1KNZA

Recognition of the rotavirus mrna 3' consensus by an asymmetric nsp3 homodimer
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
157
structure length
154
Chain Sequence
TQQMAVSIINSSFEAAVVAATSALENMGIEYDYQDIYSRVKNKFDFVMDDSGVKNNPIGKAITIDQALNNKFGSAIRNRNWLADTSRPAKLDEDVNKLRMMLGIDQKMRVLNACFSVKRIPGKSSSIIKCTKLMRDKLERGEVEVDDSFVDEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*UP*GP*AP*CP*C)-3'
publication title Recognition of the rotavirus mRNA 3' consensus by an asymmetric NSP3 homodimer.
pubmed doi rcsb
source organism Simian rotavirus a/sa11
molecule tags Viral protein/rna
total genus 52
structure length 154
sequence length 157
chains with identical sequence B, C, D, I, J, M, N
ec nomenclature
pdb deposition date 2001-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.550 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1knzA01
3.30.70.1610 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1knzA02
1KNZA
chains in the Genus database with same CATH superfamily
4CN4A 2ZWPA 3LOUA 2UUBT 4J9LA 4ELTA 1DTQA 4UY85 2DGVA 3HR0A 3MR6A 1TELA 4LUBA 1FXLA 4ZN3A 3T9NA 1FFGB 3DRSB 3PO5A 1TK0A 2IMOA 3RU0A 2B6AA 3ZNUA 3KLIB 3K7RA 1F2HA 2C1EB 3E01A 3WIUA 5DDPC 3KMQA 3FBEA 5IV3A 4P0AA 5KT3A 3NAHA 1XNQT 3CCWA 4FS2A 1FFSB 4DV6T 4P74A 1ZOTA 4WFBQ 5KFYA 3NVOA 3AJ2A 4NYOA 2XZWA 1PSDA 2IUBA 3N9OA 2E5HA 5FXWA 3MEKA 3SSRA 2IVFB 5EUHA 3JS9A 4NLWA 4Z37A 3PX6A 3T5LA 5L9XA 3VGTA 1WF0A 3Q2TC 1SI9A 1AZSA 2QYCA 2WAQD 2B76A 4CO5A 4XDCA 3GIJA 5JRCA 3CB4A 5CA5A 2YNHB 3Q83A 3Q89A 2H51B 3M6VA 3OVBA 1BQNA 3PJAJ 3G9CA 2ZJPQ 2WWUA 3C4XA 1HNWT 4KT0C 2KINB 2NPIA 4DSFA 1R31A 2OMLA 4WBFA 2I8EA 4AUKA 2OUGA 2C2EA 1TMJA 3MR2A 3SS1A 1TZ0A 2A72A 3HPOA 3KK1B 3BQ1A 3OQ2A 5I42B 3CJSA 4I2QB 3K3QC 1TQLA 1KONA 4DV3T 5JVHQ 1VBYA 2VWAA 2LJLA 4DSIA 3M8QA 3CJ0A 3DGPA 1BUXA 4J90A 5CGMA 4QPTA 5KOWA 2QGSA 3UW1A 4FF4A 2VB6A 3K0JA 4UF0A 4U7IA 2BW7A 4AL7A 1S7HA 2IC3B 4F4ZA 3JAEA 2CG8A 2K7JA 2Y3YA 2J4GA 1KF6A 4OI3A 3RC3A 4MKAA 1UEVA 2JLFA 1SQFA 4KRWA 3CQXC 3M8ZA 1G4CA 3MM9A 3CWZB 4W98A 3W61A 5AQNB 2XEXA 2AT1B 3HD1A 2IM3A 2QEXS 2OPRB 1ACMB 4DCOB 2ZH7A 4GVBB 2CJBA 2UXBT 4EWTA 1WC1A 4CNYA 4EZ9A 1HBNB 1KDNA 3ZZTA 1VQPS 3Q8VA 3DTOA 3MR7A 4YR2A 3SFDA 3IFEA 1S6PA 1MWQA 4F02A 4H4OA 4L3NA 5LXRA 3CCRS 3GYXB 2KXPB 2FBWA 3BREA 5SUHA 4HVZA 3U3IA 1U47A 4KSEB 4LF8J 2XTJP 3LK42 5FIIA 4UV8B 4LF6J 1XNQF 1OPZA 2WQYA 1JLBA 4DV6F 2DY9A 4CLPA 3TARA 4MFBA 1FKPB 4ECWA 4Z91A 2EG2A 1HI8A 2F1FA 4DPTA 3AA7B 2ZBRA 1N88A 5HXSA 3M8RA 4DU7A 2J7WA 5ABFA 4CLYA 2FJVA 2ZZTA 2E44A 2ZH8A 4PG8A 2HIYA 4F26A 4IFVB 4KHPT 4WCEQ 4NLGA 4TNWA 5DLGA 2VL0A 1GT8A 1SKUB 2J8AA 1SIZA 1RTHB 4N56A 2YINA 1Y10A 1MN7A 4Q45A 4JV2A 4HHJA 3KDNA 1D0EA 1B7FA 1CJTA 4JI5T 1HNWF 4CWBA 4OLPA 5A1LA 3EE3A 3VHQA 3EDRB 2FB0A 3J81Y 3RB3A 3R6NA 2CPYA 3B5MA 3ETUA 2QG9B 2ZM6J 4HHHA 4HT7A 2OSRA 3CJRA 2OMOA 3N6LA 4RW7B 2ZEJA 1SE7A 2IRYA 2NCKL 4NLVA 4IG3A 5ABGA 4LSLA 4ZPCA 3ZFVA 3LA0A 2VQFT 1CUNA 4JI8J 1U6BA 4IDKB 2HN2A 3MPWA 5L46A 3MUVP 1PJ7A 2ZD1A 2MZJA 4DFMA 4IIJE 1FNMA 2I6WA 3RW6A 3HXMA 4QXBB 2KU7A 1KC8T 1B4SA 1O51A 5CXTA 2J6UA 4NYPA 3AAIA 3AEAA 2KB2A 1WTBA 1MIWA 5HCMA 4DR5T 3AE7A 3M05A 2E5VA 1HYSB 4FKYA 2GQQA 4B3TT 5CH7B 4I1TA 1S0OA 1W0BA 1JNZB 3Q0AA 2DR9A 4ZZCA 1R8CA 2XS5A 2M88A 3GQCA 3CMAS 2DNMA 2XYPB 4DPWA 3ZYMA 4FP9A 2ABYA 3QSIA 1T0TV 3MR5A 2QL5B 2LOSA 4F0HA 3OD2A 4HHUA 3J7ZT 3D9BA 2UXBF 4HFDA 3TAMA 1YW0A 2CDRB 1XMOJ 1T7PA 4HLBA 3LG7A 4MYTA 3ZT6A 1RT7B 2K24A 2HAIA 3M1VB 5AQKB 2MTQA 1U09A 5THWA 2HGMA 5JMNA 4PQAA 4RKUC 2BE2B 9RUBA 4QKNA 3PDNA 3HI9A 1RAJA 2A6OA 4PWUA 4OYAA 1QSYA 2IIUA 2F4VJ 2CPEA 3RIFA 3NL0A 4I56A 2WS3A 4UR9A 3ANWA 1RT2A 1ZZNA 3ZPOA 2GVDB 5A8KB 4ZIWA 2PE8A 3MCMA 2IIHA 3VRAA 5GADI 3M2VB 4KH1B 3VALA 1YITS 1VQYA 3T1HT 2MZQA 1YQ3A 3AVSA 5DABA 3BZQA 5C25A 2G2YA 4N78D 5HI7A 3P6YC 1RISA 4RUAA 1I94F 3GJQB 2RMLA 1V9OA 2V6XA 1CC7A 4JEUB 2RQMA 4KHPF 3GSDA 3OJUA 3MMBA 4PWDB 2AYBA 5A2QY 2R8IA 1N5SA 2CXEA 3B4DA 4LF7F 4NA2A 2RE1A 3N9UC 3MKDA 2KXFA 2OPQB 4E7ZA 1FVQA 3M7VA 1KLMB 1N5TA 2HVHA 2OPPA 3VQTA 3Q24A 4JI5F 1D3WA 1WG5A 3V2UC 4USMA 1D0YA 4IG0A 4CNZA 2AZ3A 3UNGC 5ADXL 3QOFA 4IRKA 2FJBA 2GS8A 3MEDB 4ECZA 4OX6A 1LVKA 2NREA 1VLYA 1WF2A 3Q5WA 4EGWA 4F3QA 2HAFA 2VQFF 1NHKL 3W66A 3NGRA 2YU2A 2MQ8A 2LE8A 1WRDA 4U2ZA 3RX6A 2E9TA 4USJC 4GKKF 1XR7A 1KFYA 1GH8A 1MIVA 2AJ2A 4CLTA 1NWMX 2POKA 3QNWB 2XASB 3QFHA 3CE8A 1BQMB 4ZHQE 3IBCB 3V4MA 2FPHX 2CA5A 2OAUA 2GNKA 4AFFA 1S9GB 2C3PA 5A0YB 3O2IA 2H65B 2YKOA 4DR5F 2XULA 4NASA 4DPUA 4A8QA 1ZBTA 4IUFA 1Q95G 2LXUA 7AT1B 2M5YA 5DG7A 1OIAA 2YOEA 4B3TF 1QAYA 3PYGA 3F57A 2YNGA 2J5AA 2X3DA 2V68A 3EXYA 3LBXA 1RE1B 3CDAA 2OPSA 2Q6BA 3LAMA 4TN2A 4QX8B 2DL1A 4D3HA 4LR8A 2KXHA 4KGKA 4QYZJ 4BDPA 3GMGA 2VPXB 3AOCA 1U1RA 2HFVA 4IL9A 3BKUA 3BPSP 4EUVA 4DL7A 3ZNJ1 2N1GA 2FC8A 3CDEA 4KBMB 1TAQA 3ZZPA 1VDHA 3EDVA 1ZPWX 2Y0SD 4C3MA 3A8JA 4X4NA 2VFTA 5KTQA 4QHOA 2WK4A 1HWJA 1QTNB 3TLSA 1I51B 1OY9A 4FNIA 1S57A 3L9ZA 3UU4A 5U47A 4LQ9A 2EFPA 4QWEA 1UP1A 1S94A 1L3SA 2QA1A 4RW8B 2XZTB 1Y7PA 2KN4A 2LRKA 4CZCA 5K9FA 2QMXA 4WF9Q 3E22E 3CIMA 4O4HE 1DHMA 4EBEA 2LP4A 4G1PA 5I3UB 4CLFA 4OX7A 1JLGB 2H1YA 4QIGA 2VONA 2LDYA 3DP7A 1HBUA 4B9MA 3UCGA 5GAHI 1REVB 3D28A 1DQAA 1NK0A 5FDLA 3SWHA 3SCIE 2OJ3A 4ETZA 1R8BA 4M5GA 4YDDB 4R0EA 2QFIA 4ID5B 2YWEA 2XQCA 4UELA 4LRBA 3QMQA 2R3VA 2BBJA 4EU0A 3MM8A 2ZBQA 3G82A 2KO1A 3FSXA 2CDQA 4TLRA 3CJKB 1L3UA 3FRZA 4PPDA 1PG5B 1N6QB 3FHNA 3GIMA 3H2VE 3Q2MA 3U78A 4GK0E 1U48A 3GV8B 4F2RA 1ITPA 4ES3A 3LPYA 2ZH3A 3WQPA 4USVA 2R7VA 3CX7B 3A3OB 3HVTA 2RT3A 3SMZA 2JIWA 3CD7A 1CQNA 3PACA 4OHWA 3IF8B 4NLPA 3RAMA 3RQUA 2BW2A 2W4CA 5D0RA 1GMUA 4TYAA 2NSBA 1I3OB 1URNA 4B3OA 2HNDB 1VK8A 2WSCC 4WBNE 3JC6C 2HYIB 2WBMA 2VA2A 1LFPA 1ZKEA 3A12A 1X9MA 4IDNA 1QSDA 2WDQA 3UFGA 3NGTA 3W8PA 2HRYA 2LQ5A 3O44A 4Z8XA 3S1TA 5G0RB 4WJBA 4NL5A 2EHOA 4EB6E 3P5BP 1UWAA 3DLEB 3KBTA 4DJBA 4YHHJ 5ETRA 2J47A 5AXNA 1WEZA 2APOA 4NUVA 4ECRA 4J9VA 4Z2XA 4EYYR 4KHRA 1UX5A 5K8PA 4BWJA 1UGOA 4F6RC 3M9MB 2V6YB 2D3OR 2CNKB 2HHHJ 2C5JA 1RT3B 3FB2A 4O3PA 5K8OA 2Y1RI 1MNEA 5GAGU 3AJDA 3UCZP 2AJQA 4RW6A 5FVKA 2E5IA 2A6MA 1IJEB 4NXNJ 4K4SA 2WM9A 3JSMB 5C2GA 2HFNA 3DLKA 3AE8A 4RNFA 2FZGB 1TL3B 2W2OP 1F9HA 1U8SA 4KP3C 3QT8A 1Y5NB 1HNZF 2JDJA 4PW8A 3DOLB 1UZHA 2DNLA 3KV5A 2LVWA 4W92B 2DRBA 2WDRA 1T95A 2BXJA 1VQLS 3UDEA 2CJ9A 5LB7B 1TV6B 1V6HA 4KGZB 4NXMT 5KG2A 4WFAQ 2ZNYA 5DZ7A 5AQUB 1LXNA 2ADCA 3H42A 2FLLA 4Y34A 4GYRA 2M4MA 1S59A 3AAAB 3HKZD 3PR5B 2OD4A 2ZJRQ 3PUZF 5H6QB 3O5TB 2YNIB 4FYYB 3EWGA 2AJ1A 2ZLYA 3GTYX 1XIQA 2GAGC 1KS2A 1IKWB 1NSKL 3LWMA 4WZXA 2YH1A 1J5EF 1X5PA 2L9QA 2LSJA 2UVRA 4QIWD 1Q82T 3CCMS 1T02A 4KI0F 2E7WA 1Y01A 4OZLA 3AB3B 3IR6B 1X4AA 3C6UA 2VICA 2BRKA 1X7VA 2DH8A 4X65T 1M1HA 1TUGB 3WHIA 1FCAA 4C7QA 4C0BA 2X1AA 3MM6B 4PG7A 5J2QA 4DG1B 1SUQA 2UUCT 3K3OA 4K8RA 2LEBA 2DXFA 4NLXA 4I50E 2RHQB 5B08A 1NO8A 1JQGA 5DQHA 2OHDA 4ERRA 2MPKA 1YG0A 3FEYB 5AFUL 2MSSA 3P3DA 1CC8A 2K48A 1UWBB 3KHGA 1PBAA 4QPXA 1HR0T 3M32B 4DV4F 4B3RJ 3TEHB 1RQ0A 4ES2A 3VAMA 2G9OA 1XDOA 5FL0A 3CD6S 2Q9QA 4PJJA 3OL8A 5BR8F 3ZN0B 2AV5A 4DL3A 4ETXA 3ZJ1A 2LSKA 2DGWA 3EZ5A 1KVIA 2X51A 1PJ5A 4ZCLA 4NI2A 3GB0A 5KFWA 9ATCB 1YQ4A 5HWYA 4YSZA 1OEDA 3WAJA 1X4FA 4CQ1A 2WU5A 1MROB 1FK9A 4HTJA 2CHNA 4MK8A 3TUZC 3AEDA 3RYLA 2Z58B 2NXEA 4BAYB 2CPXA 4CYUB 2LHRA 1UVJA 4TX5A 3JYTA 2ALYB 2W9BB 2R7SA 4TV9E 2XY5A 1H38A 2I9SA 3QWUA 4PG4A 2JQQA 4C48A 1D09B 2LRLA 4FXVA 1OO0B 2HWIA 4K5SA 2OGUA 4B3MT 1NCLA 1UZDA 3D0IE 4LFBT 3LPEA 3FZBA 1Z0PA 2BYCA 3ZTSA 1N36F 2IMLA 5LMUF 5D6GA 1RACB 1C1BA 1VBKA 2MAWA 1RZMA 4HDHA 3NLCA 1V5VA 2JX2A 3PUAA 4TYBA 3BDPA 4TU8A 5IXUA 3FZHB 2B9XA 3LP1B 3BS9A 4CM2A 3Q23A 4EGLA 3QZ8A 2Z2YB 5KFZA 1S9FA 1N5YB 1ZP0A 4ECXA 5BXIA 2VL1A 1R0BG 2PGCA 1Y4ZB 5JDQA 4ZITA 2LMIA 1BMQB 3ZT7A 1S9EA 2EEYA 3AE1A 1RBOB 4A46A 1RWXB 2N4DA 3PG9A 1VQ7S 4I2PA 3T3FA 4RUBA 3HKEE 2OTJS 3AODA 1VQ8S 4P2SA 5L3DB 3DHWC 3G87A 1UUSA 5HP1A 4S0MA 5LMNJ 2E9XD 2BOAA 1QAIA 3EICA 1UA1A 1MWYA 2GO9A 2GZOA 1HHQA 3BSOA 3IXQA 3CCZA 4DMWA 4I0UA 5JDHA 4J9KA 1SC3B 3G86A 1LKZA 2J7KA 2YWGA 2CBIA 1WKLA 2P9BA 3NZQA 3ZZOA 2XZDB 1RT4A 4NLOA 2XWYA 2H3RA 5B0CA 4OHYA 1HNIB 1XWLA 5HQ8A 3Q8QB 3KYLA 3AB2B 2WDVA 2QRXA 3DNCA 1N0UA 1IBKJ 2GW8A 2E7VA 3R84B 1HQUA 1E6VA 3IA0A 3HKDE 4JV5T 4KGXB 1GFWB 3AVRA 5GMEA 2DR6A 3KFWX 2NXUA 5LJ5Y 1WC0A 5IZHA 2BV3A 4PABA 3N6NA 1Q53A 3POTB 2ZUGA 3MM7A 3CD0A 3HDSA 4I0WA 3US5A 4DSLA 2BJEA 4EBCA 1HI1A 2E9XB 3W2VA 2MKKA 2EW9A 2GX8A 3MTKA 3SEOA 3UU8A 1I5OB 1TAUA 3I4PA 3LTOA 1RTJB 5E7OB 2OIHA 3OR1B 4CT8A 1RADB 4RW9B 5HLFA 4R5PA 3N2KE 4ED3A 4ZVPB 2IA0A 3QGHA 2CPFA 3ZTOA 2ZOMA 1B0VA 5KFRA 4X64J 5F3TA 2Y9HA 2RQKA 4YUDA 2PIIA 3C66A 4ZPAA 2RVJA 4Q44A 2E8IA 2YKAA 3V6JA 2OEKA 2KWHA 4LRDA 5AQSB 4LR7A 2RU3A 1Q78A 3S4UA 4B3MF 2CLYB 2H4YB 3BO4A 1BR0A 2HVEA 1WC6A 4AI6A 4LFBF 2DI4A 3NMRA 3A4TA 2QC3A 2YX4A 3K3NA 5C5JA 4TN7B 5M4YA 1JJHA 3CCQS 4ILAA 4NWBA 3K89A 4DX7A 4H9NC 3KK3B 3OHAA 3H7HB 1TVRB 4PFPA 1N34T 3ZTQA 3D1HA 4OHXA 4KIAA 4O0IA 5LJMA 4DUYT 4TQSA 2UU9J 3NWGA 4NE9C 1HX1B 4N76A 3NAIA 4K4ZA 2D41A 2RNEA 5AE2A 4O3SA 2DGUA 3GIIA 1C2PA 4LRAA 4ED6A 3DKDA 3KUGA 1VQ9S 1R0AB 4GK5E 3ZC0A 1FF2A 3A3NB 2DXDA 3HHLA 3D2WA 3P8BB 3GJTB 2MZSA 1WWHA 1DTQB 1UJ6A 2ZVIA 1LWEA 3C46A 5LBQB 2EKYA 2D9OA 3L7OA 2KLQA 4UV9B 1IBLF 4FYXB 2IRUA 2VVSA 2VZ9A 3D7SB 3CX6B 1NSAA 1F60B 3OLBA 4LF1A 2ZH2A 5BJRA 2GJFA 3VAIA 3W5ZA 4OJHA 1FVSA 3E01B 3AA9A 1S72S 1JB0C 4YMEA 2I1RA 4MYUA 3AA8A 3ZSTA 2WHOA 3HHDA 3CWJA 4NMXA 2XY6A 4JB8B 4UF4A 2JQ9A 3J7Yq 4JV5F 4F50A 4ECYA 4V19J 4WTOB 2A18A 3QJPA 2KRBA 1N52B 3VV2B 3BR8A 3U1LA 3NNCA 2FVCA 4B6XA 1KQGB 2BG9E 2I59A 1YRUA 4YY3J 4USWA 1YDLA 3P96A 2FY1A 3CJ8A 3VAFA 4FZVA 1K44A 5JH7E 2AEFA 5HEOA 1HTJF 4A5XA 2JLGA 4Q8FA 4DR3J 4A8YA 3ZCIA 1PAEX 1Y0HA 2HLTA 5JRCB 1XNQJ 3IM9A 5J1EB 1BQNB 4NLDA 5AXKA 4UVAB 2D74B 1APSA 3M30A 2FJAA 3D66A 1W9RA 3FCVA 1OPIA 1G3OA 1SJ4P 2GO8A 2VBYA 2AHOB 3DN9A 3OW2R 3DI6A 1UX4A 2K9AA 3QK6A 3SV4A 3NG8A 3HK2A 4RU9A 1FI4A 5F41A 1NAQA 1F6TA 4DR6F 2RDIA 2KSRA 4USKA 3H59A 1UAWA 4TUYE 2KFNA 2XQ6A 2QFJA 1YJNS 3NKZA 1HWLA 4R25A 3EDUA 4H4MA 1RA6A 3DGPB 3MTJA 4N77A 2XYGB 1N34F 1U1OA 4DSKA 3L3CA 3PCOB 4DR1J 1DQ8A 3ET6A 2UVWA 3AQOA 4C4WA 5LJ3Y 5SZTA 1FDBA 3IAS9 4QXCB 3KKFA 3LJCA 2W66A 3R5AA 2CG4A 2B43A 4DV5J 5KFPA 2ATLA 2CWXA 3M8PA 2UUTA 4X62J 3JXOA 4O3OA 2M8DB 3D6TB 2RD5C 4ILCA 2PSZA 2X1BA 4C3LA 2M70A 2YK0A 4AQFA 2CNNB 8ATCB 2J7UA 4YTMA 2B3TB 2NOXA 4U8VA 3ZMTB 1IKYB 1IBCB 4EIWA 3UCUP 1S6PB 4RX6A 4H4OB 3R2CJ 4B9VA 4OYOA 4I43B 1QUVA 2F65A 1UVIA 3PDYA 4IE7A 3LGNA 1TL1A 2DB1A 3CJ3A 3H98A 4DCPB 2H7OA 3H3MA 5LJNA 1NJYA 1Y5LB 2QT7A 2PA3A 4LF8T 4MIWA 2RRAA 1P6TA 2V7IA 2XM3A 2LDIA 2IW5B 4A48A 2ACXA 4LF6T 1QM9A 2W00A 4IFYA 5ABFB 4CI3B 1U1NA 5EK2A 4ECUA 5KMGP 4G1QA 5CYJA 2ZJQQ 1H73A 2QL9B 1R0CB 3PRDA 3SBMA 5D4LA 2BBEA 4U95A 1XR6A 2ZDPA 3AAWB 4HKQA 5ETLA 4PG5A 2K3WA 1D0ZA 3KLFA 1VQNS 3F41A 1CJTB 5D8HB 1F5BA 4H9RC 4LFAJ 3MUTP 2PFDA 2J62A 1CJVA 1U2RA 2CQ1A 2H9ZA 3M6WA 5E3RA 2BG9A 2DEIA 3VVTA 3BGUA 3ZZYA 1VFJA 1Q1KA 5IT9U 1GXUA 4C9DA 3W1YC 4O0NA 4DR4F 1I94J 3E51A 4DUZF 4ED2A 2ZDOA 4MMOA 4DL6A 1NKBA 5EWGA 4LMZA 1G7CB 1NNDA 5H9EJ 4IG3B 2KT3A 4LSLB 3RRCA 4KHPJ 1ZM2A 3JSRA 3PVXA 4UZBA 3PJXA 4LF7J 2KH9A 2LSIA 2ZM6T 4ZP9A 4J9QA 1Q8KA 1UEKA 1FMVA 3SFUA 4ICLB 3IR5B 5IC6B 4O23A 3OYXA 4M1PA 3WAKA 5J2UE 4CI0B 1HHSA 1URRA 4IQMA 4JI8T 3G6VA 5LA6E 3ISZA 4OYPA 2MGZA 1VS3A 4AKIA 3RQWA 2B9EA 2L9WA 3SCKE 2R8JA 4DI6A 2Y6XA 3MZIA 4PPZA 3SQOP 1SPBP 2AJ4A 1D1UA 2VQFJ 3F56A 1FKAF 3DXBA 3VVUA 2AD9A 2J0QD 3NCRA 2LLYA 3PUGA 3VZHA 4GKKJ 3HP6A 3FKBA 3M2RA 4UQTA 1JXEA 1IR0A 5HVFA 1U4QA 1LNQA 3J7AN 4RZRA 4N8OA 1JLAA 2DNOA 3TAMB 3ISND 2QIFA 1PO6A 1QDUB 2KHCA 1T9XA 4EEDA 1N5QA 3H37A 2MKHA 3AXJA 3ZYLA 4USTA 3CIZA 4DR5J 3NS5A 2VG6B 5J2PA 4RJVA 2HNYA 3IWXA 4FKXA 3CD5A 5KFUA 4FF3A 4O3NA 4A97A 5LSLA 2C22A 1XMOT 3ZLIA 3DRRB 3VR1A 4WPAA 1KKHA 5CCLA 2DNNA 1KNRA 1MNDA 4F4XA 1ZPVA 2LQBA 3ANWB 3GU0A 3CK6A 1RT2B 4Y65A 1K1QA 4LIRA 3ELHA 4DQQA 4KV8A 2LU2A 2QLJB 5HAXA 2KT2A 1SC4B 1MMNA 3MWBA 2D3O1 1RAGB 2F4VT 4X4SA 2QLBB 4AQGA 2CRLA 5DQGA 3OSNA 2LA4A 1R43A 3QT5A 4USHA 5J2TE 5C25B 2BMBA 1Y11A 4PZVA 4C8LA 1S6QA 3X3UA 2CKWA 3JSBA 4ZLNA 1FRIA 1VQ6S 2E1CA 2J9DA 3KG4A 4OFZA 3DOKA 3MF5A 3MMBB 3OR2A 2FZCB 3AOAA 3WDOA 4WP9A 1AXQA 4U96A 3RAQA 4FN5A 3FDSA 2EC2A 1NUEA 1QVFR 3B78A 4CO4A 5KT7A 2NXCA 3KVBA 3KHLA 4DX6A 1HMVA 3M8YA 5DG9A 2VA3A 2R7OA 3N2GE 1S1XA 5KG3A 3N6MA 1T03B 2X9YA 1A6LA 1F3VA 4TZ4C 5LSRA 3I9YA 3QATA 1VQMS 4IG0B 2E9RX 2CMRA 3PX0A 1UW4A 1FFWB 1YBTA 4DPXA 2FJBB 1JWWA 1Z8UA 1OYDA 5IQ6A 2EVZA 4Y28C 2UXCF 1RAFB 2BS4A 2HNZB 4IQXA 4Q0BA 1HFAA 4EYIB 4GC7A 3HVWA 1PGZA 5HATA 4DWIA 4F4KA 4HACA 3N5LA 5L1KA 4YS2A 2KI2A 5F3ZA 1KVJA 1RTDB 1AT1B 3PUQA 5RUBA 3O1IA 2R7WA 1H0HB 3TX0A 2W62A 4LBHA 4COFA 1T8EA 2M0GB 5FXXA 4QWCA 1UFKA 2U1AA 2N3LA 1SC6A 1UVLA 4IDZA 2HQGA 4ZVEA 4DDFA 3CC4S 1NZAA 2XHEB 4ZI2D 4WFZA 2CNOB 2IVYA 2XMMA 1S0MA 5ETTA 3IO1A 2VURA 2W7OA 2D9DA 3UN5A 5AE3A 1X9BA 3THVA 2CJAA 2OA5A 2ILYA 4F04B 4PCQA 1N33F 1RHJB 5EWFA 4ILBA 3NBPB 1NHVA 2X0LB 3VGVA 4ZI3D 3TA1A 3JTOA 1WORA 4YSXA 3K5LA 5HEJA 4XK8C 4KPYA 3N5FA 2V8HA 4WYVA 4DO0A 3L09A 2YWWA 3OL7A 2DHHA 4U8YA 1RT5A 5KFEA 2FDNA 1B70B 5L3GB 2RQCA 4K2JA 4I4BA 3RIUC 4Z7YA 1U0HB 2YKSA 1N32F 1G73A 2L48A 2XB2D 5KT4A 1WEXA 1UVNA 3DDNA 3CULA 4P9SA 5AQQB 2WWVA 3SRZA 3M6XA 2AW0A 1KFSA 1NH8A 4AYBD 4JEHB 3HT3A 2YKNA 3Q5EA 4KFBA 3GFYA 3SI8A 1NPKA 2AIRB 5KG4A 1HBUB 1FEEA 3L95X 2GQCA 5FDLB 4WIQA 1T11A 2EHOD 1HNZJ 1LW2B 2RB7A 4JI0F 1IJFB 2HVDA 4FNHA 3HJVA 2GFFA 3R8YA 3GONA 3E3XA 1U7LA 1VQSA 2NR4A 1RWOB 5KFGA 1NLKL 4EMDA 4YP3A 3MM8B 5D4NA 3G82B 4MALA 1P9YA 1SL0A 1PYSB 2XQAA 4ZJQA 4LMJA 3R5CA 2DBBA 3W63A 3TO8A 5F8GA 5FXVA 5IQQA 3HVTB 3NCPA 3KUHA 1AUSL 3LSVA 2V0NA 2R6GF 1UVMA 4DV2F 2HHWA 4ZOLE 1HARA 4OZ2A 1J5EJ 1VYAA 3H4BA 1Q5VA 4B3OB 2R2RA 3NOCA 2ZM8A 4KB7A 2LFVA 3H3AA 4Y2CA 3ESLA 1RT6A 3PUVF 4D3GA 3THTA 5JVDE 1JLCA 4LSZB 4IE5A 4HFVA 3ZMVB 2JRSA 2KVIA 2W2UA 1IVZA 2EHOB 4RW4A 3PUSA 3RRKA 4AL5A 1M0SA 1VHFA 4QR1A 4OMFG 3PEHA 2E5GA 1XNRJ 4F8HA 1TKXA 1T9TA 4HEAA 1VISA 3MPVA 2CYYA 3EM1A 4YTNA 1JNRB 5KFCA 1VJWA 1Y3JA 4YHHT 2AWZA 5L38A 3GFHA 3BYPA 5KFIA 1KHWA 2DCUB 3RYHE 5C2CA 4HWCA 2CQBA 2FYXA 3Q8RB 4ECVA 4DV4J 5KFLA 4YR3A 1AB8A 2HHHT 4MK9A 2ZZMA 4WTYA 3ILOA 5KFFA 2P2CB 2G0JA 3PW0A 3RBZA 1F5AA 4CTAA 3BGRA 3DLKB 3ENAA 1YD8G 5BR8J 2M6BA 3J7Z5 4YB5A 1P8GA 5FLXU 3A7MA 5K14B 5EX3A 1QTMA 4NXNT 1HNVA 3TYTA 2B5JA 4AXIA 3O1HA 1NEKA 1RT1A 2V69A 2KZZA 3AAEB 4O4JE 3MFHA 5EHHA 3FUYA 1JLQA 1W26A 5LT5A 2UXDJ 4DR2J 1Z1ZA 2XAQB 3AH6A 2NSCA 1JKHA 2DNGA 2FJWA 3RLFF 4EO8A 5H9EK 2I0MA 1KRPA 2WB5A 5DQIA 1KD1T 1JXLA 2XWXA 2QV6A 4AKRB 3GLJA 3FZKB 3OUYB 4LRCA 2RKIA 4DMZA 3CJ4A 1BD6A 3I0RA 1XTZA 3P4UB 3J7YI 4LIWA 6FDRA 2VG5A 3AFGA 5DGBA 3LP0A 4YXDA 2Q9QD 1JIHA 2W8KA 2V8GA 5T14A 2VPZB 3VU7H 4AL6A 1N36J 4JV0A 2NW7A 3C6UB 5LMUJ 2QLXA 4ED1A 1OY6A 2CQDA 3OFEA 4FPRA 1KSPA 4RWXA 4QU7A 4HYKA 3F31A 4QWDA 3ZSSA 2HHTA 2CPHA 4MH8A 5J2QB 2PG8A 4A8OA 5FKYA 2BBHA 2B7BB 5DETA 1SUQB 1Q86T 3VTIA 2I6HA 3MMAA 5LHIB 3GYNA 3LGHA 2XQ4A 4A4JA 2XMKA 1Z2ZA 2QTWA 1FO1A 2FJEA 3FBCA 3RRHA 2PMZD 4USUA 4C0HA 2K2PA 4XPEA 3UVJA 2X67A 3RBEA 1FX4A 3ONXA 2ASLA 3GWCA 4XZCA 1KQKA 4RNMA 3ZC1A 5DM6Q 3C4ZA 5IT9Y 3I0SB 2P8IA 4JI6J 4DCJB 4JI7J 3UD4P 3QJJA 4B3RT 2Q9QB 3LO3A 3C3LA 3AY0A 3MCNA 1GAOA 3D3BJ 4TY8B 4RNHA 2YNFA 3GJRB 1U1LA 4YHHF 1ZS6A 2ZOGA 2L41A 1S6UA 2MKSA 5EN1A 4C97A 3CT9A 3KLVA 4BLGA 4NI2B 5L3EB 1OEDB 2PO4A 4MHCA 1CJUB 1IJ5A 3TZXA 4KO0A 2XMAA 1HD0A 2WVDA 1FK9B 4ANCA 2K1RA 2XAJB 2HHHF 5A6WA 2RS8A 5DQVA 2W2PP 2QL7B 2C2OB 5D78A 3NKYA 5E41A 5DDOC 1B0TA 5JDNA 1XDPA 2HK3A 4HTEA 4AIUA 3JCFA 3MI7X 3EVOA 3TUIC 4PYDA 5GADU 2F8HA 4RPFA 3UDLA 2XBPA 4DX8H 4NPPA 3R7BB 4H9SE 4H4KC 3RIAA 1SJ3P 2XY8B 1UK5A 1FNOA 3GG0A 1H7XA 2NS1B 3A1YG 1T3NA 2IDOB 1IR2A 1YJUA 4HFCA 1WI6A 5AQRB 1H7WA 3PHTA 1S4FA 1HG2A 2DNZA 5KFMA 4LSNA 4V1Ak 3KDOA 2ASDA 2IAJA 3QAEA 1PAUB 4ZPVR 3MOZA 4E2FB 1K1SA 3IC1A 4ECTA 1KTQA 4BJNA 3S8SA 5DDQC 1LWCB 4EOZB 5J2NA 2DO4A 3VR9A 1TL5A 4TWDA 1SB6A 2OD6A 2P5VA 5E0OA 1MN9A 1H6KX 3BK9A 3W5XA 2YN6A 2JFKA 1S76D 4LFBJ 4JI4F 2HFUA 2CCQA 1B64A 2FJXA 5LGUB 3AB4B 2LM9A 3FCHA 3UE2A 4NZ7A 1WEYA 4I2PB 1NENA 3CTRA 4A8MP 4CQIA 3HZGA 2E9XC 4CI1B 5HP1B 2P6TA 3UU6A 1R8AA 2V7LA 1KOOA 1SH3A 5DM7Q 4LJMA 5HANA 1NU4A 3HFVA 2UV8A 2MYSA 1S0NA 5LMNT 5D0HA 3OPKA 3VAKA 5ETSA 2FD2A 3B82A 5C8YE 1RT4B 4KAIA 2R2TA 3DRSA 4OZJA 1C4CA 3MURP 1IM6A 2CLYC 2O5DA 1HQUB 1E6VB 2Y0BB 4B3SJ 5E3PA 2XSJB 1WELA 1N8RT 4K4VA 4FVMA 2V8VA 4CIOA 4EZHA 1FT8A 3ZEFB 1IBKT 2KVQE 3OV7A 1YXRA 3PJWA 4C8KA 3QB5K 1UTAA 1IBLJ 2ROGA 3MM7B 5AJ3F 4I4TE 2J9EA 1DTTA 1WHVA 4DL2A 2BANA 4FXWA 1FEHA 1TKTB 5C42B 2UV8G 4O4GA 3CQGB 4FDFA 3R5BA 4O3QA 2EPIA 1UKUA 4QR2A 1OXZA 2NTYA 1HHTP 1TFYA 3DYAA 4X66T 3TX8A 3PRVA 3TANA 5HLFB 1VRTA 4R5PB 3P4PA 2GMLA 3M9OB 3D6HB 4B9LA 1YTYA 2W7PA 3HHLD 4ED0A 5ETWA 4J7CA 1U02A 1NPPA 1RYSA 3KLGA 2AJFE 1X79A 5HEHA 4P1NA 3W2WB 4A8FA 4X64T 2Q1LA 3BSCA 1ZAXA 1ZH5A 4LQ3A 3IRXA 4MT1A 3UR3C 4OYJA 3TA0A 4O44B 1JLEB 1IM4A 1LXJA 4QH5A 1CS4A 1I6JA 4PXCA 4XBFB 3PIPQ 1Q79A 3CJ5A 1K0VA 2GV1A 2KYZA 2ZM2A 4P0BA 3SZ2A 3TVKA 4EYHB 1HBOA 2E5LF 4AD6A 5H9FK 2XJ7A 1CQMA 4AXJA 1VBXA 4ZJOA 3I9WA 4DR6J 4ITSA 3SSQA 3NRXA 2HQFA 1AFIA 8RUCA 4X4PA 4YT0A 3OFFA 2UU9T 3ONQA 4KHMA 4NCGA 3OHBA 2CAJA 3HHLB 2QSWA 4CI2B 4TNOA 1L3TA 4X4TA 2H5JB 1LWEB 3HSJA 4XAXB 3KG0A 3G8SA 3B13A 4B9SA 1VRBA 2OPRA 2IA6A 5BMVE 4WFNQ 2CE7A 2WZHA 5AQGB 4GVBA 2MQPA 3BN4A 1H2TZ 3GV5B 4F4WA 4U31A 2AYGA 4FPIA 3R3TA 1N54B 5HMYA 5FVLA 2MQNA 2AGQA 2HGNA 3AE4A 5HMZA 4OJ3A 3GFXA 4ZPTR 3WX4A 4L3KA 2QA2A 3UU5A 2EFOA 1U2FA 4J9PA 4K50A 4WU3A 4X2BA 1E7PA 2EBEA 2VKZG 2GQ2A 5AQHB 1FKPA 3V81A 1ZM9A 5F8MA 2XUEA 3M3ZB 2RJZA 1AYEA 2H5EA 1FRXA 1TK8A 3AQPA 5C24A 3SSSA 2Q43A 3AD9C 2W0GA 1RHKB 2XO6A 2E1MC 4YY3T 3FZMB 4FYVB 5LXYA 3FZLB 5J1GA 5IWAF 4TNVA 5DRKA 4X66F 4ZN1A 3UQ7A 2B7CB 2XCPA 3M30B 2FLPA 3R5GA 4PXBA 4DR3T 5LSOA 4X4OA 1RKIA 3C6TA 1SJ1A 3RUBL 1YBAA 2GHWA 1WR6A 2W1BA 3DI6B 3DLBA 1Z4UA 4NZ0A 2WP9A 3AJ1A 5FP3A 2U2FA 3O1LA 3TP2A 3I1AA 5DDRC 3ZZUA 3BO3A 2C0SA 2IM2A 3ENVA 5CAAA 4X64F 1X4HA 4RW7A 5GMDA 3MOJB 2E5JA 3GG1A 4OYWA 2DY1A 4PXEA 2X66A 3ZYKA 4H4MB 2OSQA 3DRYA 3QUJA 1S4EA 2VPWB 5L4HA 3BKFA 3PU3A 2AYEA 3ZMSB 2NWBA 2DWGA 1VIOA 3Q9DA 2MQMA 3ET6B 2D0TA 1S7IA 5FLXY 4ALZA 5DJBA 2WTFA 3DLHA 2K06A 4DR4J 1JJ4A 4DUZJ 2IAKA 4DR1T 2Z30B 1YJWS 3I56S 2DR5A 2AX0A 2BA9A 3NGDA 3PU8A 3QNUA 1WR0A 3P49B 1VIXA 2UU9F 4WKRA 2FHMA 3OFHA 1DARA 1IJ6A 5LOVE 1J5WA 5F8HA 4A8WA 3HULA 4KMCA 3GWHA 4DV5T 4QZVB 2YBVA 4X62T 2DWKA 2KFYA 2QMUB 1VRUA 4EFAC 3UUNA 3RR8A 4WNKA 5D3GA 3BBCA 2J8SA 1WHXA 2RU9A 4U7UD 3I5AA 1TL1B 1FE0A 3ETVA 4QWNB 2AKWB 1RHQB 4NLRA 2R2SA 2NZCA 1XMBA 3K5PA 4KR0B 3KNGA 3P45B 4J37A 1EAYC 4DV0F 3UD5A 2KRRA 1PIEA 2MTLA 4QW9A 2KKHA 4IFYB 2MZ1A 5J0ZA 5KFNA 3RRGA 3N2OA 4U7CA 4G1QB 2X9HA 2M67A 5BYRA 2V1DB 2CUYA 3KTQA 2HBQB 2YQ3A 3UU3A 3MAAA 2LYVA 4WK1A 1T9YA 3MPUB 3R6GB 4WK3A 4AT1B 4KTQA 1FEWA 3QFWA 1WKKA 2CQCA 2NZ4A 2LM2A 2ZHAA 4YY3F 2JEFA 3N9NA 2ZKTA 1N56A 3CCUS 3EVWA 3OTDA 4C98A 4DX5A 1FESA 1YSJA 3KLFB 4OYBA 1N5VA 1L3KA 3ENWA 2I38A 2HN1A 4DR3F 2W4PA 4LR9A 1CJVB 1L3VA 4WYWA 3HF5A 2BG9B 1KLMA 2MOZA 1HNXF 4P52A 3IA3A 3TKLB 3KV6A 1S1UA 1S10A 4LFAT 3VWSA 3N9LA 2OKQA 3UQ4A 1FRLA 2GC8A 3EUNA 3SCJE 1WCRA 3MEGA 5CA1E 4J2CA 4CLUA 4TWHA 2B1EA 1RAEB 3LK2B 4EEYA 1T9UA 4YTPA 3P4WA 1SJFA 3JTPA 1I94T 3T1AA 1FHTA 4XO0A 1I1GA 2HQDA 3CDBA 3MD3A 2HS4A 4DV7J 2Z56B 1DBDA 3T5JA 4LF7T 1WC3A 2MGZB 4LREA 3R1HA 5IT0A 2PTFA 3FJ2A 2MLYA 3M6UA 4OZ3A 5KFBA 1BQMA 3LANA 2LA6A 2JL9A 4RR5A 4DR1F 2UXCJ 3NNAA 3QGGA 1BQXA 3KJVA 1GXTA 5F8JA 4ASKA 1RWKB 2BEFA 5L8RC 1HG5A 5T7LA 3T6BA 1YWXA 4ZVGA 2DXEA 3D4JA 1OMSA 3I55S 3M2RB 5GONE 4DV5F 2HFZA 4FF1A 5FY1A 3OL6A 3I87A 3ISNC 1JLAB 4F0MA 4X62F 1FJEB 3B54A 4GKKT 1X4CA 2WAUA 3CPWR 3AXJB 2Q3PA 3H8YA 3FQKA 1H74A 1UVKA 2HNYB 5KT5A 3EI0A 3OTOJ 1RXOB 2G4BA 3MK7C 3FC9A 1JLFB 4F2SA 1LOUA 1GTEA 3VQSA 3FSYA 2GHPA 2VPYB 5KFXA 2WSEC 3W64A 1NMEB 3LW5C 4K5RA 2IM0A 4I68A 3V5UA 2JZ5A 3F2EA 3GCXP 1EB0A 5EWEA 4NLUA 3OL9A 4C8MA 2GJIA 1D1AA 1N33J 3EABA 1DQ9A 2E9ZA 3W60A 2AGOA 4H9QC 5E3CA 4OLOA 1J1JA 4YFUA 5CYMA 1NHUA 2DNRA 2CXFA 1ZZFA 4RW8A 1J5OA 3DRPA 1S6QB 4X4UA 3OJSA 4IE6A 3H0PA 3Q86A 4F0KA 1SJRA 2O66A 3DOKB 1WUUA 3OR2B 3AXKA 2BZBA 1S0VA 1VC6A 3K17A 3PTWA 1RLCL 1N32J 3FEZA 2PFVA 2W25A 3NRYA 2Y48B 3SDEB 3C51A 1IZNB 1RAAB 2BUNA 4QW8A 2LU1A 1S5ZA 4JYAF 2Y1LB 1TMMA 3CCSS 2R8HA 2HHXA 4QBUA 4HFHA 5C3JA 4CH7A 4YLHA 4LFAF 2D3UA 1C1CB 2KDOA 3LF0A 3CJKA 3NNHA 3OSPA 1N6QA 3L39A 1FIOA 4Q0BB 3U7JA 4ZMMA 1SIWB 3VRBA 2IC9A 4YSYA 2W01A 4JI0J 2CRBA 1GMVA 2CEAA 1WLXA 4DOZA 1SV5A 1C0TA 3I9ZA 2SPCA 1JMTA 5A8WB 5KFDA 4I69A 2R7UA 3RBXA 2R8GA 1V5IB 4OI2A 2RQ4A 1V9DA 2HVIA 3CCTA 2HNDA 4ID8A 3I5CA 2V7MA 5DJQC 2BRLA 4ZI2C 4JI1J 4Z7CA 4RUHA 4KC5A 2K3IA 3W5YA 5KT2A 2UZAA 1EHWA 2MQQA 5G0RA 1YVFA 3GIRA 3VCDA 4X1KE 2WW4A 4LBIA 1X8DA 3OXGA 5D0EA 4DV2J 4ZVFA 4TV8E 4WE1A 3RKOA 2YX7A 4C11A 3W9IA 2JH3A 2AXDS 3VF0B 4ZI3C 7FD1A 3KLHA 4H63H 4UTGA 3IBPA 5LP6E 2VV5A 3MEEA 1RT3A 1RTZA 2J6SA 4ED7A 5GAEI 1KVKA 4C3KA 4MTPA 4U6PA 1FRJA 1HD1A 2CBJA 2FVRA 3HA4A 1RT5B 2CPDA 2UVUA 1HQ2A 1CULA 3WX8A 4ZS6A 1CSJA 4UQGA 3UDCA 2OEJA 2R7QA 2FHOB 2MZRA 4JBCA 3LUYA 2CQHA 1YBUA 3FGVA 1ELOA 1SC1B 3DCAA 1QD1A 3VHLA 2XMTA 1FKOA 4HFIA 3PO4A 1R6YA 3DOLA 3TJ9A 3OVUA 4LF5J 3GIKA 5LXTE 5KFOA 4G65A 3UULA 3J81j 3NGUA 3CGIA 4A8SA 2VJUA 2G0UA 4EYUA 2G1HA 3H40A 3MMJA 2FVSA 2VK9A 3CVRA 4ZLPA 4K0KJ 1G1XA 1YZ7A 2EHOC 2WW8A 1RAHB 2AYMA 2XC9A 1ZAWA 4IL4A 2VBZA 2W61A 4RBVA 4LRFA 4ENOA 1X9SA 2YY3A 3L8RA 2YNIA 3RPUA 3DMJA 4TQRA 5EGYA 4PJMA 4LF4F 2YDQA 3QO9A 1HNZT 2DGXA 5JQGE 3K8PC 2SXLA 4L6V3 4CO0A 3IAM9 2Q79A 1QJHA 2BACA 1MLAA 3TQ1A 2XHWA 4Q2LA 4HKAA 3MM6A 2V8SV 2IFXA 1Q0NA 5HVGA 4IRDA 4DG1A 4I7FA 3HI2A 1YRTA 3KV9A 2WOMB 2V4JA 3ICLA 3THPA 2MHNA 4YQWA 2DTJA 1K8AT 3HSZA 1HQEA 1FTCA 4X4RA 1RT6B 1JLCB 4DLEA 1J5ET 3C2PA 1UCUA 2VBXA 2C2KB 2V34A 4RW4B 2UUAT 1UWBA 4ZVQB 5CCMA 4UZCA 2H48B 1SKRA 4OI6A 3FEXB 2XS7A 5E2QA 3CCES 5DO2A 1TKXB 3K5MA 4BC7A 1S1WA 2HVZA 3UWTA 3DM2B 3VAHA 4OX9T 2VFVA 1HW9A 1XNRT 2PN6A 1FJGJ 3P4QA 2ROPA 6AT1B 5KT6A 1S12A 2J0SD 3G6YA 5JXSA 2EKNA 2VU5A 2Z8QA 4NPOA 4MLKA 1ZM3A 5HXHA 1OEDE 3MAHA 2WB1D 4CTAB 3BGRB 4KX6A 4JI2J 2EK6A 4BBYA 1MU2A 4DV4T 4RBTA 2PT0A 5HJXA 1FJCA 1BR4A 3PW2A 1M90T 5IFMA 4B08A 4WZQA 2B5JB 3U27A 1FNXH 2NQPA 4Q8EA 1IXKA 3N9PA 5AQPB 2DO0A 1RT1B 1ZOYA 3TUPA 1S1TA 4C8OA 5BR8T 2VFUA 1NDKA 4LFCJ 2RAQA 4ZPDA 1JLQB 2LLZA 4Y00A 1SUMB 1B7YB 3CUNA 5LG4A 1EQMA 3C16B 3MHYA 2FGCA 1JKHB 2RF2B 1M7KA 1SKWA 2UXDT 4DHVA 3HFKA 2RKIB 4DR2T 4LVNP 4ILUA 4LMLA 3I0RB 4MIAA 2VG5B 5HN0A 2Q9QC 3LP0B 2W67A 1Y00A 4CT9A 1XQIA 3DHXA 2VQEJ 2HQIA 2Y8DA 3EZUA 4ZEYA 4WFYA 3QLHB 4DXLA 1S48A 4F4YA 3AOBA 3JAFA 1GK8A 4ANJA 4CN6A 4UIGA 1RTIB 4I64A 1CVJA 4PRFA 1OEDC 5E5NA 5KFQA 1MWZA 4J9OA 1X0FA 5KDMC 1TR0A 1P27B 2BOPA 5HEGA 1AFJA 3KXDA 4EV6A 1F3FA 1N36T 3KJQB 5LMUT 3MMAB 1IKXA 5CJ5A 4OZ0A 1GXLA 1R27B 2P9EA 3W9HA 1UJ5A 1X0PA 2FHKA 1U0SA 2KT9A 5JDMA 2DEJA 5AE1A 1BGXT 2XMVA 1SCJB 1KFDA 3MCOA 2MLZA 2WBLA 4JI4J 4UT4A 3UVJB 1KBRA 4IDPA 2QVAA 3TZWA 1RWNB 2F63A 2M6IA 4X5TA 3MM5A 5F8NA 4ZVTB 2HQCA 4JUYA 2UUAF 1MMAA 1EKRA 4JV1A 2V7KA 3MGJA 3ETMA 3CKDA 4AQYF 1J27A 4QH4A 3RC8A 2ASJA 2Y8WA 3CO0P 2ZE2B 1W0AA 1SHZC 4CP5A 1FRKA 2DT9A 4QIVA 1LV5A 2YNFB 3CJTA 1XBWA 4JI6T 5ABHA 4JI7T 1RUSA 4CO2A 5I3QA 4OX9F 3OLAA 1XNRF 4GKJT 5I3PA 2ZH9A 1TFWA 2HZCA 5K5MA 2ZZNA 4KO0B 2OLWA 3IR7B 2HS3A 3PW4A 1XMQJ 2ACZA 4CXWA 1H98A 2V6AA 3VZIA 4MKBA 3NWRA 2GCFA 3TJ8A 3QRRA 3BQLA 1U1PA 2OV9A 3D68A 4BJMA 2BJ8A 5KXJA 2V2QA 4QOTA 5IUXA 3G2XA 1T3OA 4HR2A 1KR4A 1S79A 1VK3A 5IM0B 1N0VC 1FDAA 2VF3A 4NA3A 2AF6A 5ITHA 4JI3J 2QN6B 2DR8A 1IBMJ 5AJ3J 1ZTTA 4J9RA 1H7CA 3G96A 3GSIA 3S6EA 4QYRA 2GMHA 2EBGA 2W24A 3FK4A 3IRWP 3R6LB 4IOAQ 4NRTA 3PNIA 2R7RA 4DS4A 4LSNB 2IAJB 4DFPA 3CCLS 2NW8A 3MXZA 3MJXA 2CPJA 2UXDF 4ADZA 4DR2F 3JTNA 1Y3KA 3CQCB 2BJ9A 1CPZA 1YJ7A 5LHHB 3GN5A 1TVRA 2D5UA 3PUYF 2XMJA 4NIQA 4IE4A 3KLEB 5DLFA 4B17A 3EX7B 2BABA 3FZFB 3TVZA 4ZVOB 1NK7A 1U25A 3AXMA 1O5JA 1BXNA 4FXDA 1QSLA 3VKGA 4PUOA 2VDIA 3LP2A 1IKVB 5BYQA 1J2VA 1RP5A 2C28A 2BKNA 2CIMA 3MECA 1PC4A 2W2QP 5HROA 3RB4A 3ILJA 4P73A 4NCAA 2K5BB 3IMQJ 3RR7A 1YKHB 4OK0A 3ZZ0A 2ADBA 1NKEA 3AE9A 2KM8B 3TQEA 2E5LJ 1F5CA 1KHVA 2ZOFA 2E1RA 3PV8A 5IC4B 2V50A 1MW7A 1TU0B 2PJQA 4CXXA 2H4WB 3OFGA 4CLWA 1NJXA 3IN5A 2JEIA 1QE1A 2LQ8A 3N4WA 3WBZA 1YKWA 4CRJA 1T05A 2FLNA 4URSA 3PYFA 1FERA 2VD3A 3IM8A 3OTCA 3D0TA 2NW9A 4YHJA 5FY7A 4KUMB 3ZT5A 2H7VC 4LMKA 4WU2A 3FBFA 3SFGA 5JR9A 3TVYA 1G2EA 4B3ST 1ICEB 3MDFA 4WYLA 4KPCA 1HCIA 2VIHA 4JI6F 2EG1A 2IPOB 3QQCD 4JI7F 2JQHA 3MMCA 2ZUAA 1LQ9A 2BQUA 1DTTB 4GKJF 2BANB 2ZHOA 2RHSB 3PW5A 4U7YA 4O4GB 2XI2A 1IBLT 2CJYB 3C14A 2L9DA 3KINB 1EARA 4QYZK 2IYGA 2LXFA 3R5JB 4O4IE 3DYAB 3ZXWA 1GMWA 1VRTB 3NWIA 5EK3A 4MIBA 4EZ6A 2ZHBA 2RA1A 1RHRB 4NYZA 3A8IA 4GYSA 3HHLC 5J1EA 2N7CA 4MFRA 2FQQB 1SKSA 1MMLA 1IQZA 3V5RA 1TKZB 2VG7B 2XSAA 1TK5A 4HN9A 1SA0E 3MR3A 3MACA 1FA0A 3KLGB 3K58A 4OZNA 2RUGA 3PXGa 3SQGB 1QAJA 5KFSA 3MXHP 1VQ4S 4WFXA 3UUXB 2K3KA 2EFGA 3IRXB 3PUWF 4UXNB 1P1TA 5IWAJ 1XWMA 4X66J 1YK9A 1CS4B 2KL8A 4HTIA 1LWFA 2BJ3A 2YVSA 1H2VZ 2XGQA 5L1IA 3I0QA 4QXHB 4KQZA 2C2NA 2QSFA 2PEBA 3SYZA 1WFDA 1HBOB 3QT7A 5C7PA 5K20B 1WG4A 2DH7A 2H89A 3OXFA 3KHHA 2GGPA 4H9OC 4J5OA 4NMLA 1IUJA 4W4MA 4L9IA 2LKGA 2AEMA 3FFIA 2CQ4A 1EJ7L 2ACMA 1TP7A 1VCSA 1D8ZA 5FNVE 3V6DA 3M8WA 4ZVRB 1KN6A 2HWHA 4NCGB 5D15A 1U49A 5F8LA 4FI5A 1BHNA 1A9NB 4DR6T 2MJNA 1BLUA 4TY9A 4DS5A 2F9JA 4FBUA 4PG6A 5AXLA 3CCJS 4PJNA 2UUBF 3D67A 2AGPA 2JVOA 3GR0A 5L9NA 4WXOA 5LM7E 5CQGA 1YJRA 1O6XA 4RNOA 3ITHA 2DK2A 1FD8A 3RYFE 2X9XA 1BR1A 3M4XA 1IKYA 4K0UA 4ELUA 4UVCB 3GMIA 1WC5A 5EZYE 3H20A 3R5DA 2B9YA 1WSRA 2ZBPA 1D1CA 4NEZA 4FVCA 2IVMA 3KJNB 4U74A 2DLRA 2XG8A 4FYWB 2G13A 4R8UA 4U33A 3DOMB 2JOQA 2OEMA 2VKDA 2IBOA 4G1IA 3HX9A 3WC0A 4B3SF 3CXCR 3Q8UA 2HRUA 3G71S 3V81B 2HPUA 3MAQA 5JDGA 3SFEA 4Z90A 3IP0A 5C24B 4DBQA 4BS2A 4LF9T 2HLUA 3ZZRA 4YFSA 2WVEA 2M3DA 3PR4A 2QYGA 1U24A 3PJAA 4WBOA 1TKDA 3ZZZA 5HXCA 4O8SA 1HPZA 2B6AB 5FJ4A 2PFFB 3F73A 4KKOA 3PFEA 4UOHA 2JWNA 4ZXLA 1RKJA 2MPUA 4DV0J 3C6TB 3Q22A 4CCHA 2G2OA 2B56A 4OI4A 3BN7A 1DFDA 2HHPA 4O2BE 4KY3A 4AQFC 2ILZA 3PV0F 2V67A 1Y5IB 1Q8LA 1KK7A 4NRUA 2VASA 2A3JA 4OYXA 4P71A 1OSCA 1HI0P 1K73T 4FS1A 2M2BA 1XZYA 2NXJA 4O3RA 1U6FA 3J7YU 1IAPA 2F8EX 1AZSB 3EUHA 4DV3F 1F2GA 1NK4A 1RBLA 4C6AA 1T9WA 2L9NA 2HWTA 3NEKA 2QLFB 1IN0A 2IDLA 4IR9A 2LHNA 2N82B 4Y2MA 4HE8A 4ICLA 3RB0A 1M1GA 5HBMA 1R3NA 3CCVS 3NGSA 1HNXJ 2HEKA 1ZYQA 3Q2SC 1TL7A 1R8PA 3N28A 2ZH1A 1CBKA 3PZPA 5B0BA 5KFTA 3DLLQ 3ULHA 2DRDA 3EJMA 2WZIA 3W8GA 5FXZA 4YEAA 3HO1A 5F5WA 4DR4T 4DUZT 1EETA 4C8ZA 2H5IB 2AX1A 5KG5A 3C15A 2IJFA 2QA4G 2RDJA 3M8QB 1VRUB 2HHUA 3V6HA 3P8CD 5D3GB 2HQ3A 1DJ0A 1BWEA 3GFZA 4UF0B 4QCLA 4B9TA 5ETMA 2BG9C 3HL6A 2EFNA 5A8RA 5LOQA 3EMTA 1RU2A 5LL6d 4M5DA 1NKCA 2VG6A 2ACYA 2ZH5A 4DUTA 4DQRA 3UN3A 2CJKA 3HZEA 4ZCKA 1PYOB 2GVZA 2DHAA 2P6SA 3DRRA 1GX5A 4OYZA 2NUHA 3BJYA 1S77D 4OV1A 2NLWA 3VR8A 5FYMA 2VC0A 3W15B 3BKTA 3MM9B 2NP9A 1S35A 2F3JA 2J0WA 2F7VA 2LKHA 5IV4A 4ZPWR 3AA6B 2MB0B 3CSKA 1REGX 1VRQC 2F40A 2M52A 3N01A 2W8LA 3ZTRA 2A2CA 4LF9F 2HBRB 4DZ6A 1IR1A 3MAAB 3Q8SB 4ZS2A 2DPIA 3AE3A 3IBWA 4DPOA 3LH2S 2W9AA 1T7SA 2YKQA 1DRZA 2N4CA 2JFDA 1SL2A 2HZAA 4WIIA 4PK4A 2J9DE 3KG1A 2JJ4D 4YB7A 2O01C 2KTQA 5KG6A 1UA0A 5EDWA 1HW8A 1JLBB 2I5JA 1NJWA 5LG3A 4EBDA 3I0OA 5LCYA 4CXYA 3GPAA 4MFBB 1S1UB 2M8HA 1T03A 2HHSA 4ZZBA 2HGLA 2AQ4A 1PKUA 4ZP8A 5HCJA 4QJVA 1KLNA 5LHGB 5HXRA 4PQUA 1YX2A 2HG4A 3MEGB 3T1YJ 2H54B 4HH1A 3LWLA 3HLUA 4DLGA 1NH7A 4E8UA 3V4IA 4QIFA 2AMCB 2HNZA 1NK8A 1S97A 4P10A 3SV3A 4GMKA 4M8LA 4O2AE 1Q8BA 5M2RA 3OTBA 3EDQB 3DJBA 2QLWA 1RTDA 3P4RA 2E1AA 1LEOA 4JYAJ 5E3QA 2DGOA 1YRXA 3KNAA 2XNRA 2R9LA 4Q7AA 1FDNA 4DV7T 5ABEA 3T41A 1T72A 3UN2A 3B6BA 2YKMA 4GRSA 4DN0A 3EHZA 3I4HX 2C3MA 3UFCX 4YB1P 3IG1A 4Y0FA 3FNNA 3KJVB 2ALZA 3HCXA 5T7LB 4I6AA 2VODA 2DISA 2UXCT 4EO6A 4OV6A 4Y2IA 4CLKA 4M5MA 1EP4A 1R8HA 4TXSA 2CWKA 4I6WA 3MD1A 2FHJA 3VGUA 2V26A 3A3PB 2DR7A 2CVIA 2XQ9A 5MLCV 2ZD1B 3I82A 5ETQA 3SCLE 4FF2A 1KWMA 3TA2A 3NBPA 4N7TA 2CWOA 2D3ZA 2V8PA 1UURA 2B4UA 2DJWA 2W7AA 5KFVA 5L39A 1UL3A 2CZVC 1YLXA 4NLYA 4Q43A 4DL4A 2CQGA 2HHQA 5M2UA 1UMJA 2Y1JA 4TWFA 3OTOT 3GILA 2XAGB 2JMKA 2XY7A 1OY8A 1U0HA 4QX7B 2AU0A 4NOHA 3HKCE 1RAIB 1W2BR 5CYMB 1YIJS 4IH5A 2Z57B 1OQ6A 1J5OB 3DRPB 3QSYB 4ZKAA 3T5HA 1N33T 3T1HF 3O8WA 4NLSA 1BWVA 5EX0A 4J9MA 2Z2LA 2WB4A 1T9VA 2BKOA 5B7WA 4Q2MA 1OWAA 2XTLA 5J2MA 3CEDA 2CQPA 3CNQP 4J9NA 4U72A 3DXSX 3N5BA 4DVDA 1LW2A 1M5PC 2BVZA 3KJFB 4ANEA 1YHQS 2JVRA 1X31C 2KZMA 4AISA 4RO0A 1N32T 3JB9k 2DCLA 4IRCA 3CC2S 2V2VA 2CFXA 3R1LA 2YQ1A 2WMOA 4A56A 4P2FA 4EXTA 3KBUA 1ZETA 4KJIA 4ZP6A 2WRMA 1RSCA 2LQ9A 2E1PA 3HHEA 2C3UA 3BB5A 1SV5B 1C0TB 1RHUB 2Y1IA 5MAOA 3E08A 2D2SA 2MHEA 3VAJA 3KK2A 4P7VA 3I6PA 3N79A 5D4PA 4LF4J 3OVAA 5L3CB 3HHNB 3MZKB 1FMWA 1RGVA 4JI0T 2ATCB 1XK8A 2RRNA 2XLIA 2F9DA 1KNPA 1UJ4A 4DV7F 1F9EB 4PYAA 4QU6A 2OPPB 2KG0A 5HXEA 4DSJA 4OHFA 2FTRA 4HH0A 2LEHA 3FRYA 2XMWA 2CA9A 1X4BA 2R8KA 4A47A 7FDRA 5H6RB 3UQSA 1DLOA 4JI1T 2PA8D 1NK5A 2XO7A 4WE1B 3KHRA 2ZC4A 4C11B 3EXCX 4ZCIA 3MPDA 3LFMA 3KLHB 1JNRA 2V7JA 1FRMA 1UEUA 4IE0A 3BGFA 4DV2T 3MEEB 2CQIA 1RHMB 4DF4A 3QYYA 5F8PA 5KX5E 3MUMP 2CQ2A 2LOPA 3KVAA 1WHYA 3TAPA 2N2NA 1WHWA 4GVLA 4ZHRA 3H4DA 1RCOB 1SXLA 1CULB 3TZYA 2AJ0A 2B4OA 2P9CA 1X5OA 2HZVA 4DPYA 2UUWA 1HBMA 3NS6A 2IMWP 3OTOF 1K9MT 4GO7X 4P09A 5L4EA 4OJ1A 2C2DA 4G3IA 4QIEA 5K14A 3FXEB 1FKOB 2YNGB 2L08A 5AQVB 2KJWA 3L7PA 3LBXB 1MIYA 4ZIVA 2OPSB 3QIPA 1RU1A 1VBZA 3HD2A 2QJ3A 2YH0A 2VBWA 4LF5T 4IT4A 4IREA 2H3EB 4C8YA 1E6YA 4HFEA 3JSYA 3EGZA 1D1BA 4ILMA 3EPGA 1WI8A 3R27A 3OUYA 2WONA 4ZVHA 1X5TA 3FBLA 4K0KT 1XERA 2XYHB 3DMJB 5J1NA 2RH3A 4PFOA 3QO9B 4PAAA 1M5HA 5JVGQ 2RUSA 5CA0E 1PYTA 2MDAA 2JMHA 3G6ES 4P6QA 2N7YA 1VOMA 1QSSA 4L74A 3RW7A 4L72B 2BS3A 1NJZA 3BV8A 2BM0A 2KT5A 2VHGA 2GIRA 5B0DA 4I7FB 3PIOQ 2V4JB 2XQ7A 4NLTA 5HYAA 2KYXA 3QGIA 3RYCE 1HX8A 4U7UK 3U1MA 5AQTB 1HQEB 4RUCA 2JC0A 2NYIA 3IS9A 3A8YC 2V5HG 2XCAA 1Q7YT 3HKWA 3DRXA 1D9AA 3U02A 2RPAA 3DLGA 1MG7A 5KG0A 5JREA 3C4WA 2F5GA 3GE9A 3M65A 1BC6A 1SL1A 2HIQA 3G8TA 5HWXA 5F3JA 4UY8T 4XDDA 3BGLA 1S1WB 2AE9A 3I0SA 4JI1F 4WP8A 1D9DA 4PWWA 3C19A 4J9UE 4DBRA 4N8NA 3OTEA 3K57A 2XQYA 4P75A 4TY8A 2DD8S 3MFIA 3O1JA 4HWIB 3DFEA 3LQVA 5T41A 2FJDA 4C2MA 2FY8A 3QT6A 5ETKA 4RU2A 2BS2A 1U4BA 1FJGT 5CZVA 2UUAJ 1CJUA 1HS7A 3KWMA 2B8PA 4CLLA 4HWDA 4AQYJ 1Q8IA 4E98A 3AEFA 1FDDA 1MU2B 3VKHA 3RI5A 1ROFA 3OPCA 2V94A 5ETNA 4JUZA 3HHKA 2O1PA 3ZTPA 2Q66A 4JI2T 5KG1A 2QO3A 4OX9J 4IHJE 1FXRA 2GA7A 1S1TB 4AE5A 4DR7J 3O4XE 3PYEA 4MAKA 4P2MA 4U3CA 4AKHA 2MY8A 2BJ1A 5C2TA 3CDUA 2OO4A 4LFCT 4NXMF 4LF5F 3OYZA 1ZTWA 1KEYA 4IYQA 2MLXA 2KMFA 2MYFA 1RLDA 2V9KA 4M5HA 4GIWA 4RW6B 1CJKA 3S01A 3OKQA 3RTVA 2CPZA 4K0KF 5JTGA 3T9ZA 5HL7Q 1LWCA 2FLOA 4K7QA 2ZNZA 1YZ6A 5DGAA 2KG1A 3NS7B 1OSDA 4MKYA 4ZP7A 1W7WA 5HEUA 3K1SA 5M2PA 2VQET 1HIYA 4PXDA 1D8YA 5AQJB 5AQFB 1AUDA 3ILLA 4QH1A 2KXNB 1LK7A 4X65F 3UTKA 2C42A 1IKXB 3V6KA 4OIXA 4F4AA 2XSBA 4I55E 2HHVA 4RBUA 1H3DA 2UUCF 1Y9OA 2VOPA 1XN9A 2V2KA 1EKSA 3CPZA 2R4FA 3RRWA 1UFWA 2PBIA 2NUUG 2HMIA 3MM5B 2CJQA 4H54A 3HSDA 2UXXB 2WVCA 2X68A 2PDAA 1U2CA 1VC5A 4ISSA 4JI4T 1HR0F 4B02A 2KJVA 2XGPA 2JJ9A 2W9CA 2CADA 2XSJA 2W4DA 3ABVA 3A5XA 3RYIE 1W25A 4A98A 3RF1A 1RI7A 4YB6A 1C0UA 2AEJA 4UOCA 1ZM4A 1X4GA 1RCXB 2VH7A 2B8QA 3DU6A 4XPCA 4DL0C 3N9QA 3G4SS 4HDGA 4ZLLA 3H2LA 1TKTA 1FJGF 3NGKA 4I6YA 5C42A 2YKPA 3PKMA 1JJCB 2ZMAA 3H2UB 4F25A 4CLZA 1XMQT 3RZAA 1WG1A 1Q81T 1WNEA 1YJ9S 1B99A 3TEGA 5AQMB 2O67A 4UVBB 1E2AA 1NAFA 4NEYA 3K8VA 4DFKA 4JI2F 2C3OA 4C0OC 2J1DG 3PJ9A 2KM8C 1HWIA 4HL9A 2LQJA 4Y3CA 2ZM0A 4GKJJ 4ZJLA 1S1VA 3M9NB 4ECSA 3AECA 1PCAA 4JI3T 1EZZB 4USIA 1IBMT 3D6FB 2VVNA 1UCNA 1NXIA 2YXLA 5CYQA 1LW0A 3WZ0A 2BKPA 3M2UA 5HQMA 1US7B 3E0ZA 3W2WA 3CO9A 4LFCF 1WYCA 1CG2A 4DV1T 4ZOSA 1B7TA 2NPFA 4H63V 3UD3P 1L5UA 2J76E 4CM0A 5IS2A 4O44A 4OZ1A 1JLEA 4NCBA 3FXDB 2DIUA 2Y8YA 2N3OA 2COLA 3GN5B 3ADAC 5KAKA 1NK9A 3LALA 2OFGX 3BPDA 3J9X1 2XAFB 1GX6A 3BYRA 2BDEA 2MKJA 4B9NA 3JYTB 3QRQA 2XQ5A 2IHR1 1LVFA 3IEEA 4PAGA 1S6OA 1WOSA 2DKOB 4TKTA 1KQFB 2CHOA 3LAKA 4NX9A 2DHSA 3HMJG 4PUOB 3LP2B 4NA1A 4R0JA 2VQEF 3AD7C 1U6ZA 3MECB 5HROB 2E2AA 3QC9A 1TL4A 2PD1A 2WMNA 4WW0A 2X0HA 1C1BB 4L5GA 2QMWA 1GMWD 2NXNA 2L3MA 3AEEA 1RWMB 1EIYB 2VJVA 1WYBA 2CWYA 4ZPBA 4DSEA 4ED8A 5CD4H 3AE2A 2LXIA 2E5LT 3Q5XA 1QE1B 5F0UA 5CFBA 4LBPA 2OELA 2BVLA 1EQ0A 3K59A 1K0TA 4ED4A 2BZ2A 4ILRA 2UP1A 1QLBA 1T05B 3HT0A 1WOPA 1Q4RA 3B57A 3C64A 1S9EB 3UO0A 4GC6A 2MKCA 3I32A 4WKYA 4F3OA 1P9QC 4TLQA 2FUG9 1T98A 5JR9B 2BVMA 3WC2A 2BE9B 3OBVE 2DITA 2UUBJ 4ELVA 1DZ5A 3H5YA 3IWLA 1HFEL 1YI2S 5GAEU 3MMCB 2IY5B 2A9UA 4DNDA 2W2MP 6FD1A 1WOOA 4ZDNA 2FIUA 4YJ2E 4DU8A 3C14B 4RNNA 4QWBA 3HVAA 3HM9A 1FWKA 4OI0A 3E2EA 4CO1A 3EVMA 4PJLA 1RWUA 3O6QA 4ILLA 3PE0A 2V4RA 3IWNC 1D0XA 3NOGA 1SQEA 5BYSA 4OL8A 3EYZA 1XMQF 4HGAA 3RH3A 4EK2A 5LNKA 1JJ2R 4DV6J 3KLIA 4BA9A 2DCFA 2IJNA 3TUJC 4LT6A 2IRXA 5CB4E 1ULRA 4TU7A 3PKYA 4J91A 3I31A 5KFAA 1RJJA 4JI3F 1IBMF 2R7TA 1W09A 4NUUA 3BH7B 3EPIA 5L3FB 1FWLA 2PMHA 3QZ7A 1LWFB 2BM1A 4HI2A 3DU5A 4DV1F 2IC6A 2MZTA 3W2VB 3ZMZB 3W7BA 4G2AA 2EFQA 1FTRA 4TU9A 2JNJA 1WDDA 5IWAT 2J9CA 2D1CA 4M5LA 4Q25A 2CPIA 3DGVA 4OYKA 2C5IT 1HNWJ 3IGVA 2XSFA 2GGPB 2YNHA 3PUXF 3FFIB 2HRTA 1HL6A 4DUYF 2ZH4A 2A10A 2NYHA 4EAHA 3V6DB 2JSXA 3EGWB 4YOEA 1OS5A 2RS2A 1I6ZA 3W62A 2E7XA 4PK6A 4K2XA 1Q7LB 4DV3J 1N48A 3RGLA 1NZ8A 1NSQA 3PYDA 5GAHU 5B0GA 3KK1A 2B4PA 2A0FB 5KG7A 5I42A 2RRBA 3S7RA 1AW0A 4I2QA 3L7UA 1FWPA 4ERDA 1VQOS 2JHEA 2DGSA 2WCXA 2L3LA 2V2ZA 2XNQA 5TAOA 3ITHB 2V9WA 4IDOA 3K2YA 4ES1A 4C90A 2BR0A 3D54A 2E66A 1BR2A 5CZXA 4GO5X 2GHVC 3K8WA 3RKGA 3D3CJ 2IC3A 2QGFB 4R8UB 2K8GA 1F1BB 1WF1A 3TLWA 3J80U 1E1HB 2RSQA 3TLUA 1GTHA 5ETPA 3KOAA 1SH0A 3H25A 3BSNA 2VFSA 2UXBJ 2JQKA 3P5TL 1BY9A 4M95A 3V5SA 2KHDA 3SOLA 2CXDA 3D0HE 2YDRA 4M1KA 2XMUA 3L3PA 1HPZB 3QAUA 1HBNA 5F9LA 3OVSA 4KKOB 1RA7A 2VFRA 3TRGA 3R97A 3O9XA 1SBRA 2HPLA 4UEMA 4ER8A 5HAOA 1B0PA 3TW0A 5GAGI 4HFBA 1WSVA 1JXVA 5F9NA 3CC7S 4DV0T 1UETA 4LF9J 2ERRA 1X4DA 5CHCB 1NRKA 2DRAA 2YTCA 5DS7A 1AA1B 3GZ7A 1NDLA 1OYEA 1V3RA 3AHPA 3BQIA 5FL1A 3AEBA 1KP6A 1EX8A 3JQKA 3JADA 3FCWA 2MQLA 2OH2A 1F9FA 2XI3A 4AKGA 4IFVA 4PKDB 1YQHA 5HBMB 1LKXA 1KQSR 3DDKA 8AT1B 2ZC3A 4JI5J 2FJAB 4DIDB 1RTHA 1TL7B 3TI0A 4CN1A 3D1OA 2VUGA 3AA1B 2WVBA 4WZMA 2BX6A 5LBMA 3ZO7A 4PNIA 1HNXT 5HMXA 5HVHA 4X84A 4HWHA 1TUVA 3GCWP 4G6VB 2MQOA 1IWGA 1T94A 3PX4A 3IBFB 2V5CA 4OI1A 1T8BA 4A8KA 1EZ3A 1EETB 1U1QA 5L3BB 3PRBA 4NZ6A 4JBWF 3W65A 3PW7A 1XJWB 3C15B 2MSTA 2QA7A 2KFZA 5L47A 1Z2LA 1U1KA 5JDFA 1JK9B 5HSPA 4IDKA 3G6XA 2BJ7A 2CPTA 3JQMA 4ANDA 3D0GE 2A2FX 2QE5A 4MJKA 5A8RB 2FVQA 2VKJA 2C5KT 4MBQA 3QRPA 1CEZA 2ES0A 2YDSA 4M5DB 2QZ8A 2V63A 3UUMA 1KOHA 2DVIA 2MXYA 5L1JA 4DN9A 3GV7B 2GVZB 4B3TJ 2KNDA 3UNYA 1JLFA 2B51A 2YPZA 4K4YA 3G8QA 2HW3A 3WI3A 3M8PB 1NK6A 1HYSA 3CMLA 2HS0A 2R2UA 3B8HA 1ZA1B 1G6BA 2LEPA 3BF4A 5HO4A 2OFHX 4XAKA 4LF8F 1NBEB 1HKAA 1JNZA 1QVGR 5HMWA 4LF6F 4KGMA 1RBAA 2GAHC 1QLNA 2HPJA 2EC0A 2YU1A 2C3YA 4V19X 1JX4A 2XPKA 1NPRA 1RT7A 4RWWA 4OHZA 2OI2A 1FRHA 3M1VA 4XTTA 1YJTA 3QBCA 4X20E 5A6PA 3LDQB 3DLJA 1DURA 4YR0A 3CIRA 4K4UA 2BE2A 2DH9A 2CQ3A 1V3ZA 1AJ3A 2I5JB 3SDEA 2BJDA 4WXWA 2H88A 3M8SA 3WIVA 2FHJD 3T1HJ 2GVDA 5A8KA 4IGUA 4PQUB 3BQ2A 4OYMA 3LK3B 1PBUA 3I5BA 4L0RA 1WC4A 2MBGA 3F44A 3M2VA 5CD4A 1C1CA 1X5SA 4N41A 3V4IB 3UFEA 4URGA 3T5KA 2BDPA 2JEJA 5IOLA 2WY2A 1RK8A 2O3DA 3T1YT 2ZM6F 2D69A 3PURA 3FVYA 2BQRA 3X1LB 2ZBCA 3HJFA 1V3SA 4PWDA 1M5SA 1WDTA 5A8WA 1FE4A 3A8EA 4JI8F 2GJ2A 3CF5Q 2YKMB 1M5KC 1QY7A 4HI1A 2OPQA 2DNYA 3TWZA 4JYAT 4QWAA 2IBKA 3IG1B 4QR0A 1PILA 4WWSA 5AQLB 2PI4A 4DFJA 4H9PC 4PEOA 4NLQA 2GIQA 4U2YA 2LSGA 3BBBA 1OQ3A 4OX8A 1L0VA 4N5SA 1U26A 1Q16B 1GQEA 2W63A 1EP4B 3MEDA 3O3LA 3TLVA 2CZ9A 1MSWD 4URQU 1C4AA 3MA9A 2OTLS 2VKHA 5FY0A 4M94A 5AQIB 1FJ7A 3ZKRA 1DY3A 3FZ2A 2EK1A 4CO3A 1UFLA 3TAQA 3AE5A 5ADZA 2XS2A 1R7IA 5F0WA 2P9GA 3HSGA 2XLJA 4IDQA 1VR6A 4Y6IA 2YWFA 1D9FA 4MK7A 2JRKA 1XMOF 3T19A 4UOGA 2R42A 1R6VA 2KZ7B 1S9GA 3QGPA 2J6TA 5A0YA 2Z0GA 1QUUA 5KFHA 1FXDA 2CJXB 2L8KA 3R9LA 5B0EA 5J1PA 1U45A 3VAGA 1R89A 4DQIA 2MKIA 2A1BA 2F4VF 1UW9A 1YKEB 4Y2AA 4O4LE 4M5JA 1UPMB 1X9WA 1Q5YA 2Z4PA 1H72C 4W90B 4YN3B 3K5OA 4M5KA 2ODUA 2DGQA 2WCAA 2QX0A 3PFOA 4FBTA 4F8RA 3ENQA 5J2MB 3AE6A 1YJVA 5J2PB 1ZEEA 1ZV4X 1RDRA 2V8DA 3H5XA 3GJSB 3D5MA 5D0GA 4X4QA 1SQGA 2D7SA 2ZVSA 1M5VC 1P1LA 2EFVA 4DEZA 1ZHCA 1O8BA 1CHUA 4KV8B 5LGNB 5B09A 4IR1A 4IH6A 3CX8B 4X1IE 5L1LA 3KV4A 1TUWA 2ODVA 2Z2MA 2YQ0A 4HWFA 4IKAA 2DYAA 4CH1A 2WBRA 3TZZA 3JAMU 4OYIA 3BEGB 4CDIA 3EGVA 3KMSA 3KK2B 3JQJA 3T1YF 2LCWA 3OT9A 2IDEA 3P50A 1HWUA 2PEHA 5I3UA 2WOMA 1JLGA 4BC9A 5H9FJ 3NXZA 4BHQA 1NEEA 4E0DA 1SJQA 3MCSA 4TVAB 1HMVB 3OXLA 1REVA 2UXNB 3NRBA 4LF4T 1S1XB 2VKOA 3SIPB 3LGMA 3IGNA 2LKZA 3H5SA 3NP5A 3BR9A 2PMWA 1NDPA 2IJRA 4ID5A 3D1QA 3Q8PB 3CJ2A 5IYZE 3UPFA 2YWHA 1DLOB 3H90A 1VI7A 2I0XA 4IO1A 2JC1A 2LECA 2B9WA 5FD1A 1K47A 3OBIA 5D77A 2CVEA 3HFZB 4HACB 3I96A 3RIUA 1GNKA 3DM2A 1O3XA 4HT5A 4V1Av 2QA4S 3NCQA 4OQJA 2C2RA 1RAOA 4OHVA 2BE7D 2NTXA 4ZHRB 4ZVSB 3ETOA 2W4XA 3GYGA 3NMAA 3QB5A 2ZKUA 3JC6D 2MJUA 5DQWA 1HBMB 1HF8A 2FUPA 5AXMA 2WSFC 3HVRA 1HWKA 2G0CA 2YEVC 2FVPA 5L2LA 5DZ6A 2RILA 3DLEA 3P4SA 3GP9A 2C2ZB 2VC1A 3QIPB 3E8OA 2FC9A 3RJMB 1MMGA 5HK4A 4F3MA 2X0YA 1SVDA 1A7GE 5AQOB 1MMDA 3CMQA 3G06A 2V6YA 2RDDA 2UVVA 2GK9A 5D4OA 3NY0A 4GOUA 3C16A 1E6YB 3A13A 5I4MA 2NR0A 2RF2A 3FMBA 4XIUA 5KOXA 3CJQA 1N4LA 3PEJA 2WONB 3EAMA 3RBDA 3U1NA 1LWXA 1NB2A 4RLEA 3J80Y 1VCTA 2VKRA 3JSMA 4L75A 5G4DA 4EI2A 2YWKA 3UR0A 1TL3A 3ONJA 2OP5A 2X1GA 1U1MA 3QLHA 3FSIA 4K4TA 4NXMJ 2DIVA 4IO9Q 2IM1A 3BDEA 1RTIA 1XR5A 1HA1A 4M63A 2YKNB 5AT1B 4KFBB 3AT1B 3FBBA 1TV6A 2CQ0A 3PY8A 1A0OB 2X1FA 2DHRA 4L76A 1NDCA 4KYZA 4YDXA 1WD6A 2WVFA 3IS9B 3RAXA 4PR6A 4JLEA 3KUEA 4DF8A 4ZCMA 3K5NA 2CZ4A 3DLGB 2XZEA 4C91A 4N47A 1DAXA 3TOQA 1RYRA 1IKWA 2W2NP 2XM2A 4B9UA 4BCAA 5HQLA 3SXLA 4X65J 4KBIA 3GR1A 3PHEA 3R7NB 1VC0A 1H2UX 4ISTA 2C2MB 1ZA2B 2ZE2A 2UUCJ 3AEGA 2DNPA 3OJAA 5B0FA 2QYWA 4WP3A 4IOBA 1X4EA 1XEZA 4HEA9 2J0XA 2HKEA 1NSPA 2FJDB 4U67Q 4JOUA 2AZ1A 2KWIB 3TR5A 2ZBIA 2IYIA 1HR0J 1R8IA 4OZ5A 3BO2A 2DNXA 1VLOA 1TTHB 3CMES 3QWPA 1G8XA 3EVYA 1X60A 2YPYA 4KHZF 4UUWA 3QJLA 4YJ3E 1VGYA 2HBZB 4AQYT 3M32A 4QQBA 2XM1A 2I2YA 3HKBE 2PI5A 3PTRB 3C8YA 5IM0A 5E33A 4NXNF 4EZ4A 4ZK7M 2G1DA 2VOOA 2HURA 4F7VA 2BQ3A 3BSAA 4Q5VA 3ZC4A 4DR7T 1RWVB 3J81U 4E7SA 3CVKA 2LEAA 1LK5A 1PJ6A 4K4XA 4KH0B 2LSYA 4DQSA 2ROEA 2CXLA 4I67A 2CNLB 2XAHB 1CJKB 3UT5E 1WACA 1MROA 5LYJE 3ILIA 3H5UA 3NBXX 2MEWA 2ZH6A 1SH2A 1NB7A 2Z6EA 3BQ0A 3TLTA 1IQTA 4PK5A 2DPJA 2F4FA 3CW2C 1HNVB 4CYUA 3KLEA 2XQ3A 3C50A 2G2ZA 4B3MJ 5K8NA 5EK4A 2W9BA 5KFKA 3I9V9 4P72A 4K59A 2XLKA 4KE5A 5B0AA 3DC2A 3X1DA 3DDIA 4ZI7E 1IKVA 2E29A 3ZCJA 4A8XA 3W3SA 3BGOP 1M5OC 4X4VA 1O0PA 1U5PA 2CM0A 4ATNA 5K8MA 4P7TA 3R7SB 2Q6CA 5GVQA 1LFWA 1U8WA 2V4QA 2V5DA 2D0UA 1W2IA 3BH6B 2ZFHA 2JEGA 3L4BC 1KNZA 2OLTA 3CDWA 2WU2A 3LP1A 2HMIB 1RWWB 4K4WA 3BQKA 4F67A 2MY7A 3FMWA 4CLSA 4J9SA 1WKJA 1ZAVA 1N5YA 2JPFA 5JJBA 4DZDA 4IOCQ 3N0VA 3RGIA 4ECQA 3QPIA 2W9CB 3N9MA 2HBYB 2G0IA 2EXUA 2DGTA 2HH7A 1YGYA 1Y64B 1VQ5S 2DHGA 4DMVA 3EZOA 4B3RF 2FZKB 1M1KT 3FBZA 4LVOP 4KGVB 1C0UB 4DL5A 3EGNA 2HFOA 4G63A 4FYDA 4ZS3A 4CZZB 1M62A 2VL8A 2X7IA 1KEKA 2M7SA 2EI5A 3F0NA 3TNVA 2FJEB 3T6JA 4H4KA 1S49A 4C8NA 3B4MA 5HJYA 2GMJA 4M5IA 1VJQA 2ASYA 2X9WA 4M5NA 4CH0S 4X1YE 2M9KA 1CLFA 1PC5A 1F0XA 1VMBA 1LRZA 5KFJA 3NZPA 1NM2A 3KDSE 1GEHA 4ZA1A 1B3TA 4U9RA 5FMNA 4P2XA 1HNIA 2B0GA 4LF2A 5A2QU 4JV5J 3RG6A 2EWHA 1XC9A 2FGOA 5E3AA 2DNHA 1UPPA 5JDLA 5F8IA 1FX2A 3FQLA 2MMYA 1S1VB 2LT3A 2AP6A 3UDVA 3R2DJ 4ZLJA 3ZMUB 2PC6A 4ZVUB 1RWPB 4RL1A 1TKZA 3IHRA 2ZWOA 2VG7A 5CYQB 1LW0B 3UUBA 3M2UB 2X3GA 5A76A 3QIDA 3W9JA 1WJ9A 5ETVA 3BBFA 4DR7F 3SQGA 2HK2A 2VDHA 1IWAA 3POTA 3UI3A 1FD2A 2K1RB 5LGTB 2DHXA 1WTFA 1OWXA 2XHCA 3GA8A 4MKVA 2E9XA 3Q8YA 5H1SV 3P7IA 5JR9C 3Q5DA 1RTJA 3RHWA 4F36A 3ONLC 1RB0A 3OR1A 3T8OA 2MKYA 4RW9A 2A2DA 1VQKS 3AA0B 1BE4A 3ZN1B 1S99A 2F8MA 4BWMA 5CABA 3PM9A 4EEBA 5IT4A 1DU2A 3J7A1 4JP8A 2R7XA 3TJAA 1OJ4A 2RP4A 4DV1J 5DG8A 2WZ1A 2HSEB 2DNKA 4ED5A 4UUXA 4DQPA 2D9PA 4AKLA 2JLEA 1N34J 2YX1A 4FJOA 4AXPA 2XQ8A 2HFSA 3VGSA 3ZJ2A 1KTVA 5JUMA 1NJIT 3C98B 4OJGA 2GIFA 1HLWA 5LMNF 4DUYJ 4L73A 3KK3A 2Z2ZA 3AD8C 5J2NB 3MPYA 1VHIA 2QRRA 1RABB 4Y2KA 2ZITA 3RB6A 4UW2A 1QAXA 2B4VA 5GMKa 5IHYA 4UOFA 2WSSV 3BM7A 2A3DA 1AROP 2RIJA 1QUPA 3JAMY 2N9DA 3DOMA 4IH7A 2DNQA 5ETOA 1IBKF 3A8KA 3D6MB 1R0AA 2K7KA 4O4RA
chains in the Genus database with same CATH topology
1D0ZA 3KLFA 5HL7Q 1VQNS 3LOUA 3F41A 4J9LA 4ZI3C 1LWCA 7FD1A 3KLHA 4H63H 1F5BA 3IBPA 4H9RC 1DTQA 2FLOA 2ZNZA 5LP6E 3MUTP 5DGAA 2DGVA 4UY85 2KG1A 3HR0A 1OSDA 4MKYA 3MR6A 1U2RA 2VV5A 3MEEA 2CQ1A 2H9ZA 1RT3A 4LUBA 3M6WA 4ZP7A 1FXLA 2J6SA 5E3RA 5M2PA 5GAEI 4ED7A 3T9NA 3DRSB 4C3KA 3ZZYA 3BGUA 4MTPA 1VFJA 4PXDA 1TK0A 4U6PA 1D8YA 3PO5A 1Q1KA 1FRJA 1AUDA 1GXUA 2KXNB 4C9DA 1HD1A 2FVRA 3HA4A 1RT5B 1LK7A 2CPDA 4X65F 3UTKA 3E51A 4DR4F 4DUZF 4ED2A 2IMOA 3RU0A 2ZDOA 4MMOA 4DL6A 1NKBA 5EWGA 2C42A 2B6AA 2UVUA 1IKXB