1KNZA

Recognition of the rotavirus mrna 3' consensus by an asymmetric nsp3 homodimer
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
157
structure length
154
Chain Sequence
TQQMAVSIINSSFEAAVVAATSALENMGIEYDYQDIYSRVKNKFDFVMDDSGVKNNPIGKAITIDQALNNKFGSAIRNRNWLADTSRPAKLDEDVNKLRMMLGIDQKMRVLNACFSVKRIPGKSSSIIKCTKLMRDKLERGEVEVDDSFVDEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of the rotavirus mRNA 3' consensus by an asymmetric NSP3 homodimer.
pubmed doi rcsb
source organism Simian rotavirus a/sa11
molecule tags Viral protein/rna
molecule keywords 5'-R(*UP*GP*AP*CP*C)-3'
total genus 52
structure length 154
sequence length 157
chains with identical sequence B, C, D, I, J, M, N
ec nomenclature
pdb deposition date 2001-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.550 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1knzA01
3.30.70.1610 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1knzA02
1KNZA
chains in the Genus database with same CATH superfamily
2VIHA 2WW4A 1K73T 4AUKA 4ZPAA 4NXMT 4DV3J 4QIWD 4C98A 2PA8D 2XWYA 4TWHA 2DH9A 2J4GA 2C2NA 5DG9A 1FK9A 4FZVA 4DQRA 2CRBA 3PU8A 4PR6A 3M6WA 2KRRA 4IO9Q 3PO4A 5EGYA 1KR4A 5D3GB 1IKYA 4PNIA 5HVHA 2J9DA 1YX2A 3M2VA 1RQ0A 4ILLA 2XS2A 2LOPA 2CQ2A 3C50A 3VRBA 1HNIA 3Q2TC 3QT6A 2MQ8A 2B51A 5LB7B 3CJSA 3ZPOA 4DQSA 1S1VA 3IBFB 2VA3A 4ZP6A 1X7VA 2XLJA 3PU3A 4XBFB 3HHEA 2DK2A 4DO0A 3MGJA 4X64J 3JQKA 3CE8A 2KMFA 2CPDA 1KN6A 2VKDA 2U1AA 4IFYB 1M62A 1LXJA 4LIRA 3Q8PB 4PRFA 3I0OA 5J2PA 2CRLA 3MPVA 1WOSA 2BYCA 3LGMA 2YBVA 1D1CA 1NPKA 1AROP 2XO7A 5BMVE 5GMEA 3N9MA 2MPKA 1SE7A 4KPCA 2YNHB 2WQYA 1BR4A 4PWWA 1IQZA 4DIDB 2ZH4A 3D0IE 1GTEA 1LWXA 4B9VA 3B4DA 5CYQA 1JLGB 4ED5A 2HG4A 2HS4A 3J81j 4GKJT 2M88A 2KJVA 1IJ6A 3AE4A 2KXFA 3FXDB 4MAKA 1DTTA 5F3ZA 3H40A 2MKSA 4P72A 3C98B 3TP2A 1FMVA 1DTTB 3H42A 5C8YE 1IKXB 4HACA 4PG8A 5LGNB 2MZJA 4O23A 3LGHA 4OK0A 4TU7A 1UPMB 4B3RJ 4LFAT 4ES2A 3N2OA 3MMAB 6FDRA 1FJEB 3MXZA 5M2UA 4RNHA 4QWDA 2V4JA 1N48A 4DV2F 2NXCA 5CCLA 4DPYA 2YOEA 2DNNA 3HVWA 4F04B 1T3OA 1S97A 2X1BA 1FJGF 2V94A 1C1BA 3A4TA 3TVYA 1YKHB 3O3LA 4B9LA 2R2TA 3AXJA 2LHRA 1U6ZA 4O4HE 1QLBA 3ZXWA 3O1IA 4B3SJ 3SQGB 4QR2A 2JLEA 3C6UA 4B3MF 4NX9A 5AE3A 4RBTA 4WTOB 2PFDA 1S1VB 1X9BA 4OQJA 5KFLA 4ICLB 4DR2F 3NS5A 1VIXA 1HNIB 4HL9A 1TELA 3K1SA 4ZP8A 2C0SA 2M7SA 2HZAA 4WE1B 3GILA 2CJQA 2MSSA 5B0BA 2HHXA 4CN6A 1L0VA 1CG2A 2K24A 2FYXA 3JCFA 1VCSA 4UXNB 4DDFA 5IHYA 2DO4A 2AF6A 2HNDB 4BWJA 5B0CA 3LF0A 2Q1LA 3BGRB 1HWKA 4QHOA 2AJQA 4ECSA 1UFWA 1U1PA 1JKHB 1UFLA 3GQCA 2IA6A 2N7CA 5A6PA 5IQQA 4DR1T 3CDWA 4OLOA 5D6GA 1GXTA 2JOQA 2E5LT 5AXMA 3MR5A 3POTB 3HHNB 1NKCA 1SQGA 3BS9A 3V6DA 3HR0A 3GFXA 2HHVA 3MR7A 2V4RA 1TUGB 3M8SA 2Y1LB 4N56A 3OVAA 3D7SB 2YTCA 3P8CD 2IVYA 4RNNA 1XN9A 1BR2A 2K3IA 1SJQA 3BJYA 4DV3F 2AJFE 2OD4A 1U4QA 3PHEA 2GVDA 3MEEB 3MDFA 1IBMT 3OL9A 1HIYA 2J6UA 4ED3A 3BSAA 1X4EA 5LGUB 5KG0A 4KPYA 2VU5A 2QTWA 4C97A 1RWWB 1VQYA 4B3TF 5LSRA 1JB0C 2JMHA 3RR8A 1GEHA 3TVKA 2KFYA 5G4DA 3DOKB 1ZS6A 3S01A 2SXLA 1FA0A 2FD2A 3R8YA 3KLVA 4LFBJ 3W3SA 1WLXA 2CXLA 1VHFA 4OYPA 3PY8A 4QBUA 2H89A 1KTQA 5DG8A 4Y2CA 2MKKA 2V7MA 5L1IA 1D9DA 2DHHA 2YN6A 2X0LB 1XC9A 1FNXH 3OTBA 1NO8A 2W1BA 1N32F 1O3XA 4RR5A 4OI1A 4DR7F 4JI0T 1S6QA 4PABA 1SC6A 1W7WA 1F3VA 1BGXT 3DRRB 4ZMMA 4LF6F 1UWBB 3GN5B 4UVCB 5KFUA 3EICA 2ODUA 4EFAC 2J7WA 4KBIA 3EGWB 3AE5A 4KP3C 3JTOA 2HNYA 5A8KB 4Q2MA 4A8YA 3CCJS 3W64A 1RTDB 3HPOA 3IN5A 3HSDA 1D8YA 1UK5A 2BQRA 2BS3A 3LK2B 1T9XA 3QLHB 4OFZA 3CSKA 2W00A 1YRXA 2VICA 2J9EA 2H4WB 4WKYA 4I67A 1IR1A 2XHWA 3IGVA 1EARA 5IXUA 4DR3J 2GK9A 3UU6A 4LF5T 4ANDA 1U48A 1B0PA 3I0SA 5HQ8A 3T3FA 3ZT6A 3K0JA 4B3ST 4CRJA 4J90A 2BA9A 3EM1A 1G7CB 4NZ6A 1P1LA 3BQ1A 3H3MA 2K5BB 5KT2A 5DM6Q 4WE1A 2XQCA 3DLJA 1KLMA 5D4NA 4ER8A 1N5SA 2W9AA 4IOBA 1IKXA 1LW0A 1HMVA 4DR4J 4XZCA 3RB3A 4AISA 2LLYA 1YKEB 3AJ2A 4PXDA 1SIWB 1S72S 1WG5A 1Y4ZB 2MKYA 3M7VA 4UVBB 4MFBB 2V7LA 3EGVA 1W26A 2CQPA 1O6XA 4ZVGA 1QLNA 3UO0A 3FJ2A 3MK7C 1J5ET 1G1XA 2X3GA 5J2QB 2XMKA 1Q5YA 3AH6A 1XWLA 5KMGP 4LR8A 2XQYA 3QSIA 4EAHA 2V2VA 4ECVA 4E7SA 2X7IA 1PILA 1RWUA 2FZCB 3EXCX 3V4IA 2CJXB 2IIUA 1VQ6S 4ZVPB 2C3MA 2ASLA 1H98A 4WNKA 5BR8F 4A48A 4LFAF 1HFEL 2FJDA 2B5JB 2J8AA 3OR1A 3S4UA 4DUZT 1SUQB 4AYBD 4HFEA 3BKTA 4M8LA 2D9OA 3KHRA 4CNYA 2FTRA 2JX2A 1IAPA 1S48A 4P10A 5ABFA 3CCQS 2PJQA 5LSLA 4HTEA 5HMWA 5K20B 4RNOA 1J5OB 2B4UA 2DR6A 1KVJA 1IBMJ 2KFNA 3UFEA 2Z56B 4IE6A 3U1NA 4B6XA 5DDOC 2BZBA 2VONA 1KEYA 1URRA 3IR6B 3K5OA 5HXCA 3OD2A 3D0HE 2O67A 2ZNYA 2QLWA 3ZZRA 2Z2ZA 3HHKA 3RYCE 2XY5A 3F73A 3BB5A 2IRXA 3EDUA 1XNQJ 3NS7B 4O3QA 5AFUL 4DV7J 5CH7B 4ENOA 1Y7PA 3THPA 1FJCA 4NCGB 1QD1A 3ILJA 3PUXF 2XCAA 2XSJA 5C7PA 3CJ5A 1FD2A 1U7LA 1P1TA 1V3ZA 3UN3A 3GA8A 1S0NA 4YT0A 4KT0C 1WJ9A 4DCJB 4NXMJ 3KK1A 1Q8KA 2DXDA 2Y0BB 3G6XA 5BJRA 1F0XA 3S1TA 2MDAA 2WCAA 2E9XD 2UXDJ 1N33J 1JLEB 1EP4B 1TL3B 3HX9A 1NSQA 3VU7H 2WVBA 4X62J 4KR0B 2WZ1A 1DAXA 3JSYA 3JADA 4G65A 4RW6A 4CO3A 3IGNA 2HFSA 1RK8A 2IAJA 3E0ZA 3RJMB 2Z2LA 1S9GB 1B99A 4K50A 2Q9QB 5IWAT 3LUYA 3CJ8A 2XMWA 3W5YA 2EVZA 4IH6A 3CCZA 5A6WA 2O66A 3MM6A 2JMKA 3WX8A 3PV0F 1YJ7A 1U1LA 3OYXA 1Z0PA 1KRPA 1SL1A 5JH7E 2DL1A 2H5EA 1MWQA 1WRDA 1NDLA 1RAGB 3TX0A 4CNZA 1MMGA 4DR4F 3CDEA 2DCFA 1WF0A 2ZH3A 4IOAQ 3P45B 4N8NA 3RQUA 1WC4A 3AXMA 2EKNA 4ZVOB 4Q45A 2BR0A 2CA5A 4EI2A 1X4GA 3GPAA 1LKXA 3CEDA 4GVBA 4ECYA 3AECA 4ZZBA 1AFIA 2ZM6T 2QLJB 3M2UA 3MAAA 3VAMA 3B82A 5LG3A 2MYSA 4KH0B 1N54B 1ZTWA 3BN4A 3SXLA 3CJ2A 5ABEA 3CTRA 3HVTB 3E3XA 1NU4A 2GFFA 4MMOA 1LVFA 1HWJA 2JVOA 4AKIA 3PDNA 3OVBA 1K1SA 2HNZA 5IWAF 3SEOA 2KL8A 5DGAA 1LXNA 4H9NC 4MYUA 4I43B 2EHOD 4DPWA 3PYFA 3W9IA 2P2CB 4C8ZA 2IDLA 2ASYA 2ZBQA 1ICEB 2AZ1A 1HHQA 2PBIA 3G82A 4ZCMA 2YDRA 3M8PA 3DP7A 4OYIA 1IBLF 2WSCC 1WFDA 4YHHF 4X4VA 2FHJD 1S59A 2JSXA 2HNYB 3QQCD 4RBVA 3UULA 1VDHA 1M0SA 3NKZA 1NJXA 3Q23A 2ZVIA 3AA8A 2PT0A 3OXGA 4KFBB 4ED1A 4X84A 3M8RA 5SUHA 3QPIA 5JTGA 2CZ9A 1GNKA 3CDUA 1KLNA 4PWDA 1WDTA 2R7UA 1I6ZA 2ZOMA 2FVQA 4DV2T 3K3QC 4WW0A 3ETMA 3WIUA 2EPIA 4EYHB 4P0AA 4OV6A 3I31A 3HSGA 3NS6A 1RHRB 3G8TA 4HWFA 3C8YA 5E3CA 2KT3A 1SH0A 4O44B 3OFGA 5HBMB 3WHIA 3ILLA 3HLUA 3D9BA 4EK2A 1X5TA 2XYGB 4RW4B 4QPTA 3VVTA 4Z8XA 2M6IA 3FBFA 2AEJA 4KGVB 3U7JA 2HGMA 2BQ3A 2Q6CA 4USTA 2IRUA 5ETWA 4FKXA 4H54A 2OEKA 3DM2B 5LNKA 4RU2A 4PQUB 3V81B 3P4RA 2OPPA 1HKAA 4PJMA 4UZBA 2VG7A 2DEJA 1BMQB 2R3VA 3H98A 3NCPA 3G86A 3C15A 4ZCKA 4DL6A 2HMIA 1C1CB 3CDBA 3V6DB 4UW2A 4E7ZA 1C2PA 2D41A 3PYDA 4DSEA 4LF7T 1FVSA 2QO3A 3GCWP 5KFAA 3A5XA 3NXZA 2CNOB 4H4OA 4DLGA 1HBOB 2GAGC 3ZLIA 5AQKB 4A8QA 2XQ5A 4EXTA 4DG1B 3DC2A 2ASDA 1T95A 4KGXB 3ZSTA 5J2NB 2Z4PA 4LF4F 1KQFB 2A72A 3J7AN 2CPEA 1JXVA 2L9DA 2W2UA 5A2QY 4X4UA 3ONLC 4DZDA 4GC7A 4ZHRB 2EG1A 5DS7A 2FY8A 5ETKA 3Q5XA 1YSJA 1S94A 2VQFJ 4CLWA 3L09A 1LRZA 3PW4A 3N9LA 3W5ZA 3PW7A 1R0AB 2KT2A 1ZV4X 5F8PA 4YB7A 2FIUA 3DLHA 2UU9F 4JV5F 3FSYA 2QSFA 3UU3A 3LOUA 3PIOQ 4AE5A 2DRDA 4M5LA 2YNIB 1N36T 2CQBA 3R9LA 1JNRB 2HYIB 4IUFA 5FDLB 4EGLA 1FWPA 2IY5B 3CJQA 2M4MA 5HMXA 1U26A 2KXHA 2C3PA 4PAGA 3KG4A 4K4VA 2FZGB 4FXVA 3MM7A 3P96A 2R7SA 3CPWR 1HS7A 4JV2A 1JJ4A 1RTZA 4JEUB 2W25A 4IDPA 2EXUA 1U45A 2QC3A 2B0GA 1WD6A 3CCTA 2N7YA 2J47A 3DRPB 4ZIWA 5A8WA 5DGBA 2CWYA 4ILCA 3KJQB 1KVIA 4CT9A 2CVIA 2XZDB 4Y2AA 2RQCA 2UUBT 4ZOSA 1EP4A 4LBPA 5C3JA 3CIZA 2H48B 1JJCB 3CMAS 4AIUA 3RLFF 3MI7X 3UNGC 3RAQA 3HF5A 4LQ3A 2V6XA 1G4CA 4DF4A 4NWBA 3BO2A 4J5OA 3EVYA 2CMRA 3FB2A 2K3WA 2ZUGA 1M1GA 2JJ9A 4MKVA 1H38A 2XULA 3UT5E 2YDSA 1VFJA 4DUYJ 4UY8T 1YIJS 4WYWA 2UUAJ 2V7KA 2AU0A 1PJ6A 2UUBJ 4K4ZA 1K0TA 2YH1A 3BEGB 4QWNB 2W24A 3RTVA 1HL6A 1CHUA 1AZSA 2APOA 1NM2A 1CQMA 3PACA 5H9EJ 1K47A 1HWUA 4K2XA 3N01A 3AEFA 4CI3B 1XMOJ 2XMMA 3DRSB 2KG1A 1YLXA 2DR7A 3HI2A 1HFAA 2Q79A 3K5LA 4F6RC 3R6LB 5IS2A 2AGPA 2LMIA 1ZZNA 2XB2D 4B9SA 4EIWA 1HNVA 4ZLLA 1V9DA 3M9MB 3TA1A 5H9EK 2GMHA 2ZUAA 4ZJLA 4YHHT 4G1QA 2ZH8A 4R5PA 1R8BA 3KJVB 4TLRA 3BSOA 2CWKA 4EEDA 2JDJA 2Z8QA 2G13A 1S57A 4ATNA 3DLBA 3NMRA 4ID8A 5JMNA 2K8GA 3CC7S 2XG8A 1NKEA 1UUSA 5HXHA 5C42B 1NLKL 4YS2A 2KYZA 4J9UE 1T9WA 5L3GB 3V6JA 2L9NA 1RE1B 4UQGA 4CIOA 5F9NA 2GMLA 4O0NA 3MWBA 1WEXA 1HQ2A 4LMKA 2FJDB 1JLBB 1MW7A 2R42A 1Q95G 3BKFA 3DOMB 2G0UA 3RIFA 2LYVA 5H6RB 5KFQA 1KBRA 1BR0A 3GJRB 2FHOB 4HT7A 5EWGA 3EX7B 2Q66A 2AW0A 1M7KA 3OFEA 3FBZA 2IM3A 1RHMB 2MHNA 2VBWA 1M5PC 4ECWA 4L5GA 4HFDA 5LGTB 2GC8A 1SB6A 3M8ZA 3FRZA 4F4YA 4QXCB 4DLEA 1FX4A 3WC0A 1FXRA 2OPSB 2M6BA 4V1Av 3ZFVA 3SSQA 3QNWB 1S1TA 1FTRA 3EDVA 4BAYB 3N6LA 4AQFC 1HA1A 1QSYA 2H65B 3MURP 1DRZA 1NAFA 2VVNA 1O5JA 2X68A 3KV6A 2QRXA 4PFOA 4HGAA 2B6AB 2IDOB 4ID5B 3U3IA 2DCUB 4S0MA 4RU9A 1N56A 1NK4A 2F40A 1TK0A 1LW0B 3W5XA 4X2BA 3HZGA 3CQXC 3BBCA 4K5SA 3ZJ1A 3CK6A 2WVFA 1X5PA 2HQFA 3M6UA 1ZTTA 1TP7A 5C2CA 3KHGA 3M1VB 3RGIA 4Z37A 1LKZA 1X5SA 2RDJA 3R2CJ 2R7OA 4E98A 4EZ4A 2YXLA 4OHXA 2IA0A 1HWIA 4JV5J 1RTDA 3PJXA 3MCMA 1UKUA 3FQKA 4EUVA 4I6WA 5JQGE 1N5YB 3W62A 2WVDA 5DZ6A 3CCVS 2A6OA 3MEKA 3KHLA 4KV8B 2VG5B 5E7OB 3C46A 5CXTA 3TAQA 4TU8A 5KFHA 1CS4A 1DQAA 3Q8RB 4C8LA 2QGFB 2DGSA 4P7VA 3B78A 1LFPA 3AE2A 2AYMA 2DEIA 4PPZA 1FRKA 1JXLA 1N34T 1D1AA 3PRDA 4Y00A 3RRGA 2ZH6A 3R7BB 1RAHB 1HPZA 2AJ0A 4RW4A 2GA7A 5ETVA 4UUXA 1YZ6A 2CWOA 3VAFA 2DXFA 2JEGA 4NLXA 2CHNA 4RWWA 4PG7A 1U09A 2D3OR 1M5VC 5KFPA 3MCSA 5ABGA 1ZM2A 2V69A 2M52A 3FZ2A 3VV2B 4O3SA 1S1WA 2QVAA 2RHSB 4DS5A 1Q79A 2UXDF 8AT1B 4JBCA 2P9BA 1S9EA 1IKWB 5LMNT 4CXWA 5ETOA 4IE7A 4R25A 2J0QD 4Z7YA 4USJC 1WC1A 2VKZG 4GRSA 2VASA 5IT9Y 2YWFA 3J80Y 2I6HA 4URGA 1TUWA 5AQOB 5ADXL 2J0WA 3BGOP 2NW9A 4MKAA 3KLFA 3ZC0A 3EJMA 3FKBA 3ZZZA 1S6PA 2BE7D 2XMTA 3KJNB 4FJOA 1XMOT 5E3AA 2CXDA 5ETMA 1FRMA 2ERRA 3M6VA 5J0ZA 1CC7A 2W2MP 1Y5NB 4U6PA 2VZ9A 4IG0A 2F9DA 4L3NA 4C90A 2HHWA 1CJTA 4JI0J 3QYYA 3N6MA 3M8WA 2G1DA 2BJEA 2ALZA 4R8UB 3KVAA 5A0YB 2J1DG 1KTVA 1UFKA 1KKHA 1HI8A 1RT2B 3ET6B 1X0PA 1NDCA 1MMDA 2BJDA 3OR2B 3SI8A 4NYPA 5E5NA 1P9QC 1NSKL 4F2SA 4ZITA 2YX7A 5J1NA 2RS2A 3QRPA 3KK2A 2Y6XA 5D0GA 2WTFA 3NCRA 3HZEA 2CG4A 1YBTA 3NGRA 4ID5A 5CYJA 1U02A 4KMCA 4RW8A 3TQEA 3CJKA 5HQMA 2M2BA 1OIAA 4KHPJ 4ETXA 2GO9A 4MTPA 2E1CA 4AKHA 4YB6A 1KD1T 4P6QA 3ILOA 4X4NA 1TMMA 3GJTB 4IQMA 4O2BE 2AHOB 3NGKA 5IOLA 2KVQE 1Y9OA 2E9RX 3LWLA 3DM2A 2YWHA 1V5IB 4OI6A 5L1KA 4IT4A 3JSMA 5KFSA 2E5IA 1KK7A 3MEDB 4PCQA 1Y11A 4CO0A 2KSRA 2ATLA 3T5LA 3OBVE 2MQPA 2W9BB 1P6TA 3K2YA 2W61A 3K5MA 2DO0A 3MTKA 2HS0A 4DL4A 4DR1J 5AQQB 1VR6A 4OYKA 3ZZ0A 4L76A 3RRCA 2NTXA 5J1EA 1FKOB 2OI2A 4ECRA 3TJ8A 3KHHA 4DI6A 5FY7A 3KNGA 2IMLA 2F4VF 1RAFB 2KINB 3EUNA 3F31A 4V1Ak 3R5BA 4P75A 2KHDA 3KLIB 2KRBA 1WUUA 1AJ3A 2HH7A 1T05A 1HYSA 4BC7A 2B9YA 3P5BP 1UWAA 3CWZB 3PUGA 1FRLA 2LM2A 3I82A 1IN0A 3CIRA 4DV6F 4AQGA 3PUQA 3OHAA 1WKKA 1Q82T 1B70B 3G71S 3R7NB 1ELOA 2XGQA 3SV4A 4H4KC 3M8PB 1T8EA 1E1HB 2V8VA 3LP0B 3I56S 5AT1B 4LT6A 4MLKA 2VDIA 2NOXA 3EGNA 1KHWA 1KNZA 1GK8A 1S0MA 5B0DA 4YSYA 1RXOB 3D5MA 5DJQC 4Q7AA 7FDRA 5GONE 2R2UA 1KOHA 3C14A 4JYAJ 1WC3A 5JR9A 1QTNB 1R3NA 4DV4F 1T7PA 3IA0A 3A12A 3AA1B 4K8RA 3GMIA 2A3DA 3CCMS 2KN4A 3JB9k 5DZ7A 4IH5A 1ZPVA 3HDSA 5E3RA 1ROFA 2VODA 2GV1A 2GS8A 3D68A 3AOCA 3TR5A 4GKKF 3WAJA 3M32B 5DDRC 3DMJA 1DJ0A 2FVSA 3OVSA 1VQLS 4EZ6A 4QYZK 4R5PB 2A2DA 2V50A 5I3UB 2RU3A 4ZLJA 2ZWPA 4RW9B 4H9OC 2AX0A 4A8WA 1EJ7L 1G6BA 4Y34A 1X0FA 1TAUA 2E5JA 1BXNA 2ZNZA 3RRWA 1S0OA 3AY0A 1WC5A 1UA0A 4E0DA 1NK6A 2I0XA 1S1UB 5LJ5Y 4C3MA 4P2XA 2R6GF 1U5PA 1FWLA 3D1QA 2BXJA 1ZETA 2PGCA 1ZZFA 4RNMA 5KG5A 1V3SA 3QAUA 2PIIA 4PQAA 4I50E 4JI5T 4UTGA 1E6VB 2Y1IA 3W2WA 3NKYA 5AE2A 2ZOFA 4O4LE 4IE0A 1IBKF 2CAJA 5C24A 1TV6B 4RW6B 2C5IT 1T9TA 4FS1A 4KGKA 4OYZA 2V7IA 3MJXA 4C8KA 2ACXA 2CJYB 2XEXA 4CWBA 1Q81T 1QUVA 4K0KT 3PYEA 3JSMB 3KK2B 2XTJP 1NH7A 4PUOB 3PJAA 4WXOA 4QXBB 1WR6A 1SJ3P 2XY6A 1MROB 4F7VA 5HLFB 2Y1JA 1SQFA 2RAQA 4DQPA 4ZVTB 3MM9A 3UR3C 3J81Y 3EPGA 3J7Yq 1T9UA 1B0TA 2G0JA 1ZBTA 2AT1B 2M8HA 3PR5B 1G2EA 4PJJA 1RADB 2DGVA 1RUSA 1IM4A 1KNPA 4KGZB 3OQ2A 4Z91A 1SKRA 4DEZA 4Y0FA 3EZ5A 4JUYA 1T11A 1N33F 4G63A 4MK8A 3ZZPA 3WAKA 2DCLA 2RUSA 3KLHA 4Y2IA 3LG7A 2CQDA 1YJ9S 2B9WA 4GMKA 3TAMA 5JREA 2KKHA 1RT3A 4O4IE 3JTPA 3MMBA 3QFHA 2ZKUA 2GCFA 1TAQA 1IBCB 4NOHA 2HHHF 2MLXA 3CNQP 5ABFB 1WEZA 3W63A 2E5LJ 4DL7A 3GWCA 2WSEC 3EUHA 3BR8A 3AQPA 3C64A 4PQUA 5FLXU 1YBUA 2NPFA 4DU8A 3SCKE 4JBWF 3NWIA 2YKNA 5IT4A 3MUTP 4RW7A 2OEJA 3N9OA 3D0TA 2WOMB 1T9VA 3QSYB 5KG7A 4XPEA 3WI3A 4OX9T 2MBGA 3ZN0B 1O51A 3LK3B 3FQLA 4C8OA 5DQHA 2ZZTA 2PMWA 2EHOB 4YP3A 1ZH5A 1YQ4A 2F4VT 4BWMA 3LTOA 1LWEB 2CNNB 1UCUA 4WP8A 2RKIA 1C1CA 4JEHB 1VOMA 3HT0A 3UN5A 1XMQF 2PDAA 1LFWA 3HHLC 2DR9A 3T41A 3MTJA 4U2YA 4CO1A 4K4SA 3BQ0A 2LSYA 4ITSA 1SBRA 4DPOA 3GYNA 2O1PA 2XLIA 2C3UA 3I0SB 4J9QA 4YSZA 2ZJRQ 3PE0A 2OKQA 1VRTA 2BVLA 2OPRA 3A3NB 5HANA 2DNRA 4IFVB 4QIVA 2AE9A 2EK1A 2W66A 2YEVC 4D3HA 3OTEA 3WZ0A 1RBOB 4U7UK 1D0ZA 2BKPA 4I2PB 1WC6A 2CJBA 2R9LA 1N0VC 3TUJC 1WDDA 2WOMA 3AA6B 3AE9A 4EO8A 4YFSA 3F56A 3JAMU 3LQVA 3PRBA 1SHZC 5KFBA 4J9MA 4O4GA 2HBZB 4FPIA 1P8GA 2B4PA 1FHTA 2EK6A 4WFXA 5IV4A 1ZP0A 1S6QB 1RWVB 5HMZA 4EMDA 3BF4A 4C8NA 3DU6A 5DQIA 1S1TB 3LAMA 3P4PA 3KG0A 3TKLB 5HEUA 3GTYX 2BQUA 2HIYA 4DR2T 3W8GA 5MLCV 1S5ZA 5KFCA 1L3KA 3WIVA 5GAEU 1QJHA 3NGSA 3SCLE 2W2NP 2VKJA 2Q6BA 3T9NA 3E2EA 1CPZA 4IREA 3C19A 3DJBA 1PJ5A 4KC5A 1TZ0A 4I0WA 3SDEB 4HWCA 4A8FA 2LQBA 2K7KA 3I9V9 2GQ2A 3N28A 3TUPA 3OSNA 4EWTA 1F5BA 3ANWB 1WACA 1T3NA 5KOWA 5HWYA 2AIRB 5CYMB 1UVNA 4CLKA 1QSDA 1NDKA 5DDQC 3MMAA 5F41A 4UQTA 4A8MP 5B7WA 5LJNA 5AJ3J 3VHLA 4OHYA 4A8OA 4OZ5A 4ISTA 3CW2C 4Q5VA 3W15B 3N9QA 3PUZF 1FWKA 4ZPTR 4WF9Q 2BJ7A 4DR7J 2X51A 4W90B 2E9ZA 5L3FB 4H9PC 3RH3A 2E5GA 1VC5A 1Y5LB 2H4YB 2JWNA 3LALA 3LBXA 3M3ZB 1IXKA 1RT1B 2LM9A 2HIQA 2M67A 4PYDA 4KV8A 1S35A 2WDRA 2GIRA 1FNOA 4H9RC 2VKOA 4ZI3C 1XNRJ 2VQEJ 2BZ2A 4PAAA 5E3QA 2VFTA 2YK0A 2YH0A 1YTYA 4NLGA 1X8DA 1Y10A 1FJGT 4ZJOA 1DFDA 2DBBA 3OUYA 5KFGA 1CVJA 2XPKA 5AQUB 1RT7A 4J9OA 3PFEA 2VF3A 3MCNA 1HPZB 2HFVA 3QWPA 1YJNS 2D5UA 1OY6A 4FBUA 3ZYKA 4TWFA 4LF8J 4NL5A 1R8IA 2HQGA 3PUAA 3N4WA 3PR4A 1TK8A 2DNZA 4DFMA 3MR3A 3BSCA 4AQYF 2C3OA 5EWEA 3HKZD 3SIPB 4YEAA 4WU3A 3E51A 1JIHA 2MZ1A 5I3UA 5HL7Q 3AD7C 5HAXA 3PURA 2XM3A 2RQMA 1RT6A 4QCLA 4I2QB 4GKJF 1LWFA 1Q78A 1RHKB 3C4ZA 2WMOA 4OHVA 4KGMA 4RWXA 2J5AA 5JDNA 1MN7A 4DV0F 5DG7A 3MUVP 2RD5C 3MKDA 3ADAC 3ZT5A 3CCLS 4WBNE 2HW3A 1NK8A 4ZPCA 4DSJA 4N78D 3DYAB 5LMUF 1FE0A 2MGZA 4F4XA 1K8AT 2HGNA 1U1KA 4K0UA 2LA6A 3VALA 3GMGA 4YB1P 2E9XA 1Q4RA 2R7TA 1SC1B 4FYYB 2NR4A 1PKUA 1RLCL 2LA4A 2Z30B 2G1HA 3K8VA 3EI0A 4WIQA 4DOZA 2ZH1A 3DDIA 1SVDA 4OYJA 3X1DA 5I4MA 5HP1B 5CA5A 1SUQA 3S8SA 3HJFA 3K57A 2UXCT 1REVB 4JI7J 4H63H 4IE5A 3CJKB 4JV0A 2WONA 4N41A 4HKQA 3D54A 3UUNA 3PX0A 1OPZA 3NNCA 4C48A 4B9TA 5A1LA 1FE4A 3G96A 3KXDA 2KFZA 4RLEA 4A8KA 4WKRA 2BDPA 5B0EA 1ZYQA 4M63A 5J2PB 3QT8A 1HBMA 2IBKA 3CDAA 3D4JA 2EFOA 4MKYA 4WBFA 1TKTA 1UL3A 3TLWA 3R3TA 1G73A 3JTNA 4YN3B 3W9JA 4ZI2C 4EBEA 1HNZT 4KSEB 3I9ZA 2KM8B 4DL2A 5A8RB 5HXEA 1AYEA 2FVRA 5CZVA 1RT5B 4WU2A 3LO3A 5HXSA 3EABA 1HNWT 4TY8A 4JLEA 1XIQA 2KTQA 4ZS3A 1PC5A 3FZKB 3EE3A 3JSRA 3K89A 1WKJA 3P4QA 1BQNB 2RMLA 4Q25A 3UD4P 3BH6B 4I2PA 4DUYF 3QGIA 3NZPA 1C0TA 5HBMA 4LSLB 2WVCA 1N32T 5L3DB 3Q9DA 1IKVA 1F9HA 3AB2B 2Q9QC 5BR8J 4PG6A 3AAEB 1RTHA 3GJSB 3ZZUA 1CJKA 2XBPA 1T03A 1NWMX 4OZ3A 3PKMA 1X4CA 4PYAA 3V5UA 3VGVA 2XAQB 1JLCB 1VLOA 2RS8A 5K8MA 4W4MA 2XNRA 5A0YA 3ZNUA 4I64A 3MEGB 3O9XA 4CYUB 3MMCB 4HKAA 4YTNA 5HQLA 3OVUA 1OJ4A 3MEDA 1I94J 4TQRA 1YRUA 4RUAA 3HVAA 3GIJA 1SUMB 3P4UB 3ENAA 2UVUA 5AQJB 3O1HA 2C5KT 3ET6A 3VGSA 1PBAA 1TL1B 3O2IA 3NBPB 3EAMA 3OXFA 4JI8T 2GJ2A 4O4GB 4ANEA 1S1WB 2V2ZA 4IRCA 3JQJA 2LSJA 4NXNT 1ZM4A 4DCOB 3NNAA 3H5UA 3GU0A 4Q0BA 4LJMA 3R5AA 1OPIA 4B3SF 2XCPA 1FKPA 4M5MA 3Q8QB 4WYLA 3CJ4A 3W7BA 3ZTRA 3MM7B 5DQGA 2UVVA 2HN1A 1HR0J 1B7FA 1Q5VA 4JI7T 1U49A 1QSSA 3IRXA 2ODVA 5JDMA 3WBZA 4DV7T 5KFWA 2ZBIA 2I8EA 4OYXA 1HARA 4J9RA 3UUXB 1REVA 3GJQB 3SOLA 3Q22A 2YNGB 1LEOA 2AD9A 1KP6A 3QO9A 1N36J 3VRAA 3JAFA 4YLHA 3IHRA 1R89A 2D3UA 2CJ9A 4QW9A 4Z2XA 3HFKA 2BE9B 4NA1A 3HFZB 1X9WA 1WEYA 4IR9A 3EGZA 2UVWA 1RHJB 3BZQA 4QIFA 4UOHA 1XR5A 3MMBB 2YKMB 4OZNA 2JLGA 2B8PA 4PFPA 2BE2B 1SV5A 4JI8J 2V6YB 5DDPC 2B4OA 4UUWA 1RHQB 2U2FA 3IRWP 4IDQA 1FO1A 4AQYT 2ZEJA 4YOEA 1TKXA 2IAJB 3IFEA 1I51B 2FBWA 4UZCA 2YKNB 4JI7F 3RBZA 4QWBA 4NUUA 4NASA 3HXMA 2V5DA 2RSQA 4TY9A 1JLEA 5D4LA 3BO4A 3JS9A 1VQPS 4K4YA 3KMQA 2DHAA 2KHCA 5GAGU 4YY3T 5FXXA 4RW9A 2HFUA 4HACB 4IRKA 2CDQA 1RWPB 4M94A 1FXLA 3AA0B 3G6YA 3SQGA 1CBKA 2UXXB 4HVZA 3LPEA 4DV7F 2ZD1B 4A8XA 4TY8B 3PM9A 3VZHA 1YQ3A 4ZPWR 4UIGA 2FUG9 2HAIA 2RILA 3ULHA 2CYYA 5A8RA 5LA6E 3VR1A 5JUMA 3WC2A 2OPSA 2IC3B 3QJJA 5ABHA 3THTA 3MPYA 3KK1B 2WWVA 1RBAA 2QLXA 1U25A 1JLAA 1YI2S 4EV6A 1VRUB 1FFGB 2CJAA 3SCJE 1VBYA 2DH7A 2I6WA 2ZLYA 3N5BA 3ZO7A 2HWHA 2P9CA 2XC9A 2DNXA 3M1VA 4ILMA 1VQOS 2B9XA 2NXJA 4F0KA 2A0FB 4JB8B 4DV2J 5LBQB 2UXBJ 3LJCA 4GVLA 5FXZA 1SXLA 2HVHA 4KX6A 2UUCT 1K9MT 1FJGJ 2ZFHA 1A6LA 2VOOA 3OTOT 4ECTA 1VJQA 1D0EA 4ZDNA 2N4CA 4YHHJ 4FXDA 3OXLA 4QYZJ 2ZDOA 2VQET 2FJBB 2CLYB 3IBWA 3UFCX 3VKGA 3RAXA 2J62A 3G2XA 1PC4A 1FFSB 5JVGQ 5FVKA 1IM6A 1J5OA 3MECA 3NGDA 4NXNF 4MYTA 4FF3A 2LXUA 2EW9A 3MM5B 3G8QA 4G1IA 5ITHA 2DY9A 2V1DB 1XBWA 3OL6A 2ZH9A 1NJYA 4F3OA 5AQIB 2V4JB 4WFNQ 4HWHA 2NSBA 3ITHB 3H4DA 3TANA 2ROGA 3J7A1 2ZM8A 2FPHX 3HVTA 5E2QA 4HFBA 2VQFF 1N8RT 2XMUA 2HHPA 4MHCA 3ZC1A 1S9FA 3NMAA 3QFWA 4DUYT 5KFYA 3LDQB 1HX8A 3I0RA 3GCXP 4ZI2D 4JI4T 3PG9A 2LVWA 2VOPA 4ES1A 4BCAA 2XAHB 1JQGA 3LAKA 3RW6A 1GH8A 3R6NA 4ANCA 4ZS2A 3M8QB 4F26A 4ES3A 5J1EB 3KLGB 4OZ0A 1HWLA 1OY9A 5F8GA 3LA0A 4I55E 2KXPB 4MH8A 5HN0A 2FLLA 4C3LA 5CYMA 2HN2A 4GOUA 4C91A 1R0CB 3I5AA 3DOLA 3SSRA 4UEMA 4IQXA 4U67Q 1Q7YT 3PW0A 2ZH2A 4OHZA 4IDNA 1VRUA 3W66A 2WHOA 1U1QA 4QXHB 3QC9A 1S4FA 3CPZA 2M3DA 3H8YA 1N36F 5G0RB 4ZCIA 2P8IA 4Q8EA 3P4WA 4RUCA 3BPDA 4PJNA 2H7VC 4MFBA 3AVSA 4JI0F 2CQGA 2E1PA 4YR2A 2OPQA 4CTAB 1NKBA 3SFDA 1F5CA 4HFIA 3NZQA 2DGXA 2NW8A 3OLAA 3KMSA 2HQCA 4PWUA 3U1MA 2C2DA 3AD8C 3CJ0A 2MYFA 3IA3A 1VQ5S 3I4HX 4BS2A 3SS1A 2LJLA 2GO8A 4HHJA 4F67A 3ZTQA 3EHZA 3AEEA 4LBHA 2Y8DA 1J1JA 4WFZA 5T7LB 4TQSA 4OX9J 3GIIA 4ZHRA 1PGZA 2NLWA 4TNWA 3LFMA 3RPUA 4H4KA 1IR2A 1OSCA 4N8OA 1D0YA 2DIVA 3UVJA 2F8MA 1R8PA 1B3TA 4NEYA 3NWGA 5LJMA 3TEGA 4UR9A 1HBOA 5IC6B 3ANWA 4I69A 1S6PB 2YX4A 3RYHE 1XNQT 3AJDA 3V5SA 4E8UA 5F9LA 3E8OA 4QIEA 1VBZA 2V26A 3OPKA 2DNYA 1N34F 2DB1A 1IQTA 4ADZA 4XDDA 2Z57B 3PW2A 3DNCA 1T72A 2WDQA 2YNGA 1TL4A 3LK42 3FGVA 2ZBCA 3RYLA 1RSCA 3ONQA 4A47A 2L9QA 1JNRA 2QA4S 3HVRA 3PO5A 2W7PA 3Q24A 3EDRB 4Y2MA 4LF4T 5HEOA 1HHTP 2MKJA 2V6AA 2CNLB 1MMNA 2M8DB 4LRBA 3HKBE 4ZLNA 3TYTA 3C15B 4NLWA 2V2QA 2IUBA 3NY0A 4DS4A 2GVDB 1CJVA 2JEFA 3NRYA 2A2FX 3VAIA 5J2MB 2CQ0A 4JI4J 2N9DA 2VFSA 2YNFB 2Z0GA 1S99A 5EHHA 4MJKA 1N5YA 3JYTA 2BM0A 5A76A 2MQQA 2B7CB 3M30A 2CZVC 5AQNB 5HLFA 4OZLA 4AXPA 4IIJE 4TKTA 2OSQA 3LSVA 2XSBA 5G0RA 5IYZE 3VHQA 2A1BA 2B43A 1NJIT 1HBUB 3V81A 4XAXB 3M9OB 3AXKA 4N5SA 2PG8A 1OEDB 1BWEA 2DGTA 4FXWA 4DVDA 3BO3A 2WW8A 3NAHA 2WRMA 1EHWA 3KG1A 4RPFA 4IOCQ 2Z2MA 2LKZA 4AL6A 1TK5A 4N76A 5M2RA 1T02A 2KM8C 2KZZA 4DG1A 2DISA 2C2KB 1BQXA 4NUVA 4ZS6A 1RJJA 1RWNB 4Y28C 2R7XA 3MCOA 1FERA 1WSRA 1BC6A 2ASJA 5GADU 2XZTB 3AA7B 3P4SA 4YTMA 4K0KF 2DHXA 2MB0B 3F2EA 5T7LA 4DX6A 3I0RB 4GO5X 7AT1B 1U24A 4ANJA 3KV4A 3ABVA 4USWA 4B02A 1QTMA 3KLGA 3B54A 3I1AA 3N79A 2ZM6J 2NW7A 4JI5F 4KHRA 1HCIA 1Z8UA 4I6AA 1XK8A 2RNEA 2D3O1 1PCAA 4LRFA 3PX4A 4LSNB 3CD5A 5L2LA 2RH3A 4EBDA 1RT5A 2ALYB 5KOXA 2YX1A 5C24B 1ZM3A 1UGOA 1HQEA 2QIFA 3DOMA 3ILIA 1NSAA 4FN5A 4OZ2A 1RT3B 2VG5A 4LREA 3M8QA 3J7YU 4NLOA 1S0VA 6AT1B 3BK9A 4HEAA 3CVKA 1RISA 3ZCIA 2JJ4D 1RTHB 1MWZA 4J9KA 1FFWB 3UUBA 3A8KA 1PBUA 1VIOA 4DX7A 2W67A 2Q9QA 4KAIA 2PO4A 2YQ3A 3AE8A 2VURA 3GE9A 2P6SA 3I9YA 1MSWD 2W7OA 4ASKA 4M5GA 4LRCA 1VYAA 1JLBA 4UY85 4K4XA 1H2TZ 3D1OA 3QIPB 1FESA 3DGVA 2ABYA 3AHPA 2C28A 3H59A 1B0VA 1QAYA 3PDYA 2DPJA 3T1YJ 1MNDA 2I5JB 3T5JA 1SL0A 1WG1A 4LQ9A 2KVIA 3ONJA 4IDZA 4WK3A 3TX8A 5JR9B 1T0TV 5LBMA 2W8KA 4USHA 4AKLA 4LVOP 4F4WA 2JLFA 4U33A 5FY1A 4UOCA 2YPYA 4DMWA 1S6UA 3GLJA 4H4MA 1ZAVA 2HNDA 4LFCT 3U02A 2J9CA 1VRQC 3IS9A 3MAAB 4FVCA 2E66A 3HULA 4A46A 4Q44A 4K0KJ 2OMOA 1NB7A 4ZOLE 4MK7A 4CQ1A 4NMLA 4Q8FA 1OMSA 1Y3JA 1RT1A 3KUEA 5K14A 2BE2A 4PUOA 5IM0B 3C4WA 3R1HA 4RUHA 4HTIA 3MAHA 3GFYA 2Z58B 5ETPA 5AQRB 1VQ8S 2KT5A 2E7VA 2HHQA 3FCVA 3QMQA 2GZOA 3AXJB 2A18A 2F7VA 3TZWA 5L39A 4FBTA 3GFHA 2JH3A 3N6NA 3IP0A 3GV5B 1N0UA 2NXNA 4DSFA 4ECUA 2CJKA 3OTOJ 1RAIB 2CPIA 3VVUA 4NZ0A 1RT7B 3I4PA 2UUCJ 3PFOA 4EB6E 1AXQA 2W9BA 3NBXX 4HEA9 5LXRA 1HBNA 3QWUA 2LLZA 4NCAA 2LHNA 4B9UA 9ATCB 2EWHA 1RACB 3CO9A 2C3YA 4O3RA 2IJFA 4CLUA 2LRKA 2R7VA 2ADCA 4CQIA 2MY8A 2V8PA 5HROB 2QRRA 1KNRA 4PEOA 4BLGA 4ECXA 5ETRA 1XZYA 3MZKB 3JC6C 2W62A 4DR5F 2KWHA 4ZPVR 4ED6A 3TLSA 5HK4A 4JI6J 1WYBA 2VWAA 4U7UD 2EC2A 2DITA 2F1FA 3PIPQ 3TJ9A 4X64F 1R8CA 2H54B 4TWDA 2W0GA 1VQNS 5DLFA 3P6YC 4C6AA 2NXUA 2HS3A 4I6YA 3GN5A 3DLKB 4YY3J 2RHQB 4HYKA 1MLAA 3QO9B 4ED0A 3IM9A 2EFQA 4C3KA 4YQWA 3HKDE 2GX8A 2FJXA 4Y65A 4B3RF 2UXBF 2FHKA 2E1AA 1D9FA 4TYAA 4G6VB 1WTBA 5LMNJ 4TZ4C 1RWKB 4L75A 1B4SA 3W65A 3FBCA 5GAHI 2W4DA 4DR1F 1AFJA 2VJUA 3E22E 2BJ9A 1EIYB 2CNKB 2AP6A 3DHXA 5CA0E 1TKZA 2VG6B 3HO1A 1U8SA 4C0HA 5BYRA 4TNOA 2Y48B 4DV1F 2HHHT 5LJ3Y 4OJGA 5GADI 2MTQA 5KFZA 4X64T 3TVZA 3CB4A 4KJIA 3KVBA 4KHZF 1KSPA 4OYAA 1UJ5A 2HQIA 1M5OC 2E5VA 2RA1A 5A8KA 4KTQA 2GHWA 4ZN1A 4C9DA 1L3SA 1WI6A 4GK5E 2BBHA 3GONA 5EWFA 2FY1A 2FGCA 2N4DA 4DL0C 2ZOGA 3MEGA 3BBBA 3AVRA 4NLQA 3KDNA 3W61A 1H3DA 5HMYA 3TWZA 1U1NA 2ILYA 5L3CB 5DLGA 2XJ7A 1IJFB 3M30B 4O44A 4EEYA 3T1YT 5M4YA 3H2VE 1RA6A 1S10A 3EWGA 4F0HA 1YKWA 3S7RA 3UD3P 2VL8A 4OYMA 3UN2A 4JI1T 2AGOA 1E6YB 4E2FB 1A7GE 1X5OA 2BG9E 1VC0A 3BM7A 3OFFA 2L48A 4YJ2E 2R4FA 1J5WA 3SZ2A 2FJEA 2KWIB 5HEJA 2H5IB 4QU7A 1IBKT 4DBRA 3RIAA 2MQMA 3QT5A 2WSFC 2QYWA 4K7QA 2UUTA 4IYQA 1K1QA 2D3ZA 5F8MA 4IFVA 3S6EA 1C0UA 3BQLA 3TARA 3IWLA 4FF1A 2BACA 3MD1A 4NI2B 2HSEB 5KFVA 5KFNA 3NEKA 3FCWA 2IM0A 4UF0A 3NVOA 1KQGB 3AQOA 2DXEA 2VB6A 3PX6A 3IF8B 2E2AA 2WM9A 4LBIA 4LR7A 2BEFA 3CUNA 2JRSA 3L3PA 4U9RA 4DV0J 4A97A 2JNJA 4OYWA 1RWMB 5BR8T 4CLTA 2RPAA 2ATCB 2YINA 2VV5A 1G8XA 2HAFA 2X1AA 1XNRT 4NLRA 5KAKA 2OHDA 4KB7A 2WAUA 1UAWA 2CQIA 5CB4E 4EBCA 4F3QA 5K8OA 2A3JA 5B0GA 4KO0A 5GVQA 2QA2A 3T1AA 1X4HA 4JI3F 2LDIA 2NUUG 5KFXA 4CI0B 3NGTA 3DI6A 4IO1A 3W2WB 5L9NA 3UQSA 2W2QP 4DR7T 3BGUA 2WU5A 4U74A 2E29A 2VUGA 5BYQA 1YXRA 3RYFE 1S9GA 1EZZB 3Q89A 5HAOA 3IO1A 4X66J 4K2JA 4CTAA 1TUVA 3RI5A 5ADZA 2BBJA 4FNIA 4QWEA 1YHQS 1MROA 1N6QA 2WK4A 1CC8A 1HI0P 1UVLA 5HP1A 4HTJA 1OYEA 2AYGA 2FVPA 4F3MA 5CD4A 5A2QU 2RUGA 3QRQA 2B6AA 4CLSA 2C2EA 3RC3A 1FDBA 4NA3A 1HTJF 3C6TA 1D1UA 3TA0A 4DR6F 3K5PA 4X4QA 1B64A 1IR0A 5E3PA 3NWRA 1YW0A 2VPYB 4DZ6A 5ETLA 4R0JA 2LEPA 1NMEB 4WTYA 4PXBA 3UVJB 3FNNA 2E5HA 3MPWA 3AE3A 2BM1A 1SKSA 5LM7E 3CD6S 3P7IA 2DR8A 4DHVA 2OLTA 4CT8A 1U2CA 2HGLA 2HURA 3Q8UA 2HBQB 2EBEA 2E8IA 4W92B 3Q8SB 4WZQA 5LXTE 1RAJA 1JLQB 3V6KA 3FSIA 1J5EF 4UVAB 4KRWA 1SKUB 2OSRA 2LECA 3IWNC 1OYDA 3ZMSB 2B56A 2X0YA 1DLOA 5C42A 2OV9A 2WBRA 1FVQA 1UEUA 3OTCA 4CI2B 2XNQA 1ULRA 4CH1A 2D0UA 2P9EA 1DLOB 3H90A 1I5OB 4EEBA 4GK0E 2MQLA 4AQFA 4ECQA 3SYZA 4NLSA 4P9SA 4F4ZA 3K7RA 1OSDA 2XAFB 2Q9QD 2O3DA 1UZHA 2WVEA 4C11A 3PEJA 3DLGB 4M95A 2XQ7A 5AQMB 2B76A 2B8QA 3GG0A 3QT7A 1YJRA 3SDEA 3CX6B 2GGPB 1Q86T 4OHFA 4LF7J 4P2SA 4ELUA 3NAIA 1AT1B 4IKAA 4DF8A 1RTJB 2JL9A 2RIJA 1X79A 2UU9T 9RUBA 4LMLA 1XERA 2FJBA 3BGFA 2V63A 2VQFT 1JK9B 4JP8A 1VGYA 3O4XE 2AEFA 2UU9J 3UW1A 5I3PA 1VISA 3TEHB 1FK9B 3NNHA 2BG9B 2FJEB 2YVSA 3M65A 3J7Z5 2C2OB 4P52A 2IYGA 1CJUB 4J9LA 3HHLA 1CLFA 2HMIB 4AXJA 1DURA 2KZMA 5HWXA 1PYSB 1F60B 2CUYA 4BJNA 3ZC4A 2FZKB 4LSNA 2WBLA 3RF1A 4CM2A 5JDQA 1SA0E 2ZJPQ 5E33A 4MIAA 2OLWA 2GIFA 2CXEA 1HBUA 4C0OC 2QT7A 5E41A 4JYAF 2LOSA 3DLEB 2KYXA 3W2VB 3KLEB 2MLYA 4EU0A 1YJWS 3AFGA 4UV8B 3MFIA 4HHHA 4DV4J 4CLYA 1NSPA 3L3CA 5KFMA 3QNUA 3V2UC 1QAXA 1WYCA 2NZCA 2LDYA 1VQKS 1OO0B 2DGWA 1U0SA 2E7WA 3M6XA 2CE7A 4DFKA 1GXLA 4QPXA 3PCOB 2OAUA 4DSLA 4NXMF 5JDGA 2IW5B 2J6SA 4NPPA 3RHWA 2GHVC 3NBPA 1PYOB 1OEDC 5DQVA 3HKWA 4PG4A 3UQ7A 4RO0A 3G4SS 1IWAA 3KLFB 5C25A 2EFVA 1KWMA 4QZVB 4NYOA 3KK3A 2IIHA 2VG6A 1HR0T 4DR2J 2GJFA 1UX5A 4X66T 3Q83A 7FD1A 1US7B 4ZVFA 1OS5A 3G87A 5HEHA 5HSPA 2NXEA 2CZ4A 4LMJA 1VCTA 3O44A 3HHDA 1WF2A 2D69A 3DXBA 4R8UA 1H73A 4NXNJ 3GR0A 1GFWB 4L73A 2LP4A 3QB5K 1YG0A 5AQLB 2DRBA 2DHGA 3BKUA 3T6BA 4L3KA 3IAM9 3L7UA 4ZVEA 5LXYA 1RGVA 2DTJA 4J91A 4ISSA 5FIIA 1MNEA 1SJRA 4M5JA 3ONXA 3PUWF 3OV7A 1S7IA 3IBPA 2YQ0A 1PJ7A 1CULA 4J9NA 4KFBA 1FRJA 1OXZA 3TJAA 2YKMA 1T98A 4TXSA 3OPCA 5C25B 3KV5A 1WELA 4CH7A 1TKXB 4CO5A 1FJ7A 4PK4A 3DCAA 1NPRA 2F5GA 2EI5A 3HKCE 1LNQA 1W0BA 4O3PA 2CG8A 5JR9C 4X66F 1F5AA 3JQMA 3J7YI 4ZHQE 3UDCA 2IAKA 5IWAJ 1SQEA 1IBKJ 2UXNB 1NEEA 2X9WA 2RVJA 4BDPA 2QA7A 1Q8LA 3VR9A 4NI2A 4HR2A 1H2UX 3J80U 4TV8E 1MU2A 4CO2A 2RRBA 2HRYA 2MQOA 4JI6F 5LP6E 3A8EA 3NOCA 4X62T 4JI1J 2UXDT 1XMBA 4U2ZA 3DLLQ 3VKHA 2CPHA 1TL7A 3ZZTA 3R5DA 3MEEA 3SQOP 2YQ1A 4WCEQ 2JFDA 4F2RA 3FFIA 1SH2A 4G2AA 3AEAA 5HATA 2P9GA 1HNZF 2J0SD 4X62F 3MZIA 2OMLA 3QGPA 1WWHA 2CBJA 2WWUA 4YJ3E 1D9AA 2VKHA 3CMQA 3GR1A 5F3TA 1LOUA 3IS9B 3PJWA 2RQ4A 1ZOTA 4O2AE 2BKOA 5F8LA 2WB4A 1RTJA 3BYRA 2MAWA 2DD8S 4JI2F 5KDMC 1SL2A 1VBXA 4RW7B 4V19X 3HD2A 2P5VA 2UXCJ 1CJKB 3MA9A 3UDVA 4P2FA 1GMUA 5FJ4A 2MKHA 1QDUB 1REGX 3Q2SC 2J7UA 1Q0NA 3NL0A 3CF5Q 5KFKA 3MMJA 4QKNA 1X31C 1AUSL 5CHCB 3MECB 2J9DE 4LFCF 4ZI3D 4RNFA 2MXYA 3H5SA 1PSDA 5EX0A 3RRKA 1QAJA 1VI7A 3L95X 3I9WA 3D0GE 1HNXT 1R6YA 1SC4B 5D15A 1TFYA 2LEAA 3RKOA 2YNHA 1KOOA 3M05A 2WDVA 4EZHA 2JZ5A 2PE8A 1M5KC 5GAEI 2BUNA 2VL1A 3OHBA 1TTHB 4USVA 4DUZJ 2MGZB 5F8JA 1UVMA 2DNOA 5HCJA 5CD4H 3VAJA 2XM1A 3MM9B 4FNHA 1FMWA 3PHTA 2JHEA 1HG2A 3TQ1A 2LT3A 1S1XB 4FDFA 2V9KA 4KI0F 4JI6T 3KDOA 1EETB 3F0NA 1HR0F 2BANA 1XMQJ 3FEXB 4FYXB 1PAEX 1SPBP 3CCSS 3I5CA 3PUVF 2XQ8A 2NYHA 5D0RA 3Q5WA 1UURA 2JFKA 1VBKA 1KQKA 2QMXA 4LF8T 1LWFB 3L7OA 4YR0A 3G6VA 4IHJE 1X4AA 4IR1A 4NLYA 2GQQA 1E2AA 3HM9A 1PAUB 1FTCA 2XY7A 1XR7A 3FRYA 2I59A 3W60A 4I0UA 1VHIA 3HI9A 4HDHA 1GMWD 4DCPB 1XQIA 1AW0A 5A8WB 4I2QA 3J81U 5IUXA 4P2MA 1QVFR 2QX0A 4PG5A 3R1LA 2OEMA 3UR0A 1YJVA 2CBIA 3CQCB 2DH8A 2GNKA 3IXQA 1QE1B 2XMVA 3CXCR 1L3UA 4QH4A 3VGTA 4ELVA 1APSA 4YDXA 2JEJA 2H5JB 4PPDA 4LMZA 4JI4F 3U1LA 2XWXA 1S49A 3FBBA 4IGUA 1YZ7A 3EVMA 2IM1A 5U47A 3VF0B 3L4BC 2V0NA 3RAMA 1O8BA 2F65A 5T14A 1Q7LB 4Y2KA 1UPPA 4ED7A 2H7OA 2XHCA 1TL3A 2QA4G 3QATA 4WFAQ 1NDPA 3HMJG 4C8MA 4ALZA 2H1YA 3CJTA 3BQIA 2PD1A 1M5HA 2X9HA 4TNVA 1Z2ZA 1QUUA 2KJWA 1LW2A 4DL3A 2J76E 1BD6A 2UUAF 4JOUA 2NYIA 3VQTA 2RF2A 2IVFB 1ZPWX 2CQCA 1CUNA 2XSAA 5H1SV 1UVJA 2PC6A 2QE5A 3CCRS 4WYVA 2RT3A 2XSJB 5FVLA 3GG1A 2IFXA 1LWEA 5L4EA 1KONA 3V6HA 2RQKA 1W2IA 4URSA 5FY0A 2X1GA 2E9TA 1OWAA 2MKCA 2WZHA 1MN9A 3OL7A 2UXCF 3GV8B 5AQPB 2D0TA 2ROPA 1BQMA 4OI4A 1XWMA 3SFEA 2CPJA 5AXLA 3UQ4A 4HWIB 3K8WA 5KT4A 4EYYR 3KNAA 1DZ5A 2QLFB 4IG3A 1WSVA 1XDOA 5FYMA 2DWKA 2HKEA 2E1RA 4DPTA 4ZIVA 1GAOA 3MXHP 3DI6B 2OGUA 1U1MA 2W9CA 3OL8A 2HBRB 4I4BA 3K3OA 4UV9B 2M70A 3AE1A 2OPPB 1KEKA 2NS1B 3C14B 4LF4J 3ZTSA 4ZVQB 2OUGA 3M2RB 4B08A 4KHPT 1ZA2B 4ZVSB 3FXEB 3K5NA 3ZZOA 4M5IA 2AXDS 1RA7A 1CJTB 1BHNA 4UT4A 1UW9A 5D8HB 2CQHA 3A1YG 3VAKA 1SV5B 2I9SA 5KT7A 3TLUA 3A8YC 3QGHA 4H4OB 2HPLA 4KQZA 4HWDA 1NH8A 2BJ1A 2RB7A 3TUIC 3V5RA 4N47A 3F41A 5L1JA 2CEAA 1R8AA 4B9MA 1XDPA 4YR3A 3T8OA 2R2SA 4DMVA 4O3NA 2R8IA 2DGQA 2V68A 2H3RA 5HVGA 3FBLA 4CP5A 2KDOA 1SJFA 1U0HA 2F4VJ 2IJNA 2NR0A 4OZJA 3I6PA 3H2LA 5I3QA 4NPOA 2RJZA 1GT8A 1JLFB 4CXXA 5ETNA 4F0MA 2C22A 3RKGA 5FMNA 2BG9C 2DNMA 2ADBA 1NZ8A 4U3CA 3KUHA 4OYBA 2FDNA 3HP6A 5RUBA 1M1KT 5KG4A 2W8LA 3HHLB 4L74A 3R5JB 3PJAJ 4I7FA 4EO6A 5IV3A 2QV6A 4NMXA 2J7KA 2AMCB 3AD9C 4HH1A 2K7JA 1N5QA 1HI1A 2VFVA 3H4BA 3KUGA 5AXNA 1MMLA 3RB6A 2QN6B 2OD6A 4AXIA 4F4AA 2BS2A 2LU2A 3MM8A 2MJUA 1N4LA 4ERDA 1C0TB 1GX6A 1OEDE 2EG2A 2N82B 1T7SA 1FKAF 5LT5A 3FVYA 1S6OA 1CJUA 2OP5A 4CLLA 4QX7B 2LFVA 5FNVE 2RDDA 1DARA 3H25A 1VRTB 2XYHB 1FDAA 3LGNA 3JAMY 3AODA 3AB3B 3T9ZA 2ZJQQ 3QJPA 2H3EB 1WKLA 3ENQA 2G4BA 3AEBA 1NUEA 3VQSA 1XEZA 3LWMA 4X5TA 1NEKA 1H0HB 2BDEA 1VLYA 4EYIB 2DT9A 3ISNC 3GIMA 2MOZA 4DR6J 1U8WA 3SMZA 3MR6A 1C4AA 4N7TA 1NENA 2L8KA 3M2RA 3AOAA 4C11B 3ZKRA 2ACYA 1NB2A 4CN4A 1VK8A 1RCOB 4P7TA 5AQFB 3NOGA 2FVCA 2LEBA 2UUWA 2HZCA 3W2VA 4GKJJ 2JQKA 1X4DA 5AQGB 1HW8A 2G9OA 2IC9A 4LFBF 2D9DA 2XGPA 5KG3A 3TUZC 1DTQA 2VBYA 3NLCA 2J8SA 3DLGA 2G2OA 2N3OA 2ZE2B 2DRAA 4AI6A 2MEWA 1F2GA 2BKNA 1QY7A 2RDIA 4TYBA 3IWXA 5HROA 4KHMA 1DY3A 4ZVHA 2E1MC 2DKOB 3UU5A 2W9CB 5EK2A 2KO1A 2ZHAA 2B1EA 2F3JA 2ZH7A 1XR6A 1ZKEA 3IM8A 1T05B 2MHEA 4QW8A 4CH0S 3NGUA 2PI5A 4NE9C 2GGPA 4M1KA 2BANB 2E9XB 2QSWA 2R7QA 1T8BA 4U8VA 4HHUA 3IAS9 5LMNF 1HD1A 1S79A 4QOTA 3UDLA 2OA5A 5FL0A 3I5BA 2UXBT 3ZMUB 2XY8B 2QFIA 4Q2LA 2K06A 3ZMTB 1IJ5A 3T5HA 4KH1B 3MR2A 5F0WA 2NUHA 4USIA 3UWTA 4USUA 1NAQA 2VH7A 2UV8A 1PO6A 5M2PA 2ZD1A 3QZ8A 2DNHA 4P0BA 2ILZA 1P27B 1GMVA 4YXDA 5LOQA 1NCLA 4DV3T 4CXYA 4CZCA 2WP9A 2PN6A 2ZM2A 1FD8A 1KVKA 1ITPA 3L8RA 2N1GA 2V9WA 4O0IA 3PW5A 5L38A 2X9XA 4FKYA 1X60A 3DMJB 4IDKA 4CO4A 5FKYA 1RYSA 3FC9A 3WQPA 1RDRA 4H63V 2E7XA 2NPIA 4XPCA 3RBDA 2ZM0A 4HT5A 1YQHA 4BA9A 2IMWP 4JI1F 5KFDA 4RKUC 4DV1T 2DWGA 4XK8C 3K59A 1C1BB 2PI4A 3MD3A 3O5TB 1V9OA 1FCAA 4DQIA 4MIWA 5GMKa 1MU2B 3KOAA 5KFRA 1GX5A 1HF8A 2J6TA 5FL1A 2FLOA 4UF4A 5LHIB 5FD1A 1VQ4S 5HJXA 3TO8A 3A13A 3CJ3A 2OELA 2MZSA 4IDOA 5AQTB 3C6TB 2X9YA 5DABA 5JDHA 5H9FK 3RU0A 2QL7B 4OX8A 2NCKL 5EZYE 5KT6A 1WHXA 5DRKA 1E6VA 1RTIA 2IPOB 5LCYA 3NRXA 2IYIA 3TW0A 1S1XA 1K44A 1TQLA 1GXUA 1Y01A 4R0EA 1N6QB 2VC0A 2PFFB 2LQ9A 5AJ3F 4DV5T 3DKDA 4RW8B 3D3BJ 4JI2T 4U7CA 2PSZA 3QZ7A 3W1YC 3UFGA 5LL6d 2H9ZA 1H7WA 2OO4A 5I42B 3LP0A 3HA4A 5JRCA 5L1LA 3K17A 2K1RA 2HVIA 5MAOA 2YPZA 3FZHB 3N2GE 5FDLA 1T94A 1FNMA 4LF9F 2MPUA 1TMJA 1NZAA 3RR7A 4CLZA 2F4FA 1WHWA 3D3CJ 2OTJS 4D3GA 1SC3B 5KFJA 3UCUP 3UCGA 2FHJA 3D6TB 2C1EB 1WHVA 3RG6A 5HI7A 2NZ4A 1UVIA 1S12A 2KLQA 3RB4A 3CC4S 4ZJQA 5L3BB 2UV8G 2AQ4A 2WAQD 2V8GA 2ZE2A 1NHUA 4ZKAA 1OEDA 2HK2A 5SZTA 4PWDB 3KFWX 2X67A 4WZMA 4X65F 3I96A 4I1TA 2EFNA 4RZRA 4TU9A 3N5FA 3IMQJ 2XMAA 1NPPA 1L3TA 1R31A 1H74A 3SWHA 4TN7B 5J1GA 1HHSA 3EMTA 2C2RA 3PVXA 4A5XA 4HFHA 1IKYB 1NNDA 2W4CA 2HLTA 3OLBA 1W9RA 5IFMA 1M5SA 1WG4A 3TZZA 1RZMA 3RBEA 4X4RA 1U4BA 2PFVA 3EVOA 2Y0SD 1Q16B 4GC6A 2GW8A 4ZZCA 3M4XA 1KC8T 5J2MA 3OR2A 2P6TA 3PNIA 3T1YF 1SIZA 1WTFA 2OPRB 3RIUC 2DLRA 4GKKJ 5D78A 3RUBL 5IT9U 2XQAA 4WXWA 4LF7F 2FLPA 3G6ES 1I6JA 3IEEA 2XQ4A 1HMVB 5DETA 4JUZA 4J9VA 2VPWB 4LF5F 4OI2A 3TLVA 3C66A 2X1FA 4OX6A 2DPIA 2ZZMA 3OKQA 4GYSA 5EX3A 4F50A 3A7MA 3Q0AA 3FK4A 2G0IA 1IVZA 3CC2S 2LKGA 3KTQA 2XI2A 2OH2A 2CXFA 2XM2A 4ED8A 2V8DA 4L9IA 5L3EB 3JYTB 3DGPA 4NA2A 4U31A 5FLXY 4LF2A 4A56A 1QM9A 4IG0B 3P5TL 1HNWJ 4BC9A 4OI3A 4M5NA 4WBOA 4ELTA 1IBMF 3ENVA 4QR0A 1I1GA 3FMWA 1ZOYA 3JC6D 5D0EA 4HFVA 2DNPA 1LWCB 3KDSE 3DRYA 3I32A 3HD1A 4FYDA 1JMTA 3QAEA 1JJ2R 3B5MA 3ZSSA 3SFGA 3IG1A 4XTTA 1NXIA 5F5WA 1RBLA 4L72B 3B8HA 3PXGa 5DM7Q 3R7SB 4ZLPA 2C2MB 4X1KE 2FHMA 4PZVA 2XYPB 2HPJA 3ICLA 3ZMZB 3DRRA 1S9EB 3A8IA 2DVIA 5FXVA 1KS2A 4I56A 3Q86A 2QYGA 2XUEA 1NHVA 5CA1E 1YJUA 2HRTA 5CABA 4TN2A 2GQCA 6FD1A 4B17A 2QEXS 2LKHA 2WU2A 4UOGA 3RZAA 1HG5A 3VWSA 1RKIA 3IBCB 5IC4B 4IL9A 2GVZA 2B9EA 2MTLA 5ETTA 3OTOF 1RTIB 3GIRA 3J7ZT 4GYRA 1D09B 1D0XA 5KG1A 1N88A 2CLYC 1FDDA 4BBYA 2NP9A 3CVRA 3CCWA 1KF6A 4G3IA 3QJLA 4DN0A 1FEWA 5BYSA 2DNKA 3DLEA 3AT1B 5EK3A 3T1HJ 4DSKA 2F8HA 2X66A 5B0AA 5IZHA 4F02A 3RBXA 1L3VA 4J37A 2D7SA 3L9ZA 4ETZA 3CULA 2HRUA 2IRYA 5KT3A 3AE7A 1X9SA 1FXDA 4I4TE 2MY7A 2R8GA 3BH7B 3D66A 1VS3A 2AGQA 3UCZP 3VZIA 3FCHA 3SFUA 4IDKB 4X4OA 3D2WA 2BV3A 4DX5A 2YU1A 1GQEA 3A8JA 5JVDE 1YVFA 4ECZA 1J2VA 2MLZA 4H4MB 5IM0A 2E5LF 4X4PA 4M5KA 2VPXB 2F9JA 3ISND 3AJ1A 1FIOA 4JV1A 2E44A 3ELHA 4DR4T 4QQBA 1ZHCA 4OZ1A 3H5XA 4CZZB 3A3PB 3ITHA 3C3LA 2C2ZB 3EYZA 3KBUA 3DOLB 1HBMB 2XS7A 1YJTA 4OJ3A 4QYRA 1VC6A 3MM5A 1DHMA 3KLEA 1E7PA 2ZM6F 2V2KA 5KXJA 1XTZA 2YDQA 3LP2B 4LUBA 2EFPA 1W25A 1OQ3A 1IBLT 4DNDA 3IC1A 2M0GB 4LF5J 2HVDA 2AJ4A 3DDKA 4IRDA 2IC6A 3PV8A 4C4WA 1N32J 2RRNA 4DR3T 3PTRB 2AWZA 1V6HA 1PG5B 4DN9A 3O1LA 3T6JA 2A9UA 4FYVB 2WB1D 1RCXB 2CIMA 4DFPA 4ILBA 2XQ3A 3GFZA 4LSZB 2VA2A 4OX7A 1YDLA 1HQUA 3FHNA 1RAOA 5C2TA 2DY1A 3SCIE 1EETA 3J9X1 2LXIA 2HFNA 3LANA 2HVZA 1R6VA 4LRAA 4COFA 4ED4A 2COLA 4XDCA 1MIYA 1S1UA 4Y3CA 5CGMA 2HPUA 2D74B 2LQJA 2OFHX 1HNZJ 1QUPA 3MFHA 1H2VZ 4KE5A 4OX9F 2R8HA 2KNDA 4LFCJ 1LK7A 3CMLA 1A0OB 2UUAT 1S4EA 4YMEA 5LG4A 4PXCA 1MMAA 1F3FA 4IFYA 2GVZB 2CPYA 1UZDA 2BX6A 2L3MA 3UU8A 4OJ1A 4K4WA 4KY3A 3VR8A 2ACZA 2FGOA 2JPFA 3BGLA 4WIIA 5KTQA 4JI2J 2BABA 4ZPBA 4DQQA 4DV5J 1AB8A 2HBYB 4HI1A 1KFDA 3M2VB 3MM8B 2KH9A 3R5CA 3US5A 3C51A 2FB0A 1UCNA 4TV9E 2MQNA 4XAKA 3R27A 2GJIA 2BOPA 2MZTA 2MKIA 4OL8A 3DHWC 3GWHA 4G1QB 3KYLA 3CX7B 5HEGA 2CPXA 1N52B 3UNYA 2MMYA 4PKDB 2QL5B 2HVEA 4CLPA 1OWXA 2KB2A 3KJFB 1WHYA 4RL1A 4KHPF 2AYBA 3DRSA 2XQ9A 2E9XC 2AJ2A 4V19J 1U1RA 2BOAA 2ZZNA 4EZ9A 4KKOB 4H9QC 3RYIE 3UTKA 2HWIA 3E01A 2WSSV 1EKRA 4ZPDA 3DTOA 2W63A 3JXOA 2EBGA 2QYCA 2NQPA 1LV5A 5AQVB 3NG8A 2PMHA 1E6YA 2FLNA 4JI3J 1MIVA 1WCRA 1HW9A 1Q53A 1TL7B 1IJEB 3MUMP 3MAQA 5L9XA 3ZEFB 2LSGA 3H2UB 3O6QA 5J2TE 5HXRA 4CM0A 4WWSA 3G06A 2CKWA 2JIWA 4Z90A 2A10A 3N9UC 2CHOA 5CFBA 1F9EB 3Q5EA 3U27A 3Q8YA 1W2BR 3OJAA 5DO2A 3T1HF 1QVGR 3DOKA 4FYWB 4C2MA 4DV6T 3WX4A 3OTDA 2VFUA 3BQ2A 3PKYA 4ZK7M 4ERRA 4OYOA 4Q0BB 4QR1A 1Z2LA 8RUCA 2ZMAA 1JLFA 2AX1A 2ZITA 1Q8BA 2Q3PA 2IM2A 3FDSA 5KFTA 1NK5A 2VD3A 5ETQA 2O5DA 3HT3A 4PXEA 4TLQA 1J27A 1CJVB 2DJWA 3PRVA 5C5JA 3D6FB 3QBCA 3TI0A 2AZ3A 2CM0A 2V8SV 4F4KA 1FRHA 4AKRB 2CDRB 3M8YA 4DJBA 1BE4A 2ZH5A 4X4SA 2YKAA 3QOFA 3H0PA 1EZ3A 1FDNA 1C0UB 4LRDA 1DBDA 5J1PA 3R97A 2KXNB 4LF6T 5D4OA 2R7WA 1RT2A 1CQNA 1NK0A 3RGLA 2XZWA 3AAIA 4FS2A 2HWTA 4J2CA 3AEGA 1CSJA 3MM6B 5GAGI 2CQ3A 4B3OA 3MPDA 5J2NA 1XNQF 3ZTPA 1LW2B 3D28A 4FP9A 4J7CA 2XTLA 1X4BA 1KDNA 2A6MA 2ZBPA 4YTPA 4XO0A 2NSCA 3VAGA 4BJMA 2NWBA 5I42A 2BBEA 2YWKA 3ZTOA 4DX8H 2ZBRA 1UTAA 4NLVA 2QFJA 3EZOA 3KK3B 4OIXA 4LIWA 5AQSB 1KLMB 2XO6A 2OJ3A 4OMFG 3KINB 2QG9B 2RF2B 3FEYB 2AYEA 5F8IA 2QGSA 2JC1A 2AEMA 2XZEA 3OJUA 2POKA 1Q1KA 4P09A 2VBZA 1R43A 2ZC3A 1T03B 1KHVA 3CO0P 2MJNA 1TKZB 3R5GA 3TAPA 5J2UE 3THVA 3DN9A 5AE1A 1YRTA 1K0VA 3VTIA 3JAEA 2UVRA 2XLKA 3WDOA 4AL5A 5JDFA 4PK5A 5AXKA 2H88A 1ZAWA 3C4XA 3BSNA 3GB0A 3FEZA 3LPYA 4DPUA 3MHYA 2WY2A 2HK3A 3H20A 4DV5F 1UMJA 2W2OP 4ZCLA 4J9SA 4DV0T 4DL5A 2G0CA 2K1RB 2F63A 5CCMA 1HX1B 1FI4A 1RKJA 1UP1A 1UWBA 3FBEA 1JNZA 4ILRA 2BVMA 5LHHB 2L9WA 1YITS 1WORA 3A3OB 4MALA 3M2UB 4IG3B 3E01B 2XI3A 2W2PP 4RJVA 5F8HA 4QJVA 4WFBQ 4QH1A 4WK1A 3BYPA 1EQ0A 1VMBA 4QH5A 3D1HA 3KJVA 3TNVA 3KBTA 2I2YA 2R8KA 1Y00A 4B9NA 3JSBA 2X3DA 2YU2A 4DBQA 1L5UA 2BJ8A 4X20E 5HVFA 1F6TA 3G82B 2M5YA 2EEYA 2JEIA 4DU7A 3Q5DA 2MZQA 4KBMB 1D8ZA 5KFIA 1BUXA 3L39A 2L08A 1TR0A 2AKWB 2XSFA 3V4MA 3CD0A 1WOOA 3CMES 3P3DA 4O3OA 4AD6A 1UW4A 1F2HA 4DPXA 1N33T 8ATCB 2W4PA 4AKGA 2WB5A 4L6V3 4MK9A 4LR9A 2ZWOA 3OFHA 1JXEA 1HQUB 3NCQA 1H7CA 2ZVSA 2UUCF 1HYSB 3HHLD 3PEHA 4O8SA 4LFAJ 1JNZB 4HE8A 4USKA 1S76D 2PA3A 3PYGA 5CJ5A 1RYRA 2XQ6A 3CWJA 3PJ9A 2OPQB 3RRHA 2LEHA 2VK9A 3QIPA 3GYXB 5CYQB 1UX4A 2GAHC 3DYAA 1FF2A 1DTQB 3UPFA 4DMZA 3DRXA 1NBEB 4OV1A 1HLWA 3OT9A 5KFEA 1FEEA 2BRLA 4ZVRB 1YD8G 2JC0A 1ZEEA 3LP1B 3HCXA 3H7HB 4YFUA 2Z2YB 5C2GA 2WONB 3DRPA 1RT6B 2YKQA 2BMBA 4U72A 4NCGA 3RQWA 2HHHJ 2Y1RI 4B3TT 2WZIA 3EVWA 2VVSA 1AZSB 3ZN1B 1UA1A 4WJBA 2EC0A 4Y6IA 4YB5A 1N5VA 2XHEB 4X1YE 1MIWA 4NLUA 1RABB 1WR0A 4TX5A 4JI5J 4USMA 3TLTA 2BVZA 1HNWF 4MKBA 5LSOA 2CPTA 1RT4A 2JVRA 2CPZA 3D6HB 3PZPA 2QMUB 3ZMVB 3M32A 2R8JA 5FP3A 3N5LA 2LSKA 3NP5A 3TZYA 1O0PA 3OUYB 5LMUT 1S77D 5LHGB 2IJRA 3LP2A 2HLUA 1HNVB 1VJWA 3ZYLA 2QL9B 3ENWA 3ZCJA 4NRUA 4B3OB 1X9MA 1IZNB 4LF6J 5EUHA 4DR6T 5L46A 2EFGA 2ZHBA 1I94F 2O01C 2GHPA 4U95A 4NLDA 2LCWA 3R6GB 1CEZA 1ACMB 4HI2A 4RX6A 2B3TB 4W98A 4NLPA 3T19A 4F8HA 2R2RA 2JQ9A 3LBXB 3EPIA 1I3OB 1FT8A 3CJRA 2WCXA 4MT1A 4YUDA 1RWOB 4DV4T 2RE1A 2PEHA 3QRRA 5T41A 4M5HA 3X3UA 2D1CA 5FXWA 4EGWA 1YBAA 4IH7A 1D3WA 4JYAT 4ZP7A 2YNIA 4L0RA 3C2PA 3B4MA 4FF4A 3FZBA 3T5KA 5EDWA 2Y9HA 1CULB 2CPFA 1TL1A 4WP3A 4QX8B 2FUPA 2ZKTA 5JJBA 1M90T 1RB0A 2FJAA 2K2PA 3AE6A 3K3NA 2A2CA 2LXFA 4DV6J 2VJVA 1JLGA 4P74A 3H3AA 1Y5IB 1TVRA 2K48A 1LK5A 1X4FA 3ZJ2A 4GIWA 2YWWA 4DUZF 2DHSA 4LF8F 1XMQT 4NIQA 3PUYF 3HKEE 4ZEYA 1LVKA 1M1HA 2JRKA 3BBFA 2VHGA 1WOPA 2BJ3A 3OYZA 2VQEF 2IHR1 4KO0B 1KFYA 2DGUA 5KFOA 3GZ7A 2VL0A 2WBMA 5E0OA 2FQQB 4ZVUB 2CADA 3DGPB 2CQ1A 4XIUA 3RIUA 2KU7A 5H9FJ 1KFSA 5J2QA 2V4QA 2VC1A 1U0HB 4P1NA 5KT5A 4O4JE 3MMCA 3HJVA 3F44A 3O1JA 1XNRF 4X4TA 1HQEB 1HNXJ 3L7PA 1Y3KA 1RU2A 1DQ8A 3P50A 1WF1A 4M5DA 3HK2A 5CQGA 3QUJA 1TU0B 4ZA1A 2VKRA 4NRTA 2ES0A 4LF9J 4QWCA 5H6QB 4IL4A 4FPRA 1R8HA 3C6UB 1EX8A 3RW7A 2L3LA 4YDDB 4WZXA 4DR5J 2JQQA 1FKOA 3LW5C 4CYUA 3FMBA 4YHJA 2BRKA 1R7IA 4DSIA 1VQ9S 4F36A 3QLHA 5KG6A 2EKYA 3D6MB 2DI4A 3Q2MA 4ZP9A 2V34A 3GSDA 2EHOC 1TKDA 2R7RA 2YNFA 5EK4A 3ZT7A 3BREA 3CT9A 3MACA 1RAEB 2CQ4A 3AEDA 3U78A 4A8SA 4G1PA 1Z1ZA 4KYZA 2FC8A 1JJHA 2FJWA 4PK6A 1SI9A 2AJ1A 2IVMA 3AA9A 1CS4B 1SJ1A 5B09A 1IUJA 4K4UA 1SCJB 1UJ4A 1RU1A 4NCBA 2I1RA 2RKIB 4KKOA 3TAMB 1EB0A 2KZ7B 1NK7A 4EOZB 2I0MA 2MZRA 2YWGA 2VPZB 5B08A 4PW8A 2XS5A 3RB0A 1FEHA 4WP9A 4O4RA 3NRBA 4MIBA 4YSXA 3GIKA 1LQ9A 1J5EJ 2V8HA 2W4XA 4EYUA 3VGUA 3K58A 2HHTA 4TUYE 2V5CA 1SJ4P 2LRLA 2LSIA 2HNZB 3W9HA 1BQNA 2N2NA 1AUDA 1TVRB 5JRCB 3DLKA 3BR9A 2C5JA 2FJAB 1EKSA 5JDLA 5GMDA 3DFEA 3HFVA 4M1PA 3Q8VA 2DIUA 5K9FA 3QB5A 2I38A 4ILAA 5K8NA 3BV8A 2CA9A 1OY8A 3IR5B 3ZZYA 1TKTB 1HNXF 4MBQA 3ISZA 3OJSA 1EAYC 1HD0A 1RLDA 4F8RA 4X65J 1R0BG 2DNQA 4U96A 3UI3A 2DR5A 5IT0A 4ICLA 4LVNP 1A9NB 2IMOA 3ESLA 2KI2A 3PTWA 1U2RA 5K5MA 1KQSR 1UVKA 3M9NB 4DWIA 3AB4B 5IQ6A 2HFZA 1P9YA 1B7TA 1Z4UA 4AT1B 1VQ7S 1N34J 2PEBA 1IBLJ 4CCHA 2C42A 1JLAB 4LSLA 2QMWA 3DXSX 3ETVA 4JI3T 1QE1A 2Y8YA 2IC3A 3UU4A 3DDNA 3MF5A 3FUYA 1SKWA 4X1IE 3ZNJ1 2JQHA 4DUTA 3KWMA 1T9YA 1BR1A 2Y8WA 2HEKA 1XJWB 5HYAA 1RT4B 3B57A 1VK3A 4U8YA 4OJHA 4TVAB 3T1HT 5KX5E 3PUSA 1WC0A 2W7AA 4FVMA 1QSLA 1DU2A 5K14B 4C8YA 5JXSA 1U1OA 2YKOA 2B4VA 3QIDA 3I87A 3BDPA 3UUMA 2NREA 4A4JA 4LFBT 2BS4A 3OR1B 2LQ8A 3N2KE 2G2YA 2VDHA 2GMJA 3VCDA 3G9CA 2PMZD 4P71A 3UD5A 3E08A 3LP1A 1YWXA 2HQ3A 4QWAA 3BQKA 5LYJE 4YY3F 3OW2R 5BXIA 2XASB 4JV5T 3HSZA 2V6YA 1TL5A 4GO7X 4HDGA 4NLTA 3EDQB 3OSPA 1NHKL 1V3RA 2DYAA 1RAAB 2DNGA 2QLBB 1Y64B 1BWVA 1ZM9A 1FRXA 2I5JA 3GSIA 4U7YA 4DR5T 2H51B 1OQ6A 3EZUA 1URNA 1DQ9A 5D77A 4CLFA 3D67A 2D2SA 3P49B 1Y0HA 3UE2A 1JX4A 2ACMA 1UEKA 3QGGA 5GAHU 2V67A 3AOBA 2WMNA 3MOJB 2XMJA 3SV3A 2B5JA 3P8BB 5L8RC 1GTHA 4RBUA 4Z7CA 1B7YB 1H7XA 3CGIA 1JWWA 3C16A 2IBOA 3KV9A 2OIHA 1QAIA 4ZI7E 3AAAB 5L4HA 2UP1A 4QU6A 1H72C 4K4TA 3C16B 3G8SA 3N9PA 3HL6A 2N3LA 4IE4A 5KFFA 3VAHA 4WPAA 2CWXA 3QK6A 3ETOA 5CAAA 1UEVA 1F1BB 2ZHOA 4B3MT 3GV7B 2HHSA 4HFCA 1VQMS 2Y3YA 1VRBA 3DU5A 5THWA 1VQSA 1C4CA 3IR7B 1I94T 2HFOA 2RRAA 5D3GA 2YY3A 2VG7B 3CIMA 3TZXA 2OTLS 4GKKT 3TOQA 2YKSA 1YGYA 5ETSA 4OLPA 4X65T 1FRIA 4BHQA 3I55S 4F25A 1D1BA 1JLQA 1BY9A 4FI5A 2SPCA 4I7FB 2F8EX 4ED2A 2HHUA 2WS3A 3H5YA 1F9FA 2L41A 2KT9A 5TAOA 4WFYA 3V4IB 3KLIA 2LE8A 4K5RA 1RHUB 4B3RT 4DR3F 2LU1A 1U6BA 4HN9A 3UDEA 1UETA 4QIGA 1PYTA 5HCMA 3SBMA 1H6KX 2DHRA 2CVEA 3CKDA 4J9PA 3R84B 2QJ3A 3OBIA 5F3JA 2Z6EA 1MWYA 3CD7A 3FFIB 1NJZA 3I0QA 4AL7A 2KG0A 3W8PA 4PJLA 4JI8F 4UELA 4UOFA 2NTYA 2K9AA 2LQ5A 3TRGA 5CZXA 1RP5A 1Q8IA 3X1LB 2PTFA 2YWEA 2J0XA 3HSJA 5LMUJ 2XAJB 2IDEA 4ILUA 5LOVE 2M9KA 1RI7A 3FZFB 1R0AA 2AV5A 3KKFA 3RC8A 5DQWA 1XMOF 1YK9A 4C7QA 4NYZA 2D9PA 4HH0A 5JVHQ 4CN1A 3FZLB 1FX2A 4LF1A 2V5HG 4DXLA 1R27B 4P73A 3IRXB 5HJYA 5K8PA 5HO4A 4HLBA 5KG2A 1ZAXA 3BN7A 3MPUB 2QZ8A 1PIEA 4RUBA 1JKHA 2RU9A 2HQDA 4M5DB 4B3TJ 4C0BA 1IKVB 4N77A 3SSSA 4K59A 2CFXA 1G3OA 2V7JA 5AQHB 3CCES 2UUBF 1U47A 2DGOA 3AAWB 3CCUS 3K8PC 1TFWA 3SRZA 1NRKA 4I68A 2QA1A 4Q43A 3BDEA 4GVBB 3N9NA 3EXYA 1W09A 3KLHB 1IKWA 4LF9T 3BPSP 1N5TA 1U2FA 5F0UA 2ROEA 4U7IA 3B6BA 2EHOA 1BLUA 3MOZA 1BQMB 3B13A 4ZN3A 1FKPB 2K3KA 4MFRA 4A98A 1UJ6A 2VFRA 3TA2A 2UZAA 2MSTA 5EN1A 3IG1B 4UF0B 2VBXA 5D0HA 3LH2S 1V5VA 1NK9A 3CX8B 4DV1J 1HBNB 1ZA1B 4DFJA 5L47A 5B0FA 1LWCA 4OHWA 1TV6A 2FC9A 1SH3A 3CQGB 1JLCA 4OI0A 5DJBA 4KUMB 3BGRA 2GIQA 2YKPA 4FF2A 4ZXLA 2HZVA 3FZMB 2ZDPA 3FSXA 5D4PA 2W01A 1W0AA 2BW7A 2XAGB 1RWXB 3H37A 3F57A 2BW2A 2Q43A 2G2ZA 1MG7A 1EQMA 4KIAA 2ZC4A 2DNLA 1GMWA 3R2DJ 2X0HA 3GP9A 3N0VA 4CDIA 4B3MJ 2B7BB 1AA1B 1U6FA 1WNEA 4AFFA 4NZ7A 4AQYJ 4NEZA 5F8NA 3O8WA 1IWGA 4H9SE 3GYGA 2BG9A 3POTA 2OFGX 4URQU 2CCQA 1S7HA 4CI1B 2RP4A 3RX6A 1WI8A 3ETUA 1NJWA 2FJVA 3ZYMA
chains in the Genus database with same CATH topology
3RRWA 1S0OA 2EFQA 3AY0A 4A56A 4C3KA 4YQWA 3HKDE 2GX8A 2FJXA 1QM9A 4IG0B 1K73T 4AUKA 1UA0A 3P5TL 4ZPAA 4E0DA 4QIWD 4Y65A 4B3RF 4BC9A 4C98A 2UXBF 2PA8D 2XWYA 1NK6A 2I0XA 1S1UB 4OI3A 2FHKA 5LJ5Y 2E1AA 4WBOA 1D9FA 4ELTA 1IBMF 4TYAA 3ENVA 4G6VB 4C3MA 1WTBA 4QR0A 1I1GA 2DH9A 3FMWA 3JC6D 1VBZA 1U5PA 3D1QA 5DG9A 1FK9A 4TZ4C 2BXJA 1ZETA 2PGCA 4HFVA 1ZZFA 4FZVA 2DNPA 4RNMA 5GAHI 4DQRA 1LWCB 3PU8A 2W4DA 5KG5A 1V3SA 3KDSE 3M6WA 3QAUA 4PR6A 2PIIA 2KRRA 3DRYA 4DR1F 4IO9Q 3I32A 4PQAA 4FYDA 1JMTA 4I50E 3QAEA 1JJ2R