1KNZA

Recognition of the rotavirus mrna 3' consensus by an asymmetric nsp3 homodimer
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
157
structure length
154
Chain Sequence
TQQMAVSIINSSFEAAVVAATSALENMGIEYDYQDIYSRVKNKFDFVMDDSGVKNNPIGKAITIDQALNNKFGSAIRNRNWLADTSRPAKLDEDVNKLRMMLGIDQKMRVLNACFSVKRIPGKSSSIIKCTKLMRDKLERGEVEVDDSFVDEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of the rotavirus mRNA 3' consensus by an asymmetric NSP3 homodimer.
pubmed doi rcsb
source organism Simian rotavirus a/sa11
molecule tags Viral protein/rna
molecule keywords 5'-R(*UP*GP*AP*CP*C)-3'
total genus 52
structure length 154
sequence length 157
chains with identical sequence B, C, D, I, J, M, N
ec nomenclature
pdb deposition date 2001-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.550 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1knzA01
3.30.70.1610 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1knzA02
1KNZA
chains in the Genus database with same CATH superfamily
1ZKEA 3Q8PB 4C8NA 5FY1A 3ZZOA 1NJYA 1S4EA 4GYSA 3BO2A 3Q2TC 3LBXA 2J0SD 3JADA 2XJ7A 3SQGB 2WSSV 2XZDB 5DDQC 1GMWD 2QEXS 4DUYT 1X9MA 2BVMA 4F4KA 2R7QA 2BX6A 2WY2A 1Q16B 5FL1A 3MMBB 2ZOMA 2C2OB 4NXMJ 1VQKS 4G65A 3LALA 4DXLA 1T9WA 4C8LA 3IBPA 2XHCA 2KSRA 4NCAA 2XY8B 2LA4A 4A98A 4X4TA 1MMDA 5KG5A 3V6JA 4A8SA 2BYCA 3AAEB 1CPZA 4CCHA 4DR2T 2B4PA 4JBCA 4HKQA 2HVEA 2XEXA 2B51A 2DGXA 1IJ5A 5D3GA 1JLFA 2ZH1A 4DLEA 1Y3KA 2MZJA 4OHFA 1GAOA 1S6UA 2B5JB 4O44A 2W8LA 5LMUF 2CG4A 1SC6A 3J80Y 2AU0A 4FXDA 3MEGB 3EDQB 4DR4T 4P73A 3QMQA 2NW8A 3TA1A 2Z2ZA 1CQMA 3LAKA 1REVA 4FNIA 4YS2A 3SZ2A 1Q79A 3ITHA 3EDUA 4YEAA 5EWFA 1HR0F 3SWHA 1O6XA 1AFIA 3W5YA 4F6RC 3CX8B 2H3EB 2VG5B 4DI6A 2OO4A 5C2TA 2MJNA 5BR8J 3LK2B 4OI4A 4EOZB 3RX6A 2QLWA 2XMAA 2DGUA 5HN0A 3UU4A 5DQHA 3OVUA 1R8PA 3SI8A 3N6LA 3C4ZA 5ABEA 3RAQA 3EABA 1TKZA 2HZVA 2LLYA 1FJEB 4L75A 1G7CB 1HHQA 1H2UX 1VC0A 2FLOA 5H6RB 4QJVA 1K0TA 2HGMA 5AQMB 5AQJB 1WR0A 2YINA 4OFZA 1TL4A 1RAAB 2MGZB 4O4JE 2QYWA 3V5RA 4WCEQ 1JJ2R 4F2SA 4J5OA 4JI7J 5A8RB 4ES2A 3HHEA 3PUSA 4KI0F 3X1DA 1Q7YT 3PEHA 5KOWA 2YK0A 2Z8QA 3I9WA 3CW2C 2WSFC 3H0PA 3BPSP 2ATCB 2OUGA 4CXWA 4DSFA 2M6IA 3ZMVB 4KJIA 1P6TA 2XBPA 3QGGA 2OPPA 2XQCA 4USJC 3T1HJ 3HR0A 4V19X 5L3CB 3CT9A 3CCRS 3LDQB 4H9PC 1X8DA 1U24A 1VK8A 4FPIA 2WVBA 2JQKA 3UE2A 4NA2A 3S01A 4DFPA 5E2QA 3KINB 5I42A 3KLEB 2DTJA 4TN2A 3NBPA 4YHJA 4U8YA 3CMLA 5KX5E 3MMAB 2GO9A 4KY3A 4USMA 5T7LA 2PT0A 4NLYA 1I94F 1YQHA 2B4VA 4F7VA 3QSIA 4B17A 1YI2S 2RDIA 3CCTA 2BVLA 3SIPB 2NOXA 3VKHA 2PBIA 2VQFT 4MFBB 5KFRA 4YHHJ 3PUWF 4L3KA 5H9FK 1PC5A 3NBXX 4P2MA 3K5NA 3ET6A 3T1YF 3MM6B 5JREA 5C5JA 1NMEB 1HBNA 3TW0A 5BYSA 2OHDA 4I0UA 3M32B 4NASA 1X4CA 2HHUA 5DLFA 3HM9A 2GA7A 2RRAA 2MTQA 3MFHA 4NRTA 3IF8B 4DU8A 3R84B 1TK8A 5ETKA 5ABFB 5K9FA 4OYBA 1HQ2A 2DGQA 3NS6A 2X51A 1RT4A 2OTLS 2JQ9A 2BABA 1JJCB 2BXJA 4YQWA 9ATCB 3UVJB 2VL8A 1X0PA 2BJ1A 3AD9C 1AFJA 1RK8A 4LSNA 2ADBA 4NYOA 2GV1A 4LSLB 1K1SA 3AXMA 1SXLA 4L6V3 4TXSA 1EZZB 1EARA 1QAJA 4OI0A 3DN9A 3JYTA 3UN3A 3LAMA 1HI1A 3C8YA 4DCPB 1CJVA 4Y3CA 2DWGA 2R2RA 5L47A 2YKQA 2HLUA 3LG7A 1ZETA 4M5HA 4YDDB 4I68A 1YJWS 3H3AA 1RI7A 1X4HA 1LVKA 1OIAA 3LW5C 2JLFA 3TA2A 3FGVA 2VKJA 4Q2LA 3KNAA 2N4CA 4ZI2C 4U7UD 2QVAA 8ATCB 2AE9A 4USKA 4LVOP 3N2OA 5KFKA 4GRSA 1TV6A 1PKUA 4IH5A 3TQEA 4PFOA 2MQLA 2YPZA 2OV9A 4G1IA 1Q86T 2Q43A 1VQ7S 2I38A 2FPHX 3TYTA 5LBMA 5BR8F 2C2ZB 1XTZA 1DBDA 2H5JB 2LM2A 3RHWA 4JI5T 2I2YA 4Q25A 4NXMT 2A72A 1HARA 1S1XB 3LPEA 2I0MA 6FD1A 4DX7A 1F9FA 2FLPA 3Q0AA 1HIYA 4IE7A 1XWLA 2YKSA 2JSXA 5J1EA 1WG5A 2YDRA 2J62A 1CEZA 1X9SA 1ZZFA 3ZTQA 1JLGA 2MZQA 5KFXA 4DFMA 1TK0A 2HURA 4HFEA 4L72B 2VPWB 3BR8A 5T7LB 4CLPA 1NKEA 2MYSA 1YVFA 1NSQA 2IM3A 3DP7A 3LP0A 3Q2MA 3RYHE 3PR4A 3EXCX 1HCIA 3VZHA 2KXPB 3GV8B 4XTTA 2XULA 2XSJA 4LR8A 1GMUA 3MM7A 3EM1A 3NEKA 2XQ6A 4AE5A 2PI5A 2BG9A 4B9TA 4HWIB 5KFOA 2YKMB 5I42B 4AKIA 1WEZA 3TAPA 4RW8A 2E5GA 3JTNA 2OEKA 3TUZC 4F0KA 2WZ1A 3ZXWA 1URRA 5F8LA 3GP9A 3RRGA 4ILCA 5B0GA 5LXRA 3NMRA 5IT0A 1U1PA 3DNCA 5HXRA 2RQCA 2X68A 5C3JA 2CPHA 1HNXF 1JLQA 2Q3PA 3GCXP 1T9VA 5AXLA 2N2NA 3VGVA 3ZKRA 3MCMA 2UP1A 4PNIA 3M05A 3QBCA 4G1PA 2VHGA 1DQ8A 4TQSA 1T0TV 2WBRA 3MD1A 1F5AA 4IH7A 1RT2B 4H4KA 2X9WA 3DRYA 3FUYA 1S6PA 3MR3A 5AE3A 4WFAQ 5C25A 1U1QA 3HP6A 2PG8A 2DJWA 3ZJ2A 4PCQA 4JI4F 2VUGA 2CUYA 4JI8J 4RNFA 5L4EA 4O3OA 3MEEB 2RP4A 1JLAB 4Y34A 5AT1B 4ANEA 2YKAA 1F1BB 3ONJA 2Q9QD 3M2RB 1DY3A 5GMEA 4A47A 5AQVB 1WOPA 3LGHA 4UOFA 1KK7A 2LMIA 3A8KA 1R0AB 1U8WA 1YJRA 3RC8A 4UUXA 2N82B 1J5WA 2M70A 2RS2A 4A46A 7FD1A 2KT9A 3Q8UA 4L3NA 4CLFA 2VKZG 3G82A 1FK9B 1HKAA 3CCZA 3G96A 2V67A 3MM8A 4JUYA 3HKDE 5L1KA 4QPTA 5E33A 2UXNB 5F0WA 1XNQT 4YHHT 3SV4A 2HHXA 4AXPA 2C1EB 4EZ6A 4IDQA 4KGVB 4X66T 2RQKA 4FNHA 4UUWA 3GB0A 4TU9A 1KVIA 5F5WA 1FRJA 1EP4A 2V68A 3H25A 5EWGA 2QL9B 1YXRA 2B7BB 2R7SA 1PAUB 2DNRA 5KG4A 1HI0P 4BJNA 3M8RA 1RU2A 3FC9A 3PU3A 4ZLNA 3EZUA 1ZS6A 4V1Av 1RTHB 4JI5F 3CD5A 5HXHA 2RJZA 3W8GA 4UOHA 2VV5A 4KB7A 2QJ3A 3HFKA 4NLRA 1RAIB 1NM2A 2KNDA 3RRWA 2VOOA 2VFRA 2FVRA 1WDDA 1N32F 1HNIB 4Q44A 2MHNA 5J2UE 2UUBF 3N6MA 2JFDA 3E0ZA 3E3XA 4DEZA 4IRCA 2QMXA 3GFXA 2QLXA 5HAXA 2AX0A 2PC6A 5FL0A 2HRTA 3WQPA 3AA1B 4P75A 2HSEB 4F4YA 4NLVA 1RP5A 1UWBB 4N5SA 5J2PB 2HQCA 2B4OA 2A3JA 3M30A 2VVSA 2ROEA 1M62A 3J7AN 1NK6A 3CCSS 8RUCA 2BE7D 3UD4P 3K5PA 4OLOA 2Q1LA 3ZC0A 4DV0F 3MM9A 2WU2A 1DTQB 4DUTA 2AJ4A 3I87A 4Q5VA 4WK1A 2AEJA 3GIJA 3I9YA 4B3RT 5CZVA 1XMOF 2H3RA 2FHJA 4IDZA 2Y0SD 3BN4A 4BWMA 2QFIA 3V4MA 2HPLA 3W2VB 2W9BA 4ZVOB 1LWCA 4WKRA 3CJ4A 5AQGB 2DPJA 2JC0A 3RR7A 4H9QC 1VQMS 5AXMA 3C51A 4J9NA 3ETOA 4I1TA 1VRTA 2ZWPA 5GAGI 1RYSA 1J5OA 4F3OA 3TZZA 1VRBA 1V3RA 4X4OA 3W64A 4CO0A 2XAQB 3C98B 1HWUA 3M6VA 5DQIA 2XG8A 2DNKA 1KVJA 5AQNB 4EEBA 3LWLA 3PFOA 2RDDA 4EUVA 5J1PA 3N9QA 4KHRA 3N9MA 4I4TE 3W15B 2VBZA 2GQCA 4DX6A 4LFCT 1WCRA 2BG9E 2IDEA 2JLGA 4PK5A 2DRAA 1SC3B 3OR1A 4W98A 3M8YA 1R8CA 5HQLA 4LRAA 1PILA 3GYXB 4RKUC 2I0XA 3W2VA 2W9BB 1JXVA 3MUTP 2W00A 1C0TA 4UY85 3BS9A 5JDLA 1LVFA 4RW6A 3PW4A 1MMAA 1DHMA 2ASDA 3QJLA 3CIRA 5IQ6A 2EBEA 3M2VA 5LGTB 1HNZJ 2Z30B 2ZC4A 2CVEA 2LKHA 4PR6A 5JDMA 2G1DA 3CD7A 3QQCD 1NEKA 2KHCA 1AXQA 1UVKA 2YXLA 2UXDT 2FJAA 5B08A 5HMZA 1M90T 4ICLA 3CQXC 4IR9A 5KT5A 2BVZA 3G9CA 4PQAA 2RQMA 1XMOJ 2YDSA 2ZH2A 4DBRA 4JV5J 4RW9B 2J0XA 3G87A 2CNNB 3HD1A 5DG7A 3E08A 1QSYA 3MR2A 2DO4A 3DOLA 4RO0A 2KG1A 2YPYA 1N56A 2D3O1 1WHWA 1M5SA 3OR2B 2EFPA 5GMDA 1NEEA 4CO1A 4YY3F 4J9PA 2J7UA 4C4WA 1FI4A 5AQKB 4FDFA 1YX2A 2K7KA 4IFVB 4HH0A 5CYMA 1U6ZA 5K8PA 3TOQA 4ZI2D 1O51A 1NJZA 4ZOLE 4USHA 2LRLA 4DN9A 4I7FA 1B3TA 4DV1F 5GAHI 4MIWA 1QE1A 4OYZA 2XY5A 5LSLA 1S76D 3TARA 3E01A 4LRCA 3TP2A 2FB0A 2HGNA 1Y5LB 4X20E 3SBMA 4U31A 1AUSL 2A2DA 3IMQJ 1ZBTA 4F3QA 2FC8A 2HRYA 3I1AA 5F9NA 1SJ3P 3CDEA 2N9DA 1BE4A 3R1LA 3ZFVA 2MTLA 2POKA 4ELTA 4F3MA 2KH9A 1TZ0A 3R2CJ 1Z2LA 1TKXA 4HTJA 4QXCB 1VBKA 2YOEA 3RB3A 3K1SA 1RGVA 2GW8A 2FYXA 3MM9B 4LF7J 2EK6A 4CO5A 2GX8A 2IIUA 3OTOF 2R2UA 1EIYB 2J8SA 3DYAA 2MY7A 4DV6T 4DPOA 3FZLB 3P4RA 4I6AA 4Z90A 3O3LA 3H4BA 4UQTA 1LRZA 2RHQB 1IWGA 4DZ6A 4EB6E 1SKRA 3WC0A 2VKHA 2J9CA 4NXMF 5KFTA 4AT1B 3W61A 2AP6A 1S9GB 2AEMA 1CG2A 1FKOB 1FFWB 1S9GA 3MURP 2VKRA 2P2CB 3KK1A 4UV9B 3M1VB 4H9NC 2HIQA 1IBMJ 1WSRA 3CMES 2C2KB 2AJFE 1BLUA 4IQMA 3HI2A 3FRYA 1FEHA 1NBEB 3CMAS 4OZJA 1URNA 3ET6B 3CVKA 1LEOA 4UVCB 1MN9A 2V50A 3JXOA 5LXTE 1D1CA 2LQ9A 5LOVE 2OSQA 3DKDA 1TVRB 4ECZA 1RAEB 4F36A 1S10A 3K5LA 1S1VA 1U8SA 2ZNYA 2R7UA 2V1DB 3OL7A 4QWEA 3NP5A 4R25A 5TAOA 2PFDA 2CE7A 2HHPA 4ZHQE 1WELA 2DHGA 1RCOB 1Q1KA 1FDDA 4MK8A 3QZ8A 5LG4A 3FFIA 4NLWA 4LF5T 2HNDA 1HNZF 1HNVB 5GAHU 4RWXA 3VU7H 2LYVA 1D0XA 2JX2A 3VWSA 3PUGA 3VGUA 2X9XA 4C8ZA 2IMLA 1WRDA 3GIIA 2EHOA 4KSEB 3RB6A 3RPUA 4ZVTB 3QFHA 4OYAA 1WACA 2QA1A 4A48A 1OSDA 2YH0A 3CB4A 4M5KA 2PN6A 5L3FB 1BWVA 4J9MA 2XZTB 2FJDB 3IN5A 1VCSA 1ZA2B 5HWXA 4COFA 3CCWA 4ZVFA 3IAS9 1KDNA 2OA5A 2ZM6T 3ULHA 1TL3A 1SQGA 2WSEC 3GPAA 3KUEA 3P8CD 2E9XD 2DISA 3D7SB 1X5SA 4KV8A 1PJ5A 5A1LA 2UXBF 2YY3A 5EZYE 1RBOB 1IKYB 4ZVUB 5L3GB 3EVWA 1KQSR 2AKWB 2O01C 2VVNA 2AXDS 5AXNA 4M5IA 4CM2A 1U45A 4MYTA 2PMWA 4MLKA 3PTWA 4DR2J 1JLQB 4JI8T 2IM0A 1BGXT 4CH1A 3IO1A 5ETRA 4DQSA 1QE1B 1VQ8S 2QL5B 3HHLD 1U6FA 3TANA 4DHVA 1N33F 4PG8A 4WZXA 4A8QA 4OZ1A 5ETMA 2QN6B 1HMVA 1BR2A 3O9XA 2GK9A 5E41A 5CD4H 2WBMA 4LF4F 3TLVA 4DR7T 2XQ8A 2XMJA 4PG6A 1S1WB 3RW6A 2GJ2A 2FVCA 2ZFHA 1FKOA 4NLGA 2IJFA 2HFOA 1VQSA 1WG4A 4PWDA 2DITA 4Y2IA 3ZT5A 2E66A 1D0EA 3ETUA 4H4OB 4PJLA 3HHDA 5SUHA 4C98A 2F63A 1U25A 5IZHA 3AA9A 2K3WA 4LMLA 2WRMA 4UXNB 4DR3J 3JAMY 2WDQA 1A0OB 1U4QA 1X5OA 5ETLA 5AQTB 3LA0A 4CLSA 3NNHA 2NYHA 5KDMC 2E5JA 1VOMA 3CCJS 3KBTA 3R7SB 1S1WA 4G1QA 4DG1A 1LK7A 2C2MB 2O3DA 2XO7A 2XASB 2XTJP 3KK1B 2QLBB 3SQOP 4QWNB 1QM9A 2JL9A 1YBAA 3J81j 1QUUA 4NXNJ 4PPZA 3MR5A 4IYQA 4IH6A 3FNNA 2PMHA 5F8JA 4X4SA 2BANA 3G6ES 4TLQA 4BAYB 5KG3A 5LBQB 1VK3A 2YNHB 2F4VJ 2D0UA 4W92B 5IYZE 4ZPVR 1LKZA 2B8PA 4OJGA 3P3DA 1P8GA 3AE4A 2BJEA 5D6GA 4URQU 2YN6A 3VAGA 3MUMP 3DLGB 2R2TA 2Y0BB 5KG1A 1SE7A 5D4OA 3K8PC 4RPFA 4IR1A 4LF8F 2LQ8A 2ACMA 3OT9A 2FHOB 1L3UA 3RTVA 1Y11A 1RT7A 4H63V 5HMYA 1TKZB 3AE7A 4LJMA 2V5CA 2EFVA 2PD1A 4DFJA 4ZI3D 1IM6A 2G1HA 4OI6A 3U02A 9RUBA 3FEYB 2JJ4D 3FEZA 1FDAA 3T19A 1N54B 2WAQD 4J9OA 4RLEA 4WIIA 1KHVA 1KSPA 3HVRA 3BGOP 2VJVA 2MBGA 2HN2A 4F4ZA 3HDSA 3FCHA 3WDOA 4X66F 1I6JA 1N5VA 3SXLA 4OX7A 1N32J 4PXDA 3JAMU 5EK4A 1RLDA 3HKBE 1W2BR 1C4AA 2UU9T 3VRAA 4ERDA 1HW8A 3KLGB 3DTOA 3ANWA 1HD1A 4MKBA 4NLUA 2B8QA 4EEDA 1DLOA 4K5SA 4QH5A 5EUHA 4KT0C 3ZMTB 3N2GE 3QAUA 4OL8A 3M7VA 2DPIA 2WBLA 4X4UA 3TQ1A 1U2RA 2XNQA 2VG7B 1H0HB 1O0PA 2EW9A 3R7BB 3KJNB 5ETTA 4ZS3A 1UVMA 4M1PA 4B9SA 2DRDA 4J9VA 4JI2F 3VAMA 3PIPQ 2R8KA 1WTBA 4B3TT 4OJHA 4IO1A 4WWSA 2W7AA 4YT0A 1S5ZA 4KKOA 4U74A 2FLNA 4Q43A 2APOA 4USVA 3BYPA 3C4WA 2ZLYA 1NJIT 3M8QB 3R1HA 3KV4A 4CP5A 2J7KA 5HMWA 4FYDA 3BZQA 3IRXA 3C66A 3HSDA 4JI0J 1ACMB 2P6SA 2CJQA 4TY9A 1HWJA 4J91A 3M8QA 2VQFF 3R27A 1TKTB 4WF9Q 2ZD1A 5F41A 2XGQA 2ZE2B 1RU1A 4DV0T 5DQVA 2UV8G 3OLBA 1NK8A 4PK4A 6AT1B 3QLHB 2NSBA 2PA8D 5FXWA 3ZTPA 1J5OB 3BF4A 2K06A 1KFSA 1VRUA 5IOLA 1SIZA 3E22E 2JC1A 4RX6A 5JTGA 1Q95G 4OJ1A 4B9LA 5C8YE 5HK4A 4C6AA 1BR0A 3A3PB 1QY7A 3VRBA 3J7Z5 4B3MT 4E8UA 4XIUA 4ECYA 5BJRA 3RQWA 2KT5A 1K9MT 5DS7A 5LYJE 2G2YA 2Y1JA 3QO9B 4FF1A 5DQGA 2XWXA 3NS7B 3P49B 3SFEA 2OI2A 5AQIB 1L0VA 2OGUA 3VR9A 1FESA 3QT6A 4D3HA 3UWTA 2MKHA 2KO1A 2GJIA 2Y6XA 2DXFA 7FDRA 3AE5A 4WFZA 2ES0A 5CA0E 2R8HA 2ZM8A 4IL9A 1NK5A 1YG0A 2BJ7A 2JZ5A 2G0JA 3HSZA 2Y48B 3ZCJA 3KV9A 4Q8FA 1X79A 3QPIA 3D6HB 2A6MA 3HF5A 3E2EA 3JQJA 2DHSA 4NCBA 1RADB 3MAQA 1VRUB 4LFCF 5HP1B 1JLAA 1QD1A 1PYOB 2DNMA 4NCGB 2BQ3A 2FUG9 3BK9A 2E1CA 3GTYX 3JC6C 1KTQA 1R6VA 3SYZA 2HVIA 2YBVA 4GMKA 1WC3A 4B3OA 3R9LA 2YQ1A 5I4MA 4B08A 2V69A 2I8EA 5F8IA 3MAAA 2LP4A 3BKUA 4M94A 1C1CB 2QMUB 4ZJLA 3LP0B 4IFYA 1NU4A 3K59A 3T1YJ 4OHVA 5KOXA 2W1BA 1L3SA 1M1GA 3HVTA 2K2PA 3DOMA 3A13A 2J0WA 3OBIA 4B6XA 1J5EF 3PNIA 4NA1A 1FRMA 4M5MA 1V9DA 4URGA 4K4XA 3PW0A 2VWAA 2HHHJ 4LMJA 4O3PA 3C64A 5J1EB 3CWZB 4RUAA 4DPWA 1FJCA 1S1TA 5IV3A 5IC4B 4YY3J 3RF1A 3JQMA 4R8UA 4JI3T 2LDYA 2WB4A 2RQ4A 4DWIA 2Y8YA 1L3TA 4OX9J 4KE5A 3DXBA 2CBIA 5CB4E 3TLUA 4QR0A 2BV3A 2PEBA 4I7FB 1TELA 4IUFA 2NZ4A 3FCVA 2V7LA 3HJVA 2Y1RI 2L8KA 3MHYA 1AZSB 1LWXA 3AODA 3I9ZA 4WW0A 2V8SV 1SL2A 3UT5E 3H5YA 1KOHA 1D9FA 3QRQA 1LW0A 3WIUA 3OTDA 1RWWB 2HK3A 1R8AA 2IMOA 4AXJA 3QJPA 4M5JA 1CC7A 2HHVA 2G0CA 3K3QC 1OEDC 2GO8A 1VI7A 2W61A 3G2XA 5AE2A 3L39A 1EP4B 3DRSA 4YTPA 2V4JB 3H90A 4K4VA 3W7BA 3AOAA 2KRBA 3C15B 1Y9OA 1WF0A 1CVJA 3PZPA 2RD5C 4YP3A 3K2YA 4NYPA 1P9YA 2VZ9A 4FVMA 3IG1A 1G6BA 2BJ8A 2J47A 3ZC4A 3H2UB 1LXJA 3MGJA 3J81U 4LF6F 4AKHA 2X1BA 2ADCA 3NZQA 3ZC1A 1N88A 2VONA 2R7WA 3K8WA 3MK7C 5HQ8A 3BGRB 4N8NA 2HS3A 4HTIA 2DNNA 4XBFB 5KFWA 4J2CA 1HBMA 4DZDA 3KFWX 4TY8A 3IC1A 2XS2A 1S94A 1T02A 3QFWA 4PQUA 1SJ4P 2OPSB 4KC5A 1WYBA 1PJ7A 3SCKE 4F4XA 4LQ3A 4QIWD 4CH0S 1S79A 2XQAA 4NL5A 2XHWA 2ALZA 1TKDA 4JI4T 1JQGA 1L5UA 2ZH8A 2CJXB 3WI3A 2HRUA 3RIFA 2V7KA 5LJNA 3FSXA 5T14A 5KFLA 2DXEA 5EWEA 3NVOA 2CJBA 1B0PA 2Y9HA 1SUQA 4TU7A 4TNWA 3QNWB 4IDNA 5M4YA 3MMCA 4MMOA 2MMYA 4F4WA 4DSLA 3LK3B 1RAFB 5LG3A 2V26A 2H1YA 4J37A 1CJVB 4P6QA 1SKSA 2B9YA 3KBUA 4EFAC 2QA2A 5H9FJ 4D3GA 4OZNA 2Q6BA 2FQQB 3IGNA 2V5DA 4EBDA 4O2BE 5KFZA 3CE8A 4FI5A 2I5JB 4G1QB 1YBTA 1OY8A 3UR3C 4JLEA 3BDPA 5LJ3Y 3LTOA 4C0BA 3LOUA 1G8XA 3O1HA 3ZMSB 4LVNP 3OPCA 2PE8A 4B3ST 2XPKA 4RNNA 2H48B 3GILA 1RHRB 2V7MA 3Q23A 1BUXA 2Q66A 5ETPA 4UEMA 3VKGA 5G0RB 1S49A 3L9ZA 1FF2A 2COLA 4QCLA 4DV5J 4O4HE 3UNYA 2XMWA 1S1VB 3L3PA 4I2PB 4LR7A 2DBBA 3W9IA 3DLEB 1IM4A 2VICA 4NUUA 1M7KA 1VISA 3TLTA 4JEUB 2J0QD 1HTJF 2RB7A 4I2PA 4B3RJ 4GVBA 4ILLA 1EQ0A 1FO1A 3R5GA 2RU9A 5KG6A 4JI1J 2YDQA 3KLIA 2Z58B 3VGSA 1VQNS 1TUVA 1S1XA 1T95A 2OAUA 2GAGC 1D1BA 2KINB 4KQZA 3SRZA 1ICEB 3EICA 4F67A 1VIXA 1IUJA 2CZ9A 1D8YA 4KHPT 3MPWA 2IAKA 4JYAF 1OPZA 4U7YA 3Q22A 3ETVA 3T5JA 4WBOA 5J2TE 1LWFA 4ZVRB 2VA2A 3IWLA 3DU6A 1FTRA 4IG3B 3CPZA 3C6UB 4JI4J 4RZRA 3RQUA 1RAGB 4IDOA 4ILBA 3ABVA 3CD6S 1P1LA 1CJUA 3LP1B 3SFUA 5LCYA 3UCGA 2KHDA 3UUMA 3M3ZB 1RWVB 2HN1A 1JJHA 2HS4A 1JLBB 3DRPB 3OYXA 3P5TL 4CQIA 4PUOB 2Z57B 3OXFA 2ZH6A 4DMZA 1WJ9A 4NEZA 3QRRA 2ZJQQ 1RHMB 4Y2KA 4M5DA 4OYWA 1PAEX 2KXHA 4LF4T 2IDOB 3QYYA 1TL3B 3P96A 4TV8E 5I3QA 4TU8A 1T98A 2F9DA 1RAJA 4OX9F 3UDVA 4DV3J 3I96A 1IQZA 2AJ0A 5LT5A 2ZUGA 3FZFB 4OHYA 2WVCA 4CI0B 2W7OA 3MD3A 1Q78A 4ZLLA 2D9OA 3CQCB 1KFYA 5B0EA 1FEEA 2YKMA 2NR0A 2CJYB 2M8HA 4EU0A 2DEIA 1YIJS 3SQGA 1H7CA 3NL0A 3MJXA 5A0YB 1JKHB 1NH8A 3PXGa 5A2QY 2MEWA 2HNDB 5D15A 4XK8C 4K50A 5AQOB 2LRKA 2ZDPA 1UX5A 1QVGR 5AFUL 4ZVSB 2PA3A 2H88A 2CHOA 3KVBA 2KFZA 4ALZA 1RWMB 1OY9A 2D41A 4X62F 1WKKA 4QQBA 2CQHA 2B7CB 3EPGA 2U2FA 3MA9A 2BZ2A 3JSBA 5HO4A 2UV8A 4IQXA 3PV8A 2IJRA 1HNWF 5KFPA 4DQIA 2LOSA 2GIRA 1KQKA 4WE1A 3PUYF 1G3OA 3TAQA 3NZPA 1ZM3A 2KFYA 4RW4A 3RB0A 3W1YC 1F0XA 2XAHB 4DR6F 3DGPB 3FB2A 2YU1A 4QIVA 3S1TA 3W8PA 4DO0A 5A0YA 3HHLB 4RNOA 2BR0A 1IJEB 4XPEA 3IRWP 3GFZA 4ZEYA 4OYXA 2NXUA 5ADXL 3EVMA 3LPYA 5L46A 1H72C 2ZZTA 5H6QB 1F5CA 2ABYA 3DLHA 4IE0A 3X1LB 2GVZB 4CI3B 2AGPA 4BWJA 1S0MA 3M8ZA 4LFBJ 4RJVA 3HFVA 1PCAA 1I5OB 3CGIA 2D2SA 3ENAA 4A8MP 4NXNT 5CAAA 5D8HB 1S9EA 2XAFB 4JEHB 4CQ1A 1FCAA 2WU5A 2AEFA 3NXZA 3BBFA 4ILAA 2MYFA 3PEJA 4WK3A 3AD8C 1V5VA 3D0GE 4LIRA 1R89A 4KO0A 2E2AA 2MDAA 1NPKA 4M1KA 3KDNA 2IAJB 4DSKA 3DRPA 4AL7A 2E9ZA 3PHTA 3BGUA 3CDAA 4FYYB 2FJDA 1YD8G 3UR0A 4IE6A 4MH8A 4X1KE 4ECQA 2P9EA 2CKWA 5B0DA 2YNIA 5LHGB 1VQLS 1KEYA 1FXDA 4KR0B 4F4AA 3HHKA 3PKYA 1KNRA 2BE9B 3CSKA 1HNIA 1MMLA 4Y2AA 4DL4A 2Q9QC 1SC1B 2IYGA 2CVIA 1OS5A 4QIFA 3MFIA 5ABFA 4X4QA 2A2CA 3NGSA 3DOLB 2IW5B 3M2UB 4U2ZA 2E5HA 4RW7A 3R7NB 2EC2A 3CJ2A 2X1GA 3RR8A 4KFBA 2MLXA 2XM2A 2CRLA 1GXTA 1QLNA 4TYBA 4RU9A 3H5UA 2OPQB 3J7YU 2XMMA 4P1NA 5C2CA 1WSVA 2VG5A 3BBBA 1VBXA 4ZCKA 1HG2A 5L39A 4NWBA 5ABGA 5C42A 4HHUA 4Q45A 1NDLA 3TLWA 3V6HA 3IG1B 2EFOA 2CA5A 3LBXB 4QOTA 2VQEF 5KFEA 2FLLA 1TAUA 4EO8A 2C3UA 4G3IA 4CDIA 3Q8VA 3CCMS 3F2EA 3O4XE 3CVRA 3N5LA 3CQGB 2I5JA 3OTCA 4HYKA 3CCVS 2P9BA 2RKIA 2HFZA 3A8EA 4RW6B 5FNVE 2QTWA 5IC6B 1N6QB 1HR0J 4F2RA 1O8BA 5JR9C 4K0KJ 2AJQA 1Q7LB 1HBUA 5DZ7A 4NZ6A 4MFBA 2CG8A 4WTYA 2FJBA 3HT3A 3Q5WA 1UPPA 2NCKL 2E1MC 1W0AA 4QR1A 5IS2A 3RGLA 1RTZA 4ZP8A 3SFGA 5L3EB 1UA1A 4O3QA 4Y65A 2OPRB 3A8YC 1VBZA 4Y6IA 2VOPA 5LMNJ 4MT1A 1G1XA 1R8IA 2F4FA 2VG6B 2YX1A 1MNEA 1S6OA 1KTVA 4C0OC 2X7IA 2XM3A 4RWWA 4ATNA 3KHHA 2ZM0A 1UGOA 4KBMB 4WYWA 2PFVA 1WKJA 2XLKA 3FJ2A 2HZAA 2ZM6F 4R0JA 1IBMF 2FJEB 2ZOGA 5HROB 2LM9A 1L3KA 2V8VA 1ROFA 1YKEB 3U3IA 2UXBT 2Y3YA 1WF1A 4AQYT 1OYEA 4KAIA 4A8YA 3AEFA 1I94J 3AE3A 1CHUA 2ODUA 1SKUB 1JK9B 3N9LA 3OQ2A 3K89A 3GJRB 1TU0B 3UD5A 2K3KA 3DHXA 2KWHA 3D2WA 4EZ9A 3QGHA 3PO4A 5BYRA 4F02A 2L9DA 2EI5A 5FP3A 5JVHQ 1NKBA 2HVZA 4X64T 4KPCA 5B0BA 1T7PA 2FUPA 5IQQA 3NGUA 2ROPA 4ZI3C 2W67A 3MZIA 4Z2XA 2DLRA 4TZ4C 1DURA 2HH7A 2IVFB 3Q8YA 3THPA 4YR3A 3EVOA 4P0AA 4TYAA 2V9WA 2ZBPA 2HFSA 2CQGA 2OEJA 4CN1A 3AT1B 2PDAA 3QB5A 1LFPA 5KFDA 4B3RF 4U7CA 1CS4B 1MWYA 3VV2B 3V4IA 1MSWD 2F3JA 3GIKA 4DL7A 2KRRA 1N34T 1KHWA 2QYCA 2ZHOA 4WZQA 4KPYA 1T3OA 3U27A 4NLDA 1YK9A 1YZ7A 3SS1A 3P8BB 4AKGA 1JLCB 4E7SA 2NSCA 1FFGB 2CAJA 1UEVA 1VQYA 3PDNA 4ZKAA 3KK2A 4DV7F 1ZYQA 4C8OA 2IFXA 1EAYC 1YJTA 2HQIA 2VG7A 3C19A 4I69A 4C3MA 1UW4A 3OL9A 5LA6E 4HFHA 5FKYA 1IBLT 2W2MP 4P10A 4DV1J 1LKXA 5CZXA 3JS9A 1FXLA 2YKNA 3KKFA 4HFDA 2B9WA 2BS2A 2W4PA 1RT2A 2W0GA 3EE3A 1V3ZA 4C90A 2MKSA 1Q8IA 4O4RA 2KTQA 4OI2A 1N5SA 3KLHA 2DCLA 1SJFA 3MXZA 4YSXA 3Q5EA 5FXXA 1KLMA 3NY0A 5IT9Y 4ZCMA 4DR1F 3PYEA 4RU2A 5KT4A 4OV1A 2BDPA 1FJGF 4C8MA 2SPCA 3VAFA 1VYAA 3J7YI 2UXCJ 4RBTA 5DLGA 2R7TA 2XQ9A 5KG0A 2CJ9A 1UWAA 2VG6A 4O4LE 3OKQA 5LMUJ 1U6BA 1WOOA 4MKYA 1RJJA 2NUUG 2R7XA 1H98A 4ID8A 4I2QA 1FK9A 2ZNZA 3TLSA 1HS7A 1U09A 3HKWA 2KN4A 2FJBB 2LFVA 4DNDA 1XERA 2IAJA 1C1CA 4K4SA 5KT6A 2IM2A 1CSJA 3MPVA 4O4GB 4DV4J 3SCJE 2WZIA 4GC7A 1N5YB 2JH3A 2CPZA 3KV6A 1S7HA 4WFNQ 1DU2A 1VDHA 4EEYA 4UR9A 5HCMA 1WC0A 3P7IA 3LK42 1W25A 3HHLA 2YQ3A 3CO9A 2QSWA 3DGPA 3P4SA 3TX0A 4AQYF 4LRDA 3KUGA 3T6BA 4DUZJ 3W2WB 2AMCB 3CJSA 3BJYA 4DV6F 1V3SA 2D5UA 2FJVA 3M8PB 1P9QC 1XDPA 4PZVA 3KLVA 2AJ1A 3PYDA 2D3OR 3A7MA 5IWAT 4F50A 1TR0A 1ZHCA 2XLJA 2ZVSA 2WW4A 1VMBA 3D3CJ 3MM7B 1S9EB 2M67A 3NKZA 3T5LA 4J90A 4K0KT 1OEDB 5KAKA 2WCAA 3OXGA 2K48A 3IM8A 1IBCB 4PEOA 1RTJB 4C7QA 3SSQA 1VQPS 3AQOA 4DMVA 4PXEA 2F9JA 3IR6B 4OI1A 1Q53A 2OMOA 1UWBA 4RUCA 3H42A 2DGOA 2GMHA 1TKXB 5F8HA 2ZMAA 6FDRA 1YJUA 2HAFA 4GOUA 2JWNA 1RHQB 2RAQA 4U2YA 3R8YA 2C0SA 2B1EA 3H5SA 5HANA 2MKYA 2DGSA 1NZAA 1XN9A 3ENVA 2BE2B 3J80U 4OZLA 3JAEA 3KNGA 3BQ1A 1LK5A 3RI5A 1TMMA 4QW8A 2AIRB 5LSOA 4NRUA 4NLXA 2J9EA 1QSLA 3TR5A 1JNZA 5LNKA 3ZTOA 3QJJA 1KR4A 4YSYA 3WZ0A 4KYZA 4O3NA 3MAHA 2JEIA 1QSSA 3I0RA 3DOKA 4ISTA 1SH3A 2XZWA 1UMJA 3AY0A 4B3SJ 3C2PA 2XQ5A 2VKOA 4ED4A 5CYQB 5D77A 2W01A 1FMWA 4ZIVA 2RMLA 3AH6A 3HPOA 2VU5A 4RNHA 5KFHA 2XQYA 1UETA 1RA7A 5HL7Q 5HCJA 4P09A 2ZBCA 4F0MA 3OJAA 5KFCA 3RGIA 2CNOB 3B82A 1X7VA 3HSJA 2CA9A 3O1IA 4LF7T 5LMNF 3ONXA 1WWHA 3DMJA 3CCUS 2R8JA 3DRRB 2GHWA 1WYCA 1T11A 3ZZZA 3HO1A 2FGOA 3VHLA 2KYXA 4I56A 5E5NA 2QC3A 4H54A 3JSMA 2FJXA 2C5IT 4I6WA 1ZTWA 5ETVA 1N34J 1Q4RA 1Q81T 3PACA 1BWEA 3FVYA 2XYGB 3M8SA 2A6OA 4WYLA 4UV8B 3WAJA 1ZP0A 2BBEA 1H38A 1IBKF 3C6TB 1T8EA 4GKKT 3RB4A 1HNXJ 2RIJA 3HK2A 2BJ3A 3JYTB 3ZSSA 2UVRA 4ILUA 2Q6CA 4AXIA 3ZMZB 4CLUA 2ZUAA 3D1HA 4ANCA 2L3MA 3PW5A 1WC5A 2LT3A 3U1LA 2HG4A 3PG9A 1QLBA 4TKTA 3KVAA 2VBXA 4HACA 5D0GA 4WP3A 3V6DB 2JMKA 2LQJA 2J9DA 1YW0A 3PW7A 3ICLA 4NXNF 1XIQA 5IV4A 1KC8T 4LREA 4OYPA 4I2QB 3GJQB 4WNKA 2NR4A 1IXKA 3W66A 2V0NA 3DU5A 3ZYMA 1FD8A 2AYMA 1C2PA 3OW2R 4ZITA 3OFFA 3M8PA 5FXVA 1VIOA 1OY6A 3OL6A 3H4DA 4H4MB 2HAIA 1Y01A 3QNUA 5K14A 3UUNA 2XQ3A 1DZ5A 5GMKa 2CJKA 4L76A 2GJFA 2ACZA 3UU6A 3F31A 3A5XA 5DG9A 1XJWB 4KGXB 3IR7B 5F8PA 4LRBA 4ZCLA 3DLKA 2P6TA 2HBRB 3AB2B 2VURA 3R6LB 1XMBA 3BSNA 3MEDB 4USIA 1FTCA 4YUDA 4C48A 1U1LA 4EBCA 5AQHB 2M4MA 2R6GF 4HDHA 2I9SA 3D3BJ 1FX4A 3T9ZA 4DV4T 4B02A 2QFJA 5J2NA 2LKZA 2VPXB 4ECVA 4DL3A 4Q0BB 2LEAA 1Y10A 2M8DB 1WR6A 3HI9A 3R3TA 4MK7A 2EEYA 2X0HA 4LF9J 5DGAA 4WFXA 1C0UB 1SQEA 3MOZA 4DX5A 2RUSA 4EGWA 1QAIA 4LMKA 1FT8A 2DGTA 5GONE 1MU2B 3I4PA 4IG3A 4J9QA 4PQUB 4IL4A 3DGVA 1MWZA 3U7JA 3F0NA 2L41A 2BUNA 2H9ZA 3RRHA 3N5FA 2F65A 3AD7C 2LA6A 4JI3F 1S4FA 2KZMA 4OYIA 1HF8A 4JI5J 3MR7A 3M6UA 1WI6A 5AJ3J 5ETOA 3T6JA 2KXFA 4BJMA 2GHVC 3AB3B 2QIFA 1HNWJ 1Q5VA 1FHTA 3TKLB 4PUOA 2OPQA 3PU8A 3FMWA 1S0OA 2VQET 3CXCR 1MROB 4M63A 4X1IE 4UF0A 1RISA 2M3DA 2E9XA 1H7WA 3BGFA 2UUAJ 4QKNA 1N0UA 3AJ1A 4PABA 2PI4A 1GH8A 3RBDA 2U1AA 4CN4A 3N4WA 2DRBA 2IPOB 4C9DA 3TEGA 4LT6A 2UVVA 4PAGA 4X65F 1MIVA 3FQKA 1RTDA 1YWXA 2CPEA 2M0GB 4LFAJ 2MQMA 2A2FX 2OJ3A 3L8RA 4R8UB 1RBLA 4NZ0A 3N0VA 2IYIA 1T94A 2FHJD 4DV2T 1UZHA 3CPWR 5A6PA 2UXCF 1HHTP 2V8HA 1H2VZ 4CTAB 2BKNA 2CDQA 4ECRA 4NCGA 4TVAB 4DV0J 2FJEA 2LLZA 2D1CA 5HROA 3BR9A 2JRSA 4I50E 3WHIA 3W3SA 1E6YA 2HYIB 1W2IA 2LOPA 1B0TA 3UU5A 2DGVA 2WONB 4J9RA 3ZYLA 1TTHB 1RWOB 2VIHA 4GVLA 5CJ5A 3GWCA 2X9HA 4X4PA 3ENWA 4BS2A 4FYVB 1WF2A 4JV0A 3GSIA 4OHXA 1ZM9A 3B5MA 1KNZA 2J6UA 1OQ3A 1UFKA 1Y64B 3LUYA 3NAIA 2KXNB 3I0SA 2E5VA 4X84A 2IRUA 2ALYB 2GAHC 4J9KA 2E29A 3O1JA 1XR6A 3BQ2A 3G6VA 3V6KA 5L1IA 2CQCA 3HHNB 2MZRA 2MAWA 2XI3A 1E6VB 4ZPWR 5L1LA 2DD8S 3QGIA 2CPFA 3D6MB 3UN5A 2B0GA 3TZWA 1R6YA 4J9LA 3GWHA 1SA0E 1M5KC 2M52A 3FKBA 4QH1A 3GYNA 3ZZUA 5JDGA 2VKDA 3D0IE 3D1QA 1HYSA 3WAKA 2UZAA 2HNZB 4M5NA 2Z6EA 2QSFA 4P52A 1WHYA 2RNEA 5F8NA 1YQ3A 3HZEA 3IBFB 1HNWT 2CQ2A 3RIUC 3OUYB 1SV5A 2R8GA 3PUAA 4P72A 3PRVA 2YKNB 4EAHA 5LMUT 4IIJE 1QVFR 3AAWB 2GIQA 3H40A 4JI2J 2AWZA 2RHSB 3GG0A 2MKKA 2E44A 2VPZB 3HHLC 4I0WA 3KMSA 1K0VA 3H98A 3J9X1 3FZ2A 2WAUA 4QWBA 2AQ4A 3KK2B 1WNEA 1EETB 4ETZA 5L4HA 1PGZA 3C3LA 1ELOA 2CQDA 3AXJB 4PWDB 4DR5J 3OBVE 1IJFB 1KNPA 4ZPDA 4LFAT 4CO3A 1NPPA 4OV6A 3IAM9 5C24B 4UW2A 4MJKA 3N9OA 3CIZA 4YFSA 3LGNA 4AL6A 4HH1A 3OVSA 3S6EA 2AW0A 4ZVPB 2Q9QA 1VFJA 1X5TA 4K4YA 2EFQA 1FRXA 2BOAA 3A4TA 3FEXB 2ZKTA 4QX8B 5FXZA 4BC9A 1MG7A 2ZITA 3M2UA 4DLGA 3GV5B 3RYFE 2GMLA 4MIBA 3CDUA 4F26A 3UULA 4DR1J 2ROGA 4QYRA 5EX0A 1APSA 3MECA 2WP9A 4QR2A 3L3CA 3DRSB 3IBWA 3AA7B 4KP3C 2NW9A 2JLEA 3OFEA 2OMLA 1XWMA 3ADAC 3W65A 3FHNA 2RUGA 1C4CA 3N2KE 4LF1A 2UUAF 1LOUA 2Z2MA 3UDEA 5KFUA 4CI2B 2QT7A 1R43A 4A56A 3BEGB 3G82B 2H7VC 4WU3A 4UTGA 4KIAA 2BQRA 4ICLB 3CJQA 1U47A 4CLYA 2UUCJ 4HT5A 3T1AA 2DH7A 1GMVA 4USUA 3H2VE 4QU6A 2JIWA 4U67Q 4K5RA 3MEDA 1LFWA 4ANDA 1CJKB 3HZGA 3I31A 2CXLA 4ANJA 3CJ5A 2Y8DA 1NRKA 2DNGA 1VC5A 3OTEA 1XR7A 1A7GE 2UUCF 2QX0A 3JQKA 3ZCIA 3GE9A 2QO3A 2WDVA 1GTEA 3UVJA 3CIMA 2HHTA 5HXSA 4DPXA 2VC0A 3BQKA 3G71S 4MALA 2LXFA 3DI6B 1C0TB 2HWIA 2IM1A 1NKCA 1SL1A 2E7VA 5L1JA 3LQVA 4JUZA 1NJWA 4U7IA 1HFAA 2ACXA 5L38A 1U0HB 3QT8A 2J5AA 2W2QP 2KFNA 1VQ5S 1EETA 3DM2B 1IR0A 1MN7A 2YNGB 5FLXU 2XMVA 3GN5A 5L2LA 5DG8A 2GVDA 1JNRB 1UPMB 2KJVA 3QWUA 3RKOA 1IQTA 4JV2A 1IKXB 3Q86A 2CQ1A 1VRQC 5B0CA 4GKJJ 1F6TA 2HQ3A 4M5GA 3U1MA 4KGMA 2WMNA 3ZZRA 4DUZF 2C3MA 4C0HA 4N56A 1S1UB 5AQQB 3NLCA 1WC6A 1M5HA 2HWTA 4UY8T 2HBYB 3MMAA 1PO6A 2IDLA 2HBZB 3LWMA 2EXUA 3GFYA 4OIXA 3RYCE 1IN0A 3MPUB 3CF5Q 3Q89A 2IJNA 2YWHA 2V2QA 4R0EA 1SI9A 4DPYA 4YHHF 2BE2A 1Q5YA 4BDPA 1NK9A 4DR6T 3AEGA 2H4YB 4KO0B 3NS5A 2IC3A 4UOGA 2EHOC 2I1RA 3C50A 5ETNA 2QA7A 4A8XA 4Q2MA 2FBWA 2BRKA 1SB6A 4WXWA 3FXDB 4WYVA 1R8BA 2CM0A 1RHKB 2XSFA 2V8PA 2NP9A 4FJOA 2F8MA 3GR1A 3RZAA 1FKAF 3AE9A 4CO2A 5HBMB 1UJ4A 1LW2A 3DHWC 2M7SA 1S0VA 1UZDA 4ZN1A 3M9NB 3M30B 2CQBA 4K7QA 2E1RA 5BR8T 3GV7B 1T05A 4DU7A 5DJQC 1I94T 3LGMA 4A8OA 2XTLA 5F3TA 4IGUA 3PYGA 3IP0A 3Q2SC 4FF2A 2VBYA 4IT4A 4ECUA 2CNLB 3K8VA 4HT7A 1BMQB 3FSIA 2DYAA 4QBUA 2Z2YB 2JNJA 2C2RA 1SJRA 4X1YE 4G63A 3BKTA 2FTRA 1NENA 2ZBRA 2HPUA 3KLHB 1RKIA 1CJKA 2ATLA 2C5KT 3AE8A 4O4GA 4LF8T 2AYEA 4ZCIA 3R6GB 1KD1T 1CLFA 3NMAA 2M5YA 3RLFF 4DV4F 2KMFA 1T9UA 5JXSA 3OJUA 4M8LA 2XCPA 1S99A 4FKYA 1N33J 1TQLA 2ILYA 2I59A 2D9DA 4S0MA 2XAGB 2B9XA 3VAHA 1JXEA 2LXIA 3RBXA 2X67A 4L73A 2PJQA 2NXEA 1NK4A 4EMDA 2J6TA 4XDDA 2R7OA 1YKWA 3MUVP 4ZLJA 4WBFA 2VQFJ 3BSCA 1PBUA 2XMKA 4FP9A 1NB7A 3TO8A 2HMIB 2EC0A 4HWDA 1QTMA 4CIOA 2JEJA 3QT5A 1FDNA 5HEUA 1Q8LA 4IFVA 4L5GA 2DB1A 3PTRB 2PO4A 4FVCA 4RR5A 4C11B 1G2EA 2J9DE 2BACA 5J2NB 4ILRA 4DN0A 5KFVA 3NWRA 4WFYA 1ZAWA 2E1AA 4DX8H 1FMVA 2FHMA 4O8SA 4UZBA 5THWA 1A6LA 3IBCB 1B7TA 3TJAA 4JB8B 3HKCE 3B54A 2KLQA 2R2SA 3J7A1 3LFMA 3QC9A 3W63A 3HVTB 3EI0A 2LEHA 5RUBA 4ECWA 4ED1A 3QSYB 3UNGC 3F57A 1S1UA 1RT6A 2VDIA 4ED7A 1N36J 1LW2B 4AIUA 5J1GA 2A9UA 1RTJA 2XQ7A 2K1RA 2NPFA 3VHQA 1IR2A 3FRZA 2LSYA 2KDOA 4A4JA 4I55E 3KMQA 3GMGA 3KWMA 4TNVA 5CCLA 4JI1T 1DFDA 3B4DA 2BOPA 2O67A 3ESLA 2MJUA 3T1HF 3R97A 4WU2A 3QT7A 3KUHA 1ZH5A 1HL6A 2QL7B 1NDCA 1JWWA 2E8IA 3V81A 5CGMA 5AXKA 3K3OA 1S77D 3PRBA 5LJ5Y 1DTTA 3MCOA 3RIUA 1Y5IB 3JSYA 1PIEA 2ASYA 2JOQA 1GQEA 4TX5A 3A3OB 1T72A 2X3GA 3E8OA 3TVYA 1RAHB 1QSDA 5CCMA 2MKCA 3TX8A 4QWCA 5DZ6A 5LB7B 3AE1A 1HQEA 2FDNA 2ZC3A 4KHMA 3VAJA 2H4WB 4DV3F 5E3PA 4H9OC 2DHAA 2XUEA 2W62A 2NQPA 2UUTA 2YNFB 4DL6A 3AAAB 4DV5T 1M5OC 1PBAA 2ZHAA 1JLBA 1SHZC 3HA4A 1Y4ZB 2B5JA 4O44B 4IOBA 2C22A 3TWZA 1JNRA 4HWHA 4GO5X 2XO6A 2OP5A 1JLEA 1EB0A 1SH2A 1R7IA 1ZOTA 1NHVA 2HNYA 3IM9A 1T9XA 2WOMA 2V63A 4ZZCA 1ZPWX 3QIDA 4ES1A 2WDRA 3UDCA 2B4UA 3KXDA 1K47A 3VZIA 4CT8A 3KJFB 4EO6A 1NZ8A 2MSTA 4TY8B 1HWIA 1XC9A 3OTOT 4C2MA 3GIMA 1YLXA 1L3VA 1G73A 4PG4A 2AZ1A 5K8OA 7AT1B 2WCXA 1REGX 2W2UA 5D3GB 1AJ3A 1GT8A 2YNGA 1C1BB 3BQLA 1RTIB 3UQ7A 1MIWA 1J5ET 4DR3T 1FIOA 2E7WA 4ZP9A 1N36T 2JQHA 2PGCA 5D4NA 2HZCA 2NUHA 1VCTA 2YWKA 3OR2A 1Q82T 2KI2A 3ILJA 4LFAF 4N77A 3IS9B 4DV2F 1M0SA 3I9V9 2DH8A 2CADA 1KLMB 3DLEA 2VQEJ 5HWYA 4ZK7M 3QUJA 4DR5T 1MIYA 2E9TA 3HKEE 5K20B 3C6UA 3UCZP 1GTHA 1BY9A 1WOSA 2XMTA 4QWAA 4LFBF 4LF6J 1OJ4A 3P4PA 2DCUB 2L08A 5FDLA 4GC6A 2XY6A 2RF2B 2FGCA 5HVFA 5F9LA 3CTRA 3W9JA 3A3NB 3W2WA 4NOHA 1RHJB 2CBJA 3W5ZA 1UCNA 1ZPVA 2CLYB 1F9HA 1NLKL 3UFGA 2HWHA 1TUWA 2OPPB 4ZVEA 1SCJB 2V2VA 1DAXA 5DM7Q 4UVBB 2L9WA 3TAMB 4EYYR 3DYAB 1LWCB 1NAFA 4KRWA 1FJGJ 3I82A 5DRKA 1E6VA 3RU0A 1R3NA 1WFDA 4ED3A 4DR2F 3DDIA 3V4IB 1N33T 5JQGE 2OSRA 2MY8A 2DL1A 2UXDJ 4U72A 5KFGA 2MZSA 4U95A 4DR7F 3A1YG 2PEHA 3BO3A 1MMNA 3UI3A 4ES3A 2A3DA 3RKGA 1IKVB 3S7RA 3KG4A 1WKLA 3TJ9A 1VHFA 5J2MA 1JJ4A 3SOLA 3IA3A 1X4FA 5JDHA 2J4GA 1CC8A 3CCES 3OTOJ 5CD4A 2X9YA 3LP2A 4HL9A 2DKOB 1S9FA 3GYGA 2WOMB 4FXVA 4OX8A 1NSAA 4ZPCA 4KH1B 1ITPA 2NXNA 2BG9B 2FVPA 3LP2B 5HJYA 1J5EJ 4A8FA 2BS3A 4K4TA 3RRKA 5G4DA 2ZD1B 4DV5F 3BYRA 4IO9Q 1VJWA 2AX1A 1TL1B 3GIRA 4ADZA 3D6FB 4YY3T 4DPTA 2EHOD 2HKEA 2JHEA 4A97A 2YX7A 4QXHB 2M9KA 4IRKA 4A5XA 2HHQA 3TRGA 2V7IA 2LEBA 5KG2A 4G2AA 1VRTB 2BJDA 4NLPA 4JI2T 1KEKA 4K4WA 2IHR1 1Y0HA 5EDWA 2VFUA 5KT3A 2ASLA 3TI0A 3H3MA 2HGLA 3QGPA 1RLCL 1HBUB 1O5JA 1WEYA 3KHGA 5D4PA 2W2PP 4PYDA 2UVUA 3AVRA 3R6NA 4Z7YA 1IBKT 5ADZA 4F8HA 2LVWA 3RAXA 2BRLA 2OLWA 2HHSA 1HWKA 3HX9A 5FY7A 1S72S 2DHRA 1WTFA 3L7OA 1T3NA 1BD6A 5EK2A 2AYBA 3QATA 2X0LB 2XY7A 4B3SF 1YJVA 5CABA 4ZJOA 2Z4PA 4PJJA 1F5BA 1T9YA 1N4LA 3OHBA 2ZWOA 2WONA 3G4SS 1MROA 4E0DA 3CDWA 4OYMA 4NE9C 2HFVA 2EFGA 3NRXA 3TUJC 4Z7CA 4RW9A 1IKYA 2FVQA 1FA0A 2W8KA 2CPJA 4DR7J 5DDPC 2W25A 4WP9A 3F73A 3GU0A 1S6QA 4DCOB 4JI6T 1GMWA 2ZJPQ 3V5UA 3MM8B 4ID5A 2AGQA 1V5IB 3RBZA 4CNZA 4ZHRB 1KRPA 4LF9F 3HFZB 4TLRA 1SIWB 1LWEA 3M9MB 1RT3B 3AXKA 2AD9A 4FS1A 1V6HA 2RS8A 4H63H 2NS1B 1UURA 1HX8A 1M1KT 2G13A 4P7VA 4YB5A 1SV5B 3BH7B 1A9NB 3K17A 1P27B 4V19J 5C2GA 4KHPF 2DNHA 4ZDNA 4ILMA 4PG5A 3PUXF 4N78D 3UUBA 3ZNJ1 3DCAA 3HSGA 1FWPA 2W9CB 4TUYE 4PG7A 1HPZA 3VAKA 1TV6B 4IDKB 3ZT6A 1NHKL 4KFBB 2GCFA 1X60A 4CRJA 2GC8A 2OKQA 3PUQA 2OH2A 3NKYA 2X66A 1HW9A 1GXLA 4HHJA 3NCPA 5KFMA 1TFYA 3CDBA 4O0IA 3VR8A 1HQEB 3EAMA 4DR1T 2HPJA 2D3UA 4IRDA 4CLZA 2D3ZA 3EX7B 4Y00A 3BGLA 2X0YA 3AE6A 4HFVA 5FMNA 5E3AA 4LF5F 4KHZF 4JOUA 1Z2ZA 4YLHA 1S0NA 4NUVA 1FWLA 1RT6B 4DDFA 1U1NA 1RYRA 3VAIA 3R5AA 1SL0A 4DMWA 1RT5A 2MQ8A 3DLKB 2YNIB 4H4OA 1HBOB 1LV5A 1ZA1B 1YGYA 4DUYF 3D6TB 2RSQA 3AJDA 3OPKA 5ITHA 4FS2A 1O3XA 5KXJA 4ZP7A 2XLIA 1HX1B 5F3JA 1UVJA 2NTYA 1M1HA 4LIWA 1IKWA 3N9PA 2VF3A 2WS3A 1N48A 4IHJE 3G8SA 2FZKB 4C8KA 4P2FA 3POTA 4EWTA 3HKZD 1IKWB 1IAPA 4ED5A 3V81B 3EXYA 1SJ1A 4AQFA 4LBIA 4PJNA 4NPOA 4DUZT 2HQGA 3IA0A 1SBRA 3KK3A 2CPYA 2N1GA 2VFTA 2QYGA 4CLTA 3UUXB 2W7PA 3TA0A 3I0SB 4KMCA 1XEZA 2IIHA 5D0EA 3EPIA 2JFKA 3HVWA 2WK4A 1XDOA 1EZ3A 3ILLA 1QDUB 1D1UA 3G6XA 2PFFB 3MCNA 2B6AA 3VTIA 5I3UA 1U2CA 5M2PA 2DVIA 2OD4A 3RAMA 4MFRA 2C3PA 1QUPA 2MQNA 1AUDA 2LKGA 3G06A 1FVSA 3BB5A 1D8ZA 4C11A 4B9VA 3M65A 1JKHA 2GVDB 1JLGB 3FK4A 1CBKA 2AT1B 4GKJT 1WI8A 1C1BA 3MTJA 1X4BA 3GR0A 1R27B 3PRDA 2F40A 5HQMA 3AJ2A 4DQQA 5HXCA 3ZTSA 3ZZ0A 1FJ7A 2OTJS 3MM5B 2LSKA 2V6AA 3FBEA 2MKIA 3LH2S 4B3MF 4C97A 2GGPA 2A18A 4JP8A 4DIDB 3BQ0A 1Y7PA 1H6KX 1VHIA 3EYZA 3NOCA 3ONLC 2MSSA 1VQ4S 4ETXA 3ZTRA 2QRRA 4ELVA 3G8TA 4NYZA 5DJBA 2WWVA 5GADI 1OYDA 3UO0A 5HI7A 4F04B 2CQ3A 4WXOA 4CM0A 2VB6A 2N7CA 4X5TA 4ZHRA 3C14B 5A8KB 3KJVB 2G2ZA 1NJXA 2K3IA 2H5EA 4DUYJ 2ZBIA 1T03A 2CXDA 3H8YA 4JV1A 2LSJA 5A8KA 2WM9A 2ZHBA 1AB8A 2WVDA 2XYPB 3D67A 3QWPA 3DRRA 3ZN1B 2MHEA 2YEVC 2F8EX 2OPSA 2NXCA 2RH3A 2GGPB 3K57A 4DJBA 4MTPA 1IBKJ 3MCSA 2AYGA 4ZP6A 5ABHA 4WKYA 3GLJA 4CXXA 4Z37A 2LSIA 2D0TA 5JR9B 1RT1B 5KFNA 1B70B 4DQPA 2J7WA 4XAKA 3PM9A 2VFSA 1XMOT 1LXNA 1LWFB 1YRTA 3M1VA 4R5PB 4U7UK 1HNVA 3MF5A 1UJ6A 4AQGA 3CO0P 2E9RX 3PUVF 1N36F 5D4LA 2IUBA 4B9MA 3KG0A 1ZM2A 3AHPA 3OD2A 1RWPB 3LP1A 4NA3A 2ZH9A 4NLQA 2GFFA 2X3DA 2DNOA 2LU2A 2H51B 4LR9A 4ZVGA 2BKPA 1NB2A 3NGKA 3K5MA 3I5AA 3F41A 3CC4S 4IDPA 1EX8A 3KLEA 1FNOA 2C2NA 4GKKF 1TL1A 4FXWA 3T1YT 3Q5XA 1N5QA 4YB1P 1SVDA 2QRXA 3MPDA 3ZYKA 2XHEB 3OUYA 1FRLA 1BR4A 1NHUA 1I3OB 2K8GA 4EXTA 2DR7A 3M32A 4UT4A 3RYIE 2ZDOA 2V2KA 2CMRA 4PYAA 4HWCA 4YTNA 4NLOA 2XSAA 5DDRC 2PIIA 1ZV4X 3UD3P 1H3DA 2YVSA 5K8MA 4TV9E 2ZM2A 2QGFB 2BEFA 4OLPA 3CKDA 2HQFA 2E5LF 3EMTA 1YKHB 3ILIA 2L9QA 4CZCA 3MTKA 3RW7A 1N5YA 3T1HT 4ZLPA 4OHZA 2VH7A 1DRZA 5CYMB 2OIHA 4N47A 3C6TA 3PX6A 4YR0A 3R5BA 2CPIA 4ISSA 2KVIA 4NPPA 3GCWP 1N6QA 4LF4J 4ZN3A 1SKWA 1WUUA 5IHYA 2C42A 2V8DA 2BA9A 1IBMT 3I5CA 1DARA 3NGDA 5BYQA 4DV3T 1F2HA 3VGTA 3FZHB 4DBQA 1WHXA 4QH4A 3CULA 2R8IA 2HHHF 5FDLB 2CPXA 4ZA1A 4HFCA 2DIVA 3NRBA 2HFUA 5JUMA 4K4UA 3K3NA 1KQFB 5H9EJ 3HT0A 4ID5B 1Q8KA 3SSRA 1RWXB 4DS4A 4M5DB 3A8IA 2CWKA 8AT1B 1HQUB 2EG1A 5HYAA 4QU7A 2JRKA 3KJVA 3TUIC 4LFCJ 2IA0A 1W09A 3C14A 1IWAA 4DS5A 1CJTA 4WPAA 3QOFA 2W66A 2FVSA 4GVBB 3L95X 1T7SA 2PMZD 4X65J 1FDBA 3EZOA 4HR2A 4Q8EA 3W60A 4C8YA 2OLTA 4LF5J 4TNOA 1QAYA 1H2TZ 1OEDA 3S4UA 2BZBA 4PW8A 2H7OA 5CFBA 2VD3A 2Z56B 3D0TA 4ZI7E 1CUNA 1PYTA 2HS0A 2XC9A 1Z1ZA 5KFSA 3UTKA 1RCXB 2ZH3A 2WQYA 3CJTA 1ZOYA 5E3CA 4H9SE 3EGVA 1S59A 3N9NA 4B3TF 5IT9U 1BR1A 4LF8J 2ZM6J 3E51A 4FF3A 1IR1A 2RE1A 2EVZA 2CZVC 2KZZA 3TJ8A 2H65B 1XBWA 1TL5A 1XNRF 4TWHA 4LUBA 5FY0A 2IVMA 4P2SA 2C28A 1J1JA 1YJNS 2ACYA 5HBMA 1K44A 4HFBA 2SXLA 4ED8A 4U96A 2XQ4A 1F3FA 3I32A 5E3QA 4NLSA 4PXCA 4QYZK 2N3LA 1US7B 4EV6A 3BM7A 3FQLA 4Y28C 1X0FA 3N9UC 2UUWA 4KH0B 2Y1IA 4RUBA 3LJCA 4HKAA 1I51B 3WC2A 1E2AA 2V6YB 1FNXH 2ZZMA 2YNHA 2UU9J 4P2XA 4JV5T 2Y8WA 2BQUA 4J7CA 2BANB 4C3KA 2OD6A 1SQFA 3NRYA 5J2MB 1OWAA 3WX8A 3D0HE 4NZ7A 1B7FA 5H1SV 3ONQA 3H5XA 5F3ZA 4DF8A 4ASKA 5J0ZA 3N79A 4PWUA 3CJ0A 3IR5B 2MZTA 3CUNA 3PE0A 2PTFA 3CK6A 2YNFA 3MEGA 4EI2A 5HATA 3GFHA 4B3OB 3JB9k 2XM1A 1BQNA 1GNKA 2WHOA 5IM0B 1H7XA 4DV6J 1RQ0A 2O66A 1S6QB 5HP1A 5JJBA 5KFYA 3CX7B 3OJSA 4Z8XA 3P50A 4NMXA 2DGWA 4BA9A 1U26A 1DTTB 2M6BA 2ZH4A 1Y3JA 4J9SA 5J2PA 3IRXB 2A10A 3IGVA 4L74A 1WHVA 3J81Y 1U48A 1FEWA 4KGZB 5A2QU 1VC6A 4K4ZA 1XK8A 5KG7A 1CS4A 2ODVA 3ANWB 3KLGA 3HXMA 5IWAF 4EZHA 4EBEA 4EIWA 1GX5A 2ZE2A 2W4DA 3RRCA 1ZM4A 3K5OA 5HAOA 4C3LA 3U78A 2N4DA 4K0KF 2H54B 2BMBA 4QWDA 1UUSA 5KTQA 2LCWA 1S1TB 3J7ZT 3O8WA 4MK9A 1RT3A 1FFSB 1KFDA 1EKSA 1CJTB 2A1BA 1RKJA 2BBJA 2J6SA 2Z2LA 3M4XA 3R5CA 4H4KC 4G6VB 2LSGA 5EHHA 2GMJA 2V9KA 2KT2A 4FYXB 1HI8A 1HR0T 2UUBJ 4AKRB 5JRCB 2CWOA 3G8QA 2G2OA 5CA5A 3OTBA 4P7TA 2AV5A 1TKTA 5HEJA 4UOCA 3CJ8A 2WB5A 3C16A 3Q24A 1NXIA 1PJ6A 5F0UA 4L0RA 4GKKJ 4YTMA 1DLOB 3F56A 2D7SA 3MI7X 4DSIA 4LF2A 2V4RA 4CYUA 4N76A 5HMXA 2Z0GA 2XS7A 2KL8A 3MMBA 4YMEA 2QA4G 1RAOA 2DEJA 3M2RA 4ZXLA 4UELA 4QIGA 3SDEA 3ZSTA 2BG9C 2YKPA 2UVWA 2HNZA 4DR3F 5GAGU 3H2LA 4MIAA 3Q83A 5LXYA 4I64A 2LHNA 4DL5A 2GNKA 2VK9A 1Q0NA 4Q0BA 5SZTA 3HD2A 1OMSA 1FD2A 4CH7A 4ECXA 2CIMA 3WX4A 5FD1A 4TN7B 5C25B 2MZ1A 1S6PB 1RDRA 1U1RA 5EN1A 4DV2J 2CFXA 4TWFA 4F25A 3EJMA 1G4CA 1TUGB 4AQYJ 3RUBL 1OWXA 2CPDA 3KLIB 2BM0A 3ZZYA 3PX0A 2W4XA 3K58A 4LFBT 1TAQA 4CLKA 3PJAA 5JVGQ 4URSA 3FZKB 2CCQA 3ZO7A 2QE5A 4CN6A 4AD6A 3FMBA 3BQIA 2ERRA 5ETSA 1RT7B 3AAIA 4BLGA 2IBKA 5DDOC 5AQUB 3ENQA 2BW2A 5KT2A 2EKNA 3UQSA 3CJ3A 4LSLA 5LP6E 3ZZPA 1GEHA 4YXDA 2B3TB 2MPUA 3K0JA 4LF7F 2W2NP 2IC3B 2VFVA 3D66A 2VL0A 4DOZA 2BM1A 2NREA 3PVXA 5HVGA 1ZEEA 2ZVIA 1B4SA 1XQIA 4FN5A 1Z4UA 1KP6A 2Q79A 3BBCA 3EZ5A 1S97A 1BQMB 2GHPA 1UFWA 4B3MJ 4JI1F 3UFCX 5IT4A 5HXEA 1U1KA 1T8BA 4OHWA 3HL6A 3KHLA 2QMWA 1RTDB 4DG1B 3T41A 4NEYA 4GIWA 3JSMB 1X9BA 2CXFA 4DR6J 2KKHA 3N28A 1RABB 2VASA 1IBLJ 2DK2A 4KBIA 3DMJB 1RWKB 3W9HA 4KUMB 2OFHX 4HACB 2HLTA 4UF0B 4ED2A 4ER8A 3IS9A 2EG2A 1WDTA 2JDJA 5K14B 2B43A 4CWBA 3CEDA 4I43B 1IZNB 3OSPA 1PYSB 3Q8RB 1XZYA 5L9XA 5EK3A 4GYRA 1M5PC 2IC6A 4LRFA 1KVKA 1HMVB 4E98A 2RRBA 3D4JA 4YB6A 3OSNA 4HFIA 4ECSA 2BDEA 4DV1T 2ZH7A 2XSBA 3BO4A 1AW0A 1J2VA 2YTCA 3KDOA 2QV6A 2MPKA 2DNZA 1KN6A 4WBNE 1HBMB 2FZCB 2CJAA 2YH1A 1Q8BA 3DC2A 4A8KA 3MMJA 1CJUB 1TL7B 1HBOA 3R2DJ 3GSDA 2E5LT 3RYLA 2HMIA 5JR9A 4YN3B 4WZMA 4X62T 1XNQJ 4JBWF 3PFEA 3UW1A 1WC1A 1YSJA 4GKJF 1T03B 3WIVA 4ZS2A 1R31A 5CYJA 1XR5A 3CNQP 3MPYA 4JYAJ 2E9XB 3FBLA 1NO8A 2X1FA 2WMOA 3OXLA 3QZ7A 2V8GA 3TZXA 2XMUA 1UK5A 4B9NA 4OK0A 3SEOA 5J2QB 3NG8A 4OZ3A 4XDCA 1KLNA 2B76A 3DXSX 1U7LA 2RPAA 1GXUA 3CJKB 1KWMA 3BPDA 2VA3A 4WFBQ 4ZVHA 4HLBA 4Q7AA 4E7ZA 4X4NA 3FBFA 4KX6A 1U4BA 4YSZA 2VC1A 3UN2A 1F3VA 2YWEA 2EWHA 4O0NA 2NTXA 4JI6J 4LSZB 3GJTB 4MBQA 5JMNA 3QRPA 2AGOA 2V7JA 1C0UA 2YWGA 1HD0A 4LSNB 4DL2A 2KVQE 1RE1B 3SMZA 4HVZA 4K2JA 2NZCA 2L48A 4P71A 5HVHA 3ZT7A 3POTB 1RUSA 1BQMA 3IEEA 4ZPBA 1VLYA 3CWJA 1BC6A 2F1FA 3O44A 2M2BA 5IUXA 4FF4A 2LHRA 3T9NA 3RJMB 2AJ2A 2EFNA 2CWXA 2CXEA 4ZIWA 3HMJG 1W9RA 2KU7A 1WG1A 1YHQS 3I0RB 5EX3A 1T05B 4RNMA 4IREA 4IG0B 3ZMUB 2Y1LB 4X65T 1Y5NB 1OO0B 5KFFA 2LJLA 3MECB 1YZ6A 2LECA 1UP1A 3I6PA 2YWFA 5FYMA 4RBVA 4MKVA 2B9EA 5KFQA 3D54A 2ZZNA 3K7RA 2NXJA 3MZKB 3FBBA 4AYBD 4I67A 3PDYA 4H9RC 5AQPB 3MDFA 2E5LJ 3SV3A 4P74A 3TUPA 4ZPTR 2R9LA 1X4GA 5GAEI 3VF0B 1BQXA 1YDLA 4DV7T 1B99A 1ZAVA 4QYZJ 4DR4F 3EGZA 5JDFA 2JQQA 3FZBA 4WE1B 3RH3A 1PC4A 5HLFA 2K1RB 4O3RA 2BW7A 2KM8C 2VDHA 1HA1A 3M8WA 4USWA 4ZMMA 4A8WA 5DGBA 4OZ5A 3O5TB 4ZPAA 1MLAA 5FJ4A 2DHHA 3TNVA 1K8AT 3KTQA 4YR2A 5G0RA 4QW9A 3DJBA 4GK5E 4KV8B 4OYJA 3DM2A 5LOQA 5A76A 1U0HA 2HVDA 2YX4A 3ZEFB 2WZHA 1OQ6A 5M2RA 3EGNA 1S35A 5KFBA 2EK1A 2XAJB 4PK6A 3RC3A 2VL1A 3PKMA 4JV5F 1RZMA 4CXYA 2JJ9A 1PSDA 1OXZA 2XI2A 4R5PA 4PRFA 2HBQB 1UL3A 4HTEA 1DQ9A 2MLYA 3Q9DA 3IFEA 3JC6D 1ZAXA 5FVLA 3DOKB 5HEHA 1MMGA 3CX6B 1YRXA 2XZEA 1NCLA 1NH7A 1TL7A 3PV0F 1LW0B 4N41A 2XNRA 3DI6A 2XB2D 4CI1B 1XNQF 3FXEB 2CWYA 1AT1B 4ZS6A 4U3CA 1AYEA 2QZ8A 3AEDA 3FFIB 3ILOA 4ELUA 2HQDA 1UVLA 5J1NA 4Y0FA 2IY5B 2G0UA 2V4JA 1U1MA 3P6YC 2DNLA 2MB0B 3L09A 4EYUA 1WEXA 3B57A 1V9OA 2ZJRQ 3QO9A 3OV7A 1IJ6A 4X66J 5DETA 3MXHP 2FHKA 2RU3A 3M6WA 5J2QA 4AFFA 1E1HB 3UU8A 5AQLB 1Z8UA 3Q8QB 3R5DA 3NCRA 5CQGA 4V1Ak 4CLWA 5C24A 1ZTTA 1NPRA 2D74B 4DQRA 1JLFB 2VODA 3CC7S 3H37A 2UXBJ 3ISNC 4QX7B 2X1AA 1TK5A 1I6ZA 4Y2MA 3S8SA 2W24A 2CLYC 1X9WA 1U5PA 3DOMB 3QLHA 5GADU 2DR5A 4JI6F 3VCDA 1JLCA 5FLXY 1SPBP 4RW7B 3M2VB 5LJMA 2JPFA 3M9OB 4UQGA 1XNRT 2NPIA 4CYUB 4QXBB 4K0UA 2DHXA 1S57A 4NI2B 2RRNA 3VALA 4USTA 3ZZTA 1TMJA 1R0AA 2K24A 4C91A 5LHHB 3BV8A 3IHRA 1XMQT 2HVHA 1B7YB 5GAEU 1N5TA 4YOEA 2LQ5A 4X62J 3W62A 4DPUA 4X64J 2C3YA 5C7PA 3AXJA 4XAXB 4WP8A 1R8HA 2LXUA 1KF6A 3G6YA 4Y2CA 4AUKA 5DQWA 5L3BB 5E7OB 4GO7X 1UEKA 5LHIB 3MEEA 3PO5A 2H5IB 4JYAT 1HBNB 4OZ0A 1HHSA 2O1PA 4PKDB 4YFUA 2W2OP 2BBHA 2MQQA 3B78A 2DR6A 2A0FB 3L7PA 1FKPB 1D1AA 4K2XA 4OYKA 2CDRB 1EHWA 1RTIA 4X2BA 5B0FA 5MAOA 4HI2A 3QIPB 1X4EA 3OFHA 4FBTA 4U8VA 2XCAA 5IM0A 4MYUA 3DLGA 1F60B 3MACA 3QIPA 4IFYB 5FVKA 1N8RT 4DSEA 3FDSA 3UPFA 2FJWA 2YU2A 3MAAB 1U1OA 1QJHA 3AFGA 5D0RA 3PIOQ 5IXUA 5F8GA 3HCXA 5JVDE 1E6YB 2V6YA 3NWIA 4OYOA 1W0BA 3US5A 3PJAJ 2HNYB 3THTA 1EJ7L 2CYYA 1YJ9S 4DR5F 2G9OA 4O23A 3P45B 3JTPA 3ISZA 1BQNB 4N8OA 3RG6A 2C2DA 4IE4A 2LQBA 5LL6d 4B9UA 4X4VA 5E3RA 3N01A 3PW2A 3PX4A 1IBLF 1FKPA 2D9PA 2L3LA 2W63A 2XGPA 3RBEA 3SCIE 4K8RA 2P8IA 3NNCA 4N7TA 1YTYA 2DY1A 2NWBA 2VPYB 2DNPA 1HYSB 3LANA 2F7VA 5I3PA 3BKFA 3ETMA 3T8OA 4HI1A 3NNAA 5HEOA 1TP7A 5HLFB 2WWUA 3GMIA 1X31C 4CLLA 1U49A 2KT3A 4H4MA 1M5VC 3QAEA 1UAWA 3Q5DA 2K5BB 3L4BC 2ZH5A 3P4UB 2RF2A 1VBYA 2IVYA 3BGRA 1R0CB 2CEAA 3IWXA 2MQPA 2XYHB 4O2AE 5U47A 3UFEA 3PCOB 2JVOA 1RSCA 1ZZNA 4OI3A 4DV7J 5JDQA 1GK8A 3B13A 1DTQA 2K7JA 1U0SA 4FBUA 2RVJA 3OVBA 3NGTA 5BMVE 2ASJA 2ZEJA 4W4MA 3C15A 3ZJ1A 3C46A 2QGSA 1Y00A 4O4IE 1JX4A 4DSJA 3VQTA 4K59A 1J27A 2OEMA 2B56A 3OR1B 2DXDA 2QG9B 2V2ZA 2P5VA 2LE8A 1F9EB 3AEEA 2P9GA 3FCWA 4NLTA 3ZPOA 3CC2S 1HNXT 3M6XA 4KHPJ 1N32T 1VR6A 2N7YA 3I56S 5B7WA 5CYQA 1FJGT 2UUBT 2NYIA 3KHRA 1UFLA 2FC9A 2DCFA 1HFEL 4AKLA 1X4DA 1UTAA 1H74A 3VR1A 3THVA 5KFIA 3NCQA 2HFNA 2WVEA 3J7Yq 4HE8A 4X64F 5A8WB 4J9UE 1YITS 3V2UC 4UF4A 2W9AA 4F8RA 3G86A 3QB5K 4QIEA 2C3OA 4UIGA 3D9BA 4NMLA 3BN7A 2YKOA 1FERA 4RW8B 3V5SA 1N52B 4ZVQB 2OPRA 1CULA 2IC9A 5JDNA 1UA0A 5LGNB 4JI7T 2E1PA 2ZBQA 3B4MA 1WLXA 2E9XC 2I6HA 1RB0A 2FD2A 1N34F 3V6DA 2B6AB 2V94A 3D68A 3KJQB 4Z91A 3BDEA 3UDLA 5ETQA 2CQIA 2N3OA 3PHEA 2E7XA 2HK2A 1SJQA 4AL5A 4MAKA 3ZLIA 3IWNC 1IVZA 3GQCA 1W7WA 3ISND 4EYIB 2DT9A 1YJ7A 2QA4S 4BC7A 1YRUA 5L3DB 4AISA 2LDIA 4YB7A 4OX6A 3MM5A 3AOCA 3CJRA 2XS5A 3AOBA 4EK2A 1HWLA 3EUNA 3VQSA 2OELA 4M95A 4RL1A 3TEHB 3DFEA 2IMWP 3UQ4A 4MHCA 2NW7A 3DRXA 5E0OA 1BHNA 4DCJB 2MQOA 5B0AA 4CT9A 3MWBA 3JSRA 5A8RA 4ED6A 3W5XA 1B0VA 5LMNT 2BKOA 4GK0E 4HEAA 1GX6A 1WC4A 3GZ7A 5D78A 1QAXA 3EUHA 3O6QA 4DR4J 3GA8A 1OSCA 5EGYA 3EHZA 3KK3B 3B8HA 3CJKA 2MXYA 4TWDA 3CD0A 3ELHA 4CO4A 2YWWA 1SH0A 2KB2A 2W4CA 1JXLA 2IRYA 1WORA 2UUCT 1UVNA 5BXIA 1HG5A 3FZMB 2WB1D 4F0HA 3UCUP 1YBUA 4FZVA 1FE4A 2F4VT 5KT7A 1D9DA 3AVSA 4RUHA 5DABA 4M5LA 1D0YA 4LBHA 2DNQA 2KG0A 5LM7E 1H73A 3I0OA 4FKXA 2JVRA 4IG0A 4KKOB 3C4XA 1RT1A 3L7UA 1KOOA 1ULRA 1NK0A 4QPXA 1NK7A 3AA8A 1JNZB 1RHUB 4WIQA 4OMFG 3HJFA 4LBPA 5AE1A 1JLEB 3P5BP 4P9SA 3RIAA 2YQ0A 3AB4B 1KQGB 5CA1E 4PPDA 4P0BA 1NNDA 3D5MA 1NSKL 4YJ3E 5GVQA 1VGYA 3KLFB 5DM6Q 4WTOB 5M2UA 1KS2A 5L8RC 4CZZB 1NDPA 2GS8A 2F5GA 1D3WA 5K8NA 2QLJB 2CPTA 2UXXB 3PUZF 3AECA 2CQ4A 3DLJA 3KLFA 3HLUA 4X4RA 2ZKUA 3GONA 5IWAJ 3KYLA 1JIHA 4PWWA 2DR8A 4XZCA 2MOZA 3CMQA 1U02A 3NWGA 2H89A 1RT4B 2WVFA 2GQQA 5A8WA 5AQSB 2RT3A 3KOAA 2GVZA 1QUVA 1MU2A 3T3FA 1X4AA 1KKHA 1N0VC 4PJMA 1T9TA 2QLFB 4XPCA 2EHOB 2CHNA 1K1QA 2HHWA 1VLOA 2VJUA 2HEKA 4KTQA 4JI7F 4U9RA 3NGRA 3P4WA 3N5BA 3X3UA 3WBZA 3AA0B 4RW4B 2JMHA 4BHQA 1LWEB 3AQPA 5I3UB 2AZ3A 4QHOA 1TVRA 1NSPA 2DIUA 3PJ9A 1FE0A 5B09A 2FZGB 3F44A 3LO3A 4FPRA 5KFJA 3KG1A 2CQ0A 3LSVA 3NAHA 2R4FA 4CNYA 3GJSB 3D1OA 4AI6A 2MLZA 1AROP 2BJ9A 3OYZA 3MEKA 1RWUA 2UXDF 3MOJB 5KMGP 5T41A 4IKAA 3OL8A 5AQRB 4JI0T 1KBRA 5MLCV 2WSCC 1SC4B 1AZSA 3MMCB 3PYFA 5LSRA 1PG5B 4EGLA 2EKYA 5F8MA 1RXOB 2UU9F 4OZ2A 1FXRA 3OLAA 3KV5A 1FRKA 2RILA 4NIQA 1E7PA 1S12A 5L9NA 3A8JA 2XSJB 1GFWB 3BREA 2FY8A 4AQFC 1NUEA 2IA6A 4PFPA 5LGUB 3DLLQ 1JMTA 4RBUA 4YDXA 2LU1A 4ZOSA 4ERRA 2R7VA 1LQ9A 2R7RA 1IKVA 5IFMA 2KJWA 2FIUA 2C5JA 2O5DA 4WJBA 3SDEB 4NX9A 3T5HA 1RA6A 1R0BG 3FBZA 4BBYA 4EYHB 2ZOFA 3U1NA 2ILZA 2WW8A 4XO0A 3JTOA 3NBPB 5KFAA 4DVDA 1EKRA 2JEFA 2RDJA 3ITHB 2DNYA 1MNDA 3I5BA 2BS4A 5H9EK 1D0ZA 1CQNA 2FY1A 2DWKA 4U33A 4ENOA 3H7HB 3T5KA 3C16B 1NWMX 4OX9T 1VJQA 1HNZT 2F4VF 3E01B 3I4HX 2V5HG 3H59A 3LF0A 2CQPA 2V34A 5AJ3F 2DY9A 5A6WA 2K9AA 3SSSA 2I6WA 3AEAA 2KZ7B 1OEDE 2E5IA 3TVZA 1RT5B 5ETWA 3AA6B 2LEPA 2WTFA 1WD6A 1MWQA 1HPZB 3UU3A 1DQAA 3I55S 2W9CA 4O3SA 3H20A 3OFGA 3GG1A 4NI2A 4PXBA 1SUQB 2MGZA 5CXTA 4HWFA 3VVUA 1MW7A 5K5MA 4IOCQ 2AHOB 4LMZA 4ED0A 1S48A 2J1DG 5C42B 1P1TA 1SUMB 1UW9A 2D69A 3DLBA 1CULB 3Q8SB 1U2FA 2P9CA 3EVYA 3HVAA 3JCFA 4ZZBA 3CCQS 2HHHT 3D28A 3EWGA 1FNMA 4PAAA 1YQ4A 4L9IA 4FYWB 2IBOA 3BH6B 3SCLE 3MM6A 4UZCA 1UVIA 5HJXA 5FIIA 3N6NA 4W90B 3OHAA 4EZ4A 1UEUA 2EBGA 4JI3J 2CZ4A 3A12A 4DFKA 4B3TJ 3BSAA 2HW3A 1VS3A 3JAFA 1UX4A 1K73T 3KDSE 2RKIB 4I4BA 4I6YA 3OVAA 3EGWB 4CTAA 2RA1A 3IXQA 1RBAA 3SFDA 2V6XA 1UJ5A 3TZYA 4HN9A 3TVKA 2M88A 3R5JB 2J8AA 1LNQA 3EDRB 1REVB 1UCUA 3O2IA 1FX2A 2FJAB 2L9NA 3PR5B 2XWYA 2MKJA 4ECTA 1W26A 4MKAA 2AF6A 1XNRJ 1QTNB 2PSZA 1RTHA 2V4QA 2GZOA 1X5PA 4BCAA 1S7IA 1NAQA 1RACB 1B64A 1XMQJ 2R3VA 1I1GA 1OPIA 1F2GA 3NOGA 5AQFB 2DO0A 3EDVA 1BXNA 3PURA 4LF9T 4E2FB 1UKUA 4JI0F 3FSYA 1FWKA 3FBCA 3AE2A 1AA1B 1XMQF 4ITSA 3PJWA 1KONA 3AEBA 1TFWA 1HQUA 2DH9A 3I0QA 2G0IA 2IRXA 1FVQA 2KWIB 2JEGA 3PJXA 2CNKB 3GN5B 2GIFA 1DJ0A 1RWNB 3B6BA 2Q9QB 4LQ9A 2HIYA 4UVAB 4U6PA 4YJ2E 4HGAA 5D0HA 3P4QA 4HDGA 2NLWA 1VQ6S 5CH7B 1D09B 3CCLS 2CRBA 4IDKA 4DF4A 1HLWA 1VQ9S 3TAMA 1FRIA 2KYZA 1FRHA 3DDKA 1Z0PA 3BSOA 2DR9A 1EQMA 4HHHA 4KGKA 4IE5A 2UUAT 2DI4A 5CHCB 1NDKA 3DDNA 2F8HA 4ZJQA 4JI8F 2EPIA 4OJ3A 5HSPA 2OFGX 4OQJA 3O1LA 4IOAQ 2G4BA 2R42A 3QK6A 2VBWA 3VVTA 5HEGA 3HULA 1IKXA 2C2EA 4HEA9 2UXCT 3ZN0B 3MR6A 3PY8A 5JRCA 1JB0C 1VQOS 5DO2A 4LF6T 5JH7E 3ZNUA 4QZVB 2KM8B 2J76E 4DL0C 3MKDA 4TQRA 2DNXA 2GQ2A 1D9AA
chains in the Genus database with same CATH topology
2DGWA 4BA9A 1ZKEA 3CWZB 4C8NA 3Q8PB 3IAM9 5FY1A 5C24B 4RUAA 4UW2A 4MJKA 3ZZOA 3N9OA 1NJYA 1FJCA 4GYSA 1DTTB 1S1TA 1U26A 3BO2A 2ZH4A 3CIZA 4R8UA 4YFSA 2LDYA 1Y3JA 2WB4A 3Q2TC 2RQ4A 4J9SA 3IRXB 3LGNA 5J2PA 4AL6A 4DWIA 2A10A 4HH1A 3OVSA 3IGVA 1L3TA 3LBXA 2J0SD 3S6EA 2AW0A 1WHVA 2Q9QA 1VFJA 1X5TA 2WSSV 4KE5A 3DXBA 3SQGB 1FEWA 5CB4E 5DDQC 3J81Y 4K4YA 1U48A 1VC6A 2QEXS 4K4ZA 1XK8A 4QR0A 5KG7A 2BV3A 2EFQA 1X9MA 1FRXA 2ODVA 3ANWB 3FEXB 3KLGA 2BVMA 3HXMA 5IWAF 2R7QA 4F4KA 4I7FB 2ZKTA 4IUFA 4QX8B 2NZ4A 5FXZA