1KNZA

Recognition of the rotavirus mrna 3' consensus by an asymmetric nsp3 homodimer
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
157
structure length
154
Chain Sequence
TQQMAVSIINSSFEAAVVAATSALENMGIEYDYQDIYSRVKNKFDFVMDDSGVKNNPIGKAITIDQALNNKFGSAIRNRNWLADTSRPAKLDEDVNKLRMMLGIDQKMRVLNACFSVKRIPGKSSSIIKCTKLMRDKLERGEVEVDDSFVDEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of the rotavirus mRNA 3' consensus by an asymmetric NSP3 homodimer.
pubmed doi rcsb
source organism Simian rotavirus a/sa11
molecule tags Viral protein/rna
molecule keywords 5'-R(*UP*GP*AP*CP*C)-3'
total genus 52
structure length 154
sequence length 157
chains with identical sequence B, C, D, I, J, M, N
ec nomenclature
pdb deposition date 2001-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.550 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1knzA01
3.30.70.1610 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1knzA02
1KNZA
chains in the Genus database with same CATH superfamily
3G9CA 5M2UA 1F60B 3PIPQ 2DHAA 1FEEA 1RT2B 4GO5X 4IYQA 3A8IA 1Q5VA 4DR5J 1NXIA 4YB6A 4Q8FA 4ZCLA 2HW3A 3PFEA 1N5SA 4J9LA 4ILAA 3TVZA 3V4IA 3KK3B 1VRTA 2OFGX 2XQCA 3QWPA 4OYIA 3THTA 1D1BA 2DGXA 4X65T 3MM8B 4OHZA 4OYBA 4X84A 4DR4T 2XB2D 2DEJA 5L1JA 4B3RF 1Y4ZB 3AEEA 5L1LA 5LGNB 4OX9F 3MD1A 3A8JA 2VA3A 1RHUB 2W7PA 4DU7A 2Q9QB 4UT4A 2CXFA 1QTMA 2V5HG 3MXZA 4NWBA 4B3TJ 4HFIA 5DGBA 2UUAT 2FVRA 2B9WA 1X31C 4NLDA 1HX8A 2VJUA 2R7TA 3VGVA 4DCJB 4HFCA 3CCJS 3CO0P 9ATCB 4EFAC 3QO9A 2GMJA 4YUDA 2M3DA 4D3HA 1WDTA 5KFYA 2WHOA 4DV5J 1XN9A 1T72A 2VC0A 2XQ8A 3HP6A 2G2ZA 1ZZNA 3D0GE 2YWFA 4B9NA 1L3SA 3CUNA 1UFLA 2W2MP 2F9JA 2JQQA 2HURA 3HKZD 1YITS 1S7IA 3A3PB 1NK8A 1SI9A 3R6GB 5KG7A 4KP3C 1RWKB 2LEPA 2ZC3A 3MKDA 1QAIA 3M65A 3M8PA 4U9RA 5LOVE 1ZYQA 1P9QC 1YX2A 4WPAA 1M62A 4TY8A 4B3TF 3FFIA 3DJBA 4HT5A 3PJ9A 1KBRA 3N4WA 2V2KA 3P4QA 3GLJA 3QIPB 2Q9QA 4HFEA 3Q8YA 3SSRA 4IOAQ 3MR6A 2FHMA 2DXEA 3TZXA 2RDIA 3KMSA 3JADA 2MMYA 4CM2A 1CLFA 1LOUA 2Z4PA 5AQVB 3PX0A 2N9DA 1Q86T 4WP3A 4DN0A 3NNCA 1LWEB 4YB5A 1Q16B 2YKAA 3T41A 2ZM0A 1UJ6A 2QGSA 4DPYA 4YHHT 4DXLA 2MPKA 2YWHA 5GVQA 3JAMU 4LF9J 5M4YA 2E5LF 2A6OA 4DHVA 2DGVA 3ILOA 2UU9T 2CLYC 3HJFA 4CLSA 1KP6A 1CULB 4LFBF 3UU4A 2BS2A 2JMKA 3GFZA 2LXUA 2ZNYA 5KFVA 2H4WB 2XS5A 1KR4A 1MN7A 4CH7A 5FY1A 3H2UB 4HACA 3FCWA 3M2RB 4DX8H 5E3PA 1TKXA 1NNDA 3PZPA 2OEJA 3HF5A 1HWLA 4OYPA 2PBIA 3CCVS 3FGVA 1DQ9A 1KS2A 3OTOF 4I6YA 5C25A 3EPGA 3J7ZT 2IAJA 4ETZA 5IV3A 4U72A 3CJQA 5LXYA 5F3TA 2E7WA 3MM5B 4J2CA 3UU8A 4UV9B 4NEZA 1LW0A 2FUG9 1P1LA 1UPPA 1RQ0A 1XWMA 1W0AA 1YJ7A 5J1GA 3NWIA 2PC6A 3W66A 1UCUA 2WB4A 1WC1A 1OY6A 4HFDA 2XSFA 4KGXB 5LGUB 2XASB 2WVEA 1H0HB 3CCES 3W61A 2W4PA 3N6MA 3NGRA 4IDKB 4QKNA 4GKJT 2ZJPQ 5AQQB 2A2DA 4ECZA 3AXMA 4XAXB 1TELA 3GYNA 3KLEB 4FBUA 3O1IA 2MQMA 1DQAA 3IXQA 1OEDA 4ZJOA 2HNYB 4AQFA 4KGZB 4UY85 1GTHA 3CQCB 4LR9A 3BJYA 2X66A 3KKFA 1YXRA 2CQIA 1F2HA 3OVSA 2D69A 2WOMB 2M6IA 4FNHA 2L9QA 1F3VA 5IT9U 1CULA 2BJEA 4KBIA 1SKRA 2YY3A 3KVBA 2HFSA 5HROA 2AYMA 2KFNA 3RJMB 4HGAA 4WTYA 2IVMA 5ETNA 4A8QA 2HFVA 1GMVA 3ZT6A 4ZVTB 4KB7A 2IVYA 3UFCX 4ZA1A 1FF2A 1SH3A 3DOMA 3TI0A 2PT0A 1LWCB 3KJVB 3ONJA 2AJ0A 1FKAF 3V6DA 2QRXA 1K9MT 3MMAA 3OVBA 5F9NA 1R0BG 1UVIA 2VIHA 4JV5T 4QWCA 4DR7F 4RW6B 3SWHA 3DKDA 2C5IT 1FRLA 3JC6C 2KRRA 2QA4S 4A8OA 4CO2A 1D09B 3L09A 3T9ZA 4JI7F 4ES3A 2X1AA 4B9VA 1IBKF 3LOUA 2B5JB 1RI7A 2GIRA 2W9AA 2KZMA 2DGWA 1JXEA 4X4UA 4R25A 3ETUA 4BJMA 2LQ9A 4DR5T 2Z6EA 2AYGA 3PACA 2N7YA 2XNRA 5E3AA 3K7RA 1RWUA 3R2DJ 3VWSA 2IPOB 5I3UB 2F5GA 1NKEA 3HKDE 2B8QA 4ZI3D 1NEEA 2RILA 4YSXA 4CLKA 5D15A 2JLFA 3FSIA 2VL8A 1OWXA 4PKDB 4TY9A 2ZOGA 2RF2B 4MK7A 5M2RA 1TL7A 4NXNF 3HM9A 2RQMA 1SPBP 3RRWA 4ZPWR 3VRAA 3T6BA 4B3TT 3EXYA 1RAOA 1S72S 4GKKF 3G4SS 2M5YA 1VQ9S 4TYAA 1LWXA 2K8GA 2UUAJ 4PEOA 1LEOA 1FRMA 2YOEA 1RT1B 3L3CA 2MPUA 3Q5EA 2XQAA 2CZ9A 2HHHT 3FKBA 4ETXA 5IXUA 5ETLA 4LREA 4M5DB 4A5XA 5D77A 1QSYA 1GXUA 3BB5A 1H72C 4UUWA 4F02A 3VTIA 2ADCA 5CYMA 4RBUA 3IR7B 4NMLA 3KJFB 3MZIA 2CJKA 4CI2B 5KFEA 4BDPA 1NCLA 1N52B 4YB7A 3RH3A 4X62J 3UU3A 2BE2B 3GJTB 2UU9F 3CQXC 3CJ8A 4CI0B 3LP1B 4H4MB 1RT2A 2ZZNA 1FFSB 2V50A 1JX4A 2IM3A 4U7UD 1WEYA 3O9XA 4K4UA 4DV6T 1XMQT 2B6AB 1R0AB 1S6QB 2UUCJ 1RWMB 1U1NA 3CJ2A 4URSA 1T3NA 3LJCA 2Y1RI 5D0GA 3AAIA 5EHHA 1M5OC 4KMCA 4CXYA 3TLTA 2GGPA 1N8RT 1B0VA 3UUMA 4ZLNA 3MPWA 1V9OA 3OR1A 5H6RB 2ZUAA 3MURP 1JLEB 4YT0A 2RP4A 2H1YA 4OYOA 3EVWA 5L1KA 3C8YA 2ALZA 2XZDB 2U2FA 2M67A 3CKDA 4C8MA 3QATA 4DMVA 4NZ7A 2XQ6A 3SZ2A 1VQLS 4NLVA 3RR8A 2GHWA 2GCFA 3FUYA 2UU9J 4HR2A 3EZUA 2XWXA 3G86A 4DR1J 4DVDA 3RBZA 1S10A 4DFPA 2ZC4A 2RRNA 2EBEA 4RPFA 2X3GA 4KHPF 2XJ7A 4ATNA 5H9EK 4DUYF 4NUUA 3UW1A 4FYVB 2QA4G 2F4FA 4ZI2C 5HP1A 1ZAXA 5LGTB 2K7KA 3UU6A 1S9FA 3AECA 1RTZA 4YP3A 4DLEA 3W8GA 1EP4A 1FWPA 2RKIB 2GO9A 2GJ2A 2KHCA 3D4JA 3UDLA 2OMLA 4MYTA 1T98A 3P5BP 2C3PA 1SIWB 4KO0B 3KV6A 4WJBA 2BE2A 3SSSA 1WHXA 2AGOA 4V19X 3C6TA 2FLLA 4RUAA 1TL4A 3HKBE 1I94J 4KGMA 2HHWA 2XY8B 4C90A 2A2FX 1MNEA 3I0SB 5G0RB 5EX0A 2HNDA 4M5DA 2X9XA 3VQTA 1EARA 2ASYA 4R0EA 2HG4A 2VKDA 1UEVA 2ZBQA 3Q5WA 3G71S 1WI8A 2XMUA 2VQFJ 3DLBA 5JVGQ 5KFLA 2NPFA 1SXLA 4OYKA 3KHGA 1N33F 2WWVA 1X9MA 5F8IA 2C5KT 3PKMA 4B02A 2OPQA 2R8GA 1IWGA 2QYCA 4EZ6A 1UJ4A 2RF2A 4EGWA 3RI5A 3JAEA 4W98A 3FZLB 1WI6A 2CQGA 4ED1A 1YKHB 1HF8A 2C1EB 1NK9A 2OPQB 2WSCC 2R8KA 2VD3A 4DFJA 3MGJA 3FEZA 2P6SA 4YOEA 1HG2A 2ROPA 1HW8A 4DO0A 2D9OA 2DRBA 3QLHB 1M7KA 3HKCE 2VQEF 1WF1A 3BQKA 4M5GA 3DDKA 1DURA 3ZNUA 1T05A 4PUOA 3NRYA 4CTAA 5HMZA 1K1QA 3UUNA 2V8HA 4MKYA 1RJJA 2MEWA 2FJAB 2LDIA 3OV7A 4JP8A 4O2AE 5J2MB 3MEKA 4MKBA 3W60A 4RWXA 5LJ5Y 3I56S 4QWAA 1RAEB 3NGTA 4ECTA 4FBTA 2YDSA 2FZKB 3I32A 2DH9A 1VQ5S 2BM1A 3AE1A 4JI8F 4ED4A 3ZMTB 3UNYA 2RVJA 4F67A 3KJVA 1S0VA 2DRDA 2BACA 5IM0A 4I2QA 2MKCA 2LYVA 4NCGB 2EC2A 4OHYA 3A8EA 1TFWA 1JLBB 2XM2A 2V8SV 4OHXA 5F8LA 2JRKA 2NREA 3NKYA 2ZDPA 5GAHI 3BM7A 2CQBA 2L48A 2VPWB 2XSJB 4QPTA 3J7A1 1OY9A 2DIVA 3MCNA 1PIEA 1DTTB 3DN9A 5HL7Q 2FYXA 1RT3A 1T8EA 2FQQB 4KV8A 3ZCJA 4JI3J 2ZHOA 3C16B 2WAUA 3UPFA 1S0NA 3AHPA 2ZJQQ 1VR6A 1LFPA 3N6NA 5CYQB 1FVSA 3Q5XA 2Z0GA 3I96A 4OFZA 3PU8A 2EC0A 2V8PA 1BQNB 1RACB 4IH6A 2CQ2A 2RU9A 4K7QA 2GV1A 1AYEA 5A6WA 4K5RA 2KH9A 2BOAA 4MT1A 3QGHA 2A1BA 1VGYA 5K14A 1IBMJ 5TAOA 3M2UA 1OPIA 1KTQA 2XTLA 2BANB 3HI2A 4IO9Q 1FKOA 1F9HA 4ZDNA 3LAMA 4PXEA 4Z91A 2AE9A 3FBFA 4L74A 2EK6A 2QC3A 3JS9A 3KJQB 1TKTB 3OBVE 5CQGA 3PJAJ 5DETA 1S94A 2YX1A 3NL0A 2UUWA 4ED6A 3L39A 1NB2A 5T7LA 4LIRA 2X9HA 3ZFVA 1SL2A 3T1YF 2IBKA 4HN9A 3IG1B 3IR6B 1FTCA 4EUVA 3AQPA 3HI9A 4QIEA 2MSSA 3E51A 1E1HB 3AOCA 3BS9A 3FEXB 3PRVA 2ZBPA 4YTPA 3UDVA 3AA1B 3DMJA 3ILIA 3SYZA 4LSZB 1RYSA 2UXDF 4ZVHA 2N3OA 4O4LE 3N9MA 3ET6B 3ZTQA 2RUSA 2V9WA 3IA0A 4DR2F 2D1CA 4ZLLA 2JFDA 2WVBA 3J7Yq 4CIOA 2ZWOA 3OFGA 3VCDA 1RZMA 3PUVF 5AXKA 3P4RA 3PW2A 3FCVA 2PO4A 2RSQA 2EWHA 4YEAA 3CGIA 3RRKA 1S35A 2Y0BB 3Q0AA 1HYSA 5I4MA 4DV4J 2XS2A 3DRPA 4RLEA 1REGX 4KSEB 4P52A 1N32F 1BGXT 1UVLA 5FP3A 3Q23A 1K0TA 4OHVA 4C0OC 2Q9QD 2EHOA 2VFVA 4EEYA 2XYPB 4R5PA 3BR9A 5E2QA 2QLFB 1HYSB 1PO6A 2OJ3A 4CXXA 1QLNA 4G1IA 3ONLC 3OSNA 5DDRC 3IWLA 4HKQA 5J1EA 2RHQB 2MKYA 2V8DA 2UP1A 2ZJRQ 1H74A 3J80U 5AQKB 1FK9B 2J9DE 3ANWA 1NMEB 1O5JA 2RRBA 5AQNB 3G06A 2YNIA 4AQYJ 2KM8C 3NCQA 1S1UA 2UVUA 5D8HB 4CYUB 5B0AA 2BM0A 1X5OA 2HQCA 1RP5A 1QJHA 3IS9A 1VDHA 4ZVEA 4IG3A 5D4NA 2CCQA 3VGUA 3OL6A 3MEGB 3PUZF 1GEHA 3CC2S 3BF4A 1IN0A 3TJ9A 3NKZA 4EI2A 4Q25A 4H4KC 4M8LA 2CBIA 3WX8A 3Q24A 1DU2A 4RU2A 2DB1A 5K8MA 4ZVPB 2QV6A 4OI1A 3ZC1A 3OFEA 5LMNF 2HVEA 2WZHA 3K3QC 2VZ9A 1SE7A 1X9SA 2HS4A 1ITPA 1IVZA 1IKXB 2CZVC 3H90A 3MHYA 4B3SF 4C91A 3TLVA 1XMBA 1P9YA 1UZDA 3HHLA 5D3GA 2LKZA 2CPXA 4DLGA 3CWZB 4U6PA 1YD8G 1RGVA 1M90T 3W62A 2D7SA 2M88A 4HKAA 4QW9A 2XCPA 4FPRA 1A9NB 4AXPA 4LSNB 4LFAT 3VR9A 2I8EA 4NRUA 3SEOA 2HBYB 3IGNA 1Y01A 2ZFHA 3GG0A 3QGGA 3H5YA 1Z4UA 4CLYA 3CMES 3GWCA 3KNAA 1SA0E 3CJ5A 3KLFA 4EGLA 3DI6A 5SUHA 1BQNA 2XMMA 1F6TA 2PJQA 1IBMF 2N7CA 4ZS6A 1EAYC 5C8YE 4ANJA 3MM7B 1IJ6A 5A76A 4OYWA 2RU3A 2L41A 5CYJA 4PAAA 2EI5A 3RX6A 4U2ZA 1KEKA 2XY7A 3BZQA 4ZPBA 2C3YA 4D3GA 2J8SA 2WDVA 4F50A 4A47A 4PQUA 3VKHA 4KV8B 4HE8A 2K3WA 4U8YA 4EB6E 2CQCA 1B64A 4C97A 4OL8A 3R9LA 1BR1A 3H0PA 5KT4A 1S5ZA 3UULA 1S6PA 3W63A 4IG0B 2MHNA 2F63A 4TQSA 1FK9A 5FDLB 1LKXA 5AXMA 1N34T 4CQIA 2PD1A 4I2PA 5D6GA 4OK0A 2GW8A 3AAEB 1VQMS 2ZHAA 2KHDA 3CDBA 3W2VA 4LR8A 4ES1A 1TMMA 1LWEA 2DCLA 4ECUA 3V4MA 5CHCB 4Y00A 3M8QB 3DLKB 4EV6A 2XPKA 2ZVIA 4C4WA 3CE8A 1O6XA 3KUGA 4KGVB 2R6GF 2XM1A 2QYWA 2HQIA 3GA8A 3OL7A 5GMDA 3UE2A 5HQMA 3OYXA 5A6PA 3O1LA 1CS4A 3TO8A 2LECA 1R8PA 1TQLA 1Q78A 3AFGA 1SV5A 2KINB 4WYVA 4HWIB 2NR0A 2F40A 2OP5A 3GFHA 3GCWP 1ZETA 1CVJA 2XSBA 2K9AA 1X5TA 3DU5A 3CDUA 1YJTA 1Y5NB 3F2EA 2R7OA 3CMQA 4NZ0A 2ES0A 4QU7A 5JDNA 2HIYA 2CQHA 5KFPA 3I0RA 2HBRB 4C8ZA 4C8NA 3WHIA 5JQGE 1H7WA 2ZH5A 1U1RA 2JEFA 2JPFA 2RE1A 1URRA 1R8HA 4AXIA 2OHDA 3OVUA 3FMBA 1JLGB 3KOAA 3HJVA 2CPEA 2C22A 3RR7A 4HL9A 2DR7A 5CXTA 3BYRA 4OYZA 4B08A 1RTHA 1Q53A 1IR1A 2W62A 1YZ7A 3O2IA 3DC2A 1PKUA 4PYDA 4QWEA 2CPHA 1O51A 3ICLA 3AD7C 5IT9Y 4DBQA 3C4WA 4L5GA 3DRRA 1PAUB 2P9EA 4K4YA 3ZYLA 4FN5A 4DFKA 5AQTB 1W09A 1JIHA 1JJ2R 4PXDA 4BC7A 3OXFA 4U31A 2NXEA 3T6JA 1BMQB 4K0KT 2X9YA 3PUWF 2B7CB 3DRSB 3FEYB 1LXJA 3GIKA 4WNKA 3V4IB 1G7CB 3AVSA 4ZEYA 4H9RC 5KT7A 1NHVA 2QMXA 4LF6T 4LMLA 2YDQA 3WIVA 1C1CB 2JNJA 4JUZA 4ED2A 1SJ4P 4NCBA 3ZZYA 2J0QD 2R2TA 3HSJA 1FEWA 3O8WA 3JQMA 4WWSA 2CHNA 5DZ6A 2VG5A 5L3DB 1YJ9S 2DCUB 4X4TA 2E1RA 1BLUA 2CJYB 4WU3A 2LJLA 3TA1A 4LSLA 4OZ2A 5K14B 2AZ3A 3ZTPA 2Z58B 3LTOA 2V69A 1NDKA 4ZVRB 4HDGA 1NHKL 3UT5E 1T0TV 1FDAA 4M5LA 2LHRA 3ENVA 2ZM6T 2B8PA 3FZBA 1NM2A 4LRCA 5F8JA 1G4CA 3HDSA 1UWAA 2UXNB 1N36J 2CWOA 4ERDA 3BSAA 4K0UA 3H37A 4P0AA 2GHVC 3K5LA 2CJBA 2V94A 1W2BR 3EHZA 4WZXA 4RNFA 3RRGA 4ISSA 2QN6B 3L9ZA 2HNZA 1HBMB 4QIGA 4ZOSA 4FXVA 3KLEA 3M9NB 4C8YA 3CT9A 4IDZA 4F4YA 3C46A 1ROFA 1D9FA 3HFVA 1X5SA 3P7IA 5K8PA 3MD3A 4FP9A 4C11A 3TNVA 4L3KA 1J5WA 5AQFB 3KDSE 1J27A 4DR7T 2P5VA 1S6OA 2OH2A 2DI4A 3GMGA 5F3ZA 3F56A 3AA8A 3CIZA 3PHTA 3CQGB 5K20B 1PILA 1S1WA 3EGVA 2WSEC 5A8RA 4AYBD 1UTAA 4AISA 4A46A 3WDOA 1JLAA 4K4SA 1JLBA 3TWZA 2MQ8A 4JI2T 3EVOA 3FQKA 3W1YC 1P27B 3DRXA 2OPSA 2BW2A 2BABA 1U2FA 4H63V 2G0UA 4LFBT 4OHFA 5L39A 3IGVA 3UCZP 4DV5T 1RT6A 4LVOP 4AE5A 4L76A 5E5NA 2KT9A 2QZ8A 3MTKA 1WEZA 2X68A 3GIJA 4F4AA 1UWBA 1JB0C 1FRHA 4WBOA 2C2KB 4FKXA 5CD4H 5LMUT 2VV5A 5IWAF 1WCRA 4L3NA 3BPDA 3H25A 2VG6A 3WZ0A 3OL9A 3RTVA 1VFJA 1WR0A 1T05B 4U96A 4DR3J 2DY9A 2HQDA 3JXOA 1XNQJ 5IZHA 2LXFA 5F8NA 3CCZA 1WHWA 3DM2A 2L3LA 1KFSA 3BKUA 1TL1B 2E9XB 5J2NA 3W7BA 3UDEA 2B76A 1N33J 1RBOB 1T7SA 2P9GA 3HXMA 3RLFF 3T19A 3R84B 1CS4B 3IBFB 5L8RC 4TQRA 3RW6A 4A8SA 4IFYA 4DV7F 1CPZA 2PI4A 2HWIA 1HI1A 4DL6A 4P1NA 3IM9A 4LQ3A 2ZBCA 2DHRA 4O3QA 2KXPB 3FRYA 3CCMS 5LYJE 1GX6A 4C3LA 3PR5B 1YVFA 4RO0A 4UEMA 1GMWD 4MYUA 5L2LA 4RBVA 4H9NC 4PABA 1XR5A 1OMSA 1AB8A 2Y1LB 1FRKA 4GK5E 3N0VA 3B8HA 2IC9A 1EJ7L 5DG8A 4NEYA 2FJVA 2Q43A 3TKLB 2WW8A 3TEHB 2UXBT 3PRBA 2IMLA 5EK2A 3TUZC 3CB4A 1YQHA 2RKIA 3AEBA 4P9SA 1NJZA 3LH2S 4ILLA 4CT8A 4NA1A 2VG6B 2YNHA 3DU6A 3MAAA 2CM0A 1XC9A 4IE7A 3GSIA 4IL4A 1UP1A 4GRSA 3GG1A 1V5VA 2CQPA 1LNQA 2W8KA 4NCAA 3UU5A 2NR4A 2BA9A 4DPUA 4OI3A 4C3MA 2DNQA 1RBAA 4FS2A 3Q8SB 5LJNA 3IAM9 3LUYA 1I51B 5F5WA 1WG5A 5LOQA 2RB7A 2BOPA 3LK42 4DL0C 3UQSA 3AEGA 1FXDA 2G1DA 2V2VA 4IFVB 1FJCA 3UUBA 5IHYA 1C0UA 4PK6A 1U2CA 4C0HA 4E2FB 2LOPA 5JDFA 1WTBA 2EKNA 3W8PA 5HVGA 4ZI7E 2ODVA 1WFDA 2BXJA 3LGMA 1H6KX 4QW8A 5KG5A 2K7JA 1MG7A 3H2VE 2R42A 4DU8A 2D3UA 3K89A 2COLA 2XHCA 3R1HA 3M6VA 4OYXA 5KXJA 4MH8A 3MFIA 1GNKA 4A98A 3CEDA 4RW9A 1M1HA 4ELVA 1HWIA 2YNHB 5FVKA 3EMTA 2GA7A 5CB4E 3ETOA 3RB4A 2M7SA 2FGOA 3DLGB 1FFWB 3M8SA 1EIYB 4I55E 4IO1A 1MMGA 1C2PA 1PG5B 2MQOA 3PURA 4USKA 2ROEA 4X4VA 3WIUA 3OR2B 1UGOA 1UJ5A 1W9RA 2IA0A 2FLNA 2XG8A 2WCXA 4IE5A 2JQ9A 1XMOF 5ETKA 4GKKJ 4OIXA 3HFKA 4X20E 2FC9A 3PG9A 3KUHA 4K4XA 3CW2C 3E2EA 2I5JA 2K3KA 4ITSA 2BG9B 2EXUA 2Z2LA 2QA2A 4KX6A 2IBOA 1L5UA 3T5KA 4JI1J 4DV7J 2KJVA 3EDRB 4GOUA 4F0MA 3SOLA 2GK9A 5JR9C 1TV6A 2EVZA 3D3CJ 4HWDA 5KFOA 5FIIA 3PNIA 1N5QA 3G6ES 2UXXB 1FJEB 3TAMA 1SUMB 3I0QA 2YWWA 3PV8A 1JJHA 3BGRB 3O3LA 3D67A 4Y2AA 1WWHA 1B0TA 1RLDA 4NRTA 1UK5A 2C2ZB 3UVJA 1BE4A 3CD7A 4I0UA 3CJRA 5J2NB 4WF9Q 2DITA 3A1YG 3SCKE 3M8PB 4LF7J 4PUOB 3VAFA 2IDOB 1FWLA 4QX7B 2CQ4A 3GFXA 4CXWA 1NPKA 1MWYA 2LMIA 5AQSB 2QE5A 3I0RB 2BG9A 2HHSA 1CBKA 5C2TA 3G82B 2NXJA 1VCSA 2UUTA 4E7SA 5J1NA 1RA6A 3IBPA 4AL7A 3F44A 2BKNA 2NXCA 4G1PA 2RRAA 1T7PA 5FXZA 1NSAA 1U1KA 4J9QA 3ULHA 2V8GA 1TP7A 1UX4A 3MUMP 5EZYE 4W90B 5L9XA 3RIAA 1N32T 4I4TE 1YTYA 1SQEA 1YRUA 4AL6A 2HQGA 5EWGA 4I68A 4YY3F 2W4DA 3WBZA 5LL6d 2J0XA 1TKTA 4OZJA 5AQGB 4EMDA 1B7FA 1JWWA 1PGZA 1B99A 5K8NA 4OX7A 4PAGA 1KQSR 4ANEA 1X4CA 2XMWA 2X67A 3Q83A 3AE9A 4JV0A 2GC8A 4C7QA 4YR2A 2FHOB 2ZH9A 1WC5A 2UUCT 2GHPA 4JI8J 4ELUA 1LVKA 4I50E 1S1WB 1YDLA 3PW7A 2H4YB 1TKZA 3KK3A 4USTA 4LMZA 3CX6B 3PVXA 3DHXA 1FE0A 1SIZA 4YS2A 5JDGA 2QL9B 1XQIA 3DNCA 3E01B 5L1IA 1H7CA 1EETB 3GR1A 2VB6A 4KHMA 4HYKA 2WSFC 3MDFA 2DO4A 3WI3A 3OHBA 2ZKTA 3M8QA 1HNXF 4CNYA 4BBYA 1I3OB 2RDJA 4PNIA 3T5JA 1HHQA 2N2NA 2BJ1A 2VFUA 2QLBB 4UV8B 1RCXB 4IDKA 1UFWA 4UW2A 3Q2SC 4DMWA 2O3DA 2XZTB 3QAUA 1UVKA 4ZP6A 3CDEA 3AODA 5L4HA 4DS5A 4OZ0A 2LM9A 1HR0T 3LFMA 3SFDA 2QJ3A 3CD5A 2R7UA 1M5SA 2BQ3A 2YDRA 3HPOA 2I6WA 2B9YA 4B3ST 2P8IA 5ETTA 3PW4A 2HMIA 4I43B 3HVTA 1Q7LB 5L3BB 3TEGA 4N76A 3T8OA 2MOZA 2UVWA 5F41A 2KG1A 2UXDT 3GJRB 2AHOB 1S97A 2ZH2A 3M8WA 2LEAA 5FYMA 1S12A 3FC9A 5EUHA 3VV2B 4J9RA 4QWDA 1VC0A 4AKGA 4XIUA 4NXMT 1TKDA 4JBCA 2ZH1A 3HMJG 4CN1A 5HQLA 1U02A 3QRRA 4H9SE 1Y0HA 3RB6A 1ZOYA 1R7IA 1KF6A 5IQ6A 1HX1B 2LLZA 3VAMA 4DR4J 3J81j 2IUBA 2RQCA 4O3NA 4L6V3 3G87A 1LVFA 3PCOB 2MZJA 5BYSA 2BDPA 3D1HA 3CTRA 4WE1A 4ZS3A 2IRYA 3Q8UA 4ECRA 5IV4A 1N6QA 3AH6A 5KT3A 4HH1A 5JDHA 2V4QA 2WMNA 2IW5B 2CWXA 3KMQA 5AJ3J 3FHNA 2VQFT 3SV4A 3MM6A 2HQ3A 4X4QA 2ABYA 1YSJA 4Q7AA 5AE2A 2R9LA 4EO8A 4ILUA 2KZ7B 1IZNB 1HPZB 4DSIA 4GVBB 1FE4A 1OIAA 3FZHB 1D9AA 3CDWA 4TYBA 4A8XA 3A3NB 4DPOA 1RT7B 5IFMA 1N34F 2IYGA 2J0WA 4M5HA 2XWYA 3J9X1 5B0DA 5KG6A 4ZCKA 3FZFB 4V1Ak 3TZZA 3LANA 2ALYB 3QT7A 1S1XB 4JI0F 1IAPA 4TUYE 2UV8G 2V7KA 1GK8A 1RWPB 2EHOB 3RYHE 2FHJD 2GIFA 1NB7A 1S1VA 4N78D 2RJZA 2E5VA 2FPHX 3AE3A 2CNOB 4C6AA 2WZ1A 5ABGA 3FNNA 3AE5A 1CQNA 3D6HB 2F9DA 3ETMA 3WX4A 2VODA 3C98B 2ZE2A 1Q1KA 4PFOA 3RU0A 3M2VA 3MMJA 2BJ7A 5KFZA 4QX8B 1TU0B 2JVRA 2DH8A 1ZAVA 1VRTB 5SZTA 3PUSA 1VBYA 3I0OA 2E1PA 3Q8QB 3SV3A 4TZ4C 1NK5A 3TX8A 2HHVA 1FXRA 2NOXA 2E2AA 2POKA 5HAOA 3GE9A 4G63A 4CDIA 3IP0A 6FD1A 2HYIB 3CD6S 1HWUA 2LP4A 2MXYA 4AXJA 3QGIA 2RNEA 3K5OA 3MWBA 4CN4A 4CO0A 5A8KA 2LM2A 3VVUA 4JV1A 5KFCA 4QXCB 4KAIA 4ECYA 1RT4B 2BVMA 2W9BA 1VQPS 2W61A 2Q1LA 3MPYA 4CLFA 4KT0C 1S0MA 3DOMB 4GVBA 2UUAF 3QC9A 2YU2A 5A8WB 3U1NA 3MK7C 2OFHX 4Y6IA 4M95A 3KTQA 1W2IA 3BGLA 3SDEA 4BJNA 1S0OA 2N3LA 3QJLA 3P8BB 5C3JA 3BSCA 2F3JA 3TA2A 1HI8A 2NXNA 2IRUA 3CCQS 1K44A 1B70B 1RABB 5JTGA 4CI1B 2XSAA 4CI3B 1ZKEA 1PYTA 3Q8PB 2EHOC 2J6UA 2FDNA 2B4OA 4FPIA 2AV5A 2HNYA 4JV5J 2D9PA 4Y34A 2EFGA 2OSRA 2EFPA 1JK9B 3QSIA 4Q2MA 4OI6A 1WSRA 4H4MA 3Q22A 3OFFA 1HFAA 2CPTA 5AE3A 2CRBA 2YKNB 5JR9B 1FKOB 1BQMA 3DGVA 1XJWB 4OJ1A 5CA1E 4LVNP 2QFJA 3UR3C 2AEMA 3D5MA 2MJNA 4PRFA 2Q9QC 2EBGA 4ZVSB 2MBGA 1HNVB 2QLXA 4IRKA 2V9KA 3VHQA 4OV1A 3FBZA 4IH5A 2WCAA 1N54B 5EN1A 3MM5A 3ZMVB 5C24B 2LQ5A 3MAAB 3MAHA 2V6XA 3MMBA 2DGSA 1Q82T 3ZSTA 2KSRA 2AF6A 4YB1P 5FKYA 1JJCB 4HFHA 5HEUA 4WK1A 2YTCA 3BGUA 3DFEA 1G73A 5LSOA 5D0RA 1U26A 3LW5C 5ABEA 3CVKA 3VAIA 4DSFA 4MFBA 3FXDB 4K5SA 2XSJA 2DY1A 3PTWA 2VKZG 5KX5E 4CH1A 1TMJA 2A6MA 2DXDA 3RBXA 3TZYA 2WBLA 1GMUA 3B82A 4BCAA 3JSRA 1W26A 1HHTP 4DJBA 3PJWA 5KG4A 2KWHA 1RAAB 3H4BA 2BG9C 1H2VZ 4AKLA 5AQRB 3CCLS 2VC1A 1N48A 4NPOA 2FY1A 1YZ6A 4C8LA 4KHRA 1ZM4A 3H3AA 4ANCA 5JJBA 4TXSA 2CPIA 2YQ1A 2O5DA 1W0BA 1RKIA 2DGQA 3D0HE 3MMCB 3AA9A 3AAAB 2C5JA 4DR2J 1RISA 2VPXB 5J2PB 1O3XA 3TLUA 1VS3A 4AFFA 1XMQJ 4YLHA 1G1XA 1V3RA 4NLSA 4S0MA 3P8CD 3PKYA 2G2YA 4HI2A 3K8VA 2W67A 1KLNA 4J9NA 1YJUA 4QYZJ 2Q6BA 4UQTA 1IKVB 3AOBA 4QBUA 1TK0A 4NLXA 2ZM6F 4LMKA 4DX6A 5LA6E 4EZ4A 1FDDA 4NOHA 3SSQA 4PCQA 2LLYA 4UXNB 3HVWA 1A7GE 4NXNJ 1DTQA 4CO5A 2HHQA 3RC8A 4NIQA 4Y2KA 2IIUA 4Q44A 3CJ3A 2KT2A 4YJ2E 4LFBJ 3RKOA 1HNWF 1WHYA 2GZOA 4DSLA 3DGPB 5AQJB 8RUCA 3OW2R 2J4GA 5LHHB 2C0SA 3ADAC 3ITHA 5GAGU 2RS8A 1SH0A 2MQPA 4ZCIA 3C6TB 3R1LA 2KT3A 4DR1T 3P45B 2OO4A 5HO4A 3QWUA 1M1KT 5AT1B 4J37A 5LMUJ 4PWWA 3W9JA 1XNQF 2PSZA 1WC6A 3LDQB 4AQYT 5KFFA 3U3IA 2BDEA 4ZKAA 1OXZA 2I59A 3AA0B 1B4SA 1JNRB 4A8KA 6FDRA 4IRCA 1Q4RA 3C15B 1YWXA 2GAHC 3IRXA 4FYWB 1U7LA 3G6XA 4OV6A 4AQGA 3H2LA 2A10A 1LFWA 1QUPA 4HTJA 3PUGA 4RJVA 2E29A 3PY8A 5T41A 4F0HA 2SPCA 2OLWA 1F9EB 4NI2A 3PW5A 3NMRA 2JJ4D 5AQIB 5EWFA 2HAFA 5HP1B 3JYTA 5KFIA 1PYOB 1DHMA 3UNGC 1APSA 2ZH6A 3TAQA 4MMOA 4ER8A 5EWEA 1LWFB 2V68A 3IHRA 3NS6A 5JDLA 4A4JA 4URGA 2KFYA 2D5UA 3GIRA 3KLFB 4B9UA 4B3OA 3H98A 2WU5A 2BS3A 5H9FJ 3Q86A 3LGNA 4DS4A 1RU1A 2XAHB 4ZLJA 2BG9E 3KK2B 3RAXA 2W00A 2RQKA 4L0RA 3W3SA 4RKUC 2YWKA 7AT1B 2IJRA 1C0UB 1HQUA 2MJUA 3MEDB 2DH7A 5KAKA 2WY2A 4EOZB 3TLWA 3CCUS 2DVIA 3ANWB 3HSDA 3PDNA 2UVVA 1KFDA 2JVOA 5CCLA 2M8DB 3HHEA 2J7KA 4GO7X 2E7XA 3HHLB 1HFEL 4JUYA 1S57A 3I31A 1FDBA 1YJVA 3RIUC 2CPYA 4WW0A 1TAUA 4KPCA 4RW8B 2HKEA 1SUQB 1Y11A 1H98A 3B5MA 2X7IA 3MPDA 5KFTA 3W2WA 3NNHA 5DLFA 3F0NA 3LSVA 3MA9A 1S7HA 1U24A 3UI3A 1FJGF 5LSLA 1D0ZA 2MQLA 5HXSA 3AXJA 5FVLA 5AQHB 4OI2A 4WKRA 4KPYA 4DV3T 2X0LB 4KHZF 1QVGR 1RHJB 2GVDA 3KG0A 5JVHQ 1Q81T 3DM2B 1Z1ZA 2DGUA 5D4PA 2CUYA 3OKQA 3S01A 2HBQB 1HNZF 2R7VA 4F36A 3DTOA 1XR6A 2IA6A 4HHHA 5CGMA 4LIWA 4ZMMA 4Y2MA 1N0UA 2HIQA 3I5BA 2DD8S 2WDQA 2NQPA 4XPCA 2XHEB 4BHQA 5DQVA 1UWBB 5IOLA 4Y65A 3OTCA 3SQGB 3K3OA 1UURA 3PDYA 4ED3A 4M63A 4QIFA 1OQ6A 2HHHF 3QZ7A 2J6TA 3M9OB 1S9GA 4Q2LA 3TUIC 5FJ4A 3NOGA 3G8TA 1VRQC 4U8VA 3QJPA 1DBDA 3EZOA 1AFIA 5E33A 4ECQA 2KVIA 4LF6J 3I9V9 2C3MA 1O0PA 3DDNA 2ZOMA 2ZNZA 4GKKT 3MM6B 4IT4A 4NLQA 2NSCA 2XNQA 2PMZD 1T03B 2WZIA 3AB2B 2HHTA 3R7SB 3MM9A 4OZ1A 1CJUB 4H4OA 2A0FB 2PMWA 4WFZA 1A0OB 5KFHA 2KVQE 3PR4A 5HYAA 3BR8A 3OYZA 4L9IA 5DS7A 2ZD1A 4DSKA 1RT6B 2HS0A 2GS8A 5D0HA 1MIWA 3MOZA 3IFEA 4QXHB 1HD0A 4CLTA 2XMTA 1ZM2A 3I9YA 1N36T 2ZLYA 2I0XA 2B1EA 4C0BA 3NBPB 4HWHA 3A5XA 1KOHA 2E5JA 2VICA 2VFTA 3FK4A 2HVHA 1HWJA 2V1DB 4OLOA 1WSVA 2HFUA 5GMKa 4FF3A 4ED0A 2HN2A 4GC6A 4X4PA 3QMQA 1RYRA 2GVZB 2YQ3A 4UY8T 2LCWA 2BANA 1HCIA 3OTOT 5JDMA 5A8RB 4K59A 2W9CA 1BWVA 3TVYA 2OELA 4KR0B 2V4JA 2DNPA 5A0YB 2BUNA 4ZVOB 5KT5A 4UTGA 2BX6A 2VFRA 1QTNB 4ECSA 1UUSA 5JR9A 2FHKA 5IT0A 1S9EB 4QYRA 2OGUA 3MR5A 3KYLA 2WDRA 3BGFA 3RRCA 4TNOA 4PPZA 1SJ1A 2ACMA 1E6YB 3ONQA 4U2YA 3PYFA 4BAYB 4F4KA 4Q0BA 2WU2A 4QR0A 2V6AA 2C2EA 1WKJA 1YBUA 2HLTA 2GAGC 4KI0F 2IC3A 3UR0A 4IHJE 1UCNA 2V6YB 5CA5A 2ASDA 4ILMA 2J5AA 1YK9A 3T5LA 3NP5A 4B3MJ 4F3MA 3LK3B 4MK9A 1R8IA 4DUZF 1G2EA 4JI5T 4Z37A 4J9PA 2N82B 3MOJB 2H7OA 4GC7A 5B0FA 3ZZUA 4E8UA 4DZDA 2DO0A 3X1LB 3JQJA 1VLOA 3MAQA 2XC9A 2R7QA 2Y8YA 4HEA9 4MALA 2D0UA 1REVB 1HWKA 2V7JA 1RK8A 1RXOB 3OT9A 3A8YC 2NW8A 4TU8A 3Q8RB 4CLWA 5ETSA 4YY3T 2K24A 3BSNA 5HXCA 1RTHB 2DT9A 2AIRB 2XEXA 3WAJA 3MPVA 1VQYA 4DV0T 2ILYA 3DGPA 1XIQA 2JLGA 1N4LA 3TQEA 4NASA 5DQWA 5JXSA 2UXCF 1RADB 3T1HT 4I6AA 2C2RA 1ACMB 2G9OA 4PJLA 4OX8A 1NHUA 3Q2TC 1L3VA 3I0SA 5G0RA 4DL5A 2W2PP 1VHIA 3NZQA 3BV8A 4P0BA 3A7MA 4X5TA 3BGOP 2E9XA 4JI7T 4PW8A 3FDSA 4EWTA 2Q66A 5HSPA 5AQUB 2HZAA 2D3O1 1NDCA 4IRDA 3CMLA 4K8RA 4RNHA 5B0EA 2WB1D 4RW7A 3TYTA 3VAJA 2DYAA 3SQGA 2A3DA 4DIDB 4F26A 4KJIA 4DV2J 1XK8A 4GYSA 1US7B 2M0GB 1F0XA 2D41A 2BZBA 3M6XA 1QE1A 5HCJA 4EYHB 2DR6A 1HKAA 1PSDA 2NP9A 2W01A 1N33T 1PJ5A 3J7YI 4DV5F 3UD3P 3N01A 2IMOA 1T8BA 2KT5A 4FI5A 2DR5A 4QJVA 2AU0A 3I5CA 3CJ4A 1NPRA 2AP6A 4GMKA 5HROB 2MKJA 3PUQA 3VF0B 4JI5F 2B3TB 4FYXB 3BSOA 3ZZ0A 3R5CA 1K1SA 4WCEQ 2PFVA 3P4UB 4WFYA 2WOMA 2LEHA 3UFGA 5IUXA 4TLRA 2GVDB 4DUYT 3QYYA 1HD1A 2M70A 5BR8T 1NO8A 2QMUB 5LXRA 2DNMA 3RRHA 5HLFB 3J80Y 4KKOA 4B9TA 3QB5K 3FBCA 3O1JA 1XEZA 4B9MA 2YPZA 3P4SA 2YU1A 1J5OB 4NLRA 4WE1B 2R2UA 4X64T 1LQ9A 3BQLA 2E7VA 4OYJA 4EO6A 4PZVA 2W66A 4E0DA 1U6BA 1UX5A 3C64A 2B0GA 3KV4A 2E66A 2VOPA 2HVDA 1D0XA 4DOZA 1YKWA 4WBNE 4JI4F 4QWBA 2RS2A 3G6VA 3IF8B 4ELTA 3J81U 3IR5B 2D9DA 1DZ5A 2I6HA 2B9XA 3HFZB 4ZVUB 3BQ0A 2MB0B 2LA6A 5GAEI 3ZEFB 3RGLA 3HVTB 4HFVA 2CVEA 4A8WA 3V81A 4LF8J 4DR3F 2UXCT 2N4DA 4F0KA 1PBUA 2FJXA 5AQOB 1D8ZA 1WOSA 1EZZB 1DQ8A 3IC1A 4I67A 1LK5A 2VPYB 3B13A 2JSXA 5LT5A 1WG4A 5DJBA 3OLBA 2BKOA 4EYYR 2HQFA 3JYTB 3HVAA 4IIJE 2CKWA 1S6QA 1OPZA 5DGAA 3CK6A 4PPDA 4QOTA 1WYBA 4JI1T 3IRWP 5ITHA 4XPEA 2FC8A 4HH0A 4IQMA 5FNVE 3H40A 3Q9DA 1C1CA 4LF1A 4YHHF 2C3UA 1ZBTA 2L9DA 3UN2A 3G8QA 3PHEA 3TLSA 5LM7E 2I9SA 1RWXB 2VBZA 3CCWA 1NENA 4X2BA 2AX0A 4DEZA 3GIIA 4HVZA 2Z56B 1NLKL 2C2MB 4KIAA 4MAKA 1G6BA 2QT7A 5B7WA 1FRXA 3AAWB 5IC4B 4JI0J 2M52A 4IL9A 4DCOB 5KMGP 1FESA 3TARA 4ZVFA 3D28A 2G2OA 2RT3A 3US5A 1U09A 5FL0A 4KUMB 5ETVA 1S1XA 4DV2F 5LCYA 1N34J 4OJGA 4TLQA 1KONA 1VOMA 2OD4A 2KG0A 3K3NA 1YRTA 2CJQA 3ENWA 4O4IE 5IC6B 1K0VA 1LW2B 2DNLA 1HR0F 4RW7B 3NCRA 5HCMA 3AY0A 2HAIA 2BZ2A 5HMYA 1HPZA 3OD2A 1AUSL 1R43A 1HNWT 3R6LB 1OYDA 3OUYB 3G82A 3QT6A 3T9NA 4MLKA 4NUVA 5LHGB 4MIBA 3AE2A 3AXJB 4LF7F 1ZTTA 4U67Q 2QA7A 4UVBB 4L72B 1U49A 2VKRA 4QYZK 3L3PA 3CD0A 4MBQA 3OXLA 3W5ZA 2CJXB 4IOBA 2MZ1A 3UFEA 1WC4A 3O1HA 3T1YJ 4LF5T 3EXCX 4OZ5A 1XNRJ 3EICA 2CA5A 3HR0A 2YVSA 1Z2LA 2HFNA 4TX5A 4PK4A 4CLZA 3KBUA 2WONA 4NYOA 1U0HA 2JEIA 3ZYMA 2EK1A 5BYQA 4JEUB 1U6FA 1BC6A 1OEDB 2BYCA 3S7RA 2IM1A 2DCFA 1KEYA 4Q8EA 2H65B 1H2UX 2BQRA 1WTFA 3IN5A 5HMXA 4IR1A 3OL8A 2LKGA 3T1HJ 1IBMT 2V2QA 4ZVGA 5J2UE 3KHLA 1ZP0A 2AGQA 4RNOA 2FBWA 1X5PA 2HRYA 3HD1A 2XQ5A 4JI2J 5FDLA 1WKKA 2Z8QA 5DM7Q 2DR8A 3H59A 3RYLA 4O0NA 3BH7B 3T1HF 3VVTA 1U25A 4BS2A 3P3DA 5MLCV 4JI7J 4YFSA 1SJQA 1MN9A 4DFMA 1RHKB 3ZXWA 2DJWA 4IDOA 4BC9A 5T14A 4I4BA 2LRKA 4ZP8A 5HXEA 1TL5A 1GAOA 4TWDA 4IH7A 5E3CA 1I94F 5EK3A 4RW9B 3SFUA 1Y10A 1K47A 3AB3B 2HZVA 2JL9A 3D2WA 2KB2A 4LF5F 2NS1B 4O3PA 3FBEA 3C2PA 2F4VT 2RDDA 4NXMJ 1S59A 4P6QA 2HMIB 3BKTA 2J9DA 1NH7A 2JQHA 1RTJB 3QQCD 4JI4T 3PYDA 1JLAB 4ENOA 4XZCA 2LOSA 3UQ7A 2PDAA 5DDOC 3KDNA 3CCSS 3O4XE 4DV1J 4DR7J 2W9CB 3DDIA 4MIWA 3M4XA 3R7NB 4WIIA 3BQIA 4CO1A 3NRXA 3GB0A 4FNIA 4UOFA 1DY3A 1RTJA 4IFVA 3OBIA 4DI6A 4A8YA 1HR0J 3A12A 2KXHA 1JLQA 1UW9A 4I7FA 5H9FK 4ED5A 2WAQD 4AUKA 4DV4T 2VHGA 4FVCA 2MKIA 4CH0S 3ISNC 1RWOB 4LF2A 5ETWA 2E9ZA 3ZJ1A 3S8SA 4X64J 2CJAA 2DK2A 5F8PA 3R6NA 5DQHA 2Y0SD 2VQET 1L0VA 1YG0A 4XDDA 4HTEA 1FXLA 1RUSA 5A0YA 1MIVA 4F8HA 3K58A 2YKOA 3GR0A 2JZ5A 4WKYA 3E08A 4TWFA 4J9OA 2MGZA 4LR7A 3LQVA 3THPA 1YBAA 3P4PA 4PJMA 4RBTA 3EPIA 2CYYA 4YTMA 4XBFB 4P75A 4R8UB 1RCOB 4J90A 2J47A 4ED7A 3N9QA 1S1UB 2QGFB 2VWAA 3TANA 3DRRB 4JYAT 2P9CA 3KLHB 2R8HA 2K1RA 2JC0A 1WORA 2JRSA 1HQ2A 4NCGA 5KFRA 1RAHB 1IKWA 5L3FB 5IM0B 4DX5A 1XNQT 3MEEA 2DIUA 2Y6XA 4LF8T 2BS4A 3LBXB 3FXEB 4F4WA 1PC5A 3ONXA 5LHIB 2R7SA 5JRCB 3LGHA 5K9FA 3DLHA 4ILBA 3F41A 3UO0A 3MTJA 4UIGA 1FVQA 1CJKA 2RIJA 1ZTWA 5AXLA 1E6VB 5I3UA 2FLOA 1R8AA 4DDFA 4K50A 2VG7B 2V67A 1TUGB 2VQFF 2DHHA 2ZZTA 2P2CB 2AYBA 2CZ4A 2YH1A 2AWZA 1RE1B 3TUPA 5HJXA 2CG8A 2X9WA 2HNDB 2AJ2A 3W9HA 2L9NA 4X4NA 2FJBB 3UUXB 2FY8A 2XQ7A 1Q0NA 3QLHA 5A2QU 2DHGA 4TV9E 4G1QB 5BMVE 3K5NA 5FXWA 4KY3A 2ATCB 1SKSA 2LHNA 3RB3A 3GP9A 5DRKA 4EZHA 4FF4A 1S77D 1Z2ZA 3IAS9 3W9IA 3UQ4A 1HHSA 1WJ9A 2HFOA 2OD6A 1QAXA 2Q3PA 3FB2A 4QIVA 1EQMA 5I3PA 2X51A 4IOCQ 3VHLA 2W4XA 3M7VA 4NZ6A 2XCAA 5FLXU 3JTNA 3D1OA 1S6UA 4O3SA 3UTKA 2BJ9A 3FCHA 2KXNB 3NY0A 2DHSA 2AW0A 1OWAA 3W2WB 3MR2A 1KDNA 4DR1F 3LP0B 3LPYA 1DLOB 3CIMA 1SQFA 5C42A 2W8LA 2XAFB 2XO7A 3TZWA 2E9XC 4M5IA 1M0SA 1IBCB 4IR9A 1JKHB 2DWGA 2Z2ZA 4PG4A 4DUZJ 1FJ7A 4H4KA 5AQPB 1VRBA 1FHTA 3R3TA 2XQ4A 5FY0A 1BQMB 2AKWB 2MSTA 2BQUA 4BWJA 1OY8A 3GTYX 4H54A 2VVSA 3HT0A 4ZZBA 2IC3B 4URQU 4NMXA 1F5CA 3B6BA 5LJ3Y 1SJRA 1VRUB 4PG6A 1FJGT 3KK2A 2CAJA 2XHWA 2ZBRA 4IUFA 1RKJA 1E6YA 4OMFG 2U1AA 4OYMA 2IY5B 2NXUA 1RTIA 2HWHA 4WZMA 1RWNB 1XNRT 2CPZA 2I2YA 1UZHA 2PN6A 3EGZA 1AJ3A 3OPCA 2AXDS 1YBTA 2YINA 1XBWA 1NSKL 4MIAA 3M3ZB 1MWQA 5IQQA 2LA4A 5LMNT 5F3JA 1MROA 2CNKB 5KFDA 1X9BA 3P4WA 5K8OA 4AKRB 3H4DA 1URNA 2G0IA 2DXFA 3IWXA 3FSYA 3KWMA 4HHUA 1F5AA 2DWKA 1U1OA 2BMBA 1WC0A 4LRFA 3BPSP 1RLCL 5LXTE 1WR6A 3F31A 4OX9J 1LWFA 2FJWA 2R7WA 4O4GA 1FRJA 3IMQJ 1H3DA 3BQ2A 3V6HA 2CQDA 2H3EB 3LG7A 4C3KA 3SIPB 4ID8A 5LMUF 3R5GA 5KFWA 1UA1A 2BKPA 2C2DA 2AEFA 4YN3B 2QL7B 1J2VA 1T02A 3ZPOA 4FDFA 3HK2A 4B6XA 4OJ3A 1J5ET 4YSZA 3MCSA 4HEAA 1AFJA 2H89A 1QD1A 4IFYB 1IM4A 5ETOA 4N5SA 4M1PA 2EEYA 5U47A 2MHEA 1MLAA 3M2VB 3NNAA 2ODUA 2HPJA 1TL3B 5FL1A 4ZPTR 2CFXA 2QYGA 2WONB 3F73A 2EKYA 4ID5A 1V9DA 4KYZA 3LP0A 2VURA 3VAHA 1IJ5A 4DBRA 3FJ2A 1RT1A 4M94A 4ZOLE 5IYZE 2DNOA 5DG9A 1IQTA 2CQ1A 5HMWA 4F6RC 2BW7A 5J1PA 1NDLA 2E5HA 3TAPA 2J62A 3GU0A 2PG8A 2GJFA 2YN6A 3VZHA 3X1DA 1RT5A 2BBHA 3MMAB 1RT7A 1NKCA 1NJIT 3M9MB 4O2BE 2K48A 3QRPA 4C98A 4LFAF 1WEXA 5L3CB 5J2PA 4F3QA 1SC4B 2NZCA 3CJSA 1UAWA 1IBKJ 3CF5Q 3N5BA 1MMAA 4N47A 2WTFA 2KFZA 1AT1B 3BH6B 3QGPA 2DRAA 5LBMA 4YJ3E 4X65J 1UW4A 4LF4T 2DKOB 1MNDA 1HBOA 1FNXH 4PWDB 4CO4A 2QLWA 1SV5B 2YBVA 1N6QB 1FNMA 4YDXA 4DV3F 4YY3J 2K06A 3EAMA 2YX7A 5IWAJ 5LG4A 2J6SA 1CJVA 4N8OA 2IDEA 4Z7CA 3UN3A 1B7YB 4DV0J 2CVIA 2V5CA 5KFMA 2E8IA 2RUGA 4NXNT 2PA3A 3PX4A 1NDPA 3GIMA 4G6VB 4WIQA 2MLXA 3MUTP 2NZ4A 1ZHCA 3NGUA 2LT3A 2HNZB 2WVCA 2LSKA 3JSMB 3KLIA 5ETMA 1IBLT 2LSJA 4MJKA 1X0FA 3RKGA 4QWNB 3I9ZA 3V6JA 1RAFB 3CMAS 1WD6A 3LP2A 2J7WA 4N7TA 4X66J 1R31A 1D1AA 2YKPA 2NUUG 2VDHA 2XLJA 2LSYA 2NUHA 2MZQA 2B56A 5KFKA 1PAEX 5L38A 2NTXA 4CWBA 2GVZA 5F8GA 3S4UA 1NPPA 3SFGA 4CT9A 4J91A 1NZ8A 2R8IA 5FLXY 2GO8A 3M32A 3ETVA 1JMTA 2MY8A 2F4VF 1S76D 3CPZA 3E0ZA 4DSEA 1N5YB 4PQUB 1WYCA 2V7MA 2ZKUA 1P6TA 1U1PA 1AZSB 3MMBB 5ABHA 2IAJB 4JI8T 2PFDA 3PXGa 1DRZA 5ADZA 1HL6A 2AD9A 2ZM8A 3QZ8A 3BN7A 1FMWA 2D74B 4O3OA 1IBLF 1N5YA 1Q8BA 2VF3A 4USMA 3EZ5A 2BE9B 3I4PA 2CWKA 4G3IA 3EDVA 2KM8B 1I6JA 2W7AA 4K4VA 4TN7B 1U1LA 4DX7A 5L9NA 3K0JA 3G96A 3J81Y 1TKZB 5FXVA 3GZ7A 1CJTB 2AT1B 4OZ3A 3LK2B 4DPTA 4WYLA 1Z8UA 4O4RA 4QU6A 3I6PA 4ZXLA 2JWNA 2VU5A 3JSMA 4K2JA 3AJDA 3ZMSB 3D6TB 1LK7A 2MYFA 2WBMA 1SC3B 4DQPA 5CJ5A 2YKMA 4B3SJ 3M6UA 5D0EA 3MF5A 2OPPA 4RL1A 2GNKA 5C25B 2Q6CA 2IC6A 4RWWA 2J9EA 1FJGJ 4KHPT 1UFKA 4K2XA 1GQEA 4UF4A 5HANA 2X0YA 4ALZA 1RHRB 5AXNA 3C16A 5CFBA 2VL1A 1C4AA 1HQEA 3DRYA 3L7OA 4PWDA 4H4OB 4WFNQ 4Z90A 3DP7A 2OAUA 4LUBA 4JEHB 2Z30B 3VAKA 2PEHA 5BJRA 1SB6A 3HHLD 4EYIB 1KLMB 3QBCA 4N41A 4TNVA 4H9QC 3CULA 1HA1A 1IQZA 4C9DA 3LA0A 2Z2MA 5A8WA 2V5DA 4N8NA 2BR0A 4DL4A 5CZXA 1YRXA 2DNHA 4WXWA 2YX4A 2C28A 2ZUGA 1JLFB 2ASJA 2FIUA 4O4JE 4PXCA 4F4ZA 2G4BA 5ABFB 2E1MC 4QIWD 4ILRA 2NCKL 4A56A 1IKYA 4ISTA 4OX9T 2QMWA 2XZEA 2YK0A 2OEMA 1VYAA 1OEDE 2B5JA 2IIHA 2ZH8A 5CA0E 2FZCB 3OXGA 5DLGA 1KSPA 2YH0A 5HATA 2OI2A 4RNMA 2VG7A 4HDHA 1C4CA 5GONE 2B4UA 3N9NA 4B9LA 1WHVA 2VVNA 3DYAB 4NA2A 2AJQA 2R2SA 1QY7A 3DOKA 1YGYA 4P73A 5HEJA 5DJQC 3EJMA 2KKHA 1C0TB 4QQBA 2I5JB 2W0GA 3V6DB 3C14B 3MR7A 3RGIA 4TU7A 4MTPA 3GONA 2LU2A 5IT4A 1FO1A 1IXKA 2MLYA 2YNFA 4E98A 3GFYA 3RHWA 3ET6A 4YSYA 1R3NA 1U47A 1J5EF 3F57A 3KLHA 4A97A 5HAXA 4CCHA 2Y9HA 1VQOS 3JCFA 3GN5A 2HGNA 2MLZA 1Y3KA 3Q5DA 5F9LA 4EAHA 2QSFA 2DPIA 2XTJP 3EGNA 1FIOA 1TVRB 4HI1A 4P74A 5GMEA 3PU3A 1XTZA 2HS3A 2K3IA 4NXMF 4IG0A 4KH0B 3I55S 3EE3A 4DR5F 4B3RT 3RAQA 2X3DA 1QM9A 2DGOA 3TR5A 4JI6F 4TN2A 2KJWA 4I7FB 3IO1A 1HNWJ 1JXLA 1Z0PA 4LT6A 4O44A 3A3OB 2CNLB 1NWMX 3DLEA 3SCLE 3HLUA 1X4AA 3BBCA 4TVAB 3N6LA 4Q0BB 5LNKA 2V0NA 2XBPA 4B3MT 1GFWB 5HQ8A 1KWMA 3HKEE 1YJNS 2CMRA 1S9EA 3RF1A 3HHLC 2B6AA 2R3VA 3EM1A 1TTHB 4QCLA 2E9RX 3A8KA 5EGYA 4Y0FA 2AQ4A 3GSDA 2NTYA 2JFKA 2FJDB 2IM0A 3MEGA 3CDAA 3RQWA 1GMWA 3KJNB 4ECXA 4LF8F 1V3SA 3DLEB 3IS9B 4N56A 3VU7H 2ZDOA 1AZSA 3S6EA 4IDQA 3QK6A 2C42A 3PM9A 4CYUA 3M2RA 4X4RA 3MUVP 4LF7T 3CCRS 2FD2A 3ZT5A 3TA0A 1IBLJ 2JHEA 2F8EX 2HH7A 3SCJE 3QFHA 2YNIB 5KFXA 3CNQP 3B4DA 4G2AA 2MQQA 2VL0A 2JJ9A 4WYWA 1X60A 1DTQB 2YWEA 4ZCMA 4X62T 1U4QA 3KLGA 3ISZA 1SBRA 3QSYB 2VONA 1C0TA 2ZH4A 1RHQB 1JNRA 4FXDA 3ENQA 3ZTRA 3D1QA 3TX0A 1NJYA 1UPMB 1N56A 3VAGA 1DARA 4JI5J 4ADZA 1R27B 3PFOA 1V6HA 1Y5IB 1DJ0A 3TUJC 3JQKA 2JX2A 4DV4F 2MYSA 3ZYKA 3VALA 3E01A 1VBKA 2QEXS 3AEAA 4AQYF 3KDOA 3QIPA 2W2NP 3V5RA 3AE8A 2QVAA 4UVCB 1B0PA 1GTEA 4EEBA 3FFIB 4O0IA 3L7UA 2V26A 2DNRA 4R0JA 2FJBA 1KNZA 1W25A 3IBWA 2WW4A 4A8MP 1H2TZ 1S49A 5HN0A 4HWFA 4F3OA 2A18A 3V2UC 3O44A 3A13A 4P09A 1FKPB 1NAQA 4ZVQB 3VQSA 1L3UA 3HSGA 1FFGB 5F0WA 3FVYA 2UUBJ 4J9UE 1D9DA 4F25A 2C3OA 2E1CA 1YQ3A 1X4EA 1Y5LB 4DR6T 4M5MA 2F8MA 1MIYA 2RH3A 3QOFA 1HQEB 2LE8A 3LBXA 3J7YU 3RUBL 1DFDA 3AA7B 4EIWA 1HBUB 4YHHJ 1QUUA 1U0SA 3BREA 1M5HA 3AE6A 3TOQA 3JSBA 4IKAA 3AOAA 3RPUA 3NOCA 3BDPA 3QT8A 2OPPB 3OJSA 1VLYA 4O4HE 2GQQA 4USWA 1X4GA 1FKPA 3GQCA 1PYSB 4WP8A 2BVLA 3LO3A 1OEDC 1QDUB 3SFEA 4FYDA 2OPSB 3D0TA 5KDMC 3CC4S 1DAXA 4H9PC 4F04B 2UXDJ 4P2MA 3PUAA 2MTQA 4C8KA 3ZNJ1 1LRZA 1UL3A 3ZLIA 2HN1A 3IG1A 1QLBA 1OO0B 2HGLA 4NLGA 3GMIA 3EUNA 1ZH5A 1CJKB 5T7LB 2DNXA 2ASLA 2YKNA 2E9XD 2Y1JA 3FBLA 4LRDA 2MKKA 1RHMB 2QG9B 4OQJA 1TV6B 1MMNA 3EVYA 5KFQA 5JH7E 1IR0A 2ZOFA 3O5TB 1NRKA 1MW7A 5CYQA 4DUYJ 3RG6A 5C24A 3NAHA 4PK5A 4C2MA 1WDDA 3PO5A 3FRZA 4ZZCA 4FVMA 2AX1A 4X1KE 3PO4A 3ZMUB 4ASKA 3R7BB 3EWGA 4KGKA 1RT3B 3HD2A 1PJ6A 2IJNA 4DZ6A 3OTBA 1S4FA 4ZPVR 5J2TE 3K8WA 1FRIA 1PJ7A 2SXLA 5HXHA 1LW0B 3TJAA 2O67A 3I1AA 4DQRA 4DQIA 4EBEA 1VK8A 2N4CA 3NBPA 3M8ZA 3UCGA 1Y7PA 4LBIA 3DXBA 2HRUA 5A1LA 4EBCA 5L47A 4LRBA 2I0MA 2FJDA 2HPUA 3AVRA 4YTNA 2J9CA 3IA3A 4QPXA 2KDOA 2IAKA 4LF4F 3AA6B 1N5TA 2M6BA 2BJ8A 4PG5A 1JLQB 5A8KB 3KK1B 4UF0A 2B51A 4RX6A 2G0JA 1GXTA 1CG2A 1YW0A 2QO3A 2KLQA 2DHXA 1GX5A 4F2RA 5DZ7A 2UZAA 2IYIA 1SVDA 5C2CA 5EX3A 3LP2B 1KHWA 4GKJJ 4B3RJ 1XMOT 2XMVA 3KFWX 1EB0A 2DEIA 1B3TA 3JTOA 5AQLB 2VJVA 1HMVA 4DUZT 1U5PA 1MMLA 2I38A 1IJFB 4O44B 4DV6F 5C2GA 4BA9A 2RMLA 3B4MA 2RD5C 4U7IA 1ZOTA 3U02A 3ABVA 3RC3A 3U7JA 4DV3J 4JI3T 1GXLA 4E7ZA 2CXLA 4XO0A 2FVQA 1SHZC 5C42B 3DOLB 3D0IE 1D1UA 4P2SA 1WOPA 3RYCE 4ZHQE 3V6KA 4CQ1A 4RW4A 2WM9A 2VASA 4CTAB 2FVPA 2HLUA 3C4ZA 2FJEB 3NVOA 2GMLA 1U1MA 4ZPAA 1RBLA 3EI0A 5DABA 2B4VA 2HVIA 3HVRA 1JJ4A 4MK8A 3I9WA 4OZLA 2CA9A 1YKEB 3ZC4A 1WLXA 3U78A 2B9EA 1XR7A 1T9XA 1V3ZA 1NZAA 4ICLA 4QR2A 1U48A 4CLLA 4JOUA 7FDRA 8AT1B 3VGSA 3K59A 5HBMB 1R6YA 2LXIA 2CQ0A 2ZE2B 2XLKA 2OV9A 3N28A 1HNZJ 3N2GE 3ZZRA 2R7XA 1ZPWX 2F65A 1HLWA 3BGRA 3HHKA 3FZMB 3L4BC 1HTJF 3D54A 2HHHJ 4KO0A 4K4TA 1RAJA 3NS5A 4GVLA 2NYHA 3CC7S 4K4ZA 1RWWB 3KVAA 4YHJA 5FY7A 1VBXA 3QRQA 2LQBA 3A4TA 4OZNA 3HHNB 4U95A 4OI0A 7FD1A 3RW7A 1KKHA 5EDWA 4I2PB 3RYIE 5FMNA 2E5LJ 1SC6A 2GX8A 4DG1B 3GILA 3M6WA 2Y8WA 3KBTA 1N88A 1REVA 3PE0A 4JYAF 3T1AA 2XAQB 4L75A 5FD1A 4HTIA 4I64A 1HMVB 4R8UA 3K1SA 2V4RA 3SMZA 1IWAA 2VUGA 4B3OB 5KG3A 2UUBT 3EABA 2W25A 3UDCA 3MM7A 4L73A 2MZSA 4UQGA 4OLPA 3W15B 4RR5A 4ECVA 2ZBIA 1SUQA 4Z2XA 2WP9A 3DI6B 3TP2A 1KOOA 5HXRA 2V63A 4GKJF 4RU9A 5M2PA 2ZEJA 4UVAB 5E41A 3N9PA 1T3OA 1NK7A 1Q7YT 4EK2A 2XI2A 2OSQA 3M8RA 3R5AA 2MDAA 4JV2A 1IBKT 3X3UA 1N36F 4H9OC 4ZIVA 2ACYA 4YFUA 4YXDA 4QR1A 3UD4P 2JDJA 2BEFA 4Y2IA 1P8GA 3NS7B 4IE0A 2WS3A 3DHWC 4IE4A 2B7BB 3P50A 4USJC 4DCPB 2HHUA 5D3GB 1CJTA 3I82A 2VBWA 3NZPA 1ICEB 2EG1A 4KQZA 5CYMB 4QHOA 4QH1A 2YKSA 3KG4A 2F1FA 1TZ0A 3CCTA 3C50A 3ZTSA 1HBNA 1RTIB 4LMJA 2W4CA 2CQ3A 3KK1A 5MAOA 1R0AA 3I5AA 2AGPA 4NA3A 4YR0A 3LF0A 2KMFA 3UWTA 1SC1B 2LDYA 2V7LA 2EFOA 4X1IE 5CAAA 3UD5A 5DDQC 2X1BA 1J5OA 1H7XA 2H88A 1Q8LA 2OPRB 1WF2A 3SRZA 4LQ9A 3OTOJ 1NK0A 2A9UA 1SH2A 2XMAA 1VQ4S 2DISA 3P6YC 2ZMAA 1CC8A 1TKXB 1HI0P 3G2XA 4TU9A 3SDEB 1X8DA 4CN6A 1JKHA 1EETA 3KUEA 2D3OR 1SKWA 2H7VC 3NAIA 2CPFA 4RUBA 1T94A 5JDQA 1Q5YA 4DG1A 1DTTA 4UOHA 1XDOA 1M5VC 2VBXA 2VA2A 4JI1F 3VRBA 4P2XA 3BBBA 1S1TA 2NWBA 1T9UA 1A6LA 3C15A 3T5HA 4JBWF 3QT5A 4EXTA 3WC2A 4U74A 3ZO7A 4F4XA 4X4SA 4Z7YA 1RU2A 4YDDB 3K17A 2YNGA 1VIXA 1FI4A 2HPLA 3HX9A 1Y00A 1W7WA 1T9TA 2AJ1A 1TUWA 3M1VB 5L3GB 1WKLA 2VKOA 4P72A 1QAJA 2DGTA 5DM6Q 3D7SB 1YJRA 2YPYA 3WQPA 1X7VA 1CJVB 3NG8A 4RW6A 1KK7A 4TKTA 3RZAA 2XO6A 3GV5B 1FWKA 3OQ2A 3N9OA 2KRBA 2D0TA 2VFSA 3KXDA 4LRAA 2MAWA 1BY9A 4ICLB 1F3FA 2C2OB 2Q79A 3SQOP 2JEGA 4IQXA 4KRWA 3MJXA 4MHCA 5JMNA 3ZKRA 4DMZA 3B78A 2H5IB 2OA5A 2ROGA 3AEDA 2J76E 3DMJB 3DLLQ 3ZZTA 3ZN0B 1JNZB 4OX6A 4XK8C 1I1GA 2H5JB 2CG4A 3HA4A 3HHDA 3JTPA 4WU2A 1EZ3A 3NEKA 5AFUL 3N79A 3CJKB 2ZITA 2CPJA 1EQ0A 2JH3A 4KE5A 2R2RA 2HWTA 1ZA2B 1SCJB 5AQMB 1LWCA 1WOOA 1HNXJ 1SJFA 1IKWB 3TAMB 2H3RA 1KHVA 2CBJA 2X1FA 2HGMA 5BR8J 3GYXB 4GIWA 3C6UB 3D9BA 5ETQA 2XMKA 4ED8A 1R89A 1YQ4A 4U7CA 4MKAA 2ZZMA 3TW0A 3CX7B 1C1BB 1GT8A 1QSLA 1UEKA 2MZTA 4I0WA 2L9WA 4CZCA 1MWZA 4P71A 2BRLA 4DV0F 1X4FA 4DN9A 3H5UA 2H51B 2RPAA 4DPWA 3M05A 3Q89A 4MKVA 1U1QA 3NBXX 2E5GA 3LAKA 3QPIA 1D1CA 3GCXP 3FBBA 1HQUB 1RWVB 1P1TA 4WP9A 4DF4A 1NBEB 1UKUA 3C4XA 4F2SA 2JMHA 2J1DG 2GQ2A 4LF9T 5GADU 2V8VA 2RA1A 4JI0T 3MACA 1HARA 4XTTA 4CRJA 2CHOA 4Q45A 1WELA 2FLPA 1VC5A 1EX8A 3GJQB 2VPZB 4U33A 8ATCB 2D3ZA 3AXKA 4NX9A 6AT1B 1X4BA 1ZZFA 4FYYB 3CJTA 5H9EJ 2UXCJ 5IS2A 5C7PA 4FZVA 5B0CA 1UA0A 3PYEA 3FQLA 1OJ4A 4PJNA 2Y1IA 1VQNS 1RAGB 3TRGA 3R2CJ 5HI7A 2YKQA 2GJIA 1FCAA 1VK3A 4NI2B 2WQYA 1H73A 5KFGA 4M5KA 2A3JA 5J0ZA 2W24A 5KOXA 4LF6F 3EYZA 4I2QB 2MKSA 3KLIB 1OS5A 5HEGA 1KNRA 2VG5B 3QNUA 4J7CA 2W2UA 1FT8A 1X0PA 2WWUA 3QNWB 2ZD1B 4AIUA 5LMNJ 3CX8B 1JLCA 4UOGA 2NPIA 3B54A 4ECWA 5H6QB 1XDPA 5KG0A 3ZSSA 1U0HB 1L3KA 3T1YT 1OQ3A 2KN4A 1TK5A 3TJ8A 4NLTA 5KG2A 2P9BA 1AW0A 1VRUA 4TY8B 2XS7A 5LP6E 4KTQA 1HBOB 4ILCA 1RSCA 5HLFA 1VHFA 2VOOA 2IM2A 1GH8A 2LEBA 3QFWA 1N0VC 4V1Av 1G3OA 4USUA 3PJXA 2C2NA 1MU2A 4AI6A 2MY7A 3HCXA 3C6UA 5E0OA 2XYGB 2IMWP 3HKWA 3THVA 4YQWA 1H38A 3JSYA 3KINB 5CCMA 1TFYA 1Y3JA 1ULRA 3NGDA 4TV8E 4UR9A 2UUBF 1J5EJ 3R5DA 3QJJA 3ZTOA 4DQQA 4PFPA 1RT4A 2D2SA 1PCAA 3VR1A 3BO2A 1CC7A 1VQKS 4IG3B 3J7AN 1FA0A 2KU7A 3DYAA 2FJEA 4JI6T 2UUCF 1NK4A 2PE8A 4RNNA 1T03A 1G8XA 2N1GA 4TWHA 4NYPA 3C19A 3MCOA 1VQSA 5C5JA 1T95A 4WFXA 3MMCA 3OPKA 5JREA 1TL3A 4J5OA 2XM3A 4JB8B 2EG2A 4O3RA 3O6QA 2CXEA 2CDQA 1MMDA 5L46A 3PW0A 1XWLA 2Y8DA 1YJWS 2DNKA 1YIJS 1VC6A 3N5FA 4YR3A 2L8KA 4DL2A 1S1VB 3I87A 1HS7A 3M1VA 3W5YA 1VJWA 1U8WA 3BK9A 2M8HA 1CSJA 3DLKA 2ZHBA 2YNGB 2DNYA 1OSCA 4NLOA 4K4WA 2ZM2A 4LBHA 3R8YA 4IREA 1KQKA 5E3RA 5HVFA 4IDPA 4Y2CA 4I6WA 4UF0B 1IJEB 5ABFA 2DR9A 4RW4B 4U7UK 3MR3A 3HO1A 2XLIA 2QSWA 4FKYA 1T9WA 1JLCB 1X9WA 5CABA 1HBMA 4LFAJ 3OVAA 2UV8A 4ZITA 1RDRA 2B4PA 4LF5J 3HT3A 4X62F 2LU1A 5IWAT 3V81B 1KVKA 4ZPDA 2I1RA 3PTRB 1D0YA 3TVKA 2YKMB 5J2QA 2UVRA 1WRDA 2ZWPA 5HK4A 5AJ3F 1FTRA 4AKIA 3H7HB 2LRLA 4QXBB 2HZCA 1WF0A 2ZH7A 3K5MA 1E7PA 4ZK7M 1SL0A 5KFNA 3P96A 2W2QP 2RHSB 1Y64B 5THWA 2WVDA 1XZYA 2DLRA 1HIYA 2ZVSA 3PRDA 1HNXT 2FHJA 2HHXA 2CE7A 3D66A 3CXCR 1VQ6S 4B3MF 1BR0A 2G13A 4LSNA 2V2ZA 4XAKA 4P2FA 1NUEA 3PIOQ 2ADBA 3HZEA 5B0BA 2QA1A 3TQ1A 2E5IA 3AB4B 2J8AA 4DV6J 1F1BB 3MCMA 4DL7A 3IRXB 3W65A 3J7Z5 2IVFB 4DR6F 5KFBA 1YHQS 2XGPA 2CIMA 4NLWA 3JAMY 4W4MA 5CD4A 4IDNA 2CADA 4COFA 1FNOA 3HZGA 2CRLA 3NCPA 3OTDA 2WRMA 2F4VJ 3SXLA 1C1BA 3EGWB 3EDUA 2DBBA 4PWUA 2XYHB 2XQ9A 4DV2T 4X66F 1KQFB 5LJMA 3U1MA 3BO3A 4FJOA 2M2BA 2V7IA 4PXBA 3N9UC 3GV8B 2H5EA 2AYEA 3ZZPA 1CJUA 1KFYA 1ZM3A 2NW9A 5GADI 5GAEU 4JI3F 2JC1A 2L08A 5HJYA 2YXLA 3C3LA 4G1QA 3C14A 3VKGA 5E7OB 1R6VA 5BR8F 2KYXA 2PI5A 2VQEJ 3UCUP 4I1TA 5KFAA 4KFBA 3DOKB 1NSPA 2KYZA 1KQGB 2ACXA 3SI8A 2CNNB 1D0EA 1HNIB 3JAFA 2RAQA 4R5PB 2YEVC 4QH5A 2GQCA 1S4EA 2BE7D 2W2OP 4X65F 2PIIA 3RAMA 1VIOA 1RTDA 1KRPA 3JC6D 4USVA 2GMHA 3EDQB 2R8JA 1AA1B 4UUXA 2QRRA 1UVJA 4ZLPA 4JYAJ 3H5SA 2H54B 4TNWA 4AL5A 5B0GA 3KHRA 4P7TA 4DF8A 2RQ4A 3D68A 5HVHA 4MFRA 3MEEB 5I3QA 4K0KJ 5I42B 3MXHP 1JNZA 3E8OA 3E3XA 3ZCIA 3P5TL 2G1HA 1FX2A 2DL1A 3OTEA 1FERA 3IBCB 5DO2A 2B43A 2YQ0A 2PGCA 1T9VA 3H20A 1MSWD 2KZZA 3QIDA 4PYAA 4OI4A 2EFVA 5JVDE 2HBZB 2XI3A 4JLEA 3GYGA 1ZEEA 2CLYB 2KXFA 4RUHA 3ELHA 3H42A 4MFBB 3RYFE 3CO9A 4CM0A 2XQYA 3M30B 3U1LA 5GAHU 3PUYF 5ETPA 3S1TA 1Q95G 4DQSA 4ZIWA 3SBMA 3DLGA 1E2AA 2NSBA 2IDLA 4Q43A 4G65A 3Q8VA 3DOLA 5B09A 4ZHRA 3LWLA 4U3CA 2L3MA 5EK4A 3PEJA 2Y3YA 4Q5VA 3L95X 2CXDA 3ZJ2A 3JB9k 2JIWA 4JI2F 5AE1A 3R5JB 1UMJA 4JI6J 3AD8C 3MZKB 2G0CA 4ZN3A 2KO1A 2ZM6J 4ID5B 5D78A 5L3EB 1VQ8S 4KFBB 2CPDA 3C66A 4UZBA 3IEEA 3W5XA 2MKHA 4CLPA 4RZRA 3KG1A 3ZMZB 1TAQA 3KLGB 2V4JB 5DDPC 2M9KA 2JQKA 3H8YA 1XMQF 3RB0A 1N5VA 1Q79A 4N77A 3MPUB 3KLVA 1EKRA 3N5LA 1RB0A 2ACZA 2QLJB 4NLUA 3UN5A 2GFFA 1XNRF 3MFHA 4C11B 1FEHA 1IM6A 3SCIE 2UXBF 4ZI3C 2X1GA 1EP4B 2E9TA 3R27A 2HRTA 3U27A 4EBDA 3POTA 2AJ4A 1KVIA 2OPRA 4O4GB 1NAFA 1K8AT 2MTLA 3RBEA 2OLTA 3VZIA 1PBAA 3FMWA 4X4OA 1N32J 1BHNA 3M32B 4U7YA 4USHA 4HFBA 2XY6A 1WACA 2W63A 4AD6A 3POTB 3LPEA 1UEUA 3AJ2A 3GN5B 3GWHA 2FVCA 1NK6A 4C48A 3KV9A 1FX4A 1VQ7S 5KFUA 4NPPA 5J2QB 2NYIA 2XMJA 4LSLB 2DTJA 3K57A 2OTJS 1VISA 1MROB 5D4LA 1I5OB 3KNGA 4F8RA 3V5SA 4LJMA 3MECA 2OKQA 1UETA 3DLJA 2GGPB 2W9BB 1T11A 3BBFA 2VBYA 4EYUA 3NLCA 1IR2A 1JXVA 4BLGA 2XY5A 3H5XA 4DNDA 4FXWA 4DR3T 4M5JA 4WFBQ 1S9GB 1ZPVA 4ZN1A 4LBPA 1DLOA 3AJ1A 1UVNA 4OHWA 3G8SA 1S79A 3ILJA 4KC5A 3OJUA 3K5PA 1QUVA 4J9VA 1M5PC 4HHJA 4PJJA 2WVFA 1QSSA 3R97A 3K2YA 1AXQA 1LXNA 5DG7A 3N2KE 1CUNA 3RBDA 3ENAA 4DSJA 1SL1A 3ITHB 3CJKA 2O1PA 3H3MA 1BD6A 2VH7A 5KT2A 4DR6J 3RIUA 1TL1A 4CO3A 3OUYA 2VKJA 1BWEA 1WG1A 4LFCJ 4PQAA 2LKHA 1EHWA 2F7VA 1NJWA 2CJ9A 2NW7A 2IJFA 3BYPA 1VBZA 5LBQB 4KH1B 2EW9A 1U45A 3BKFA 1KLMA 3ZZZA 2R4FA 1RT5B 1ELOA 2A72A 1FD8A 2WK4A 3PUXF 3NWGA 4Y3CA 4WFAQ 5CZVA 1ZV4X 3N9LA 4AKHA 2XAJB 3ZT7A 1LV5A 1NU4A 2EFQA 3GPAA 5I42A 1TL7B 1QE1B 5F8HA 3CIRA 3OLAA 2HK2A 5KFSA 3PV0F 4M1KA 4UOCA 1RA7A 4DPXA 2Y48B 3UVJB 1WNEA 2IFXA 1B7TA 1U6ZA 3AEFA 1IKYB 2OEKA 2WSSV 4A48A 4CLUA 2XUEA 4FS1A 5GAGI 5H1SV 4ES2A 2VDIA 5HBMA 3MM8A 2CDRB 4JI4J 1MU2B 3L7PA 4LFCF 3QAEA 3W64A 2LSGA 3MECB 3BO4A 1BR2A 2FVSA 2FZGB 4ERRA 4DV1T 1HW9A 1TR0A 5RUBA 3T3FA 2E1AA 2BBEA 1AROP 3OFHA 3EX7B 1D3WA 3CJ0A 3M2UB 4RUCA 2OIHA 2K2PA 3HULA 3D6FB 3AE7A 5E3QA 4WBFA 3RQUA 5LB7B 1FDNA 4HT7A 3QB5A 4X66T 4KBMB 4FF2A 2KWIB 2CWYA 4BWMA 1QVFR 1X4DA 3NWRA 5JUMA 1NH8A 3D6MB 1O8BA 2HHPA 3N2OA 2DPJA 2HEKA 4IE6A 4ZP9A 4KHPJ 1U4BA 2XQ3A 4LF4J 2HSEB 5LSRA 2W7OA 2W1BA 4UZCA 2ERRA 3BDEA 4NL5A 1S6PB 1Q8KA 5KTQA 2FGCA 3WC0A 4GK0E 2UXBJ 4J9KA 2WMOA 2LQJA 3PX6A 3MEDA 4CZZB 2LFVA 2PA8D 2QX0A 2K1RB 2EHOD 3FSXA 1ZS6A 2XGQA 4X64F 1M5KC 1F9FA 2QL5B 3GJSB 3AT1B 4DL3A 1HNVA 3HSZA 1R0CB 1EKSA 2MZRA 2LSIA 3R5BA 1HBNB 2BV3A 2MGZB 1I94T 1VI7A 2QFIA 1KD1T 2JOQA 1XERA 1AUDA 2MQNA 2APOA 1BXNA 3I4HX 2XZWA 3BQ1A 1T9YA 2H48B 5A2QY 1SQGA 3BN4A 4J9MA 2VK9A 3NGKA 3EUHA 3ZN1B 4DV1F 4P10A 2PMHA 3IWNC 4ZJLA 2ILZA 2GIQA 3AD9C 1CQMA 3GV7B 4O23A 1BUXA 4OJHA 2EPIA 4NYZA 3LP1A 5HEHA 3CWJA 2V34A 3AE4A 5LG3A 4HWCA 1LKZA 4V19J 2Z57B 5J2MA 4ZHRB 1YLXA 2ZH3A 4KKOB 2J0SD 1BQXA 2FJAA 2LQ8A 2QTWA 3DRSA 1HG5A 5CH7B 2JEJA 2PEBA 3ZZOA 2WBRA 1IKXA 4DR4F 4USIA 4PR6A 2YWGA 3LWMA 4Z8XA 5HWYA 3SS1A 2KL8A 3ESLA 4B9SA 4DUTA 2AMCB 4NLPA 1F2GA 2F8HA 1U2RA 3P49B 2NLWA 1NJXA 1M1GA 2HK3A 2FTRA 2WB5A 1OYEA 3PEHA 1TUVA 4CNZA 1IKVA 5KG1A 1S48A 1KVJA 1SKUB 3BEGB 1XMOJ 2AEJA 4HACB 4B17A 5K5MA 2H9ZA 1ZA1B 5KT6A 4I56A 9RUBA 2OMOA 3M30A 1JLGA 2P6TA 3D3BJ 3L8RA 1X79A 2XAGB 2YNFB 2OUGA 1D8YA 3CVRA 1WC3A 2BJDA 1HNZT 3VR8A 1OSDA 1RTDB 4ZS2A 1U8SA 5J1EB 4ZI2D 1K73T 5G4DA 4Y28C 4WTOB 2CEAA 1VJQA 1ZM9A 4EZ9A 4AT1B 2R7RA 4W92B 4GYRA 4I69A 4LF9F 3NXZA 5B08A 1KC8T 3ZC0A 5ADXL 3C51A 3OJAA 2XULA 3M8YA 5BYRA 1F5BA 2BBJA 3PYGA 3OHAA 4K0KF 1E6VA 3DRPB 3ILLA 2DNZA 3CSKA 2ATLA 5JRCA 3FZ2A 1HBUA 1X4HA 3EVMA 4UELA 2JLEA 3B57A 1WUUA 2BRKA 3QO9B 1JLFA 3G6YA 1HNIA 1PC4A 4FF1A 1FD2A 5KOWA 1RAIB 1SJ3P 5BXIA 2K5BB 2IHR1 2KTQA 2O01C 5F8MA 3OSPA 1BR4A 3HL6A 1V5IB 4J9SA 3VGTA 1NKBA 4ZJQA 1VMBA 3Q2MA 1Y9OA 1Q8IA 3RIFA 3MI7X 3OR2A 3KV5A 1FMVA 4LFCT 3E22E 4WK3A 4DV7T 4IGUA 1S99A 3IM8A 1KTVA 4OYAA 1LW2A 3V5UA 4ANDA 4PG8A 4WXOA 2EFNA 4XDCA 2V6YA 3OR1B 3PJAA 4EU0A 3K8PC 3DXSX 2DNNA 2LVWA 1I6ZA 3NGSA 2E5LT 2BJ3A 1TK8A 1QAYA 4DR2T 2VKHA 2E44A 4C8OA 5DQIA 4F7VA 1UVMA 4RW8A 1YI2S 3W2VB 2DNGA 4O8SA 3LALA 1NEKA 1CEZA 1R8BA 4ZP7A 3CPWR 2M4MA 1NSQA 1CHUA 5L4EA 4QZVB 2Z2YB 3QUJA 1S1TB 2KI2A 1KNPA 2AZ1A 1R8CA 3NMAA 4YMEA 2PFFB 5D4OA 4X1YE 1JQGA 2O66A 4JV5F 1L3TA 2AJFE 2A2CA 5HEOA 2IRXA 4M5NA 4H63H 2HVZA 5DQGA 5FXXA 4EEDA 3WAKA 1J1JA 1QSDA 2PTFA 1JLEA 4PG7A 2OTLS 3AQOA 5F0UA 4AQFC 3ISND 4NE9C 4HLBA 4A8FA 2FB0A 4WZQA 2J7UA 4DWIA 1IUJA 3KHHA 1VCTA 4NLYA 1TVRA 1ZAWA 5ETRA 2HFZA 2FUPA 3FZKB 2X0HA 3MM9B 4ZPCA 2QIFA 1KN6A 2KNDA 3NRBA 3DCAA 4CP5A 2BVZA 4P7VA 5HWXA 5KFJA 4QH4A
chains in the Genus database with same CATH topology
4XPEA 3G9CA 2FC8A 5M2UA 1F60B 5L2LA 4RBVA 5EDWA 3PIPQ 4HH0A 4I2PB 4H9NC 2DHAA 4IQMA 1FEEA 1XR5A 5FNVE 1RT2B 3RYIE 5FMNA 3H40A 4GO5X 3Q9DA 1C1CA 4IYQA 1FRKA 4YB6A 4YHHF 4GK5E 2C3UA 1SC6A 4ZCLA 3N0VA 4Q8FA 2HW3A 2GX8A 1ZBTA 3B8HA 3PFEA 2L9DA 1N5SA 4J9LA 3TVZA 3V4IA 4DG1B 3GILA 3KK3B 2IC9A 1VRTA 5DG8A 3M6WA 2OFGX 3QWPA 2FJVA 2Q43A 3KBTA 1N88A 3G8QA 1REVA 3TKLB 3THTA 3PHEA 2WW8A 1D1BA 3PE0A 4JYAF 2I9SA 2DGXA 3MM8B 3PRBA 4X84A 4OHZA 3T1AA 5EK2A 2VBZA 2XAQB 3CCWA 3TUZC 3CB4A 2XB2D 1YQHA 2RKIA 4X2BA 5FD1A