1KNZA

Recognition of the rotavirus mrna 3' consensus by an asymmetric nsp3 homodimer
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
157
structure length
154
Chain Sequence
b'TQQMAVSIINSSFEAAVVAATSALENMGIEYDYQDIYSRVKNKFDFVMDDSGVKNNPIGKAITIDQALNNKFGSAIRNRNWLADTSRPAKLDEDVNKLRMMLGIDQKMRVLNACFSVKRIPGKSSSIIKCTKLMRDKLERGEVEVDDSFVDEKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*UP*GP*AP*CP*C)-3'
publication title Recognition of the rotavirus mRNA 3' consensus by an asymmetric NSP3 homodimer.
pubmed doi rcsb
source organism Simian rotavirus a/sa11
molecule tags Viral protein/rna
total genus 52
structure length 154
sequence length 157
chains with identical sequence B, C, D, I, J, M, N
ec nomenclature
pdb deposition date 2001-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.550 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1knzA01
3.30.70.1610 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1knzA02
1KNZA
chains in the Genus database with same CATH superfamily
2RILA 4OX9F 2XSJA 4NZ0A 4K4WA 4TNVA 4B3ST 1W7WA 3FBFA 4P7TA 5A8WA 1S99A 3BR8A 4L0RA 2IJNA 1L3SA 2CXLA 2ACMA 2C3YA 2P8IA 3GFXA 4RW4A 5CYQB 2BANA 3IMQJ 1Q16B 5L1KA 4DUZF 1QVGR 2B6AA 3DDNA 2Z8QA 5HQLA 3E8OA 3N4WA 2Z0GA 1F6TA 3BSAA 3C4WA 1OEDC 2N9DA 4FYXB 2KT3A 1GTEA 4X2BA 4B17A 4PR6A 2O3DA 1BR0A 7FDRA 3UDEA 4ZVHA 1DQAA 1N5YA 1REVA 1YQHA 2DXFA 2BW7A 3UQ4A 1UPMB 4NLDA 5KFNA 3THVA 3H2LA 1D0EA 1HX1B 4HWCA 5F8IA 3UD3P 1GX6A 1UVLA 4DUYJ 3AH6A 2KXFA 2KFNA 4Z8XA 1W2IA 2FZKB 1PBUA 2AEJA 4ZVEA 1LOUA 1TAQA 4K50A 4OYXA 3THTA 1I51B 3ETVA 3L3CA 1AUDA 4RWXA 1WSRA 5J2NB 4PXEA 4ILUA 2HHHF 2WAUA 2FJEB 1NEEA 3W1YC 4ANJA 3QLHA 1Q4RA 3MA9A 1WC6A 4KGMA 5FMNA 2OPPB 3SFEA 1RGVA 4UF0B 1LWFA 1XNQJ 3P4QA 4RR5A 1IJ6A 4LQ3A 4U7CA 2JRKA 4MMOA 1LFWA 3MM5B 3J81U 5GAGU 3WC0A 5CZXA 3ENWA 2VBXA 4ZS3A 2GQ2A 4I1TA 2K7KA 3I0SB 1X0PA 5LJ3Y 5KFYA 2NTXA 2XPKA 2EVZA 1JLFA 2D9DA 1P27B 3FSIA 2XM1A 3TO8A 2FLLA 1S72S 5LSLA 3AJ1A 3D3BJ 3SQGA 4EZHA 1UW4A 2QLWA 1UCUA 1X0FA 3CSKA 3NNHA 2R4FA 5JDGA 2VURA 2GGPB 4BCAA 1TVRB 1WKKA 1W26A 1HW8A 3C16B 3HHDA 2AZ1A 3RAQA 1FEWA 3IBCB 4Z90A 3NVOA 3DYAA 3W8GA 1RT2A 3KK1B 2VU5A 4DPWA 3Q22A 4DV6T 5KFXA 2XEXA 2KZMA 2L8KA 5HROB 2DWKA 4I7FA 3OYXA 4R0JA 1LW2B 2HQ3A 3PHTA 4F4AA 4FNIA 3OTEA 3W61A 4A8FA 3IG1B 4CN6A 4C8YA 4N76A 2V8PA 3D7SB 2OEJA 3RAMA 4URGA 1S6PB 2IIHA 2VFSA 4OI2A 4I4BA 4ECRA 4HH0A 4MKYA 2FHJD 3N6NA 4C8ZA 2KG0A 1R27B 3CDWA 4MJKA 4P74A 1T9WA 2RF2A 2WONB 4JEHB 5CHCB 2AHOB 2PFDA 2JQ9A 1YZ7A 5AQNB 5FL1A 2ATLA 2DR7A 4U9RA 4QXCB 3GJSB 1JLGA 2AW0A 3W62A 4KBMB 4JI2J 4IG3A 3VHQA 3PFOA 2LEBA 4X1IE 4WTYA 1GFWB 4RBTA 4LR8A 1I94T 3QIPA 2F8EX 4RKUC 1RWOB 5C25B 2Z2YB 2W2PP 1IJ5A 3AT1B 4JP8A 3ICLA 5A2QY 2PIIA 5KFVA 1UJ6A 2VPZB 3JSMB 2RAQA 1KBRA 2DNOA 5K8MA 4CLLA 4CH0S 4HFEA 1LKXA 3R8YA 3TANA 1UAWA 1DZ5A 4WNKA 2NW8A 4YOEA 4I2PA 2XZWA 2HLUA 3LK2B 1HQEB 4IFVA 2ASYA 1WORA 4L3NA 5KFDA 5F0WA 2DNKA 4UOHA 4C8LA 1CHUA 1MSWD 2LKZA 2AE9A 1RT3B 1JXVA 2H4WB 3U78A 3KDNA 3NWIA 1SUMB 3BO4A 3RQUA 1T98A 4DNDA 2QYCA 2Z2LA 3TAPA 1KEYA 2VQFT 1RACB 5EHHA 3T9ZA 4WXOA 3OVUA 2L41A 1NHVA 4DV1T 2K2PA 3GMGA 4ISTA 5HXEA 2KI2A 1FJGJ 1UZHA 2OJ3A 3GWHA 4UUWA 4OJHA 1K1QA 5DLFA 2A9UA 2VV5A 3DRPB 2YNFB 1QM9A 1FTCA 3LBXB 4WW0A 2ODVA 3JYTA 1VJWA 3R6GB 1KSPA 1SJQA 1VQ4S 3UU6A 3IBPA 1XK8A 4Z37A 5H6QB 1ZZNA 2L9QA 5L9XA 1FFSB 2BVMA 1D3WA 4M5LA 5A6PA 2ZH6A 1YQ4A 4ATNA 5KT7A 4ED4A 1TV6B 2XI2A 1ZAXA 4YTMA 5M2PA 3GU0A 3W2WA 2NXUA 3PY8A 3I0RB 1MWZA 1FKPA 2G2OA 4DMZA 2V94A 5I3PA 4DR3T 4PK6A 3BS9A 4DSKA 4S0MA 1K0VA 4QR1A 2CPHA 2XYPB 2RU9A 3E3XA 2DR9A 2ILZA 2J8AA 3MMAA 4B3RT 1FKAF 4Q7AA 2W9CA 2CG4A 3OLAA 2DCUB 2VQEJ 3PZPA 1C1BB 3N6MA 3MMJA 3BBBA 3LJCA 5F9NA 2RQCA 5ETVA 3NOCA 4XPCA 3PNIA 3R5DA 3ZXWA 4L6V3 2C42A 1F2GA 3IBFB 5KT5A 1WWHA 2EFVA 4CIOA 4CCHA 1D8YA 4Y34A 2GMHA 2Y1RI 4J9SA 1HA1A 4OYAA 1N36T 3ZMZB 1S4EA 1IWAA 4ITSA 4ZHRB 4N78D 2DO0A 5KFCA 4O4HE 4DV7F 4A46A 4HEA9 1WC1A 2CQ3A 2V0NA 2KT5A 4CLWA 3PX6A 3BK9A 3MPYA 2DNMA 1RCXB 3DM2A 1WEYA 5IT0A 3B82A 5AE2A 1B0VA 5LHIB 3T41A 1WI8A 1I94F 3PYFA 3ZZZA 2LM2A 4N7TA 3ET6B 1KFDA 1ZPVA 3IP0A 5LMNF 2YH1A 4DV3T 3JTPA 2DR6A 3POTB 2XTJP 1R8CA 5IC6B 1TL5A 2CQGA 1Q81T 3GYGA 3BREA 4EMDA 2DO4A 3PEHA 2VFTA 1U0SA 4OYJA 1FO1A 1YKWA 4EOZB 1VHIA 1N54B 4PFPA 3T6BA 4IFYA 3MEKA 3RC8A 1QE1B 2BVZA 4JI0J 1T9VA 4Q2LA 1EP4A 2QVAA 2FY8A 2DGTA 1WF1A 4IDNA 1HMVB 2DGXA 3LDQB 1NSQA 1UP1A 2FVRA 2GS8A 4PG7A 1J5ET 1FRJA 4NUUA 1LNQA 3WI3A 3UD4P 2R7XA 2DITA 1HKAA 4TLQA 1VFJA 3FBLA 5HEGA 2IYGA 1SJFA 3J7Z5 4DUYT 2CHOA 2WSFC 1LVFA 5IM0A 2EHOA 4QIWD 4YTPA 2HQCA 1NAQA 2F9DA 3HX9A 1SJ1A 5E3CA 1BD6A 8RUCA 3A12A 5ETQA 1LWEA 3TUJC 1XNRJ 1SCJB 3M32A 3CULA 2Y8YA 3CWZB 2X1BA 2RS2A 2B1EA 5BYQA 4RNHA 4TXSA 3UW1A 2AYEA 2H54B 1FKOB 3HSJA 3SZ2A 5CYQA 3OR2B 4PXCA 1HPZA 2OTLS 4NL5A 2RP4A 3Q8UA 4B9SA 2LSGA 3G87A 3K89A 4YY3T 3UULA 3EZUA 3ZZRA 3BQ2A 3V6KA 3CC7S 1QAYA 1VQ5S 4U6PA 4TNWA 1N4LA 3EGWB 3GWCA 1FRHA 1WD6A 3KLEB 1JKHB 5FP3A 1N6QA 1F3VA 4R0EA 3TAMB 4IRKA 2MKSA 4DR3F 2IY5B 1ELOA 1HR0J 2WP9A 3SFUA 2V7JA 1NNDA 3TVYA 4F0HA 4O4IE 3KHGA 4B3RF 4ELVA 1WKJA 3GYNA 4F4XA 3LP1A 2VHGA 2BW2A 2VH7A 2LRKA 2ZHBA 2J6TA 3TJAA 2X3DA 3CD5A 4LF4J 3TQEA 2VKDA 3U1LA 3AVSA 4H54A 4FVCA 5HVGA 5J2NA 3DKDA 1T7PA 2ZDPA 3JTNA 2FJEA 4OYKA 5DS7A 2EBEA 1EZ3A 4PYDA 2XB2D 4U31A 2WB5A 4XK8C 4CYUB 3HJVA 2QMWA 4JV5J 3FSYA 4NPOA 5I4MA 1N36F 2DY9A 4UF0A 1E6VB 2ZM8A 3MXZA 2FJAB 4L5GA 2DHGA 3K59A 4TY9A 1ZS6A 2CPEA 2W01A 1M0SA 2V7MA 5ABEA 1Y11A 2H48B 4LF7J 3I0SA 3FGVA 1HG2A 3CO0P 2RS8A 1CPZA 4F36A 2YBVA 2JWNA 4OYWA 1VBZA 1T05B 2H3EB 1NK8A 2IUBA 5E3RA 1RTZA 2Z2MA 1MMDA 1KC8T 4YSZA 2Y6XA 4U8VA 5IWAT 1J5OA 2V9WA 5IZHA 1M1KT 3QWPA 2G1HA 2GW8A 1M1HA 5JDHA 1HNWJ 1TVRA 2YX1A 4DR2T 3Q8PB 2MKKA 3ONXA 2DGOA 1NB2A 4F4WA 3KK1A 3RBDA 2ZOGA 2LQBA 2NR0A 4ZVSB 1MROB 1UVJA 3LGMA 1UPPA 1LW2A 3S7RA 3MM8A 3RUBL 3IG1A 4Q25A 4X84A 3RHWA 3K3OA 5C24B 2MZRA 1S6PA 4ILCA 1WHVA 2D1CA 3I4HX 3PIPQ 3Q5DA 3KOAA 1LQ9A 4DX8H 1GMWA 1X4EA 1J5WA 4B08A 1PO6A 4JI6J 2ASLA 5AFUL 3CIRA 2JJ4D 2ZZNA 4LRCA 5AQKB 5KX5E 1WSVA 4K4TA 2JQKA 2UV8A 2LHRA 2KLQA 2YTCA 1FMWA 5D4OA 2N3LA 4H9NC 4MHCA 5AQPB 4DL3A 3N5FA 4DJBA 1HHQA 2XZTB 2LHNA 4GK5E 1G7CB 1XNQF 4MBQA 3TLVA 5LXRA 2BMBA 4ECZA 2YNHA 3UNGC 1NMEB 4G1PA 2HK2A 2C0SA 1U1QA 4PAGA 1KQGB 1SC4B 5C25A 3BQLA 5CD4H 1FXDA 4K59A 1XR7A 2XNQA 2ROPA 1T3OA 2FJWA 5CCLA 3JC6C 1MNEA 4C2MA 3I5CA 5BR8J 2HBYB 2E5HA 2BBHA 3Q23A 4I64A 1B0TA 4CLSA 3PUWF 2VASA 4DHVA 4CI2B 2FGOA 1YLXA 1RT3A 1FVSA 1HFEL 4P72A 2A2DA 1HNXJ 5JDMA 4LFCT 1WG4A 2RVJA 4PKDB 2AX1A 4C3MA 1S10A 3ZZYA 5KFWA 2DNZA 4O44A 2GQQA 4LBHA 2OFHX 2MKIA 2KJVA 4IR9A 4I4TE 4YS2A 3PXGa 1RT5B 2M6IA 4LR9A 2W1BA 2MKCA 4ZVUB 3M4XA 3MUTP 4TLRA 1U6BA 1WKLA 3BH6B 2YNFA 3LWLA 2CQ2A 4TY8B 2GMJA 1HBNB 4XBFB 3QT5A 4Q5VA 2NXJA 1ZOYA 3RYCE 3BJYA 3RYFE 3GIRA 1H7WA 5LHGB 4JI2F 3HPOA 1TV6A 1PGZA 1HFAA 4USMA 4HT7A 4DR1J 2EWHA 2IM0A 3FC9A 3FQLA 4UQGA 4R5PB 3I0RA 2OPQB 3Q9DA 4UV8B 2OH2A 5IUXA 2KO1A 2MY7A 1WOSA 2CNLB 3RGLA 1VBKA 1FWLA 1D1AA 1Q5VA 3KDSE 4USHA 2XQ5A 1W09A 3D54A 2C3OA 1XC9A 4UZCA 2VK9A 1QUUA 1CBKA 2SPCA 1C1BA 1EIYB 1H7CA 4YB1P 1RXOB 2HBZB 2NREA 4HKQA 4TU8A 5JR9B 1GXLA 5C42B 2Y8WA 4J9QA 4JI0T 1TUGB 3ZZOA 3G86A 4ID5A 1KKHA 3SEOA 4Y2KA 3UCUP 5KAKA 3CCVS 2AF6A 4HEAA 2H65B 3RW6A 1O6XA 1H7XA 4GK0E 2MKHA 1EETA 4LSZB 2Y3YA 5K8OA 2IMOA 4ILMA 2D3O1 2AIRB 5FY1A 3UI3A 2V69A 1Y3KA 4B9NA 4FYWB 3H59A 1V5IB 1IBLJ 1S7IA 2ZH3A 1DY3A 5HN0A 1HNZJ 3Q8SB 4FXVA 1X5TA 3SBMA 4USVA 1FJGF 3QOFA 1YTYA 5GAHI 3MCSA 1S1VA 2YKNA 1TL1B 2WCAA 2O67A 3RPUA 1XMQJ 3PVXA 3TX0A 3NKYA 1FJCA 1HBUA 2XO6A 4DV2J 4NOHA 1RAOA 1SIWB 4EO6A 2IA6A 3FZBA 2CWOA 2XY7A 2EFGA 2LU2A 2RRNA 4YHHJ 2UUTA 4UW2A 1S1WB 3LP2B 2QIFA 3RRHA 3R5AA 1ICEB 1VRQC 2VG7B 5DQHA 1WYBA 3O1HA 4K2JA 1U1LA 5J1EB 1QE1A 4ZI3D 1XERA 1TMJA 3ZKRA 3CJ4A 2MJNA 4DR6J 4OHWA 1AROP 3CWJA 1HMVA 2V8DA 4J5OA 3W66A 1JXLA 3FCHA 3BV8A 1SL0A 4AQFC 4Y2CA 3Q2SC 4LF9J 3TZWA 4JOUA 1HQUB 1NHUA 1RT1B 1HR0T 4WE1B 3GLJA 2JMHA 2YY3A 3NS5A 4ISSA 1JNZB 2D0UA 2DHAA 4LFBJ 2VB6A 3OD2A 4JBWF 4QXHB 2H7OA 4EV6A 2VQEF 5AQVB 1JLCA 3EUHA 2HZCA 5E3PA 2XLIA 3CF5Q 3LALA 1NWMX 3H4BA 4LF4T 1XDPA 2NOXA 4DUTA 1GQEA 4MFBA 2C2MB 3I0OA 4OI4A 3N9NA 3RRCA 5FVLA 1N0UA 3QNWB 2XNRA 1D9FA 2BJDA 2ZH9A 1NU4A 2UXDJ 3PJWA 2ATCB 5ETOA 4DSEA 4I56A 5ETLA 3RRGA 4RU9A 5LG4A 4JV5T 1RCOB 2AGQA 2CNNB 3T1HJ 4M94A 2VJUA 2J0WA 4EK2A 3OR2A 1L3VA 3N9OA 3EWGA 3VAKA 4DBRA 4U2YA 2YWKA 4NRTA 4PWDA 3JTOA 2HWHA 2QTWA 2EC0A 2KXNB 3A8EA 3G8TA 3FKBA 4JV0A 3N9QA 3KLEA 5K5MA 3GA8A 2H5IB 2CQ1A 3AA9A 3ILJA 5CXTA 4K0KJ 1GXUA 1PYOB 4CM0A 2XY6A 2FZGB 2LKHA 3D0GE 2XSAA 4CLTA 2LFVA 4ANEA 3T5KA 4IE4A 4X5TA 3UU4A 1YBUA 3FMWA 2K8GA 1FNMA 2MKJA 3CUNA 3BM7A 3AXJB 2QMUB 2A18A 2EEYA 4C98A 4YJ3E 1HNWT 2JSXA 4FBTA 4RNFA 4EXTA 2YDQA 1M1GA 2DHSA 3T8OA 2IFXA 3PURA 2NSBA 3V81A 2JLFA 4P2XA 4JI0F 2Z56B 2N4DA 3DI6A 3R2DJ 4MTPA 1KLNA 4LF2A 4TNOA 4BC9A 2XQ4A 5I42B 3HHEA 3JXOA 2ZE2B 3EDQB 3FVYA 4ETZA 4KGZB 3PDNA 4CYUA 2ZOMA 4DPXA 4OHFA 2V2QA 1JK9B 2LT3A 3RIUC 2EI5A 1IUJA 5LSRA 4O3OA 2NUHA 1KLMB 5FLXU 4KO0A 1ZP0A 4K4UA 2OI2A 1E6VA 4DMWA 3HZEA 3T1YT 2PO4A 4P6QA 2W7AA 4CLUA 3OUYB 3NS6A 5KT4A 3RIUA 1JNRA 2F7VA 5DG9A 4X66J 1S9FA 1M7KA 1XNRF 1BGXT 1U24A 3WAKA 3N2GE 2DD8S 4PPZA 2QLJB 3KLFA 3LAKA 1JJ2R 3MPWA 2DLRA 2HH7A 5KTQA 2YNIB 4ICLB 4O8SA 2NXCA 1J1JA 1S6OA 1H2VZ 4QU6A 4IR1A 3VKGA 3IR7B 2AWZA 3SV4A 1SJRA 2AJ2A 4WFXA 3ZMTB 4WIIA 2Q9QD 2GJFA 2V9KA 2MJUA 4GKJJ 4RW7B 4ELTA 2CQIA 3H40A 1NJWA 1OS5A 3SDEB 2QJ3A 5JJBA 4H4KC 1WNEA 1NDKA 1RT7A 1XDOA 2CPTA 1JJ4A 1HR0F 5EX0A 3IR6B 4LIWA 5BR8T 2PFFB 4C9DA 3G82A 3EDVA 3TEGA 3F57A 5C24A 1NDPA 1SUQB 2F4VJ 2V26A 3GP9A 4ED6A 4CP5A 2KYXA 4OHXA 3DRYA 2HVEA 3C64A 3E08A 2OPSB 1FXRA 2H3RA 2HHQA 2AXDS 1WOOA 4LF4F 1TFYA 4U72A 4XIUA 3HKCE 4AKIA 1CVJA 3UNYA 1RAJA 3IRWP 4JEUB 2R2SA 3OBVE 5ETPA 3OXFA 1RA6A 5E2QA 1L3UA 2BG9A 3VU7H 3HHNB 4O2BE 4C4WA 4JV5F 1G1XA 5HVHA 4LFAJ 4ZJOA 1LW0A 1EARA 2MPUA 4FNHA 1KTVA 4GO5X 1K8AT 4B3OB 3PU8A 3KDOA 4B9TA 2VIHA 4C91A 3M9MB 5KFLA 2KU7A 2Y8DA 3ZCIA 1HWLA 4LF7F 2B0GA 3AB4B 2LSYA 4OZ2A 4ZP7A 2WCXA 2YOEA 4GRSA 1X9MA 5LA6E 3U1MA 5LJNA 1BWEA 2W4XA 2FHJA 1TKZB 3MEEB 5HEHA 5HMZA 4H63V 2XM2A 5CABA 2K48A 4LF1A 2RUGA 3E51A 5LGNB 3SI8A 2W7OA 4DR1T 1UEUA 3RYLA 1HNWF 2G9OA 3U3IA 1R8HA 2BBEA 1HNIB 4X4TA 2HKEA 3NRXA 4P2FA 3RGIA 4TQSA 4YTNA 3PTRB 3MAAB 2C2OB 2HBRB 2HGNA 2QN6B 4R8UB 4C11B 5DDOC 2YU1A 2KINB 4ZLNA 3MR6A 2ZM6F 2R8JA 2JEFA 1OSDA 3CJKB 2J9CA 2GV1A 3M05A 3A8KA 2OSQA 3ZTRA 2QA4S 1RT5A 1NK5A 1XMBA 5H9FJ 4J91A 3LF0A 2CA5A 2WU2A 5B0BA 4JI6F 3FZ2A 2KH9A 1IWGA 4U33A 1PC5A 4M5NA 4N8OA 5GADI 1QSYA 1WOPA 3M8PB 1V9DA 2HYIB 2OLTA 5K8NA 4ZVOB 5J2MB 2W61A 3TUIC 2M8HA 4IGUA 4NPPA 4ID8A 4WF9Q 1RWXB 1ZHCA 1IBLT 4CLPA 3OYZA 1HNZT 2M3DA 6FD1A 2DRDA 5LG3A 2FJDB 5FJ4A 3QSIA 1EAYC 5AQJB 2BE2B 1XMQT 1DTQB 2WVCA 4OZ1A 3TA2A 3VVUA 3BPDA 1P9YA 2PE8A 4DFJA 3M8QB 3RF1A 9ATCB 2V4RA 4DPTA 1O8BA 1D09B 3OJAA 5JR9C 5L3CB 2DI4A 4F67A 1SC1B 2CJ9A 3M30B 1SA0E 3QB5K 2ZC3A 3FCWA 4WXWA 5BR8F 2NWBA 3EJMA 1S1UA 1ZOTA 3K1SA 1I3OB 3N6LA 1IKXB 1JIHA 5C42A 1R0CB 2QSWA 1AB8A 5DRKA 4IDPA 5T41A 1VQ7S 1Y64B 3NBPB 1N56A 2I2YA 2GHVC 1HNXF 2HWTA 2LYVA 1FE0A 4U74A 3BGLA 2GVDA 2FC8A 5DQIA 2AYBA 1RUSA 4WWSA 2NXEA 3W5YA 2QA2A 2YX7A 4CO2A 4DV5J 1TL7A 4N41A 1BQMB 4RW6B 1ZA1B 1S0MA 4AXPA 1U0HB 2AT1B 1NDLA 3KLGA 5KG2A 1FEEA 2MY8A 1K0TA 1V3ZA 4CXWA 2LM9A 4DLEA 1JQGA 1FNXH 2HHPA 5F9LA 4ED2A 4TZ4C 4NXNJ 4FP9A 4FPIA 1U49A 1RT4B 2ZZTA 2GMLA 4O2AE 3AJ2A 1GXTA 3FZLB 5FYMA 2J62A 2LQJA 2JEJA 1S59A 3D2WA 2VG7A 4DR1F 4HACA 2FVCA 4UVAB 4DWIA 2XQ6A 3CJ8A 4JI5J 5ETNA 5ETWA 3ZPOA 5ETKA 2J1DG 2B9YA 2I6WA 2ZWOA 2I0XA 2PT0A 1HQUA 3N79A 5C7PA 4FS1A 4IIJE 3E0ZA 5AQMB 4OMFG 3DOKA 5K14B 4QIFA 2J47A 3SCLE 3DXBA 3NZQA 3RB4A 2DIUA 4DF8A 5AXMA 4IREA 4F25A 3NG8A 4DG1B 5L9NA 3K5LA 3CCES 2R8GA 2V6AA 5CA5A 3BGRB 4QW9A 3ZC4A 2PN6A 3PKYA 3DGPB 1YRUA 1F60B 1KNZA 2OTJS 4ZPAA 2YINA 3NOGA 3CX7B 4QX8B 1TL4A 4XTTA 2QMXA 2CIMA 3DU6A 4KFBB 1XIQA 3W63A 4OJ3A 3W9HA 3HL6A 1HX8A 4KE5A 3C15A 4PNIA 2JQQA 3CX6B 2E5VA 2IYIA 2NR4A 2G0IA 3VGVA 3O1JA 3MCMA 1HNZF 4CTAB 1FDAA 2ZBCA 2J9DE 4NYZA 4ENOA 2OEKA 3E01B 5DDRC 2W7PA 1XMQF 1RHMB 1QJHA 2IRYA 2R7RA 2MYSA 3W60A 1PBAA 1S94A 3LPEA 4DV2F 2CJQA 5AQTB 1NZAA 3ZNUA 3H7HB 5KFIA 1URNA 4JI1T 1FJ7A 1VGYA 1UGOA 1WHWA 1M90T 2EKNA 5J2PB 2YH0A 3FQKA 4YHHF 4CXXA 1EB0A 4NIQA 2ADCA 4X1KE 2FLNA 2HPLA 4ZZCA 4GKJT 3MEDB 3QGGA 1LEOA 4ZVQB 3AEDA 4DR6F 4ZIWA 4X64J 2WSSV 2ZE2A 1ZBTA 4BDPA 3GG0A 4PABA 2WSCC 3GG1A 4LF9F 3HVWA 2L48A 4AQGA 3LK3B 5THWA 3EGZA 3N9PA 2CXFA 4LFBF 4KQZA 5F8GA 4RNOA 2HN1A 4NLXA 4KUMB 3RB0A 2YVSA 2OIHA 3UFGA 1OY6A 3DRSA 3OVAA 4JI3J 4X4QA 4LMJA 1PAEX 1ZM9A 2W00A 2CQCA 3A5XA 5JVGQ 3W15B 3P45B 2UXDF 4C7QA 4KBIA 2GVZB 2DGQA 3LGNA 3Q5XA 1VK8A 2ZNZA 3CDEA 1XZYA 2E5LJ 3T1HF 2X1FA 2HFSA 1TR0A 4CLZA 4ICLA 4NEZA 4V19X 4L76A 4ES2A 3I4PA 2OELA 2BDPA 2LQ8A 1OPIA 4P09A 2DYAA 1DAXA 5I3QA 5HAOA 2ZDOA 1G3OA 3D68A 3PJAA 3RJMB 1ZM3A 3MMCB 4RW7A 1CSJA 3M1VA 3ZJ2A 1NB7A 3SDEA 5F0UA 2O66A 4F50A 1EHWA 2E66A 4A8MP 4K0KF 4YDXA 3AOBA 3M8SA 2DRBA 4M1KA 3J80U 1SE7A 3AVRA 2W8LA 3OHBA 4UZBA 2KM8B 4I55E 1RDRA 1SUQA 3M8WA 1YHQS 5J2QA 2G13A 2OPSA 5HWXA 1V6HA 5T14A 1RYRA 5J1GA 2HZAA 2UUCJ 5SUHA 1RISA 4OZ0A 2LLYA 4JI4J 2C5KT 1L0VA 3AOAA 5HANA 1ZETA 3D4JA 2HMIA 2B9EA 3KHRA 3C50A 3FB2A 2AJ0A 3PV0F 5HXCA 4XAXB 4BS2A 4IYQA 3RI5A 2VDIA 3ITHB 3GFHA 4PJLA 5IQQA 1FF2A 4CDIA 2MMYA 4QH4A 2DTJA 1BE4A 3EPGA 4OFZA 2AKWB 1Q53A 3MOJB 3OPCA 3D66A 4AIUA 4X66F 3UUMA 1X9WA 1G2EA 3ZEFB 3H20A 3DRXA 5HVFA 4NYOA 3HR0A 2I1RA 4MALA 1QSLA 2C1EB 4EB6E 1RTJB 3MEEA 1HQ2A 1RA7A 4OZJA 5U47A 2UVVA 1UVNA 1U47A 3I6PA 4M5KA 2VOOA 2B8QA 2CQ4A 3TKLB 3R5BA 2VONA 1S7HA 1RWUA 3PYGA 1R31A 4DF4A 2X66A 2C2EA 2UUAJ 1HNIA 3FCVA 3QGIA 4GKJF 5B0GA 5KMGP 4IDKB 4ED8A 2RUSA 1T7SA 2OPRA 4WPAA 4R8UA 3KNGA 1JLBB 1RSCA 2WOMA 1R0BG 2V34A 3D5MA 4MAKA 3CJKA 4LVNP 2QLBB 5DABA 2IRUA 1G6BA 1IBKJ 4KGVB 1NENA 2F4VF 3MEGA 4MFRA 1KHVA 2ASDA 4YB6A 4FS2A 5AJ3F 5HBMA 1F9HA 1N8RT 3KLVA 3ZT5A 4AFFA 2XULA 3AAEB 2XY5A 4QH5A 1U26A 3FZHB 5HXSA 1Y9OA 5B0DA 3M8PA 4KHMA 3PR4A 3VVTA 1SQFA 1HWKA 3DOMB 1FT8A 5D3GB 4G1QA 2QYGA 4O3SA 2MB0B 4EYIB 4LFAF 2QRRA 3Q8YA 1DTTA 1JJHA 1JWWA 4F2SA 1A7GE 1ZZFA 3ZZ0A 3CCLS 4B3SJ 4K8RA 2AD9A 2VBWA 3M8QA 4B9MA 2RB7A 4E2FB 3Q5EA 2DNNA 5D78A 3N9UC 3A13A 4NXNT 3N5BA 1OEDE 4P71A 1U2RA 1HBMA 3M30A 4KGXB 4PUOA 1EKSA 4NEYA 3PDYA 1FRKA 1S9GB 3CDAA 3JAMY 4PPDA 5C8YE 1SBRA 2JLGA 4GYSA 2W2UA 5LGUB 2XAFB 4CLFA 1GMWD 3BQKA 2RH3A 2YXLA 5ETMA 1F9EB 2MGZB 3K8PC 4TX5A 2LXFA 3B4DA 2ZJPQ 3TUPA 2AJ4A 3BN4A 3HFVA 5GMDA 2JNJA 4DPYA 1B4SA 3U02A 3MUMP 2E7XA 3QIDA 1HBOA 3U7JA 1E2AA 1AW0A 2QSFA 2CADA 4U7UK 2V6YA 4CT8A 3CC2S 3EZ5A 3J7ZT 3BQ0A 1FHTA 4C97A 3G9CA 3NBXX 1U6FA 3FNNA 4B3MJ 4NXMJ 3VV2B 2NYHA 2DNGA 1NK6A 4EGLA 2YN6A 2LEHA 3JCFA 1RWMB 1WELA 4MIBA 1UMJA 3GR1A 3A8IA 1C1CA 4J9OA 4QIVA 2HNDB 4ZCIA 1YRTA 3AD9C 3H42A 2R2RA 1I6ZA 3R5GA 1BQXA 4OI3A 1HHSA 1BMQB 3MK7C 4HI2A 4ZLPA 4QYZJ 5HMXA 5DJBA 2VBZA 3AE7A 1RAFB 3BZQA 4GKKT 3H5SA 4F2RA 1L3KA 3JC6D 3R84B 1XTZA 3UUBA 4KY3A 2CG8A 2HHTA 4DPUA 1PC4A 3NRBA 5E3QA 4LJMA 4ES1A 4ILAA 1SVDA 2QL7B 1TQLA 1ZV4X 4LUBA 1HWUA 5K14A 4QWBA 2ZH2A 1T9XA 5HEJA 4YXDA 2OKQA 4MKAA 2ZZMA 5HXHA 2VG6B 5FXWA 3AE6A 3RKGA 2J9DA 4MYTA 3OL9A 2DEIA 1PJ5A 4DPOA 2XLKA 3RKOA 4C90A 4DV6J 1KK7A 1VRUB 3BGRA 3NAHA 1NK7A 3NCRA 4IG0B 3DGPA 4ZVPB 4EU0A 2UXXB 3H5YA 3PUXF 4LF5T 4LMLA 1RE1B 4KFBA 1QUPA 3AXKA 3P6YC 1NK9A 3CD6S 4F3MA 4K2XA 4ECXA 4K4YA 1KVJA 3V5UA 4F7VA 5GMEA 4W92B 3UTKA 3TI0A 2C22A 4DV5F 4K7QA 2V1DB 5E7OB 4DL0C 3PRDA 1SQGA 5AQOB 1WF0A 3UO0A 3HULA 3MR7A 5H9EK 3MPVA 3CJQA 5KT6A 4CTAA 2R7TA 3MCOA 5A1LA 5L3GB 4B02A 4JI3T 5LMUJ 4YFUA 1NM2A 3E01A 2OA5A 4PZVA 3VZIA 4P9SA 4NCGA 2CVEA 2D3OR 1SKRA 3QPIA 4ALZA 2HGLA 3ZMVB 2ZNYA 4KTQA 3AA7B 2D3UA 4NXNF 4H63H 3EHZA 5KFOA 2CQHA 5J2PA 1DURA 1SL2A 1S0VA 5JDNA 1H2TZ 1SIZA 3UU8A 2DNYA 4CNZA 3KK2A 5HP1B 4OHZA 3K5MA 4LIRA 4AUKA 3HLUA 4LSNA 1IN0A 2G0UA 4JI5F 4XAKA 2IAJA 1PJ6A 2N4CA 1NLKL 5F3TA 5EGYA 4EYUA 2F4FA 1VQNS 4HFDA 1RLDA 4PJMA 3AA6B 3GV8B 3ULHA 3NWGA 1WTBA 1KFSA 3KXDA 4O4LE 3JSRA 4RWWA 1VQKS 5AQRB 5HI7A 2UUCT 3IF8B 3V6JA 5AE1A 4PQAA 4J37A 5BYSA 3H98A 3PUAA 4ES3A 2VQFJ 3DC2A 4DZDA 2YK0A 4A47A 3CQXC 2L9WA 2VFVA 4QJVA 4DV1J 5GAEI 2JHEA 2RHQB 2R3VA 3CK6A 4FYVB 5ETTA 2A0FB 1IKVB 2KTQA 3MPUB 5TAOA 3BBCA 1RHJB 3TNVA 3IRXB 4M63A 1E6YA 3GPAA 3VR1A 4CWBA 4PQUA 4Q0BA 3G8SA 3PFEA 3HJFA 2ASJA 3KFWX 1S6QB 1P1TA 2JRSA 2CWXA 3BQ1A 2WTFA 3K5NA 1SQEA 1Q8KA 2BOAA 2KM8C 1QLBA 2UU9T 4RLEA 5IHYA 1LXNA 4HDGA 1REGX 2HVZA 1NZ8A 4YQWA 3KV5A 2GO9A 2QFIA 2DNHA 1N88A 4KHPT 3ZLIA 2K06A 5I3UA 1YKEB 2CPDA 5LYJE 2C3UA 2UXCT 3PW4A 4ZS2A 3MM9A 4JYAJ 2X0YA 3P4SA 1S9EA 5L4HA 1XMOT 1HWJA 2UUAT 3MHYA 3MACA 2W4CA 4P2SA 4TN2A 3TA1A 2LRLA 5DQGA 4YFSA 3QT8A 3GSDA 2WW8A 3M2UA 1DJ0A 3HT0A 2XMUA 1ZM2A 4H4MB 3X1LB 2XZEA 3CJSA 4X64F 5LP6E 2FBWA 3DLKB 3G6YA 3K3NA 3EVWA 2BJ7A 3GFYA 5AQQB 2EW9A 1Y5NB 5A0YB 1JX4A 3C4XA 3OTDA 3ITHA 5AQLB 1N32T 1TP7A 2BE9B 3DRRB 3TYTA 1VRTB 5B0FA 2MHNA 3NNCA 2LU1A 3VAMA 3MGJA 5F8JA 5JMNA 3QJPA 1CJVB 2PDAA 1APSA 2N1GA 4NUVA 2MHEA 3Q89A 4MLKA 3OL8A 2UVWA 4JI3F 1JLAA 4DV0T 3HP6A 3O6QA 5L39A 5HJXA 4WZQA 4C8KA 2DCFA 1N34J 2DH9A 2W9BB 3PKMA 3UN2A 3AAWB 4RW8A 1LXJA 2C3MA 2I9SA 3CDUA 4Q8FA 3W7BA 3KJNB 3M2RB 3KJQB 4CH7A 2E5LF 2V8GA 3PHEA 4OYBA 2MZQA 1NKCA 3K57A 1T11A 1UFLA 3J7A1 4LF8T 4MIAA 3DJBA 4LBPA 2Q1LA 4O4GB 2WVBA 4OL8A 4WYWA 4A8YA 3QT6A 4DV3J 1XWLA 3SSSA 4MK9A 4WK3A 2OGUA 2DBBA 4IDKA 4Y3CA 1S97A 1IKYB 2NSCA 2HFZA 1JLBA 5JRCA 1RBAA 3K0JA 2XMAA 5HQMA 5LT5A 2RMLA 3H90A 3OR1B 1C4CA 3NRYA 2B4PA 4EEDA 2R8HA 2DH7A 3MECB 3ZT6A 3IR5B 4PG5A 5K8PA 4U8YA 1M5OC 3MM7A 2DK2A 3IA3A 3TR5A 4KGKA 2APOA 2W66A 4ZEYA 3QJJA 4A5XA 2UUCF 1J5EJ 1OEDA 2V2KA 4FI5A 1ZTTA 3RYHE 1N48A 2R42A 4NMLA 3IWNC 2DH8A 4QYRA 4JI4F 1RAHB 3O9XA 4Y2MA 3K8WA 4C3LA 1TAUA 3D3CJ 4MKVA 3MFHA 3NMRA 1BQNB 3DOMA 2BEFA 5T7LA 2RA1A 3BYPA 1WC4A 1SH3A 4B3MT 1X8DA 4NXMT 3BR9A 3GONA 3FUYA 2BR0A 2P5VA 4CO5A 4TVAB 1H74A 4UY85 1CS4B 3OXLA 1H72C 1FA0A 5HLFA 4A8QA 5JUMA 3MCNA 1WR6A 1C2PA 3ZO7A 4X4NA 5EUHA 2YNGA 3OFGA 4O3PA 3VHLA 1D9DA 3PJXA 1T9UA 4QWDA 1IM6A 1SKUB 5LJ5Y 2L9DA 3HDSA 1FEHA 2V8VA 1IM4A 2MZSA 4YY3J 4NCAA 2IBKA 4H9PC 3WX4A 4FPRA 3TW0A 3QQCD 3P5BP 5AQFB 2CQDA 4X1YE 3N2OA 4P1NA 1F0XA 4O0NA 1KONA 4QZVB 1PJ7A 1QSSA 2UUAF 2QZ8A 3JSBA 3CVKA 3P8BB 5L3DB 2A3JA 2YKMA 4NLYA 1O51A 1XN9A 3MWBA 2R8IA 3QO9B 3GN5A 2W4PA 1SHZC 3QFWA 3HKDE 2VKJA 2XQ8A 3AA8A 3J7YI 3CCWA 5DQVA 2U1AA 3CCRS 5KG3A 2VODA 1IBKF 3LP0B 2KVQE 1NJZA 3THPA 3GV5B 3HVTA 2C5IT 2NZCA 1OMSA 3OW2R 3O5TB 5SZTA 2JPFA 2HNDA 1SPBP 4ZPBA 3C51A 2U2FA 3H5UA 4U7UD 2XMJA 1XQIA 2ZM0A 2GX8A 4OI1A 5EK2A 1X5PA 2DNQA 3ZZUA 3BO3A 1CJUB 5IFMA 3J9X1 5J2UE 1LK5A 2HVDA 1P9QC 1JLEB 3FFIA 3C6UB 4O23A 3DMJA 2MZ1A 1UX4A 5LMUT 1TKDA 2N7YA 3KUGA 4AL7A 1QSDA 4JI7J 5IT4A 4B3SF 1FDBA 1VMBA 4FYYB 3DP7A 2ZUAA 2HFVA 5IWAJ 4LRFA 4OZ3A 2V5DA 3T19A 3KBTA 3JQMA 5J0ZA 1URRA 5C2GA 2QFJA 4DR2J 2UXBT 3UVJA 2KZZA 3EI0A 1SI9A 2A2FX 4ZOLE 2DR8A 2WWUA 1T9TA 4WCEQ 2ZKUA 4Z91A 2IM3A 3AQPA 4CN1A 4WBOA 4YUDA 4J9UE 3OBIA 2FIUA 3H8YA 4PYAA 1VRUA 1WTFA 1FK9B 4J2CA 2HPUA 4EBEA 4Z7CA 2VICA 3ZN0B 1NPRA 2GIRA 2WVDA 1SJ4P 2GAHC 3HSGA 4QPXA 2UUWA 4H9OC 2AV5A 1X9BA 5JVDE 2PC6A 2HQFA 3O8WA 3E22E 5G0RA 4J9KA 3B6BA 1RK8A 4B3MF 4NXMF 2WVEA 5EDWA 3HKZD 2GZOA 2LA6A 3OLBA 5D4PA 1TL3B 2CPZA 2ZVSA 1RAGB 3AE2A 1TK5A 5JDLA 4B3TJ 3FBCA 2ZH4A 3HZGA 2RQMA 4M5JA 5CZVA 4EI2A 1H98A 4N47A 4DX6A 4CNYA 3OTOT 3W8PA 4WKYA 3H4DA 4DR7T 2ZD1A 2PG8A 4C0HA 3OHAA 4DCOB 3EX7B 4CO0A 3R5JB 3HI9A 3RG6A 3EDUA 2W63A 5J2TE 2W9AA 2V8HA 1D0XA 4PWWA 4PFOA 1A9NB 2FHOB 1Q5YA 3CQCB 3W5ZA 4ANCA 4ZA1A 3UFEA 1F1BB 4H4OA 2UXNB 3IS9B 3DLGA 2IAKA 3CXCR 3MF5A 1NKBA 2C2NA 4NCBA 4DR4T 5J1NA 3AQOA 2LDYA 3CIZA 1MLAA 2H7VC 4D3GA 4OZLA 2D3ZA 4L3KA 5KG0A 1Q7LB 3I9V9 3ZSTA 1VLYA 4KAIA 2R7UA 5KFZA 2CQ0A 4JYAT 3CKDA 2BA9A 4OZ5A 3DCAA 3EVMA 3IBWA 2R2TA 4FJOA 4LFCJ 4L9IA 4HHJA 4CI0B 3AE5A 4A48A 4DV6F 4UTGA 1O3XA 2XTLA 4KV8B 4Z2XA 4GIWA 4H9QC 1BR1A 2MQMA 3NGSA 5L8RC 4WP3A 1HD1A 2P6TA 4I2QB 3WIVA 4NLUA 4HWIB 4IHJE 1UWBA 4Y65A 2WMOA 2C2RA 2DT9A 4HHHA 4UV9B 2F1FA 1JB0C 4ILBA 3OSPA 1XJWB 1S6QA 1IR1A 3C14B 4NLRA 4ZPVR 2C2DA 2I8EA 1RTHA 4RO0A 5LMUF 4UR9A 2XSJB 5A8WB 5DGAA 2X51A 1M5KC 1N34T 1GNKA 3GMIA 1HYSA 4G2AA 1TKXA 4Y00A 3R7BB 1S49A 4USTA 2B6AB 3EUNA 5L38A 3UD5A 5H6RB 1DLOB 3OVSA 4IQMA 4RNMA 1FFGB 1JLQA 2VDHA 2BACA 1CULB 1X4HA 3CB4A 2HHVA 4ED5A 1REVB 3D0TA 2IC9A 1B0PA 1C0TB 3DLKA 2B56A 3SWHA 4EUVA 1UETA 5BYRA 3PUQA 2XG8A 2K1RA 3AE4A 5A0YA 2M67A 2B7BB 1YJUA 2K7JA 2E2AA 5IV3A 1EX8A 2AEFA 1RQ0A 1GH8A 3DRRA 4DSIA 5JTGA 4UQTA 1MMNA 3VAHA 3KG0A 2CPXA 1KHWA 5HCMA 3MJXA 1MWYA 4F26A 1WC5A 2LSKA 3ANWA 2EFOA 1U2CA 3KLIB 1R0AA 3MM6A 1CG2A 2CUYA 5JVHQ 5ABFB 3RRKA 4QWCA 2FVQA 5LCYA 3GIMA 4BLGA 2VQFF 1Y0HA 4DS4A 1LWFB 1W9RA 3HFKA 4ZCLA 2XWYA 4LSLB 4DV1F 4WU3A 2BE7D 2DGUA 3T9NA 2VKRA 1VQMS 4GC6A 1WEXA 2HRTA 1VC6A 2WZIA 4PK5A 4ZPDA 2LSIA 5FDLB 1AZSB 2E1CA 2VKHA 1RWNB 1JLFB 3L7UA 1RHQB 5A8KB 3FBBA 5C5JA 3H37A 4F02A 3SQGB 4WBNE 5DG8A 1QAIA 4ED7A 4AISA 2BJ1A 4DR5T 4BAYB 5E0OA 3ZTQA 1YK9A 1HWIA 4QKNA 2NS1B 3MECA 1CJTB 4YB5A 2PEBA 2ZEJA 2D9PA 2W2OP 3GZ7A 3SCJE 4JYAF 1I5OB 3HHLB 2RU3A 3DYAB 1RT2B 2OSRA 3BKUA 1FE4A 5KFBA 2WBRA 2NPIA 2HHUA 3MMBB 2ALZA 2CPIA 2ODUA 2VFRA 4I7FB 1PYSB 3BYRA 4ILLA 5CYMB 1YX2A 2V8SV 1E1HB 2XMKA 2UVRA 3US5A 1UVMA 2PD1A 3AECA 2V6XA 1CS4A 1F5CA 4B6XA 2CPJA 2HQDA 2Z57B 1MIWA 4NA1A 3R6LB 2A6OA 1W0AA 2RF2B 1N5SA 4MK7A 1XEZA 2WDQA 1R8BA 2X0LB 1GMUA 1QY7A 1V9OA 3TWZA 2XQ7A 4JLEA 5FXZA 1M5HA 3HKEE 2EKYA 2OPPA 5D0HA 3C46A 2HS0A 1T95A 1JLGB 3VAGA 2AP6A 3MDFA 4QIGA 1N34F 3SOLA 1X4CA 3MD1A 5ADXL 2QYWA 3LOUA 5HL7Q 4A8OA 3MM5A 3A8JA 5EWFA 4RL1A 3CCZA 1P8GA 4HFBA 4DX5A 3CMAS 3RZAA 4YB7A 1IXKA 5ETSA 3E2EA 3KJFB 4CI1B 4ZLJA 3EICA 3C19A 2OD4A 4A8XA 4JI7T 3P7IA 4DV3F 1KN6A 3OPKA 2IIUA 3NGTA 2BUNA 4USWA 4UVBB 3M8YA 4KP3C 3QO9A 4BJNA 4DCPB 3GIJA 3DLLQ 1FDDA 4GVBB 2CCQA 4I2PB 2GGPA 1CC7A 5KG4A 4IFVB 1YJRA 4F4YA 3C16A 1UW9A 1VIOA 3CCJS 5E5NA 1Y00A 1DRZA 2X3GA 2BZBA 2LKGA 4Q43A 3SCKE 3LP0A 2V67A 2CJKA 2X7IA 1B7TA 2KT9A 5GAHU 1KD1T 5HROA 5LHHB 5FXVA 2CZ4A 3TQ1A 3HD1A 3FBZA 1J5EF 4YSXA 3M3ZB 3X1DA 2IVYA 3K17A 4AXIA 1NPPA 5L3BB 2PMWA 4DUYF 5FKYA 4USUA 3T1YJ 3D6FB 1AUSL 1S79A 4ERRA 4GYRA 4NZ7A 1RAEB 3NGRA 1JLEA 2WONA 2LP4A 3C6UA 4OLOA 5K9FA 4NA3A 2ZBRA 3I9YA 1FI4A 3KKFA 1IJFB 2P9BA 1WFDA 3QB5A 4B3TT 2ZUGA 1LK7A 2AJ1A 2QA4G 2XBPA 1Q8LA 1VR6A 1WYCA 3ZMUB 5DQWA 4TWFA 3PU3A 1BC6A 1H6KX 3UR0A 1U1NA 3SS1A 2WB4A 1SC3B 4YY3F 2BV3A 1FKPB 2XCPA 2SXLA 2B5JB 4IOAQ 1RWWB 3C66A 4ECUA 3JSMA 4ZI7E 3LWMA 4P2MA 3HXMA 2R7SA 2K3KA 3KHLA 2X1GA 1OIAA 1EZZB 3AY0A 2E1MC 1SKWA 1OO0B 2BKPA 2E9XB 3MMAB 2AU0A 4F8RA 2GJ2A 2N2NA 1V5VA 3D1HA 4IUFA 5GVQA 2KRBA 4ZI2C 2X9HA 3NS7B 3LK42 1HQEA 3PJAJ 1WDTA 4A8SA 4JV1A 2RDDA 4IH6A 5EWEA 4Z7YA 4OJ1A 1UVKA 2C3PA 5KFGA 1K73T 3M6WA 3WAJA 4F4KA 2HHHT 2AEMA 4ER8A 2KB2A 5CGMA 4QW8A 3FDSA 2Q43A 3I82A 3BBFA 1TL3A 3SSRA 4G63A 1FRMA 4Y0FA 2IMWP 3CCQS 3BDPA 2N7CA 4DQRA 3HKBE 2KHDA 2JJ9A 5L3EB 1MMLA 1T8BA 3LH2S 2BZ2A 3AEEA 3TA0A 2VG5B 4GVLA 1HI1A 3DRPA 4ANDA 3MD3A 4A98A 3MAHA 3H3MA 4PEOA 2F40A 3LBXA 4ZVRB 2JFKA 4IO1A 3RU0A 2O01C 3U27A 1S5ZA 2K5BB 2MQQA 5JDFA 2VC0A 4EYYR 4JI7F 3KLHB 3GV7B 4J9LA 2HQIA 4HTJA 2A72A 3LW5C 1FRLA 2DHXA 5IWAF 1B7FA 2XMTA 2VKOA 4IFYB 4DR2F 1AA1B 2LQ5A 3VGSA 4RU2A 2EC2A 3OXGA 3PW5A 1R8IA 3QRPA 4K4SA 3FSXA 2ZWPA 2WBLA 1PYTA 1CQNA 4YMEA 1UX5A 3ZCJA 4AL6A 1ITPA 2GAGC 3I31A 2WBMA 2HN2A 4DOZA 3HK2A 1AYEA 3QRRA 5B09A 1SH2A 5J1PA 3Q24A 5DO2A 2FVSA 3UU3A 1IVZA 1DBDA 2B8PA 1PSDA 5IM0B 2KFZA 1VBYA 2EHOB 1U7LA 3TAQA 3A3PB 3BB5A 3VQTA 1P1LA 2A1BA 5LSOA 1S1XB 1X9SA 2AJQA 3FEZA 1FD8A 3LSVA 2FYXA 4P75A 1VOMA 2ZLYA 2HFUA 3CQGB 3PUYF 3C14A 4DU8A 4GMKA 4PG6A 5BJRA 4UVCB 3GB0A 2RDIA 3W64A 4KC5A 1OY8A 1X4DA 5CJ5A 4ZHRA 3MFIA 4B3TF 3Q2TC 4DQSA 1UWAA 3ZT7A 4DL5A 2COLA 2RNEA 4MIWA 3RX6A 1HPZB 3AXMA 1RADB 3FEXB 2QE5A 2D5UA 1DLOA 2YWWA 4ZPWR 1MN9A 3G6VA 3FJ2A 2CZ9A 3ET6A 3HM9A 2E44A 2P6SA 1N6QB 3PW7A 3POTA 2NPFA 3C4ZA 1CULA 3AE3A 5IT9U 1G8XA 2WHOA 3WQPA 5FVKA 1PCAA 2IM2A 1C0TA 1SB6A 1U8WA 2W24A 3N9LA 1CQMA 4K4ZA 1NO8A 3NCPA 4TU7A 3HA4A 2B43A 5KFFA 4NI2B 1UL3A 4ZMMA 3LP1B 5IC4B 2BKOA 2CJYB 1GMVA 2G0CA 2QL9B 4CLYA 3V6DB 2BOPA 3KV9A 2G2YA 4X65J 2XGPA 3HSZA 1L3TA 4AKGA 2JVOA 4RUBA 4WZMA 3KLIA 2F9JA 3ENQA 4LFCF 2JQHA 2OAUA 1VBXA 5ABFA 3SSQA 5KT2A 5FD1A 3EAMA 2FPHX 4H9SE 1IJEB 4AQFA 1VQ9S 4DI6A 4ZN1A 4QIEA 4LSLA 3QAEA 4P7VA 3MPDA 2BABA 2DHRA 1IKWB 4OV6A 3RBZA 3NGUA 1BLUA 2J4GA 5FDLA 2VPWB 1AZSA 3CPWR 2H89A 5HQ8A 2ES0A 2HQGA 5A8KA 2CPYA 1IBMJ 1FKOA 2FJXA 2BJ8A 2IM1A 4IE7A 3HHLC 1J5OB 3GE9A 2NYIA 1NAFA 2WRMA 2I0MA 2R9LA 3PUZF 1IR0A 3P5TL 2XMWA 4LF6J 1CJTA 4IDOA 1O0PA 1T9YA 1JKHA 4F6RC 1VLOA 3I5BA 3HHLA 3QMQA 3TAMA 1N5QA 4CRJA 2N82B 1SV5B 3ZTPA 4ZK7M 4UELA 4YP3A 5KFMA 4A56A 3CCUS 2I5JB 3MMBA 5L47A 2KHCA 3T5JA 3MUVP 1WACA 3EDRB 1US7B 5GADU 5CYMA 3MM8B 4AT1B 3MOZA 2QGSA 1FTRA 2RHSB 3H0PA 5CFBA 5ADZA 2DL1A 1YQ3A 4AKLA 4YT0A 1Z4UA 2IPOB 2CXEA 2G2ZA 4QBUA 3CJ5A 3RBXA 1R7IA 1IZNB 2MTQA 1U25A 3S01A 3BSOA 5EK3A 2CBJA 2HVHA 5L2LA 1LKZA 4PJNA 4HWHA 3ZYLA 4PW8A 2JL9A 2M5YA 2XGQA 3G96A 2X9XA 3RLFF 4K5SA 1B99A 3O44A 4IE5A 2QC3A 3VRBA 5KOXA 2CLYB 4XDCA 4DV7T 4KHZF 1Q79A 5HK4A 4GC7A 4DZ6A 4C0BA 3PW2A 4ECSA 2FJAA 1RTDB 3Q83A 3AE9A 2D41A 2LMIA 5ITHA 2YNHB 3PIOQ 3WDOA 2HS4A 4IKAA 3PW0A 3I5AA 4JBCA 3BKTA 1T05A 5LMNT 2CJAA 1HHTP 4DO0A 5B7WA 4W4MA 3UQSA 4NLPA 4ILRA 3TRGA 2E7WA 4CH1A 4ERDA 4P10A 4JI1J 2XAHB 4Q2MA 2F8HA 3VQSA 3QGPA 4GVBA 2ZITA 1SKSA 3PRVA 3VAFA 3P8CD 2XSBA 1AXQA 2KWIB 4N5SA 2LXIA 1H3DA 1E7PA 4HN9A 1N33J 3D0HE 2XHEB 3KMSA 2A3DA 1OYEA 4YLHA 1S76D 1J27A 1WC0A 2CWKA 1MROA 5D0EA 2PFVA 2LEAA 2XUEA 2ILYA 4O44B 7FD1A 1VQOS 2IJFA 2DIVA 1U5PA 4H4KA 3IM8A 2ZVIA 4WYLA 4HDHA 4QH1A 3KWMA 4DQIA 4YJ2E 4EBDA 4CZCA 3FZFB 5D4LA 3L9ZA 3MAQA 3FZKB 3HO1A 4JB8B 4TU9A 2QO3A 2B7CB 3EXCX 4KB7A 1BY9A 4FKXA 3HVRA 4HFVA 1XR6A 3CD7A 2K9AA 4M5IA 3NEKA 4AXJA 3CTRA 2R8KA 2V68A 2CXDA 1FIOA 3OVBA 2DNXA 4O3NA 5GMKa 3HF5A 2PMHA 2QGFB 1FNOA 2DGWA 3G6ES 2DGSA 5BMVE 1F3FA 3V4IB 3RYIE 1C4AA 3OTBA 1B70B 2JMKA 4BHQA 1S12A 1K44A 4I68A 1NKEA 2E9XC 5CAAA 4ECYA 1TK0A 2B5JA 1KOHA 1FRIA 3UPFA 3OJSA 2KG1A 1RAAB 2VC1A 2V50A 2R2UA 3NZPA 4ZVTB 2KDOA 4K5RA 1RU2A 4F4ZA 3AHPA 1T3NA 5KG7A 2YKOA 3I1AA 3K58A 4DMVA 2ZH7A 2E9XA 2Z4PA 2ZH8A 3TJ9A 4CO4A 1K1SA 2NP9A 5IOLA 5GAGI 2GO8A 4PWUA 4M5DB 3KG1A 3SQOP 1JXEA 3GFZA 2ZJQQ 4HFHA 3JAFA 4I6AA 4ID5B 2AX0A 3VGTA 2HVIA 3V4MA 2PA3A 1KNPA 2HPJA 3D0IE 3LTOA 4JI8J 2AQ4A 3PYEA 1Y4ZB 5AXKA 4EFAC 5LB7B 1EETB 2VZ9A 4HLBA 4BC7A 3GSIA 3ETOA 2Y9HA 3DXSX 3UUNA 4C48A 2KXPB 1WI6A 1V3SA 3T1YF 2HURA 3B78A 2VG5A 2VL8A 4DV4J 4LRDA 2H5EA 2MSSA 1S1VB 2YKNB 4TY8A 3VAIA 1CC8A 3K2YA 2VL0A 2YDSA 2GHWA 1HBNA 2IW5B 4FF1A 1X4GA 5JXSA 1HBUB 1Z2LA 1RB0A 4UT4A 4AL5A 2Y0SD 1L5UA 4ZDNA 4MK8A 2MZTA 2RRAA 1T8EA 4FBUA 3KLHA 3QFHA 3EABA 2XAJB 2PBIA 4RJVA 5DDPC 4DQQA 2HNYB 1KQSR 1ULRA 3AE8A 2QG9B 2WB1D 4IO9Q 1ZPWX 2CKWA 1QTMA 1UFWA 3Q86A 3RTVA 2KSRA 1YSJA 2VKZG 1NPKA 4R5PA 2OPQA 4MH8A 2HAFA 3KJVB 3AD8C 3O1LA 3L8RA 2RQ4A 2F5GA 2KNDA 2D7SA 1Z8UA 3PG9A 2KN4A 4EIWA 2HFNA 3M2VB 2B3TB 3W9JA 2EHOC 3PJ9A 3L4BC 2PSZA 2ERRA 3RRWA 4HYKA 1PG5B 3N01A 3KUHA 2VBYA 3WX8A 4PAAA 3VCDA 2V4JB 2V7KA 1TKTB 5JR9A 1JLCB 4Y2AA 4QCLA 5IT9Y 4KKOB 2BRLA 1S1XA 4X65T 1U02A 3QZ8A 3DLJA 3KVBA 2OHDA 4MFBB 3TZXA 2D69A 4CO3A 4ZLLA 1O5JA 2OFGX 5CQGA 2E5GA 4DL4A 1VRBA 5FIIA 1NSKL 4CT9A 3I55S 3GILA 2ZH1A 2XQYA 2H51B 2HIYA 3DFEA 3GJRB 6FDRA 5IS2A 2P9EA 5KG6A 1XNQT 1EQ0A 4KHRA 1UCNA 4PG4A 4PWDB 1IQZA 4OI0A 1TL1A 1WC3A 4M5GA 4KJIA 2FLOA 2HHSA 4CM2A 3JAMU 3D6MB 2Y0BB 4NWBA 2QEXS 4QWEA 3DLBA 2W2MP 2OO4A 3VWSA 3D1OA 1IBMT 2V7IA 2IVFB 1AFJA 2LLZA 4WTOB 3J81Y 1YDLA 1GEHA 1S1WA 4C3KA 4IOBA 1VC0A 4P0AA 3UE2A 3LP2A 2W62A 1KVKA 2Z30B 4NI2A 2BBJA 1DQ9A 1HCIA 3I0QA 3L39A 3AOCA 5J1EA 4LF6T 4EEBA 3V6DA 1R8AA 3AAIA 1MN7A 3FZMB 4OQJA 3OFHA 1B3TA 3O2IA 3V81B 2CFXA 4ETXA 2HIQA 3DI6B 3LFMA 3UDVA 2EBGA 3Q5WA 5AQUB 1RT1A 1RU1A 4WE1A 4TUYE 3ZYMA 8AT1B 2ABYA 1JNZA 4LT6A 2DNRA 1Z1ZA 3OFEA 3CCSS 2E5JA 4ZP6A 4KO0B 1S4FA 1I6JA 2D2SA 5H9FK 4DL6A 1X4FA 3NL0A 4PJJA 4UY8T 2B76A 3I9ZA 1WUUA 2CJXB 1VQPS 1IKWA 1NHKL 1JNRB 4I6WA 3S8SA 1R89A 2V2VA 2YQ0A 2MQ8A 3KK3B 2H1YA 4WKRA 5HXRA 3DNCA 2BS4A 3MURP 1HIYA 1QD1A 4DFKA 1UTAA 3TVKA 3KLFB 3MR3A 1SH0A 2HS3A 3K5OA 3RQWA 2X1AA 2LOSA 2FQQB 4JI2T 3B57A 2WM9A 3MZIA 5D0RA 5AQGB 5M2UA 4UF4A 2MQNA 4USJC 1H38A 2BJ3A 1IBLF 1TFWA 1NXIA 2MTLA 3KV6A 5LL6d 1U2FA 4X4SA 4GKKJ 1LFPA 2ROGA 4URQU 3DU5A 4ZPCA 2CVIA 4FXWA 4ZJLA 1SV5A 2IVMA 2AMCB 5KFPA 2I5JA 4P52A 3M9NB 1HLWA 2XS2A 2X68A 1RT7B 2ZM6J 1Y7PA 3PTWA 1Q8BA 1UJ5A 3AXJA 4NRUA 1NJYA 3RIFA 2NW9A 3G82B 4C0OC 5KFAA 3QC9A 1NH7A 2XC9A 1M5SA 3DHWC 3OT9A 1N33T 2QT7A 4NASA 3WHIA 2EG2A 2HLTA 4DS5A 2DPIA 2CLYC 3AB3B 3LAMA 3TZZA 3H3AA 4X65F 2Y1LB 5I42A 2L3MA 3NGDA 2CM0A 3F0NA 5IYZE 1W0BA 4LF5J 2HZVA 1Q7YT 4E7ZA 3ILIA 2RDJA 1BWVA 1C0UB 3OJUA 4UUXA 3ISNC 2BG9B 4IDZA 3KNAA 1KLMA 2GK9A 4X4OA 3CW2C 3CX8B 5EN1A 1RABB 2PGCA 3GCXP 4DFPA 1UVIA 4E8UA 1HI8A 1FJGT 1RTDA 3OUYA 4I69A 1AFIA 1Z0PA 1LW0B 1R6VA 3NWRA 1IR2A 3CE8A 3V6HA 4TN7B 3AEGA 2YKSA 3O3LA 4URSA 3A3OB 3KVAA 3KHHA 4UOGA 5C2CA 1U1OA 4M95A 2E1PA 2BX6A 5KOWA 3J81j 1UJ4A 1B64A 2YNIA 4M8LA 1IBMF 2FB0A 3OQ2A 1RTIB 2KYZA 1KOOA 2VPXB 1F2HA 3AB2B 4I6YA 3HKWA 1OWAA 2BG9E 3BDEA 4C6AA 4YEAA 3H25A 5A6WA 2CPFA 3LANA 3TP2A 2XZDB 4LF6F 1RBLA 3V2UC 4IQXA 1YITS 4OYIA 2GA7A 5AQSB 1AT1B 1RAIB 3ZFVA 2C28A 4OHVA 1M62A 4B9VA 2LSJA 3J7Yq 3ZNJ1 5LGTB 2VQET 4U96A 4DQPA 1KRPA 2MPKA 3I96A 2MBGA 2OMOA 3HSDA 3HMJG 2KVIA 3IHRA 5DDQC 4CQIA 4KPYA 1FX2A 2ALYB 3FXDB 2A6MA 2IDLA 7AT1B 4HT5A 4JI8T 2CHNA 3GR0A 1YKHB 4PCQA 1U4QA 3FBEA 1RHKB 2ZJRQ 2JLEA 3CCTA 4Y2IA 2HNZB 2UUBJ 1GK8A 2KFYA 1ROFA 3QSYB 3QAUA 3CCMS 3AODA 3V4IA 2BYCA 5FNVE 5HMWA 1FMVA 4ZS6A 5KFJA 3ESLA 1D9AA 3CJ2A 4DV4T 4B3OA 4ZN3A 3FEYB 1N0VC 3P50A 2P9GA 1VIXA 4AYBD 1QLNA 3B54A 3U1NA 3J7AN 1SL1A 2UU9J 2YDRA 5HJYA 4OLPA 2DXEA 3NAIA 2PJQA 4ZIVA 1S35A 4KHPJ 1TZ0A 3H2UB 1TKZA 2D0TA 1MIYA 3OSNA 3DHXA 2V4QA 2J6UA 3C6TB 4RBVA 4JI1F 1B7YB 2HHWA 5AQHB 2UXCJ 4M5DA 2Q6CA 1Q1KA 4X20E 1LWCB 2WU5A 1VISA 1F9FA 1S1UB 3KYLA 4HFIA 3UU5A 4HVZA 1KR4A 1XMOJ 4IE0A 3ZTOA 4U67Q 5M2RA 2R7VA 1MG7A 3TVZA 4L73A 2NXNA 4QWAA 2XHCA 3UN3A 1N33F 4I67A 4NMXA 2M4MA 3SFGA 2DXDA 2NLWA 1KWMA 2CQPA 3MAAA 3Q0AA 2XQAA 4C11A 2W0GA 3CEDA 2RKIB 2GNKA 1QAJA 2QLFB 3A4TA 2RRBA 5DETA 2GVDB 1BHNA 4CLKA 2HGMA 5DGBA 1N32J 2PEHA 1U1RA 5HEUA 2E5IA 1CEZA 1TL7B 2MYFA 1H73A 2LECA 1NJIT 3TLTA 2L08A 1V3RA 5LBQB 3QGHA 5B0EA 3W2VB 1Q0NA 4BWJA 2IJRA 2CAJA 1WR0A 2AYGA 3IGVA 5EK4A 3KLGB 3SXLA 2CEAA 5DM6Q 2P2CB 2DR5A 1U1MA 1XNRT 3P96A 3D6TB 5AT1B 2C2ZB 3WZ0A 4DV0J 3IA0A 2J8SA 1RWKB 3BGUA 1ZAVA 5J2MA 3NMAA 2HNYA 3EYZA 4QR2A 2YX4A 1G73A 1KTQA 1FVQA 2M52A 4AQYJ 1N5VA 4YN3B 1UK5A 2MLZA 2OUGA 2FJDA 5HWYA 3G6XA 4LF8J 2FUPA 1NUEA 2BE2A 5LM7E 1OSCA 5F8NA 3KJVA 1DTQA 3EMTA 4HACB 3IC1A 3G06A 4HE8A 3EGVA 2HRYA 3TUZC 3M2VA 2VPYB 3ONJA 4Y6IA 3MXHP 3R6NA 1R43A 3P4WA 3PO5A 3I32A 3PO4A 2MLXA 1QDUB 1S48A 5F8LA 2BM1A 2L9NA 2IMLA 3DOKB 4TYAA 2V4JA 5GAEU 1TKTA 1IKXA 3CO9A 4KKOA 4QU7A 2BVLA 1Z2ZA 3ONLC 3NBPA 2WSEC 2OV9A 2W4DA 3RC3A 2XI3A 4KSEB 3VALA 1FX4A 1VJQA 4JI8F 3EGNA 3QRQA 5KXJA 1FRXA 5K20B 3N5LA 2B4UA 2OD6A 1BQMA 3ZJ1A 4RW6A 4FYDA 1D8ZA 3C15B 2V5CA 4BWMA 1U0HA 4WIQA 2XLJA 3TJ8A 1VDHA 3QATA 2OLWA 4K4XA 4DCJB 1FDNA 1IBCB 4B9LA 4DV4F 3ENAA 3MI7X 4LF7T 3IN5A 2YU2A 4ECQA 1SXLA 2AGOA 2JX2A 3X3UA 3JS9A 3NLCA 1FJEB 4NA2A 1RT4A 4QX7B 4LVOP 3H2VE 4EZ6A 4ZHQE 2E1AA 2LA4A 2EFQA 2WAQD 3B13A 2G1DA 2IHR1 4OK0A 3LO3A 3HT3A 3ADAC 3F31A 5F5WA 4F8HA 4QQBA 2HAIA 2K3WA 2YQ1A 5KG5A 2EG1A 1SC6A 3BH7B 1WEZA 3K3QC 1YD8G 2HWIA 2IBOA 4ZI2D 2EK6A 5B0CA 3KV4A 3M8RA 3AE1A 3JQKA 4KPCA 1HL6A 4LMKA 2RT3A 2ZM6T 4JV2A 2M0GB 2EFPA 1G4CA 2OP5A 1R8PA 1KF6A 5CD4A 4V1Av 2B4OA 1PAUB 1TUVA 3QK6A 3C2PA 4DG1A 2HEKA 3DOLB 5HSPA 2XS5A 1TK8A 4HWDA 4JI6T 4BJMA 3LUYA 3DRSB 4ZCMA 4O0IA 2IC3B 2FVPA 3KK3A 1VQSA 2YWGA 1VQ8S 4OZNA 1KP6A 2NUUG 1MW7A 2GJIA 2E1RA 3G71S 3JB9k 3OL7A 4EZ9A 4CN4A 1WDDA 4W98A 3Q8QB 2J9EA 3P4UB 2JH3A 3JSYA 1RKIA 3IWXA 1RHUB 3K7RA 4WFZA 1OYDA 2YKAA 2EPIA 3EPIA 2VF3A 2QRXA 4ZKAA 1S0OA 4QR0A 3Q8VA 3M7VA 2XASB 3O4XE 3FXEB 2FDNA 3AD7C 2F8MA 4HKAA 1IQTA 3M1VB 1ZM4A 4M5HA 2CYYA 2KXHA 2FUG9 2VA2A 2I59A 5KFHA 2P9CA 4YSYA 2QX0A 4USIA 2GQCA 2UXBJ 4RZRA 3R2CJ 3BEGB 3K8VA 3JAEA 2ADBA 3C3LA 4U7YA 4DSFA 1NSAA 2R6GF 2UP1A 4Q8EA 5J2QB 3MEDA 1NJXA 5AJ3J 4A8WA 2BG9C 1GT8A 2MQLA 3CJRA 3A8YC 4DIDB 3JQJA 4NLOA 3CJ0A 4UOCA 2W2QP 2HHXA 1HNXT 4U7IA 2WW4A 3ZMSB 3DDIA 4HTIA 1MIVA 4IL4A 1KFYA 2LJLA 1C0UA 2GHPA 2HMIB 3CIMA 1RBOB 2A2CA 4HFCA 3ZSSA 5DZ7A 3KTQA 4LREA 4AI6A 4X4UA 3OTCA 3SYZA 3HHKA 1HNVB 2LE8A 2HG4A 3NY0A 4YR0A 2QA1A 2CNKB 4O3RA 1WCRA 5G4DA 3EXYA 4G3IA 3NP5A 4ZVFA 2HBQB 4HL9A 2JIWA 3T5LA 4KT0C 2GVZA 5FL0A 3OTOJ 3PE0A 1QAXA 4DR7J 4HR2A 2UUBT 2QL5B 1RTIA 3BKFA 3G8QA 5EX3A 2VD3A 1EKRA 3BSNA 4QYZK 4EAHA 4M5MA 5KFUA 1S6UA 2FD2A 1S77D 5DJQC 1U09A 4A8KA 4XO0A 1RLCL 4IH5A 5LXYA 2CBIA 3KMQA 3MR5A 4WFBQ 5CA1E 3MMCA 3SRZA 3J7YU 4PXBA 3UDCA 4GKKF 4WFNQ 5D15A 2I6HA 4BA9A 5M4YA 4DR4J 1GAOA 1YWXA 4PRFA 3F73A 2BJ9A 2E9RX 4FDFA 2OPRB 2XHWA 2WOMB 2J0XA 1WG1A 4OI6A 4UXNB 4WK1A 4G6VB 4TWDA 1FWPA 3NXZA 1HW9A 1NEKA 1YJ9S 2IC6A 4EZ4A 4H9RC 1X4AA 3DLEB 3ENVA 1R3NA 2NTYA 3D28A 1QUVA 3VKHA 3MEGB 3VRAA 4PK4A 1TMMA 2XM3A 3F56A 4ED1A 4OX6A 3GQCA 4E98A 5HBMB 4CO1A 3UUXB 3M8ZA 1Q8IA 5EZYE 3KUEA 4LF5F 4ED3A 4TQRA 3A3NB 3HD2A 3GIKA 2HNZA 4DSLA 2X9YA 4ZOSA 2G0JA 4G1QB 3FRZA 3N28A 4IT4A 2POKA 4RUHA 2K3IA 4ZXLA 2XSFA 1Q82T 1DTTB 2B9WA 2BJEA 3VR9A 1UFKA 1LVKA 2X9WA 2XWXA 4XDDA 2OEMA 3HHLD 1YBAA 4KH1B 4IRCA 4DV2T 4E0DA 2FHKA 4DN9A 4ZITA 1FXLA 1RTJA 4NLTA 2CWYA 4EYHB 4F04B 3T5HA 3C6TA 1HBMB 2J0QD 3H5XA 4YHHT 4AQYT 1X31C 4WP8A 4L75A 4PUOB 1LWCA 2AJFE 3ISZA 2DGVA 1MMGA 2JZ5A 3C8YA 3UWTA 4ECTA 1XR5A 2E9TA 2M2BA 2WVFA 5LJMA 1ZYQA 1ZAWA 2RD5C 3EM1A 5E3AA 4DR6T 1YXRA 5F41A 3CNQP 2WDVA 5HAXA 2FLPA 4GOUA 3MR2A 2WZ1A 1FERA 1U1PA 3TLUA 2F63A 4LF9T 1W2BR 4NLGA 3GJTB 2RKIA 2H4YB 2Y48B 3ZYKA 2YWHA 3WBZA 1HBOB 2UZAA 4RUAA 1EQMA 2QLXA 2CDRB 2V6YB 3F44A 1XBWA 4LFBT 2VUGA 3IXQA 2XCAA 2H9ZA 2MAWA 2YKQA 2WWVA 5F8PA 5JDQA 1VC5A 1FFWB 2D9OA 1J2VA 3HFZB 3R1LA 3W2VA 3GCWP 5D8HB 2W8KA 2ZMAA 4COFA 4U2ZA 1K47A 1IAPA 4AD6A 1C1CB 1T0TV 1RWVB 2UXDT 3T6JA 1RWPB 1EJ7L 3T1AA 2YWFA 3F2EA 4PXDA 3LA0A 2M88A 2JDJA 4QPTA 5KFSA 3T1HT 3DGVA 5D3GA 1RT6B 1CLFA 1UA1A 3IFEA 2DNLA 2VVNA 5FY7A 4OX8A 2KL8A 2UUBF 3OKQA 3NGKA 1NDCA 5CH7B 4NYPA 2MXYA 2JFDA 1DARA 3N9MA 2BRKA 2GCFA 2HRUA 4PG8A 3Q2MA 1ZA2B 1LRZA 3MTKA 4ZP8A 2XO7A 3FHNA 2WZHA 1ZTWA 2CMRA 4DDFA 3QUJA 2Z58B 4OYMA 2UU9F 4K0KT 2YKPA 3P4PA 4GO7X 4DR5J 2HK3A 5IQ6A 1YJWS 4KHPF 3GTYX 4OV1A 2BQ3A 1S9GA 5HATA 4DLGA 3LQVA 4O3QA 2UXCF 1H0HB 2CZVC 1YJVA 4BBYA 3ZZPA 2XS7A 4NZ6A 3ZN1B 1XMOF 4HHUA 2Q6BA 3EVYA 2MGZA 1FESA 3TEHB 4EGWA 3R1HA 3L7OA 3G2XA 2ZBQA 4QXBB 3IAS9 3JADA 3IO1A 4RW9B 3ZC0A 5L1JA 3PACA 3PV8A 2MSTA 3L95X 3CMLA 2FJVA 2V7LA 5LXTE 3GYXB 2IDOB 2VFUA 2KWHA 4MKBA 1T02A 3RW7A 4DSJA 1N32F 3A1YG 4C8MA 3RBEA 2ZH5A 3W3SA 1MU2B 2B9XA 3TZYA 1CUNA 4X66T 3RIAA 4FF4A 2BXJA 5KT3A 2LOPA 2DKOB 2MEWA 3PYDA 2FGCA 5FLXY 4HWFA 1FWKA 3VAJA 2H88A 5A8RB 4DN0A 2QA7A 4NCGB 4NLQA 4DV0F 5JH7E 4RBUA 2VVSA 3EVOA 3SFDA 3PUGA 3VF0B 2E9XD 3W5XA 3IAM9 4DEZA 3WC2A 3ONQA 4OHYA 4AQYF 2DPJA 2DRAA 1U6ZA 1Y5IB 2W25A 4FN5A 3KK2B 4LF8F 4J7CA 2J5AA 2BKNA 3DTOA 1UKUA 1HTJF 4LSNB 4YR3A 2XJ7A 1X4BA 4M1PA 3QJLA 2RIJA 3NCQA 4WZXA 2IAJB 3F41A 4K0UA 3VGUA 1LV5A 2YQ3A 1LWXA 4UOFA 2XYHB 4IRDA 2VG6A 4DL7A 2F4VT 1X5OA 5GONE 4CQ1A 3V5SA 5L46A 2Q79A 4CZZB 5HO4A 3DOLA 4P0BA 3L3PA 2O5DA 4IG0A 3AEAA 2IC3A 3BSCA 1YJ7A 4X62J 1N52B 2M6BA 1PIEA 1VK3A 1KDNA 1RI7A 1YRXA 1TELA 1D1BA 1YI2S 1P6TA 3TX8A 1WLXA 3EZOA 1VQLS 4LQ9A 2LDIA 3ZC1A 4L74A 1T94A 3W9IA 4LFAT 2ACXA 3QWUA 5HYAA 3CT9A 3L09A 4NLWA 1E6YB 2MKYA 1CJKB 5L1LA 2JEGA 4PQUB 4Q0BB 1YBTA 5F3ZA 4N56A 2CDQA 4OX9J 2JEIA 4ADZA 1S57A 4G1IA 2MZJA 2I38A 3BPSP 2A10A 4J9NA 2IDEA 3CC4S 5HCJA 2W67A 5ABHA 3RH3A 4FF3A 2ZC4A 3M6VA 1MNDA 2DVIA 4DUZJ 1GX5A 3AA0B 5I3UB 2PI4A 3S4UA 5E33A 3V5RA 3R7NB 4ECVA 3UT5E 2AYMA 4FZVA 1NSPA 3MM9B 5HP1A 1JMTA 2C5JA 2Q3PA 1S9EB 2M70A 3D6HB 4OYPA 4A4JA 2EHOD 4WP9A 3AEFA 4USKA 2RJZA 5DG7A 2HSEB 1S1TB 3QYYA 2BQRA 4LMZA 4J9MA 3M2UB 2CJBA 1FCAA 5E41A 2DHHA 3EE3A 2NZ4A 1VYAA 4YDDB 4NLSA 2DNPA 4XZCA 1PILA 4OYZA 4QOTA 4NX9A 4NE9C 2Q9QB 4ZZBA 3AEBA 2BQUA 1HNVA 3S6EA 3IWLA 2XAGB 1OY9A 2HHHJ 2PMZD 1HI0P 2W2NP 1NRKA 1RJJA 2BDEA 2FJBB 3CJTA 1DFDA 2D74B 1Q78A 1HARA 2LEPA 2ROEA 4LBIA 4NLVA 2WK4A 2CRLA 2B4VA 1JLAB 3ZTSA 2R7QA 4YHJA 2M9KA 4RW8B 1S0NA 5F3JA 4L72B 4WFAQ 3B4MA 1IKVA 1KVIA 3R5CA 3IRXA 4IE6A 1DU2A 5D6GA 1Y01A 4HGAA 3RB3A 2BM0A 1T03B 3OL6A 4U95A 3B8HA 5ABGA 2J7KA 3P4RA 3PRBA 4OIXA 1TU0B 1NK0A 5KFKA 4IOCQ 2MOZA 1N5TA 3FMBA 2JC1A 3M6XA 2H5JB 2RSQA 4RPFA 4B9UA 2EFNA 4RW4B 2VOPA 4P73A 2F65A 2VWAA 1YVFA 3ILLA 5JRCB 2BANB 4F0KA 4EWTA 3LGHA 3FRYA 2GIFA 5AE3A 3ETMA 1OJ4A 1XWMA 2UXBF 1U8SA 3R27A 2NCKL 1U48A 2DEJA 3ZZTA 4XPEA 3DLEA 5D0GA 4OYOA 4G65A 3RR7A 3MM7B 1UA0A 1NH8A 2BS3A 4H4MA 4DX7A 5L3FB 1N5YB 1VHFA 1A6LA 2WDRA 3UDLA 1OEDB 2UV8G 3TLWA 4ZP9A 3IM9A 1W25A 3CD0A 3RB6A 5RUBA 1D0YA 2YPZA 1M5PC 4O4JE 4LRBA 5T7LB 4DV5T 4LRAA 1VRTA 3AA1B 4ZPTR 4CI3B 3R9LA 1CJVA 5HLFB 5H9EJ 1X5SA 5KG1A 4FVMA 3QLHB 2JC0A 2YNGB 2GIQA 4QHOA 1PKUA 1QTNB 1RYSA 2G4BA 4K4VA 5LBMA 3S1TA 2W9BA 4D3HA 5B08A 5CA0E 1F5BA 1KEKA 3D9BA 5F8HA 1H2UX 2MLYA 3OTOF 3RR8A 3M2RA 4AE5A 1ACMB 2E7VA 3KG4A 5AQIB 4DR7F 3PX0A 3L7PA 1AJ3A 5F8MA 3UCZP 3SIPB 2ZKTA 4O4GA 3A7MA 3DDKA 5KFQA 1NCLA 1D0ZA 1YIJS 4V19J 3NKZA 1KQKA 2FY1A 4EEYA 4C8OA 2R7OA 4JI5T 3IGNA 3VZHA 2NQPA 4I0UA 2K24A 3R7SB 5KDMC 2YKMB 1IKYA 3SV3A 3BN7A 1RHRB 4ED0A 3LPYA 4TWHA 4DR4F 3C98B 2N3OA 3GN5B 5JQGE 3OR1A 2L3LA 4KX6A 4AKRB 1VQYA 4TV8E 1NK4A 4JUYA 3UCGA 4DL2A 1YZ6A 2FHMA 2VJVA 1BUXA 1MWQA 5EWGA 2XMMA 1X60A 2WQYA 2XQCA 2KMFA 2ZOFA 2X0HA 4KH0B 3HVTB 3ISND 2Z2ZA 2J76E 3BF4A 1VCTA 3MTJA 3KINB 4KIAA 5B0AA 4EBCA 2DCLA 2V2ZA 2ZBPA 5IV4A 4YR2A 1YJTA 2ZM2A 3B5MA 1DHMA 5LNKA 1UURA 3HCXA 1ZEEA 4J9PA 1BQNA 3AFGA 1RT6A 2ZHAA 4KI0F 3CJ3A 3R97A 1I1GA 4WU2A 5DM7Q 2BS2A 4ZVGA 3UFCX 4I0WA 2Z6EA 5JREA 4N8NA 4J90A 3PX4A 1Y3JA 5MLCV 3FFIB 1Y10A 4W90B 3MKDA 2JVRA 3DMJB 3NNAA 4KRWA 3QT7A 3QZ7A 3VTIA 4R25A 5D77A 5MAOA 2WMNA 2LXUA 3KBUA 1KQFB 4HI1A 4IG3B 4WBFA 1VI7A 1R6YA 3PEJA 4IL9A 2CRBA 5L4EA 4U3CA 2WS3A 2E8IA 3BQIA 5LOQA 2WY2A 3DN9A 3TARA 4DU7A 3UVJB 5AXLA 4TKTA 4O4RA 3QIPB 5H1SV 2ACYA 3VR8A 3M6UA 4Y28C 1HD0A 3CDBA 3GJQB 1UZDA 1D1UA 3N2KE 5FY0A 2PA8D 4ZI3C 4X64T 4UEMA 5BXIA 1VS3A 4RW9A 4C8NA 4ELUA 3D1QA 3PM9A 1Q95G 2PTFA 4TYBA 4J9RA 3M65A 4X4PA 4AKHA 5G0RB 2MQPA 1WF2A 4F0MA 1QVFR 5D4NA 2HW3A 2J7WA 1TUWA 1OPZA 3M9OB 3ETUA 4FKYA 1MU2A 4F3QA 2V63A 1WHYA 1VCSA 3TLSA 3CVRA 3PUSA 2ZHOA 4X62T 5AXNA 2CQBA 4LR7A 4RX6A 3N0VA 2Q66A 4MYUA 5A8RA 4DV7J 1KS2A 4IH7A 3I87A 5A2QU 2MDAA 3T3FA 2DISA 1WJ9A 4E7SA 3RAXA 2E5LT 2AZ3A 2ZD1B 1CJUA 3HI2A 4J9VA 1RP5A 3GIIA 2OMLA 3O1IA 3QBCA 5CCMA 1I94J 1YG0A 4Q45A 3TOQA 3UQ7A 4RNNA 2E29A 4OX9T 5KFEA 5LMNJ 4IDQA 4H4OB 3JYTB 3BGFA 3DLGB 1Y5LB 2ACZA 2J6SA 3UR3C 4DUZT 3BO2A 3SCIE 3R3TA 5LOVE 4DR5F 3ELHA 1MMAA 2YWEA 2XMVA 2IRXA 5KFTA 4I50E 2X67A 4OX7A 2GFFA 5L1IA 3W2WB 4CXYA 1YJNS 1SJ3P 3G4SS 2IA0A 1WG5A 3BGOP 1WRDA 2Y1JA 1FK9A 5FXXA 2KJWA 3WIUA 5C2TA 2DWGA 1YW0A 1DQ8A 2LQ9A 2MQOA 5HEOA 4X4VA 4TV9E 3J80Y 3UN5A 4JI4T 4X4RA 1UUSA 3FK4A 2XQ3A 2W9CB 2KKHA 2Y1IA 1HS7A 1OWXA 4FXDA 2DY1A 5CB4E 2FTRA 2XYGB 3I56S 3PUVF 1UWBB 4KMCA 2XQ9A 2CA9A 3LG7A 1D1CA 3OV7A 1CJKA 3I9WA 2CE7A 2B51A 2CNOB 5ETRA 2ZBIA 2KZ7B 2FC9A 4RUCA 4ZCKA 1GTHA 3K5PA 1RTHB 4KR0B 1VQ6S 4EO8A 5KFRA 1BXNA 1OQ3A 2EXUA 9RUBA 1OQ6A 2XAQB 2VA3A 2QV6A 1TTHB 1K9MT 2KT2A 2RQKA 3SMZA 1HYSB 1NBEB 3OFFA 1TKXB 3PR5B 2FZCB 4I43B 3D67A 6AT1B 4WFYA 1X79A 3PCOB 3P49B 2ZFHA 2LCWA 1Q86T 3DM2B 2M8DB 3AJDA 4DBQA 3IS9A 1BR2A 1U1KA 1S1TA 4DR3J 5C3JA 1ZKEA 3ABVA 2RE1A 2DB1A 1JLQB 4N77A 4JUZA 1OXZA 2DJWA 2Q9QC 5HMYA 1BR4A 3CPZA 3AAAB 4WJBA 3IEEA 4MT1A 4B3RJ 4KYZA 2GC8A 4OJGA 2C2KB 1WHXA 4ZJQA 2K1RB 5DZ6A 2V5HG 1RKJA 3DLHA 2PI5A 2Q9QA 2EK1A 1U45A 2YPYA 4UIGA 1FD2A 3Q8RB 2M7SA 1HG5A 1IBKT 1EP4B 2YEVC 4DVDA 1YGYA 3CGIA 2E9ZA 5DLGA 8ATCB 5IXUA 4HH1A 2FJBA 5CYJA 3QNUA 3ANWB 2NW7A 1U4BA 1R0AB 1A0OB 3MM6B 2KRRA 3HVAA 1JJCB 4ASKA 3W65A 2RPAA 4KV8A 2VL1A 4V1Ak 1N36J 4X62F 4WYVA 2O1PA 4QWNB 3CMQA 4DFMA 1X7VA 2XY8B 1M5VC 4FF2A 4ECWA 4Q44A 4I2QA 4F3OA 1RZMA 2J0SD 2AGPA 1KNRA 2UVUA 2R7WA 1T72A 4HTEA 5A76A 3CMES 3ILOA 3MZKB 2J7UA 1ZH5A 1UEVA 1LWEB 2F3JA 2LVWA 3P3DA 1HF8A 1T03A 4DXLA 3M32B 4A97A 2JOQA 1UEKA 2HFOA 1F5AA
chains in the Genus database with same CATH topology
3QGHA 1YJUA 2K7JA 5B0EA 2RILA 1O8BA 3OJAA 4OX9F 5JR9C 5L3CB 2DI4A 3W2VB 2XSJA 4NZ0A 4BWJA 4F67A 4K4WA 1RQ0A 2AYGA 3IGVA 1GH8A 5EK4A 3DRRA 2CJ9A 3KLGB 3SXLA 4DSIA 2CEAA 4P7TA 5A8WA 1S99A 4UQTA 3M30B 5DM6Q 3BR8A 4L0RA 1MMNA 2DR5A 3VAHA 1U1MA 2IJNA 3P96A 1L3SA 3KG0A 1SA0E 2CXLA 2CPXA 2ZC3A 1KHWA 2C3YA 4WXWA 5BR8F 2NWBA 3GFXA 1S1UA 4RW4A 3MJXA 1ZOTA 1MWYA 3WZ0A 4F26A 5CYQB 3IA0A 2BANA 2LSKA 3ANWA 2EFOA 1Q16B 3KLIB 3N6LA 1IKXB 1JIHA 5L1KA 3BGUA 4DUZF 1R0AA 1QVGR 2B6AA 3MM6A 1ZAVA 5C42A 5J2MA 3NMAA 3DDNA <