 3V5UA 2P9BA 3JQMA 4HWIB 4ELVA 3FQKA 3A7MA 3OTCA 2B9XA 4KGMA 3KJNB 2JQQA 1VI7A 1IR2A 4Y0FA 4O4HE 5HMYA 5AQSB 1WTBA 3RYLA 2YKSA 3KLFB 1RUSA 1KP6A 4Z90A 1F2GA 3HZEA 2CLYC 1N33J 4CQIA 4DJBA 2XLIA 2J7WA 4NEZA 4G1PA 1ITPA 3KV6A 3CCES 1V6HA 2E5LT 1BWEA 1WFDA 1PBAA 1D8YA 2FJAA 2LQ9A 3OHAA 3C6TA 1NLKL 4OYWA 5KFNA 4P2FA 3JAEA 2D9DA 4LF9J 3C4ZA 5F0WA 5KFQA 3OVUA 5L9XA 1VRTA 4B17A 4I4BA 3CJRA 3QK6A 1J5WA 4IRDA 1UMJA 5D0GA 3KNGA 3Q8PB 3R1HA 3IG1B 1S7HA 5CYQB 3A12A 5J2PA 4ZVEA 4DL6A 3L8RA 2LOPA 3UFGA 3I0QA 2GCFA 4M5NA 2W63A 2QGSA 3A8EA 4DR1F 3LDQB 2JLEA 3DHWC 5LJNA 2R7QA 3C16A 3TJAA 2W61A 3CJ8A 5CABA 4HFVA 1RTIA 1X79A 3NLCA 2CDQA 5DZ7A 3UPFA 2W0GA 4PAGA 4YTPA 3VTIA 5E3AA 2I1RA 4FPIA 3CVKA 1XMOT 2DY1A 1RAHB 3GIIA 2CHNA 2V4RA 5EHHA 1HPZB 2EXUA 5DDPC 3VAMA 3S4UA 4HGAA 2FHJD 2ZJRQ 3NGKA 1QUPA 1PJ6A 4ZVGA 1M5SA 2MB0B 3MM9B 3N9OA 4Q0BA 3ELHA 1FXLA 2Z56B 3G8QA 3T6JA 3N2OA 4P52A 1QAYA 1KNPA 4UOCA 4DHVA 3LANA 1N52B 4O0IA 3PO5A 3A3OB 1NEEA 3DDIA 2EI5A 1GFWB 2UXDT 4GC7A 2Y1LB 2ZE2A 1R43A 3G2XA 2WQYA 1H74A 5JDMA 2ZVIA 1WG1A 1MWZA 4NYPA 1R8PA 1DTQA 1GTHA 1IKWB 1KLNA 4HH0A 1UVKA 4HT5A 3K8WA 5GMDA 4QWEA 4W92B 4F26A 4FXDA 5I42B 4DFMA 3DXBA 1QAIA 2K7JA 4ZI3C 4GK0E 4HTJA 5J2MB 3MGJA 1GX6A 1LK5A 2VL8A 1GAOA 3M2VB 3M2UA 1D1UA 2UP1A 3O5TB 1SJRA 1RU2A 3MWBA 3R9LA 1RKJA 1X4BA 3PJ9A 2CQ2A 4A8MP 4RR5A 1UWBA 3AAIA 4Y00A 1UCNA 1N34F 3RU0A 2MOZA 3I82A 4U7IA 5JDGA 1J27A 3GU0A 5E33A 3UU4A 1HW8A 2FTRA 4WNKA 4NRTA 3DOKA 2HPLA 4K7QA 2QTWA 4NEYA 5LT5A 4WIQA 2SPCA 4IO9Q 2CNLB 3H3MA 2H65B 5AQMB 4WFYA 4NXNJ 1FWLA 2QE5A 2COLA 3UW1A 4YHHJ 1UPMB 2BBJA 4BLGA 5CD4A 4X20E 1M1KT 4PK4A 1FRMA 1G73A 3PV0F 4LR8A 4CI2B 2N7YA 4JOUA 4JI0T 3RPUA 4LF8T 2BG9C 1HYSA 4DV3T 2YWKA 4GKKT 3K5OA 3AXMA 2AW0A 2BDPA 1R6YA 3NWGA 3GJSB 3JTNA 3VQTA 1HWUA 4Q2LA 3OR1A 2VPYB 2YNFB 3N9NA 2KVQE 2CNOB 4W4MA 2IW5B 4O44B 2E9ZA 5DG9A 4JI7J 1RTJB 2WMOA 2ACZA 1LWXA 2XAJB 5HROA 2GJIA 2E5LF 2H5EA 3P49B 2PO4A 3Q8QB 3BS9A 4FS2A 1NJZA 5JDNA 2VHGA 3AB4B 3CCSS 1AUDA 1N5YB 5DQVA 2IAJB 2OD4A 1LWEA 3G4SS 3FC9A 1H2TZ 1L5UA 2HFUA 1H6KX 4ZIWA 5M4YA 4HDHA 3MEEB 4M5GA 2XWYA 1GXUA 3M3ZB 2H5IB 4WYWA 1HX8A 2R7OA 2XZTB 1C0UB 3W66A 2EFVA 5L1LA 1TVRB 4QQBA 3TAMA 4IDKB 4ICLB 4N76A 4IH7A 1HBOB 3UWTA 2XO7A 3CJQA 2M67A 4NRUA 2J4GA 3GTYX 1NUEA 3EX7B 4K0KT 2E7VA 2ZBCA 5F8LA 3AE6A 2VQFT 4IH6A 2XS2A 2IJFA 5ETQA 3LP1A 2IYGA 3MAAB 1XMOF 4DUZJ 4MHCA 2FJVA 4Z7YA 1BQXA 1NB7A 2JZ5A 5B0DA 3UO0A 1YKHB 4F2RA 4YSYA 4RW6B 4L9IA 1JB0C 1RHMB 2BZ2A 2ZH6A 2J9DA 2OLWA 4WFBQ 2OMOA 2HEKA 5H6RB 2F65A 1U0HA 1M5VC 2C2NA 4AQGA 2YNHA 2BKOA 5B0EA 4QW8A 3WIVA 4FNIA 3KLIB 2O01C 2V0NA 1REGX 3C6UA 1YJRA 1XERA 2B1EA 2HRTA 4DPXA 1JXVA 3ZC4A 1RWNB 4N56A 1ROFA 2DXFA 1RA7A 3AH6A 4LF2A 2Z2YB 3IRWP 4DFJA 1Z1ZA 3UR0A 4U7UK 3VRBA 1EQ0A 3DRRB 2GJFA 4DMZA 5KFBA 4GKJF 1UAWA 1ZETA 3M30A 5EWGA 5LYJE 3UD4P 5ETSA 2MZTA 2YDRA 3TARA 5CB4E 1WSVA 5KG6A 3QJPA 1UEVA 2MZJA 2CQ1A 4JEUB 4IG3B 4A56A 2CXDA 3HK2A 4U7YA 2BXJA 2HVZA 2G0JA 1S72S 2PMWA 3TUJC 4USVA 4QYZK 2R2TA 4FP9A 3W62A 4TWDA 2L9WA 4B3TF 4NASA 2G0IA 4DPUA 4COFA 3CPZA 4H4MB 3RBDA 4P9SA 3D1OA 4RW8A 2C28A 2PT0A 1D9AA 3F2EA 4LVNP 4NLDA 4Y6IA 4DUYT 1FWKA 3IS9B 5DLFA 4LF8F 5D78A 1WR0A 4DXLA 5KG7A 3EZ5A 4X4TA 3VV2B 2UUBJ 4XPEA 1FKPB 5A2QU 1HIYA 2JQHA 2HH7A 4ZVSB 1GMVA 3DI6B 5RUBA 1UZHA 2KM8C 2C2DA 1FJGF 3UCZP 5EUHA 4Q43A 4RBUA 3W1YC 3JAFA 4IDNA 3OPKA 4AQFC 1EKSA 4M5MA 4ILRA 2CCQA 2EHOB 2LRKA 2C22A 2W01A 2H3EB 4TWFA 3I96A 5C5JA 4AISA 4ANCA 3L3PA 4LF7T 1ZHCA 3C14B 3NAHA 3BBFA 1X4EA 2X9YA 3SSSA 2HZVA 4ISSA 3BKFA 3RBZA 2XGPA 2C5KT 4L75A 4G1IA 4OZ2A 1ICEB 3DLLQ 2P2CB 1KSPA 1DARA 2XYHB 2DI4A 1LFPA 4CLUA 3M1VA 2X9HA 2OSRA 2VURA 4NI2A 5BXIA 3UN2A 3B82A 1QAJA 4OYAA 2DRDA 1FRHA 2J62A 4N77A 2GVZA 2BDEA 1GT8A 1CPZA 1LVKA 2W2NP 4RW4A 7FD1A 5IWAF 4CQ1A 4YS2A 2D2SA 4WYVA 2BG9A 4RW7B 4UR9A 4PUOB 3OQ2A 2IMOA 3ZPOA 1RT1B 2NZCA 3UVJA 2ZJPQ 2HZCA 3OHBA 1S12A 5LGTB 2EG2A 5LMUJ 4KT0C 3K8PC 3MTJA 2Y9HA 1ZZFA 2FJDA 3DM2A 2XGQA 4ZPBA 3OXFA 1HBMA 2MKHA 5BYSA 1CULB 3NL0A 2VPWB 3L09A 2XAHB 4CRJA 2V4JA 3HZGA 3PUWF 3UQ7A 1OQ3A 2XC9A 3BSOA 3HI2A 5AJ3F 1TMJA 3TI0A 3VAKA 2E9RX 1KHVA 3QSIA 1D0ZA 5HATA 4NLOA 3QIDA 4CLFA 2ILYA 4YT0A 1UPPA 5L47A 3DLJA 5H9FK 2HHQA 1FTCA 2LKHA 5HYAA 3J7ZT 4C48A 2NXJA 3MECB 1VRQC 3J7YI 4UXNB 5CZXA 2Q79A 1R8BA 3K1SA 3P4PA 2OAUA 8AT1B 1RAAB 4V1Ak 2AE9A 3EYZA 2Z57B 1WC6A 4B9LA 1S35A 2OPRA 4BJNA 4BHQA 2LHNA 4RUAA 4DR6F 3FK4A 1N36T 1W2IA 2FHMA 5FL0A 2W66A 4B9UA 3GONA 3O8WA 5CA5A 3CUNA 3I87A 4X65J 3FZBA 1OWAA 5AQTB 3HT3A 4XDCA 3K59A 4ZEYA 4WPAA 3K58A 4J9UE 3EABA 1FT8A 3CT9A 1QJHA 5B0FA 2R7RA 1T95A 2JHEA 4IKAA 1BQMA 3PRVA 4WXOA 4DV2J 3FEXB 3PRBA 1APSA 2KYXA 2MKCA 1DURA 1KD1T 1NDKA 3BGRB 1YJWS 3MR7A 4ZHRA 4R0JA 5HLFB 4DR3T 4JI6T 1RB0A 4LR7A 4DUYF 4AI6A 1S1XA 3W2VB 4CI0B 1N54B 4PJMA 4I6YA 3A8JA 2GA7A 3G87A 3DRYA 3QOFA 5ABEA 2VBZA 2VVNA 1RTZA 4HDGA 2DCFA 4U72A 2FJXA 4OZNA 3CW2C 4IOBA 3FZMB 5DQGA 3BH7B 4HI1A 5CCLA 3K57A 4IQMA 3J81Y 1JJ4A 4DV6T 4YTMA 1FIOA 3QZ7A 1VRUA 2DNLA 5FDLB 1SB6A 3QGIA 4FNHA 4DLEA 1YI2S 5EGYA 2A0FB 2XSFA 2WCAA 4LF7F 2X9WA 3SDEB 3VAHA 4ELUA 4X84A 1Q7LB 3PUVF 4UELA 1J5OB 4U74A 2V7IA 5J2UE 3M6UA 4F6RC 3HKDE 1UGOA 1F6TA 2YWGA 3NGRA 3T5KA 4WTYA 3ZMVB 1DHMA 3AXJA 3LP2B 4CT8A 2CWOA 4N47A 4KGVB 3TVKA 2CG8A 1CJUA 2R9LA 1TKZA 3KV4A 3EZOA 4U3CA 4USMA 4Y2MA 2H1YA 2HWTA 3KDOA 3MM5A 3V2UC 4RW9B 3JSMB 1NSPA 1OSCA 3NKYA 2C2MB 3U27A 4CZCA 1HD0A 4O4GA 5AXKA 2I59A 2FDNA 5AQHB 5GONE 2LM2A 2UUAT 2J76E 1M5PC 4USKA 1AZSA 1FERA 1BHNA 4P2XA 1OWXA 1Y4ZB 1Q8KA 5GAHI 3AY0A 4AQFA 3GYNA 1KFSA 3EPIA 3GMIA 2WOMA 4ID8A 4IL4A 2C3MA 3QB5K 4HFBA 2LQJA 4EGWA 3GWCA 3AEEA 5EZYE 3KK3A 2QSWA 1T9WA 3U1MA 4M5DB 5F3TA 1FJ7A 4EYIB 4MIBA 5J2QB 4DCPB 3CQCB 2HW3A 1BWVA 4HEAA 2UUCF 2E5VA 1RT5A 5HSPA 3DLKA 4JI0J 1RBLA 4KPYA 3BR9A 3TX0A 3R5DA 3FBZA 3DMJA 2BE2B 3WX8A 1GMWA 1OPZA 2AMCB 2KXPB 1S1UA 5KG0A 3RB3A 3PTRB 1WKJA 4OHXA 1RTDA 1WHWA 1UFLA 4W90B 3B4DA 1EZ3A 2YQ3A 4WK1A 1CJVB 3PIOQ 3EMTA 3D66A 4GC6A 4AQYF 3Q8VA 2E9XC 3W2WA 5LBMA 2RQ4A 1R0AA 4QW9A 5FY1A 4KHMA 3LA0A 4N8NA 4ZMMA 2FLNA 3PW5A 3RIUA 2R7XA 3MR6A 1IR0A 2RB7A 5C3JA 4TQSA 4DMVA 4Z8XA 3I0OA 5DJBA 4CLYA 4EAHA 5HEUA 3JAMU 2O5DA 3BSAA 2R42A 2FBWA 1WD6A 4O3QA 2AJ1A 2BS2A 4LBHA 2MLXA 1RLDA 4KFBB 3QJJA 5HQLA 6FD1A 1N0VC 3V6DA 4Y65A 4ECWA 5L39A 4KY3A 1R6VA 4UQTA 2PFFB 4JYAJ 5A8WB 2IFXA 1HMVB 3SI8A 3HCXA 2Q6BA 1S1VA 2WU5A 2W4CA 3OJAA 2ZEJA 3P5BP 1SKUB 3MD3A 3GB0A 3CCUS 3RGLA 2V6YB 2KH9A 2J8AA 3W60A 2OGUA 4CT9A 4AD6A 3FMWA 2OFGX 1TL3A 2MZRA 3GZ7A 2XQYA 4X4SA 1UW9A 1URRA 2JEFA 3C2PA 4IDOA 1ACMB 2HQCA 2LU2A 3BQ0A 3X1DA 3PYDA 4ZPCA 3SCIE 3BYRA 3GJQB 3ENAA 3I32A 2WU2A 1HNXJ 5AQGB 3CDUA 3IWLA 3R6GB 3A1YG 1G2EA 5DGAA 4CI3B 5KFPA 4H4OB 2LKZA 3DRPA 4RUHA 1KEKA 3EDVA 2HFNA 2XQAA 1T72A 2QJ3A 2MKKA 4OZJA 5DG8A 1WELA 2MY8A 5MAOA 4LF5J 2LA6A 3ILIA 2M6BA 3BM7A 5J2NA 2H54B 4X4OA 2X67A 1WC3A 1HNZJ 1LW0B 4P75A 4PK6A 5KG4A 1C4CA 2RDJA 2KTQA 2JJ4D 4YOEA 2NUUG 4YFUA 1S97A 2R8HA 5BR8J 2M7SA 2VODA 3LF0A 3F41A 4CXXA 1W7WA 3HHLA 2JRKA 3CX8B 2LA4A 2LMIA 2VH7A 2LSJA 3RH3A 2UXBJ 3I9WA 1WEZA 1SKRA 9ATCB 3N2KE 4EI2A 4WCEQ 1IJFB 1CS4B 3FHNA 3M8WA 2BKPA 4HACA 2WONA 1NHVA 3AAEB 2V50A 4ECZA 2AP6A 3FQLA 3W5YA 2V94A 4E98A 2DK2A 5GAGU 3H8YA 3CCMS 1HR0T 1YBUA 2UUAF 4C3KA 5KOWA 1HHTP 5HMWA 3FZFB 3KUHA 4HE8A 3JYTB 2BEFA 4QX8B 2JEIA 1CHUA 2AHOB 3PRDA 2VONA 1VLYA 1NAQA 2RMLA 5CH7B 4NLVA 2KT3A 3M6XA 2HIQA 2GVDA 1T7PA 2J1DG 2XLJA 2MGZA 2JNJA 4O0NA 4ZS6A 4OYIA 5IC4B 3HMJG 4AT1B 2KWHA 1MW7A 5LSRA 4NLRA 3MM8A 4ZP6A 4WZQA 3LWLA 4LFAJ 4ERRA 2V7KA 4IRKA 2VQET 3VZIA 2MZSA 4MK9A 4C3LA 3UN5A 4B3MJ 4U8YA 5F8HA 2IMWP 1P8GA 1JKHB 4OYOA 4DV0F 2AYBA 1U49A 1T9VA 4AL5A 1JLQB 4CH0S 1YKEB 1YJ7A 2HKEA 4EEDA 3OFEA 5CD4H 1DFDA 2BRKA 4C9DA 4RNMA 1SHZC 2DCUB 1LWFB 3PEHA 2UU9J 4FKXA 2ZM6J 3D1HA 2ROGA 5ETOA 3THVA 1P27B 3MCSA 2IIUA 2NW8A 2CXEA 5IT9Y 3BGFA 1IBMJ 2EBGA 1NWMX 1TK0A 3KWMA 2QL7B 2GX8A 2RU9A 1KTQA 4TN7B 3ESLA 1CC7A 4U95A 2XSJB 2IY5B 2YNIA 3EGVA 3FSYA 4FKYA 2G2YA 3GWHA 4ZN1A 1ELOA 2FVSA 2QFJA 3ABVA 1HNVB 5DZ6A 2ALZA 2VUGA 2XUEA 2V8SV 2E1PA 2MKJA 1S57A 4EYUA 4YXDA 3PV8A 2RA1A 3QLHB 2OPQA 4FYYB 3N0VA 2AF6A 4CM0A 4X5TA 1B7YB 4FYXB 4ED7A 4FXVA 5L8RC 1RT2A 5BYRA 2L41A 3SV3A 2UXCJ 4I43B 5KTQA 3MUTP 5KFWA 4DFKA 3CO9A 3N6NA 2Z2ZA 2HK3A 2MSSA 3V81B 4X1IE 2N3LA 4URQU 3DOLB 2DKOB 1VBZA 3B4MA 4PAAA 2W7PA 2P9CA 1IWGA 5HAOA 3RTVA 3DCAA 1WHYA 1JLEB 2MQQA 4OZLA 1N6QB 3O6QA 1SJQA 3PM9A 1RWVB 3CK6A 5BMVE 3PUAA 2E9XA 4X4RA 2ZHBA 2CWYA 3O1HA 3NMAA 2HVEA 5F0UA 3ZNJ1 3PUGA 2AJ4A 1ZZNA 1T8EA 3O9XA 2W24A 4B3SJ 2WDRA 4EYYR 4PYDA 5CXTA 1JJ2R 3R84B 3EGNA 2R8KA 4B9TA 4O3RA 4DBQA 2JLGA 3W9HA 1VJQA 1WWHA 1H0HB 2KU7A 4PWDA 3QO9A 2V4QA 1W09A 1S1WA 3FSXA 1Y3KA 2N2NA 5L2LA 4AYBD 1HPZA 3CWJA 1QTMA 5H9FJ 1U1QA 3DHXA 3EVWA 4IGUA 4K5RA 1EP4A 3ZZPA 2FJAB 3ZC1A 3C6TB 2HG4A 4Y2AA 4PKDB 4MMOA 4JV5J 3G82A 1HWIA 1VC0A 3B13A 3MM9A 2DEIA 2PIIA 4NL5A 1N36J 4PPDA 3I4HX 2WAQD 2D3OR 4EWTA 1YRXA 5AXLA 3I5CA 3FJ2A 3RB0A 5J2PB 3PEJA 5GMEA 1FFSB 4NPPA 1RHJB 3GSDA 3Q8RB 2OSQA 2P5VA 2VICA 5FNVE 4KHPJ 3C16B 2NPFA 1TU0B 5F8MA 2JL9A 1RTIB 3OR2A 2ATLA 1W9RA 5J2MA 3ZN1B 1BUXA 3M2VA 4DR3J 4ITSA 1TV6A 5M2UA 2JEJA 5DQHA 2VU5A 5B7WA 3I0SA 1YX2A 2RUSA 2VQEF 2DNKA 4X4NA 1DRZA 3CIZA 1PC5A 5E2QA 4RX6A 2HHWA 1R3NA 2AJ2A 2X1FA 4O4IE 2XMJA 5LG3A 2B76A 4Q0BB 2IYIA 1LEOA 4WE1A 4F4WA 1S7IA 3P3DA 1MSWD 1WJ9A 2V5DA 4EYHB 1X4DA 1G7CB 4JI2T 5EX0A 2KYZA 4LF6F 3A5XA 1ZM2A 3ZZYA 5IQ6A 1CUNA 4OX9F 1WACA 2ZE2B 5C25B 2RUGA 4B02A 3WIUA 1PBUA 1EKRA 1WEYA 3ZC0A 3C50A 1PIEA 1DTQB 4IE7A 1IXKA 3GIRA 2MQMA 3WDOA 1H3DA 4ES3A 5LHGB 2L8KA 1QSDA 3Q24A 1UUSA 4XBFB 1SBRA 2ZD1A 1OXZA 2YH1A 3Q8YA 4I6AA 2A3DA 4MJKA 3M2UB 4MT1A 4PG5A 4O44A 2I8EA 2FHJA 5B0CA 4ENOA 5MLCV 5AE1A 4J9LA 4OI1A 1IQTA 1WKLA 1Q8IA 3W7BA 1FFWB 2VC1A 3AQPA 3LP0A 4ZVTB 5DJQC 4LUBA 1JLCA 2ZHAA 4AKHA 2H4YB 2LOSA 3R2CJ 2IA0A 4JB8B 3EDUA 2RT3A 3DOKB 4DL4A 2XMUA 1D1CA 4CDIA 4LFCT 2KT2A 3MEEA 2MHNA 1Q79A 4ILMA 3QZ8A 3CDBA 3MI7X 1T03B 1C0UA 3IGVA 1G8XA 5I3UB 3IA3A 2E9TA 2W4XA 3P6YC 1PJ5A 1ZOTA 2F63A 8ATCB 4IDKA 3D0TA 1G1XA 3NS7B 3BYPA 2QMXA 4MFBA 2XAQB 4KYZA 1K0TA 3RLFF 3G6VA 3WX4A 3H42A 3G8SA 2QLJB 1U2RA 1VQ9S 3KDNA 3CJ2A 1US7B 3MAAA 1OEDE 1H2VZ 5JVHQ 2EFQA 2KXHA 3ZCJA 2QIFA 8RUCA 5HROB 3TA2A 1LRZA 1HQ2A 4DNDA 2IDEA 4ZP7A 4OZ5A 2Q9QD 4ILAA 3LALA 2BBHA 1SC4B 1UX5A 5LHHB 4DPYA 2D3O1 2I6HA 2POKA 2CVEA 4K4TA 3UDEA 2X1GA 4DSKA 3AA7B 1O3XA 1NSKL 2YINA 2XLKA 2WVEA 4DO0A 4TN2A 3OTBA 1NPPA 4DSLA 5K5MA 2WZHA 4DU8A 3PDYA 3KLIA 3LG7A 3GV8B 1LKZA 4IE4A 2A2FX 5C2CA 3ZTSA 1WLXA 3TAMB 4Y3CA 1RP5A 1KBRA 1KTVA 2WP9A 3HKBE 4ANDA 4LFBT 1L3SA 3W3SA 3N9QA 1VQOS 3PJAA 2IM3A 4QIWD 1N48A 1IBLF 4C91A 4JI1T 5LSLA 2BQRA 2RQKA 3DRRA 5U47A 3SIPB 3LP1B 2D74B 4DV1F 4OFZA 1IAPA 1QSLA 4DV7F 2E1CA 2I38A 5JVGQ 1VMBA 2OO4A 2WMNA 4W98A 1R8IA 2CLYB 3ZZZA 1HTJF 4MKBA 2D3UA 5L9NA 3UUBA 1JK9B 4PQUA 4BAYB 2LECA 2NZ4A 5KT5A 4UVBB 1L3VA 5JQGE 4JI3J 2V7JA 1NPRA 1HBNA 3UCUP 3G6YA 5LHIB 3ZSSA 1N32J 2XMWA 1U0HB 2KRRA 2GIFA 1X4CA 4JI2F 1RWOB 1Q81T 3C3LA 1R89A 3V4IA 1Y3JA 1N8RT 2K2PA 3C6UB 3FCHA 3UT5E 3L7PA 2VKHA 1RT6A 1R27B 4U6PA 2A3JA 3RYFE 2ZUGA 2V6AA 3R5BA 3LSVA 2B5JB 2AX0A 2DXDA 1MNDA 2EW9A 5EWEA 2XYGB 2R4FA
chains in the Genus database with same CATH topology
1UCUA 2G0UA 4KR0B 4NLQA 1HW8A 5E33A 2IBKA 2XWXA 3BQKA 2BJDA 1IKXA 3PR4A 2FTRA 4ALZA 2Y6XA 2ZH4A 2Y1IA 3KLHA 2ZNZA 4WNKA 3LQVA 4NRTA 4CI1B 3DOKA 3MEDA 2HPLA 3KLFA 3VAFA 1K73T 1VQKS 4QXBB 5LT5A 2SPCA 1UVNA 5FP3A 4DR2F 4MALA 2J9DE 5EK2A 4XAKA 2KG1A 3S8SA 4IO9Q 3FEZA 3FEYB 4WFYA 1TFWA 3N9UC 4LIRA 4J9NA 3U78A 2B3TB 4AXPA 4ES2A 2AX1A 3HLUA 3C64A 2KFYA 1F60B 2J5AA 2CQPA 3RBEA 4C8ZA 3WAKA 3M2RA 1H7CA 2QE5A 2GFFA 3O1LA 2HHVA 1N5TA 2COLA 2K5BB 3POTA 1PC4A 4B3OA 3UW1A 2W7AA 2E44A 2ZH7A 4NLUA 3HHLC 1UA1A 1S94A