1KO0A

Crystal structure of a d,l-lysine complex of diaminopimelate decarboxylase
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
419
structure length
419
Chain Sequence
PHSLFSTDTDLTAENLLRLPAEFGCPVWVYDAQIIRRQIAALKQFDVVRFAQKACSNIHILRLMREQGVKVDSVSLGEIERALAAGYNPQTHPDDIVFTADVIDQATLERVSELQIPVNAGSVDMLDQLGQVSPGHRVWLRVNPGFGHGHSQKTNTGGENSKHGIWYTDLPAALDVIQRHHLQLVGIHMHIGSGVDYAHLEQVCGAMVRQVIEFGQDLQAISAGGGLSVPYQQGEEAVDTEHYYGLWNAAREQIARHLGHPVKLEIEPGRFLVAQSGVLITQVRSVKQMGSRHFVLVDAGFNDLMRPAMYGSYHHISALAADGRSLEHAPTVETVVAGPLCESGDVFTQQEGGNVETRALPEVKAGDYLVLHDTGAYGASMSSNYNSRPLLPEVLFDNGQARLIRRRQTIEELLALELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diaminopimelate decarboxylase
publication title Diaminopimelate Decarboxylase uses a Versatile Active Site for Stereospecific Decarboxylation
rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 142
structure length 419
sequence length 419
ec nomenclature ec 4.1.1.20: Diaminopimelate decarboxylase.
pdb deposition date 2001-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00278 Orn_DAP_Arg_deC Pyridoxal-dependent decarboxylase, C-terminal sheet domain
A PF02784 Orn_Arg_deC_N Pyridoxal-dependent decarboxylase, pyridoxal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.10 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 1ko0A01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 1ko0A02
3NZPA 3WQDA 1XFCA 1TWIA 2NVAA 4BHYA 1NJJA 3OO2A 3CO8A 1QU4A 4DZAA 1SZRA 2NV9A 1RCQA 3B8UA 2RJHA 2ODOA 2OO0A 5IRPA 2QGHA 3WQEA 4XG1A 3HURA 4LUSA 3N29A 3R79A 2PLJA 7ODCA 4LUSB 4PB3A 1BD0A 1W8GA 1FTXA 4LUYA 3HA1A 2DY3A 1HKWA 1KNWA 1TUFA 5BWAA 3E5PA 1VFSA 3KW3A 1L6FA 5GJPA 2PLKA 3C5QA 3B8VA 1SFTA 3E6EA 2YXXA 3LLXA 2VD8A 2ON3A 4BEQA 1B54A 3AWNA 3B8WA 3BTNA 1EPVA 4BF5A 4KBXA 5FACA 3N2BA 1D7KA 3S46A 5FAGA 1CT5A 3WQFA 2J66A 1VFHA 2TODA 3GWQA 3ANUA 4BEUA 4ECLA 4ZGYA 4XBJA 5GJMA 4AIBA 1XQLA 4A3QA 2RJGA 4WR3A 4ILSA 3CPGA 2SFPA 1L6GA 3AWOA 4QHRA 3MT1A 3VABA 4PB5A 3SY1A 1XQKA 4Y2WA 3NZQA 3N2OA 2O0TA 3ANVA 5FAJA 1VFTA 1KO0A 5GJNA 4DYJA 3WQCA 4LUTA 4PB4A 1NIUA 2VD9A 4V15A 1HKVA 3B8TA 3WQGA 4LUTB 2P3EA 4FS9A 1F3TA 3UW6A
chains in the Genus database with same CATH superfamily
1TQXA 3W84A 1OHLA 3ZJ6A 1H7PA 2ALDA 5G5IA 4ENLA 2HPIA 1XLDA 1A5SA 1I45A 5BXRA 1XLFA 1UUMA 1OG6A 4GGHA 3EXSA 3VVGA 3SM0A 4KCWA 2PWHA 1GQKA 1HNYA 1T6MA 2A6LA 2J8GA 2XTKA 1CZ1A 3QC3A 4X2RA 2ZZ1A 3W0KA 4AD1A 1GOIA 5CSYA 1JPKA 4R53A 1MEWA 1UH3A 1P1XA 1EP3A 3ARYA 2WO5A 3SCVA 2VZSA 3ME3A 3IV3A 2ZXBA 4HA3A 4PCPA 3S83A 1JZ3A 4JHZA 4MWAC 2F2HA 5HUOA 4WSHA 1XSIA 1W56A 4IISA 3HPFA 1XIGA 5C70A 1W1PA 1B4KA 1QWGA 3FXGA 3KBMA 3VCRA 5LIXX 5CSSA 1ZAJA 3VIOA 1K6AA 3HN3A 4GA8A 4DELA 4EF8A 2AKZA 3VZZA 5A6TC 3H26A 1L2UA 2V6AA 1R3RA 3BPWA 3T2OA 4HQVA 3W6MA 2P5NA 1NU5A 3TIMA 5DO8A 2WKLA 4EIVA 3UZWA 2V63A 1OBAA 1W1ZA 3SECA 3NXFA 1GWJA 1HF6A 3L9CA 1ZJAA 2EKCA 4Q3MA 3BW3A 5AC7A 3DFTA 4JX5A 1H3GA 3IGXA 2WW5A 1W3NA 1YEYA 5DX7A 5ABFA 1V3LA 3NZPA 4GIEA 1B3OA 4U10A 3VGEA 3AUOA 2PDUA 5FCZA 1NJJA 2VWTA 4CNNA 3MUIA 4UFLA 1LYXA 4H6RA 1NFBA 2FB2A 3EOOA 3KDNA 2YCLA 2Z28A 5F4WA 2VQUA 3V0SA 2BG5A 4FI4A 1RVKA 4IFRA 3OQ8A 3SN0A 2CPUA 4JN6A 3WEZA 1MXSA 4IIEA 5DCBA 5H6HA 2YJQA 2EG8A 4O57A 1O68A 3G1DA 4NF7A 3W02A 1GVQA 1ZBKA 2R1MA 3PB0A 2OU4A 3W7EA 3L21A 1VD6A 4QTGA 1B3WA 3BZGA 1VJSA 1HGYA 1P1MA 3W4RA 4JTUA 3MKCA 4F2TA 1WOBA 1XICA 4I6KA 4R7WA 2VEFA 4NP7A 4XKYA 1H41A 1EXBA 1C9DA 1VFHA 1A0DA 3AS1A 1JNDA 1HN1A 1RZMA 3BSMA 1WA3A 3PZIA 2GJPA 2QF8A 3CPGA 4YLWA 3VMNA 2SFPA 4ZSUA 4O53A 4JQAA 2VDGA 1XIMA 1VB9A 3E0FA 4O18A 1QNVA 1ENUA 3HG3A 4JEQA 3CK5A 2B81A 3G2GA 4DYJA 2ZA3A 3GVVA 3NQMA 3VKJA 4AZGA 5DT5A 1UOKA 2XZ9A 4LT9A 4ML9A 4TQTA 3DKLA 1JXJA 2IW0A 4DUXA 1UQYA 1I1WA 5CPOA 2PDCA 2JF7A 2NQHA 2WLYA 3AJ7A 4UB9A 4F8XA 1OK6A 2CZFA 3GIYA 3SFKA 2ISSA 4KRTA 3NJ3A 4ADTA 4LGXA 1BYAA 3OLIA 3WNNA 1HX0A 4YHGA 3WQOA 1UWAA 4JICA 2DORA 1RH9A 2ZRYA 5A8GA 3P6LA 3KRZA 1KRAC 3RN6A 1DVJA 4IIBA 1JYVA 5HR6A 2P53A 1X38A 2HRWA 3HFYA 2BHUA 3WDJA 4PA8A 4UTWC 1KA9F 4JQ1A 5IM51 4A2SA 3GXNA 1TRIA 5DELA 1IZKA 2DVUA 2ZZ2A 4Y90A 5FSEC 2ZUVA 2O7QA 3R5EA 4FXSA 3RO6A 1ODUA 2E28A 4AZ6A 4AMAA 4DJDD 1Q7ZA 1AK5A 2F2KA 3S5ZA 1J79A 1JUKA 2DZWA 3G5EA 1NFGA 4GBUA 3HQ1A 3D0CA 4PUNA 3VPLA 3U4AA 4JTGA 1TWDA 3FJ4A 4Q4MA 1UC4A 1G69A 2QDEA 2YYTA 2PDPA 1CGTA 2EG7A 1EFZA 1W2VA 4L6DA 4DJDC 2X05A 2VFDA 3W85A 1QR7A 3P93A 4PCSA 5IOBA 2ZDSA 1VEPA 2A6NA 3HM7A 3F5JA 4GJIA 1PHWA 2XIIA 1MW1A 4AYGA 2Z26A 2CHOA 1CLXA 4JYDA 3TAKA 2ZRXA 2IXVA 4RW5A 4EP8C 1A3XA 4BQ2A 3CB8A 4BQ5A 1SFTA 1GEQA 4Z2KA 3L66A 4C60A 1EQPA 4PTWA 3FGCB 1ZSXA 2V5DA 4FOUA 4ZB2A 2QYGA 4EACA 1UWTA 2CW6A 3W1NA 4D6GA 1UR2A 2XSAA 3WQFA 2OGYA 4E4UA 4N9BA 4ZO7A 1MW0A 5H8UA 4WF7A 1ICPA 3R43A 3EDEA 2VR4A 2INFA 1U2YA 2NX1A 2YCEA 1FXPA 4GINA 1E0VA 3BWWA 3CPUA 4AVFA 3CIVA 3BLDA 1GW1A 2B0MA 3ITXA 1YKWA 4XIAA 3II1A 5I79A 3IVUA 4WHBA 3FJ6A 3IGSA 3OYZA 4UMAA 3WJZA 4FPSA 3UWWA 3N2MA 3GIQA 3UZYA 4MADA 3PM6A 3EA2A 2GVEA 4GO9A 2JIWA 1H7XA 3F4CA 2NUWA 4N9EA 5ABGA 2J7HA 1VZWA 1B3XA 3RM4A 4ES4A 1BYBA 5LYRA 1FA2A 1HKWA 1DQUA 2B7OA 3DIPA 3TX9A 4LFYA 3RX3A 2RDXA 2CWNA 1TV3A 2XN0A 2A5HA 3ATZA 5DBUA 4UTIA 4URIA 5BXPA 1E51A 3UFYA 4DBUA 1D9EA 1CENA 3S2NA 2VRKA 3R12A 4RNIA 4PTVA 4K8EA 2P88A 4N0RA 3ZFHA 5F2IA 5CC7A 1LRTA 3WQ8A 1VFMA 3UY8A 4QAIA 3WF1A 1ZLPA 2JIEA 3ITTA 1NARA 5KETA 1YXDA 3OHIA 2YL8A 4AY8A 5B80A 1U1UA 3N11A 2Z0IA 1OCNA 2PDXA 3G0XA 3W70A 4Z2JA 2H8ZA 3FN9A 3ZYZA 3BV7A 1UQZA 4NAFA 3OG3A 2DZPA 4HZ7A 4MOZA 3UXLA 3DGRA 1NIUA 4O0KA 1OK4A 4XZMX 1JUBA 1K8CA 1OF8A 3ABXA 2D2JA 2V5LA 3LI0A 3E9AA 1UD5A 3IANA 3T4WA 3P7YA 1OQFA 1KD0A 4IMCA 4CQ9A 3GR7A 5K7JA 1FWRA 3CS2A 2PB1A 3RPMA 4ZODA 3LM3A 4LC8A 4B5XA 1HL9A 1W3IA 4W5ZA 4LUSA 2C0AA 2DUAA 3RMJA 5BRQA 2CLIA 4J3VA 2HBVA 5BOFA 2WMFA 1SSGA 4N4QA 3L2IA 4F0RA 1KR1A 3KBWA 5JBDA 3LHTA 3HU7A 1W9DM 1PZ1A 1B0IA 4X9YA 4LAOA 4AY7A 2BX7A 3JU2A 2B31A 5A2BA 3MP4A 4EVZA 3TAOA 1GVSA 1ZY9A 4PN2A 5CH9A 5FACA 2QMJA 3VOFA 1BLIA 3MI3A 4MNLA 2E6FA 5LIWX 1EOMA 3AMCA 2DZSA 3LDVA 3GS6A 4U4MA 2PGRA 2OQHA 2HK1A 3W00A 4H2HA 5ECVA 4KKXA 1FBAA 3CL7A 3LZ5A 4PUUA 1E73M 1CXKA 1S2UA 2R82A 3WF0A 1MDRA 2Z27A 5AYIA 4O1CA 3SCOA 2CKRA 3T05A 3M0YA 4XZBA 1UR1A 2ZRVA 3SO7A 2ZTKA 1RVGA 1A4MA 2XISA 2BZNA 2J4GA 2WMJA 3WH8A 2ASHA 2ADAA 1V3HA 3R89A 4M6QA 1XIIA 4ROPA 4US5A 3PNZA 3AIEA 3MCOA 1A3HA 3M44A 3WN6A 1Q66A 1R87A 3HG5A 1VCGA 3GVRA 2C19A 3D46A 2V9DA 3I7QA 4G1NA 3MQTA 2X2GA 4IZGA 1CECA 3PWAA 1VFSA 4XB3A 3AMKA 2AL2A 2HE8A 4Y8EA 3ONCA 3OIHA 1WBHA 3M6YA 1VHNA 4A8RA 3N4FA 1QI5A 4DLFA 4DAIA 2R91A 3GXIA 4W9TA 4JQ3A 5D32A 3PBMA 3E0LA 2E5CA 4R33A 4U3AA 3NVTA 3ZT5A 3N4AA 1FWEC 2Q71A 4C65A 3MI6A 3V3WA 4IPPA 1C9WA 3THDA 4DF0A 2XH0A 4DN1A 3EWDA 4IPIA 3ITOA 1XINA 2PC8A 1SR0A 2PWUA 2VRQA 4AWTA 1BG9A 3TLQA 2WC7A 3S1WA 3L4TA 3SIZA 4OHQA 4N02A 1CXEA 4OV4A 1P7TB 4HNCA 5REQB 1X96A 4QDWA 4AHPA 4M1BA 3NWRA 4BWLA 1EIXA 1KFBA 1HP5A 1K4HA 1XBYA 4PUDA 3THQA 1QDSA 2ZA1A 3WQDA 3A4WA 3NDOA 4HBKA 1KRCC 5C5YA 1PKYA 2ODOA 4O16A 2QAPA 3WJYA 2I9EA 4ZQCA 4Q4SA 1DWIM 4V27A 1AJ0A 5KTLA 3H2EA 4IFKA 3FIGA 4FX7A 2VGFA 4KGJA 4LCRA 1Q6LA 1AUSL 3WEOA 2J24A 4I7WA 3VE9A 4CD7A 2ZC8A 2B4GA 3M47A 1GTHA 3CH9A 2VP8A 3TYDA 1NEYA 2WK2A 3IJ7A 4RPPA 1AD4A 2V5BA 4AVNA 3L2MA 1PCKA 3STGA 4ZOAA 3P61A 1JYXA 2WSRA 4Z42C 4ZQRA 2WMGA 1V93A 1CGVA 3EMCA 4Y96A 2OYLA 2QKFA 4QQUA 1CGYA 5CKSA 3VC5A 4D71A 2ZDRA 4QLJA 4NNAA 2ZRZA 4J27A 2Z2UA 3B8SA 4J3SA 3ZLHA 3KWXA 5I3KA 1BWKA 4Q4QA 3TKFA 1QK2A 3GD6A 1B4EA 1O4UA 2GGJA 3VMPA 4JCMA 1OB0A 1EP2A 2J6XA 2JF6A 1YPXA 4W87A 3MCNA 5D30A 1DPMA 1W5NA 1EOKA 4AXKA 5E9XA 4HHLA 3CQKA 3LQGA 4IL2A 3BCDA 5GJNA 2CITA 4HYWA 3B04A 3I6TA 7A3HA 1V8EA 2QDHA 4EPEC 2C1HA 3BG5A 3T55A 4O0ZA 4WVXA 1VBGA 2OPJA 3WNLA 2V5JA 4L56A 3YPIA 1DWHM 4JTHA 4QSHA 3CZKA 4JAWA 2G50A 3O06A 4UR9A 1I6NA 4O17A 4NKCA 3R79A 4GC3A 5CAKA 4S3FA 2OFJA 3OBKA 1WZMA 1QPNA 1ZPTA 3A3WA 1V3IA 3RRAA 3WLIA 1ECEA 3LCHA 1DJZA 2DSWA 1MVYA 3I68A 1O66A 3NG3A 3HPXA 5DXYA 4KIRA 5D05A 5B7YA 1EPVA 3LTYA 4FNUA 1IT8A 3V7PA 3TXZA 3L0GA 4AZ7A 4IQJA 1WKFA 1JQXA 4LY4A 3VTRA 4C6EA 1FXQA 3P84A 3CM4A 1J2WA 4H6EA 3W27A 4DBSA 4GBDA 5FL0A 4KCTA 2WHJA 4FNRA 1K8ZA 3M0XA 4HP5A 4J2PA 4JIPA 5K3VA 5CJMA 3GC5A 4ACZA 2V0TA 2A0NA 5DFAA 4C6MA 3GQYA 5HUPA 1EF3A 3I3BA 2DH3A 4A29A 3N6HA 1DHPA 4NZFA 2I17A 4MPQA 3CZGA 4Q6JA 1NDYA 3A4XA 1Q4WA 2WZMA 3VDHA 3PUGA 2VCAA 4YVPA 1VF8A 3S42A 4OBRA 3H21A 4FIRA 3PAOA 2WB5A 4H6KA 4ZCWA 1C7TA 2AAAA 2CWXA 3AHTA 3D5HA 3HMCA 4HYRA 3RR1A 3EDKA 8A3HA 5MKGA 3KZPA 3UBPC 2WMIB 3F4WA 4C90A 4JGDA 1HKIA 4NASA 1E9ZB 4LB3A 4D6DA 2GJNA 3SSJA 3L2LA 1EUNA 2O4MA 1XUZA 1EDGA 2BNJA 2V3FA 2QUVA 4NYYA 3PBUA 2GSHA 4U3CA 3P14A 2RDTA 1P6CA 3LD5A 1K8XA 4E5TA 3VNMA 4DZHA 1BTMA 3RO8A 4XAGA 3C2RA 2DZAA 3WCZA 1QVBA 3AXIA 1QWKA 4Y9NA 2OG9A 5C0QA 3O7UA 1V0LA 1BRLA 4RLIA 2XWEA 4E3VA 4QROA 2BY0A 3O6DA 2E8YA 3EWXA 7REQB 2XWDA 1DQXA 4GOAA 3NEVA 3WG6A 3RX4A 3AXKA 3VD5A 1NQKA 3LOTA 1AW5A 1DIEA 1LOSA 3M1ZA 2YXOA 5C9RA 2EEXA 3V5OA 1DXEA 3U57A 3S9YA 4HMCA 1TIWA 4REQA 1OC7A 2J9ZA 4G56A 3G6MA 2ZRUA 2GWNA 2VZUA 4ZSTA 4OUEA 3BDKA 3F5LA 2HWGA 4W8AA 1QI0A 1RLDA 4BY3A 4W7WA 5D02A 4WXYA 1U1JA 3G22A 2CLPA 3E0IA 3TC6A 3K13A 5E9AA 1VRXA 4G5DA 5G4WA 3N6QA 2YKKA 5EMLA 4QAWA 5D09A 3SQSA 4CVUA 5HQMA 1C7SA 4HNVA 4KEZA 1DTUA 1B54A 3BH4A 3WDHA 4PMYA 5C2CA 5DF0A 3B9OA 3NVDA 4AZHA 3BAKA 2W91A 3WUBA 3ABQA 1EYEA 2I5GA 2XGIA 4V1YA 3GLCA 1V6TA 5C8BB 4L64A 4A3QA 1DHKA 4DXKA 3GUWA 1C8VA 1FUYA 1OFQA 4FP1A 1UR3M 3J7HA 4JY8A 1WCGA 4NHVA 3M5ZA 5ABEA 2VX7A 3NL2A 2QDDA 1KBLA 3T78A 4ZA0A 3JW7A 2REQB 2WSYA 1U22A 4HPXA 3VILA 5PTDA 3BGGA 4UFHA 5TNVA 3EWUA 1XBVA 1O5QA 1E6RA 1S5WA 1B9BA 4YTRA 4GD0A 1X6LA 1X7FA 1Q7MA 2A85A 1TO3A 1WUFA 3HQPA 3EOLA 1WXJA 5MHBA 1CI1A 3EX2A 2OWCA 4PUMA 5CLTA 4B5WA 2OO6A 2QUTA 2YB4A 2MUCA 1KLZA 1KM6A 1EC8A 2OLAA 2TSYA 3TFCA 1MDLA 5D8ZA 3ZSSA 1AA1B 2H9AB 3NL5A 1QOPA 1KNWA 4G9PA 4H41A 1XYLA 3AICA 3RFAA 2YXGA 4C1KA 1TPDA 2NX9A 4F2UA 1A49A 3TZFA 3R8HA 3KHDA 4MJ2A 4KFNA 3SIMA 4KFPA 1FH8A 4HNLA 5EBAA 5I78A 1UW9A 3BG9A 1CGUA 4H7CA 3AFBA 1A5BA 3SCUA 2Z4GA 3AIUA 2C16A 1J0HA 2Y85A 2XUCA 3SSZA 4FAMA 1GVOA 1HL2A 4CD8A 1M5WA 4IOTA 4JX6A 3AO0A 1O1ZA 1EWDA 2YL5A 3EX1A 4ICCX 2WPGA 5E0CA 2Y8UA 1YQ2A 2QXWA 1AQ0A 4AEEA 4AFYA 4XSLA 5FSDC 2J9XA 3M4HA 3OGRA 1FFQA 4QEEA 3R94A 3WBXA 3B0VC 5U4NA 2VM8A 3VKDA 3N2CA 3E38A 4X60A 3QTGA 5AVHA 1QOQA 5GQBA 2QZRA 3OO2A 1WDQA 1QU4A 4O52A 1TG7A 4DHGA 5T9CE 1JCLA 2IUZA 1REQB 4H2CA 3VI2A 1AMKA 3GHUA 4E2OA 4BKNA 4ZBCA 3CV1A 3TR2A 3H2AA 3SRDA 3W7GA 4X0NA 2C18A 2NQLA 3A4AA 3DU0A 3ARZA 4Q8WA 4AMCA 4JTAA 3GXTA 4AVOA 5FOOA 1GGOA 3NQ6A 4H8HA 3VE7A 4O15A 4X2PA 4RE4A 2YFOA 4ATWA 4PSPA 3TA6A 2Y7FA 5E09A 1X1OA 3SUVA 1ZAIA 2HXUA 2C15A 3F4DA 2C3ZA 1FWIC 5EMKA 1KXVA 4XISA 1KCZA 1EJRC 3AMGA 5KZ6A 3RDKA 3UXKA 1PDZA 4HOXA 5F2GA 1N82A 4C1LA 4K36A 4CU6A 5AHLA 1SFJA 4US5D 3LY0A 2QIWA 1NM9A 1F8MA 1YDVA 3DG6A 2E0PA 2E7FA 5EMJA 3TJLA 2PDGA 1TE6A 3QFEA 2QVHA 3GDLA 4N42A 2BSLA 2FZ8A 3CZ8A 1AL8A 3W82A 1TV4A 1H7WA 1EO5A 4IHCA 4MNMA 3GH7A 3CC1A 2E5DA 1LWIA 2CLMA 3S6TA 4O4VA 3B0UX 2PDMA 3M64A 4ZOEA 2NQJA 3NOYA 4UUIA 1G94A 4Q33A 5I09A 1DJHA 1OGGA 2WM1A 3QSTA 3W1UA 3QPEA 4LXFA 4LTSA 3NZGA 2WPBA 4UMCA 1O12A 2QMKA 4ZR8A 2W92A 3W2UA 2PLKA 4JL1A 5U7SA 3G3MA 2PGFA 3C3NA 2CBJA 2DSKA 1ICSA 1GW9A 2WVVB 4EPDC 4PRWA 1TWZA 1AH4A 5HDRA 1W54A 2OLSA 2VOTA 4FLSA 1TTPA 3HQNA 4XAZA 4IL0A 3M43A 2CFFA 3D3AA 3BAWA 1DWAM 3A13A 3OIXA 3W26A 2PI6A 1DIDA 3W6LA 1QPRA 3NTYA 2G41A 2Y0FA 3URAA 5CZKA 2GL5A 1GZJA 4X22A 2XVLA 3ALGA 3VABA 3A22A 1Q6EA 1M04A 2VVSA 2NV2A 2YDRA 4PMDA 4NY2A 1OSEA 3G77A 4V15A 3APGA 2G8ZA 1G4TA 4LWWA 1JNEA 1F9CA 3MDWA 2CZ5A 3PUDA 4ZXOA 5LIYX 1BWVA 3MANA 4BWLC 3U5YA 3EPMA 1OINA 1IEQA 4NX0A 3SCPA 3OBEA 2VKZG 4ZVJA 5A8PA 4ADSA 3MBDA 5LHEA 4PULA 1TPH1 4C1NA 1G5AA 3NM1A 1H2JA 1EDTA 3TTYA 3BCJA 4K7YA 3C0LA 4JQ2A 4XAYA 4UWMA 3FGCA 1NWSA 4KESA 1P0KA 4MUZA 1ZUAX 3VXGA 2YA2A 3I6RA 4O50A 3NIYA 3NZ1A 3O6CA 1VBRA 4GY0A 3P80A 3S1GA 4I8YA 3O6YX 4U33A 5BOEA 4D6HA 2XVGA 4GNKB 1POKA 5IBXC 2J66A 4PUWA 1KGWA 4RV3A 4AHOA 5E5CA 3W1MA 3ZR4A 1KCKA 1XISA 2EO7A 5JIWA 1Q6CA 1XPYA 1NF7A 4H8NA 4O8AA 3AZSA 4AY1A 1OVDA 1WAUA 3BK0A 2WZIA 3Q58A 4RE3A 5CZSA 4D6JA 2GQAA 4B9YA 1KGUA 1D8WA 3WQPA 3QJAA 3CQJA 1VENA 4Z1YA 1EJXC 1IIGA 1XH1A 2V38A 3NDYA 1KM1A 1XM3A 3TN5A 3RM8A 4B5SA 1IT7A 3PPHA 3WFLA 2QCGA 5L6UA 3N25A 4XD5A 3CNYA 3AISA 5CPSA 1DJWA 5I02A 4QJ1A 4Z0SA 1UWRA 4Z1CA 1JZ2A 4Q8PA 1WNOA 5HPOA 4U31A 4LUYA 3R0DA 1V51A 3DBPA 4DYKA 1E4MM 2X7WA 4PTNA 3EWZA 3V16A 1CXHA 7TAAA 2YXXA 4S3AA 1Q6OA 1PCWA 4I90A 4A8NA 1YTKA 2R1KA 4FO4A 1HP4A 4HN4A 3MKKA 4EK7A 4Z2LA 4AZCB 1H61A 1DL3A 3CQHA 4R3UA 3UPMA 2VFFA 3CAKA 4QE1A 1D3CA 4E3TA 5RUBA 3CMFA 5IFPA 4YJ5A 4I7UA 3V5FA 4WOQA 5FEZA 4WRHA 3M7SA 4XO6A 2V81A 3CHDA 3FX4A 5FA5A 5D38A 4NRSA 3W7OA 3IV8A 2FPYA 3KBSA 4FXRA 2DH2A 4OE7A 1FWWA 1G67A 3CBWA 3IVTA 2Z1KA 1EBHA 4GVHA 2V3DA 3ZVHA 2WCGA 1R38A 2W9MA 3VOCA 1M7JA 4WDXA 3SGZA 4J4KA 1XP3A 3AHYA 3HURA 3PHAA 4H83A 1TE1A 5CZTA 2FFIA 3FA5A 1RR2A 2XHYA 5JH2A 3MS8A 3K8LA 3T08A 3HZ3A 3TCSA 4TX8A 2Q8XA 1FWNA 4ZE5A 2X0YA 1TCDA 3VA8A 1B3YA 2HV5A 8XIAA 3DENA 3DHPA 1R2TA 5BNKA 1I0BA 3A3XA 1UKOA 1RD6A 3PJUA 3EYPA 4JIEA 1R3QA 1EEPA 5H91A 3KOZA 3TK7A 4GH3A 4X0VA 3VMOA 1EO7A 1I75A 4LRSA 4LPCA 4WSJA 1UHVA 2CHRA 3EMZA 2YA0A 4JYFA 3ITGA 4W84A 2D2OA 1VH7A 3H2OA 4AZBA 3EA3A 3GDRA 4IQLA 1K03A 2G3NA 3NO1A 5GJMA 4HA4A 5KEZA 1E55A 3APYA 4O10A 2Z7GA 4W93A 4JQ4A 4XIMA 1DJQA 3MT1A 4GZIA 2QCCA 2Q8LA 4QM1A 1E0TA 2I5QA 4QP0A 1THFD 3N3TA 5I07A 3IIOA 6A3HA 2FGLA 2I1OA 1JCJA 4R9XA 1HKVA 1OYAA 1DWJM 1E5NA 1JUEA 1E56A 2Y8KA 4AD0A 2Y7DA 4FNPA 1P0NA 2ZFAA 3TNOA 3UP8A 1SO6A 3O07A 1TMHA 1TPVA 1L2QA 1JR1A 3FA3A 1I1XA 4HHHA 5D04C 5JIPA 5A8NA 3M0ZA 1V5XA 1WKDA 4GO8A 2GDQA 2F6UA 1ONXA 3QMSA 1R2RA 1S5TA 2V2HA 2J79A 1VYRA 3HO8A 3GW3A 3MCMA 2GJRA 1UIPA 4HMNA 3NSXA 5DQPA 5CPNA 2I56A 3VKBA 3VCCA 1GHRA 1CXLA 2G3JA 1PL9A 1XIDA 3QR3A 3HV8A 3DG3A 3NR0A 1UR0A 4B5NA 2R1LA 4CEXC 2C8NA 4O28A 2A3HA 2NT1A 1UWUA 4CNTA 4ATLA 1WYIA 4UQ9A 3NZRA 1QW9A 4Y8FA 4CUCA 1YIXA 1TMLA 1RV8A 4FHAA 3ZLGA 1JCNA 4TU1A 4OJYA 4TTUA 1F4AA 1P7TA 3OZMA 2HTMA 2AQWA 4W8LA 3I65A 3PZQA 2DZUA 2CKSA 3TSBA 4FLRA 4JZ5A 5DCDA 3TLLA 1JDEA 3AYSA 1LLWA 5AZ1A 1U83A 4WLCA 1BVZA 3PG9A 4ZZ9A 1KW1A 3SUUA 4NNBA 3ID7A 3QBUA 2QGHA 2Z1VA 2FVLA 3PJXA 3WD3A 4GXMA 1IEWA 3UERA 4WK9A 4F0MA 1WDRA 4ZENA 3RF9A 2DDXA 4H19A 1JCXA 4ZTYA 5C7VA 3LMZA 5H2ZA 3ZR6A 2D23A 3H55A 1ODZA 3DCPA 3S1VA 3OLGA 5A3HA 2OWXA 1ONEA 3WNKA 5G2WA 1N55A 4J35A 2BTMA 3AMLA 1PX4A 2OVLA 3H53A 3NQ7A 2GGIA 2H6RA 4WD0A 3S46A 3CJPA 4GI4A 4I6VA 4TX6A 2TODA 1O94A 3Q4DA 4OFCA 5CPQA 2XG9A 1WZLA 4JEJA 4YCPA 3ARTA 4L4OA 1TJ0A 4B92A 3MYOA 3GG8A 4CD4A 1S1PA 1JFXA 3LUTA 5CBBA 2QAFA 3FJLA 3WBWA 5I3GA 1DEDA 2FVKA 2PP1A 4DB7A 1JDAA 2OOFA 3GKAA 4OTKA 5CBIA 1L0PA 2G37A 2UV8G 4XAFA 2VURA 1TELA 3N3MA 4NI3A 3MYPA 3QOKA 5AHNA 3PZOA 4D72A 3OODA 3SCNA 1W5QA 3VIIA 2QQ6A 4IMDA 4I8DA 2HVMA 1ZL1A 3P81A 5ENLA 2VX4A 1JPDX 1PKMA 4JKLA 4F9DA 4MY8A 3F2CA 3S9ZA 4S3CA 2BGSA 4L1XA 2IPFA 4FXFA 1CWYA 1E6ZA 4IPJA 2CBVA 1ZTVA 2C91A 4P7LA 4PFMA 1YDNA 1P5BA 1TX0A 3ZJ7A 4F0KA 1RCXB 2UY3A 3GNNA 4GMEA 2Z29A 1K8YA 3AU2A 4INFA 4YNGA 2I57A 1QCWA 5A8QA 2JGQA 3WEMA 3QKZA 1KV8A 1D3GA 1X97A 3DFOA 6ENLA 5J5RA 3FXYA 4RZ5A 2ZUWA 1GZGA 3PJTA 3IJLA 2VWSA 1V0MA 5GNYA 1UD8A 1G9HA 4Y9PA 1PZ2A 1Q13A 5KITA 4B16A 1DJIA 4RZ4A 3UGRA 4P7NA 3UJFA 3GY1A 4QCFA 1EGMA 2PDJA 3G1YA 3FCPA 2OOGA 3SN4A 3IUHA 2JK2A 4YTSA 4MAVA 4HTBA 3OZOA 2V8ZA 5FESA 2UWFA 3IK4A 5E6YA 4P8WA 4X63A 3WNOA 2RH9A 3N2TA 5A6BA 5C7HA 1ZCOA 3W7IA 1A5AA 3GO2A 2WMHA 4EXBA 1K9EA 4GI6A 4K6AA 2D2GA 1OX5A 4IUGA 1LRQA 5HA7A 1JPIA 3IS4A 1G4SA 5EMYA 3L68A 1V79A 5CG7A 4Y9MA 4RNHA 4ATDA 4HU3A 2QR6A 3SCRA 3VIMA 1OF6A 3FYOA 4UZSA 2PEVA 1FP9A 2YDSA 2ACQA 3B9DA 1BXCA 5G2IA 1F05A 4G1KA 3GDMA 1LF1A 3U8GA 4C6JA 1WXZA 4LV9A 1QMLA 3R10A 4K7VA 3W83A 1TPC1 3W87A 4ICMA 1TUXA 3MUY1 1S3HA 1Q2SA 4HGXA 1PHQA 5AHFA 4Q7IA 3U2EA 3BQ5A 3RLVA 3IUIA 2BY2A 4A22A 4G7FA 7REQA 3I3DA 1SW0A 4UTLA 1HG3A 3DEQA 4HSNA 4NU7A 2ZZ3A 2PWFA 2YSWA 4GH1A 2J13A 4KW2A 4Q8VA 1TZ9A 3GFYA 2WZTA 2VDIA 2PE4A 5HNNA 3A21A 2YYUA 1UJPA 3WX7A 3CLWA 3O9NA 3BUVA 4A35A 3NQVA 1A80A 1XUUA 1EPXA 3LPPA 1LG2A 4LRTA 4GC4A 3CWNA 1E70M 1BFNA 1OFAA 5C9ZA 4C6IA 1NY1A 1GJWA 3OA5A 3D3FA 7PTDA 1UZHA 3QF0A 3PTKA 2G95A 3A6OA 1ISWA 3JRKA 3KHJA 4HIBA 5BRBA 2POTA 3FVDA 3N2BA 3B8DA 1QI3A 4OOZA 3BOLA 1W3LA 5FF7A 5DMLA 3IWPA 3QW3A 1V0NA 3WBYA 1M1BA 2RDWA 3B9EA 4W8BA 4BEUA 4O8RA 3IJ8A 4LBRA 1KLYA 4AYSA 3TUUA 2GQ3A 4ILSA 4W5UA 4QS5A 3NSNA 3QHOA 2XVPA 3O0KA 5FEXA 2Y24A 3CHVA 3E2VA 1LROA 4IMGA 1AG1O 1E72M 1MEIA 4FZIA 4EX4A 3AYRA 2Y7GA 4LX4A 4DZ5A 3WQ4A 4C6BA 3RPTA 5BROA 2KAUC 2ZOXA 4BF9A 3IRSA 4MPKA 3WENA 3DYMA 2QUNA 3TN6A 2AQVA 3QLLA 3KLLA 3UZJA 5BMXA 3HJEA 3BJSA 2OZ8A 5M17A 3AC0A 4K1WA 2VELA 1WZAA 1Y5WA 1QXLA 3CV2A 3RLHA 1VP5A 3BAYA 3FEMA 4ZQMA 2A79A 4BQ3A 1TRDA 3CUZA 3U9IA 2H9AA 2Y2WA 2BS9A 1OFDA 5TIMA 2XVKA 3N73A 1KM0A 4FA3A 3NSMA 4QXIA 2UY4A 3G1AA 1EKOA 1IXOA 3DFSA 4CCCA 1E6QM 1QASA 3S5YA 1GPWA 3OVRA 3QXBA 2OX4A 3BXWA 3G1SA 4YYFA 2L5HA 2WSPA 1CBGA 2B7NA 5LIUX 4HNOA 4MG4A 1R5YA 1RY0A 1A5MC 4DO5A 1DJXA 3BMXA 4QX4A 1XKYA 1E0XA 3QY7A 1XLCA 4AD4A 3LGGA 1W9VA 3TOPA 1E5JA 5G4HC 4Q8TA 3TYCA 2GWGA 3CLMA 1R47A 2D0GA 4XUGA 1FWBC 3L4ZA 1B1YA 1BXBA 5DT7A 4LVGA 1GK8A 1OYBA 3WF4A 4AZIA 5CG0A 4PMZA 4GQGA 4W7UA 3UR2A 1YLVA 4DO7A 4H9VA 3UZZA 2DIJA 2GVJA 3C0JA 3GTIA 2XFYA 1XJBA 3UG3A 4DUOA 3QLDA 2X16A 1JZ5A 4JBRA 1DP0A 1MXDA 2D24A 2PS2A 2Z1WA 4D8ZA 2E67A 2HXTA 3N34A 2FH8A 4KMQA 2R8WA 1XGDA 3K1DA 1REQA 1FDYA 1YW1A 1G1YA 3L4YA 3M5YA 3LI1A 3VDAA 4NX5A 1J01A 3B9AA 1BTCA 1E4LA 1O5RA 5E1QA 4CCEA 4M24A 2IKGA 2ZKMX 1W6TA 3UZXA 1XRVA 1KRBC 2NUYA 4HJWA 1BD0A 5E70A 2VR5A 1ITXA 1NELA 1XSJA 3L0KA 1TUFA 3QSRA 2E1WA 3B4YA 1PZ3A 3T2QA 3W28A 4PL2A 3GHTA 1Q5MA 4LEFA 2LLEA 1B31A 4FEZA 3MSRA 2BGQA 2C0HA 3T2PA 3S8HA 3M9YA 4M6PA 1KM5A 3KLKA 4C6CA 1PVNA 4UQBA 1UP2A 3F2DA 3DI0A 4FNSA 4A4AA 4XAPA 2C13A 1IF2A 4Q6XA 1GYMA 1EGVA 7ENLA 2V2CA 2F6KA 3H2MA 1CDGA 4DBEA 3AXHA 5C54A 2ACUA 4CQDA 3ORWA 1FWAC 3RJXA 1Z89A 3T44A 4IP7A 1TJPA 1PE1A 3O05A 3L4XA 1GT8A 2OEJA 5TD4A 1XV8A 3WFZA 1IWAA 2A3CA 3VGBA 3ARQA 1CB2A 2Q8ZA 2O55A 1F3WA 1SW3A 3CT7A 5CCZA 1NVMA 3LTPA 3EMQA 3UD6A 1W3KA 2J77A 4CD6A 3B40A 1NTHA 2J27A 3THUA 1AQFA 3UXDA 1M65A 2YLAA 4MHBA 4RDZA 1RHCA 1RLCL 1W8GA 1OWQA 3GVGA 8XIMA 1EJSC 4J3XA 2PDKA 1LUCA 1OFBA 3LHUA 1Y5XA 4ZFMA 5A6LA 3CGTA 2WVVA 1SMAA 4NZCA 5HJLA 2WAGA 4AIEA 4DAFA 3G0SA 3W7DA 1IZJA 1QOXA 3MU7A 2FJKA 5FKYA 1R3VA 3U7VA 1MW3A 3GNOA 3UJEA 1A53A 1EHAA 2PDFA 4PODA 4AX6A 1IHIA 4ACZB 2YA1A 3MMDA 2OLHA 3A9IA 2PZ0A 3L0NA 4GUIA 5A2AA 3SEPA 1YBQB 1UWQA 1WOAA 1M53A 2WCAA 3GK0A 3QR0A 5FJOA 2WLZA 1A50A 3N2OA 3TE9A 2ZZ5A 3UWQA 4F79A 5G4EA 3N12A 2PURA 2J7EA 4UR7A 2FQIA 4R88A 5EMMA 2VCBA 3ICJA 4MF4A 1JPMA 1XD1A 3EX3A 2Y7EA 2DPEA 3P8JA 4KIEA 5CEWA 3VOIA 5DRCA 3JZEA 3O3RA 1E6PA 3SRKA 4XBKA 4P61A 3ECQA 2NSOA 3LQLA 6TAAA 3E96A 2DSVA 1JRCA 4AD3A 5T91A 1XIEA 4H3DA 4GZJA 4AUBA 1PYMA 1MMFA 1U5JA 1JF6A 2Y6ZA 1UPMB 1YMYA 3PVFA 3QOMA 4IGNA 1R9YA 2UY2A 3I10A 1A5UA 3QHNA 1G4EA 3KL0A 1LG1A 4D2JA 4OKDA 4DVOA 2OT0A 4ZE4A 4C6QA 1L8NA 4HA0A 2HNEA 3GAKA 2PMQA 3LMYA 1UD4A 3M6DA 1M7XA 2CERA 3GHSA 3W1QA 4AWEA 3LN3A 1DIKA 3XISA 3V4BA 4YIWA 4GI9A 4WDTA 2ZE0A 3E12A 5GNZA 3K46A 1ZU8A 3EOUA 4D8LA 3W25A 4QE5A 3EB2A 4DNHA 4Q4OA 4JTDA 3THAA 2P50A 4REQB 1I2PA 1ZP4A 1EXPA 1J9YA 1J10A 3UWUA 3PULA 3DX5A 3KVLA 1W9BM 2Z25A 3GXFA 4MGGA 3EXRA 1JD9A 1R9XA 5HMSA 1GTEA 2OGJA 1UUQA 2PLCA 1BWLA 1R7AA 3ATYA 3G1FA 4CLMA 1HW6A 3QMTA 4C6OA 2EJ1A 5HMFA 2YFNA 1XHGA 3HG4A 5CC5A 4RXFA 3CWHA 1PWLA 1EHNA 5XINA 3PWGA 3UWEA 3DESA 2WKJA 3ES7A 1R30A 1EJUC 3VYLA 4H9UA 3W74A 8RUCA 4V28A 3W53A 4KETA 4C6FA 5I06A 4GUHA 1VFOA 4AWSA 3PZMA 3CQIA 2WZEA 3UZ5A 1PX8A 2JKPA 3WMLA 4NQ1A 1G4PA 5LA0A 1Y0EA 5A6MA 2CNCA 5CZJA 4KQNA 4GZEA 1SO3A 3NCOA 5M03A 2WJZA 4FF7A 3AJXA 1EJWC 4PCTA 4FB7A 1GKQA 3VD7A 1KTBA 2J6VA 3WNPA 1A3WA 5EFFA 1FX6A 3M0HA 2A3AA 1Z69A 3B97A 3WDQA 1SO5A 1UMLA 3MO7A 2G4JA 2PDNA 3RG6A 1Q65A 3SB0A 4RZBA 4YTQA 4DO6A 4YMZA 2YBVA 2C7FA 1YNPA 2QT3A 1QW7A 2DGAA 1XW8A 1GYLA 5A6BD 1KC7A 1OIMA 4H7VA 5I2UA 3OLEA 1LOQA 4FX6M 3WLHA 4RNFA 2JGYA 3CO4A 3PSVA 3NQDA 1OADA 3ZJKA 4U2YA 1QI4A 3AXMA 3L12A 3PF3A 1GCYA 3A5VA 4YS1A 1W32A 4Q8MA 4BR1A 2W6RA 3SJ3A 4GNVA 1QPOA 2FPTA 5AC4A 3I6EA 3W7MA 1XYZA 3H6OA 4EXQA 4Q4PA 2VEKA 4MLRA 2J7FA 1FTXA 4IFOA 3ARSA 2PRHA 5LKYA 1XI3A 3WH9A 1R3SA 1UA7A 2QCDB 1M01A 4NXKA 5HATA 3QZ6A 1GG0A 1TTIA 2CLKA 2Q02A 2A7PA 4XV0A 4BFAA 2F6XA 2O9TA 1L6SA 1VBUA 4JN7A 4GACA 5AYYA 4I9MA 3H23A 1VLWA 1F3EA 3EGJA 4E2VA 1AQMA 3UWZA 1RBAA 1AJZA 4CCDA 3L5AA 1Q63A 2YCIX 1FHUA 2FHCA 4IMEA 4ZGYA 4CQAA 2GUUA 1GVIA 3SUWA 1LL4A 2A3LA 4Z08A 4H00A 4GX9A 1G0CA 3PY2A 1ZBCA 2ABBA 2D22A 2GJLA 1ISXA 3QQ0A 3TJXA 4OZOA 2BOGX 4UIOA 3IK2A 2VZTA 3HTWA 4PEEA 1RJQA 3NOEA 4NSBA 3V36A 2OEKA 2PDLA 3WJXA 2VUNA 1WPCA 5SWUA 2NX3A 2X1IA 2J8TA 5LXEA 1GUVA 1JAKA 3NQBA 3BC9A 4B3KA 2RJHA 3C61A 1KKOA 4LANA 1A5LC 3AIWA 1EUAA 4AIUA 2VZVA 3FDGA 3CMGA 4GHRA 4GI8A 2CU0A 4HNTA 3C8FA 3ABOA 3SCWA 3ARWA 4CQCA 2Q6ZA 3FKRA 2YW3A 2VFGA 4H04A 1K77A 4LYRA 6ALDA 2E68A 3QYQA 5BWAA 5AC6A 4LVBA 2W0UA 1M7PA 1RAKA 3VIGA 4LU0A 4TR9A 4XVEA 3QPZA 1OD0A 2WHMA 3UF9A 2MNRA 1R3TA 4I3GA 5HOSA 2HK0A 3AOFA 2VGIA 1BSIA 3FHQA 4CGTA 1GKPA 1AD1A 1HKJA 2FLIA 3LU2A 2YL9A 2VXNA 4ZOBA 1PJ9A 3LV5A 2BB0A 3WO8A 1FWCC 3IEBA 1HXJA 3EB3A 2YW4A 3NGJA 3WMSA 3Q37A 1SMDA 1XFBA 1IWBA 4D9PA 1ELSA 3BJFA 4IJCA 3BLEA 2OZ3A 6PTDA 5TQLA 5FJPA 3DFHA 1B3VA 3QV9A 4UCGA 4BHYA 4WKAA 1UR8A 3M0KA 4R34A 2ONEA 1MI3A 4L7ZA 4CEUC 4WGXA 4G7EA 3L4UA 4OU1A 2DT0A 2PPGA 3VDCA 1K9DA 3LCWA 4GX8A 4LEQA 4F4RA 4HOWA 3GYCA 1XLGA 2ZXAA 2BV9A 2FPVA 4K2SA 2GVGA 3VGDA 3W7CA 3CWOX 4WXZA 3WIJA 2QCEA 4YPJA 3V0UA 3QC0A 4IPLA 2PWEA 3G1RA 3OGSA 2OQLA 2GYIA 1VQTA 1ZP3A 2FHFA 4AWUA 3E02A 4I9JA 3F7JA 4PC8A 4AXNA 1XWYA 3NM3A 3LA4A 5FF3A 4DIAA 2ZUUA 1M3UA 1H5YA 2DU2A 3AHXA 1FWDC 3PBGA 4O19A 3AXXA 3WY1A 1S38A 4XTDA 3T0AA 3TWAA 2CLLA 2AKMA 4RK8A 4QHRA 4R7JA 1GKRA 2BHZA 3ENLA 3PZTA 3V18A 3VCNA 5LNVA 1NP2A 3WNMA 1BSLA 1F3XA 4JCLA 3IACA 1C91A 2XINA 2VYOA 3MHFA 1XR2A 4QJ3B 3W81A 1AMYA 4E2BA 1GQIA 5CPMA 4U5IA 4C1NB 1JIBA 4IXHA 3PB2A 1W1A1 1PIIA 3G24A 2QNEA 4PGLA 4J5NA 3GC2A 2DP3A 2AQOA 5AHIA 4MTVA 1JFHA 1V08A 5FJRA 4OWGA 1DQWA 1PS9A 1W17A 3GU2A 3U2ZA 2ATMA 4DPPA 1TKKA 1L8PA 5IDZA 4ZO8A 2VGBA 3GH4A 1UD6A 4MFDA 4FSAA 1C8YA 3AS2A 1T99A 3S5NA 1U30A 2JEQA 4F66A 4JFUA 1XGEA 3WH6A 3HG2A 4WEVX 4GUJA 4EOUA 1JJKA 2IKHA 1K7XA 1BHGA 3R11A 4BI7A 4MWAA 2HDJA 1F6YA 2EJAA 4XD4A 1TVPA 3POCA 1H5VA 3E2SA 4JTTA 1WBJA 1IEXA 2QJNA 4CD5A 4PMUA 4GCAA 4V1XA 3B4UA 5LNSA 3SZ8A 2CETA 4RDVA 1QAPA 3S2MA 4NAEA 4AG0A 1KBBA 4XD3A 4UTTA 5A69A 2VMFA 2WC4A 1YDYA 3RLGA 4HU4A 1ALDA 2J7CA 4H9TA 1ZFJA 4CQ8A 3CAQA 4HJFA 1VBHA 3KE0A 1MRQA 3QZEA 3NFUA 2P3EA 3LGEA 2P0IA 4NZ1A 5AKQA 1ZBVA 3W71A 3B03A 1X1NA 4ALDA 5DLCA 3RCYA 2EAWA 1ESWA 2INZA 5JXQA 5CGQA 2HROA 1QRQA 3VM7A 2CZEA 4IM4A 3MZNA 2RHGA 3KAOA 2PC4A 1S5NA 4N6EA 2NWRA 5D9PA 5HULA 3WD0A 1VPYA 8TIMA 1VGAA 5JBEA 1O95A 4CNSA 1C8QA 1J0KA 2CLOA 2CYGA 5GJPA 1CB7B 4IIGA 4LUIA 4HSHA 1Z44A 4GCXA 3P82A 5C55A 1YADA 3I4EA 3S6OA 1W5MA 3VIHA 3UCQA 5C9UA 4KEMA 3NAVA 4DX3A 2QJGA 2CXEA 3KRBA 4UQCA 3GFXA 1TJ1A 4BCEA 1US2A 4F9JA 3MHUA 3MVTA 3PPCA 1CCWB 3AUJA 2W61A 4C91A 4EANA 4RXGA 2WBGA 1CNVA 3W7QA 1HT6A 3WL0A 4MJMA 2CBIA 4IIFA 1VJZA 2J7GA 3P67A 4LSBA 4DJFD 3ZVHB 5L9FA 1R6WA 4UC5A 4O12A 2PBGA 1VFTA 1H7OA 2Z00A 4TVUA 4JKKA 2PTXA 1KXHA 3H2NA 3BLIA 1V4YA 2RGLA 4FF5A 4G2DA 3MSYA 1TV8A 2WV8A 3GG0A 2ZVRA 4AEFA 4Q8OA 3FLUA 3H2FA 2WYSA 3AMDA 5A94A 3HF3A 3HPAA 4FIQA 3SR7A 1WDPA 2I7GA 3NA8A 2DVTA 2ZA2A 1VIWA 1OCQA 1FQ0A 2W63A 4BA0A 3C2OA 5AHEA 4GVFA 4XKMA 4CKQA 1E43A 2INEA 4GISA 2WNNA 1O7AA 1RBOB 1SJDA 3IPWA 3I7SA 5IHRA 2PDQA 7TIMA 3NL6A 3W88A 3C8NA 3OPSA 1CGXA 4M51A 3FV9A 1TPUA 3P3BA 1W31A 3IIZA 3UU0A 3T9PA 3K4WA 4DBWA 2XPKA 1EA9C 3AWNA 5E6ZA 1JCTA 1UR9A 3VD9A 4AU0A 1QBAA 1TZ7A 1IEVA 4LVAA 4E8GA 1KWGA 2QUUA 1O1HA 2NUXA 3G3DA 4S2CA 2QHAA 3AZTA 3T07A 2RJGA 4QITA 4UTHA 2D69A 2EPNA 3SURA 2NQ5A 2GVYA 4DXXA 2CLHA 4GWEA 3N9KA 3SCTA 5LXXA 3AWOA 3WH7A 2BVDA 4JTSA 3FYYA 4TMBA 1HVXA 4XZWA 2E6YA 1XYFA 1Q2RA 1J0JA 1VS1A 4W7VA 1H49A 4A8LA 3EOEA 3GYEA 2E09A 4WGHA 3WQGA 5HQEA 3UETA 4FXJA 4OOUA 2WMKA 2VT0A 1HJXA 1Z9AA 2ZBTA 4Z2HA 3U3HA 3IAPA 1IWPA 3UYIA 4HYVA 3NYDA 3B05A 3ZIZA 4HZMA 2WXDM 4RPQA 3STEA 3CASA 5BWFA 3GG1A 3LCXA 4JHOA 2WQPA 1WAWA 2WSKA 2X8RA 1US0A 5I6SA 2CHNA 2DZBA 1VC4A 2DJXA 4F0HA 3E6EA 1OJXA 1QO2A 2GOUA 3MSDA 1JZ8A 2DV0A 4LVFA 4WZHA 1XCWA 1SUXA 3GKFA 3BSHA 3B8WA 5I3HA 4DM2A 3M0VA 5LIKX 1JCYA 4TO8A 3H8AA 1IXPA 5XIMA 4O11A 3ZXWA 1PO9A 4ERAA 3DHFA 5HWNA 1SJBA 1H11A 1C92A 1NFPA 4A05A 2R6OA 4E8DA 5I3IA 2DT1A 4AX7A 3EX6A 3OU8A 3KEHA 1V7AA 2OMAA 5AYXA 3QEZA 5G2HA 5KZDA 4S3GA 1H09A 2ZQ0A 1S1RA 4C7FA 1JF5A 1I2RA 5D2WA 4WJEA 1MQPA 2JALA 1G01A 3IGHX 1HO1A 4PMRA 3B0XA 1ITUA 3G1VA 1ZJHA 3DI1A 1B30A 1E6NA 3BMVA 1KFWA 1XGZA 1P43A 3VNZA 3EBVA 3GTXA 2ZVIA 3GU9A 4WIWA 2OTDA 5CQ1A 3MJMA 3OA3A 3ARPA 4H8VA 5DBTA 2XIQA 2GK1A 2EPKX 4PMXA 3RM9A 5EGRA 3K4AA 1RSCA 1RBLA 1IIHA 4CN4A 3W6YA 1FFRA 3FDKA 1T40A 3FW6A 3WLQA 3P62A 1O6IA 3MMTA 2EHHA 1E9LA 5FIPA 1TWSA 4JD4A 2ZUMA 5A8MA 4HK7A 2NQ9A 2OZ0A 2QF7A 3GFZA 1XG4A 2BFGA 2PU0A 1TR1A 1GOMA 2ZUSA 4O0QA 4S2BA 2FJUB 2VEGA 1BYCA 5BYWA 2Z2AA 7XIMA 1R9ZA 4JTKA 3DFNA 3WH5A 1JYNA 4MB4A 3WYZA 1X8FA 5CPTA 2DUZA 1ITQA 4WY0B 1UZ1A 3C4UA 3QYSA 1BAGA 1EX5A 1V0KA 1KO0A 3DZ1A 2XU2A 1VIZA 2WANA 4BJHA 2OXNA 1H51A 3DGBA 3KBJA 1G7VA 3R7MA 3VOGA 1SVDA 4JFVA 1ADDA 1XRFA 3CO8A 1YXYA 2TRSA 3TYEA 4LY8A 2ZIDA 1DXFA 1E0UA 4AZ5A 4QLLA 1TJ2A 4EPBC 3WQEA 4HPJA 4WCJA 1RA0A 1ZNNA 2DIEA 2J7DA 2PCEA 3FHAA 1EGZA 2EPLX 2C79A 3WBEA 2E40A 4EWJA 1TIMA 5JBFA 2X30A 3LTSA 2PDHA 3LCGA 4F0SA 4IGHA 2POZA 4RUBA 1MXGA 4GUFA 4PSRA 1H1NA 5J04A 3MMWA 3A64A 4S3DA 2CBUA 3URQA 3LSBA 3KL3A 3S4TA 3T81A 4PMNA 1U5HA 2DQWA 3S3GA 4QSFA 1BF2A 5CJNA 2OELA 3MB9A 1R7OA 2YCKX 3PUEA 3W3OA 3ANUA 2P76A 4E8CA 3MSGA 4N6FA 3H4GA 2PD5A 1YBQA 1YE4A 2W66A 5EKYA 2DJLA 1ZAHA 1EL3A 1Z3NA 4I9AA 1H0IA 1YYAA 4CVWA 2ZXDA 1R3WA 4XZLX 2VC5A 1MUCA 4AH7A 1ADOA 3MV01 2WQDA 4ERIA 4AB4A 1MEHA 2CC0A 2V69A 1GJUA 1FKXA 3WKZA 3GAYA 3A23A 3H2CA 3OZYA 2PBOA 3TW7A 4IMFA 2UZ9A 3TYAA 3QGKC 1J6OA 2TMDA 3THCA 3KFTA 5HBFA 4H8UA 4DM1A 1DWFM 4IG2B 3R0UA 3IGUA 2VEMA 2XFWA 3TQ0A 5A1AA 2FFCA 4OQVA 1E4NA 3TOYA 1X1ZA 1OCBA 1ZQ5A 3O8AA 4M8UA 4FLOA 4D6IA 1C3FA 3F03K 4MKSA 3W2JA 3TSDA 2R14A 4L61A 2QCMA 3NPUA 4QQ3A 3QY6A 5JMUA 2BWGA 3SFWA 3Q45A 4HU8A 2FGZA 3W23A 4NG3A 4WOZA 1L9WA 1SO4A 2DSUA 3V0TA 2EBNA 2IMRA 1KKRA 1F61A 2WC3A 4NZJA 1TYGA 2VFHA 3WQ5A 2EPHA 3WFAA 3ZWTA 4DO4A 4JNYA 3BW2A 3S2LA 3DFPA 5I77A 3GWQA 4GJ1A 4Z1DA 1PIGA 1UBSA 3TONA 1O5KA 1LBLA 2F8QA 3HGSA 3H70A 3PS7A 2MANA 3P8IA 1QPKA 5F2MA 4JTJA 3JZUA 1E1EA 3UWVA 1PSCA 1Y8BA 4KS0A 5F4XA 1H1YA 2VEIA 2PRLA 3WLOA 5HJYA 3G0UA 3QGAC 3BMWA 4LUJA 4GXPA 1XLAA 4ROQA 1LL7A 1E1CB 4M7TA 4B4FA 1KGXA 1FWTA 5LGXA 3N15A 1OD8A 4NYUA 2XM1A 5F2LA 3W01A 2G4FA 4P8VA 3VD3A 3R2GA 1VFLA 1TB3A 3FKKA 2B7PA 5I0DA 3R58A 4ICNA 4B5UA 1X6UA 3H12A 3M0JA 2YOCA 3O2LA 4M56A 3TQKA 2YR1A 3MWCA 3ONBA 3R8RA 3GXMA 2QULA 1SM9A 3LB0A 4KF1A 5ABHA 1UASA 1LRNA 5KINA 1KM2A 5BXSA 4MWAD 4GYPA 3W75A 1NQ6A 3NUKA 4Y7EA 1HUVA 3JVAA 4PE8A 2WVTA 2E3ZA 5EB8A 4Z17A 4BEQA 2NQZA 2DSZA 2J25A 3R1ZA 1ITCA 3LZ3A 4DRSA 2YLLA 1A0CA 5ABTA 2QLYA 2EPMX 3NO3A 3MP5A 2ATSA 5HXMA 3PN8A 4XBJA 3RIKA 1I2NA 3MUXA 1PX3A 5LA1A 4GZ7A 1OGBA 2ZX9A 1QPQA 2FHBA 4IP4A 3QY8A 1XH0A 3G8RA 1NAL1 3T4CA 2C1IA 3ITCA 2WJFA 4UTMA 4UTTC 2VRJA 4JPGA 3IJQA 3VD4A 5D2YA 1JG9A 3W1AA 2A21A 4GYFA 1J0YA 1LWHA 1HKKA 2FB3A 3PTMA 3UA4A 2F9RA 3S47A 2KZHA 4AQLA 3K2GA 4WY0F 2D1ZA 4UTFA 1IV8A 5AYBA 1RQEA 4ZQPA 4QIUA 3UXAA 3QV8A 4RJEA 3DAQA 2OB3A 4IMAA 1PTAA 4NJKA 3D6NA 1J2BA 1OABA 4Q22A 1QTWA 4HNNA 3TYBA 1NP0A 2QCDA 2EKGA 5CGMA 1CLVA 1X7IA 4GFSA 3ZOAA 4S3BA 4Q32A 1QK0A 4GQBA 3GZ3A 1DJGA 2DUXA 4KWUA 3EPNA 1XRSA 3WMBA 3OBAA 3S2CA 2ZUNA 5I7GA 3N1AA 5A6AA 2XH2A 4DUWA 1LBFA 1Q8AA 1Z32X 2PD9A 1QNRA 3KL5A 2ZRWA 1CT5A 1YNQA 4GK8A 5AC5A 1H63A 3AS0A 5D9MA 1DV7A 4Z2GA 5T26A 1GOOA 2AGTA 3CEPA 1S2AA 4QG6A 1W1B1 4WSKA 4XTIA 4EXAA 2HCVA 5KZMA 1W2PA 1VCVA 4X3ZA 3NQFA 1QHZA 3SN1A 4IX0A 4O1AA 2GDVA 4IGMA 2VJXA 3BAIA 4Y2WA 2XGBA 2V68A 5EL1A 1TJRA 5I3JA 1FWGC 1EZWA 2IQDA 2BXVA 1XD0A 3LK6A 4OBTA 4LUTB 3ZM8A 3EDJA 4GE8A 4LS1A 3UA3A 3OB8A 1W8SA 2ZUTA 2QJJA 1XPGA 2ZADA 3WUGA 1RQBA 1WB0A 3CV7A 1ONRA 1MUWA 1AQHA 3OLDA 1ML1A 1KCLA 4DYEA 1J6PA 3F5KA 3ARVA 4H9XA 2DZXA 5D2XA 4NVTA 1F5ZA 4J3TA 3LX9A 1EJTC 4QJ4B 3DFQA 2GGHA 3M0MA 5D2VA 3TQVA 4KH2A 4C6PA 1M41A 1JPHA 2X2YA 3GVQA 2GJXA 4CN1A 3WK0A 3MDUA 3EXTA 4ORIA 4K1GA 3PZ9A 2PGWA 4MUPA 3T40A 1CGWA 3OVPA 3QQWA 3NL3A 4MJZA 2FTYA 3F4VA 3W7KA 3AS3A 1PV8A 2GFTA 1LT7A 1WQ5A 4J28A 1Q6FA 3GU1A 4CQBA 4FNTA 2V30A 1CEOA 4PTDA 4H1ZA 2ALRA 3W76A 1JI2A 3OGVA 4HOZA 3GBDA 5C9WA 1TTQA 1AH0A 1LBMA 1G7UA 5A8OA 3OEXA 1KCXA 1GOXA 1HJSA 1OYCA 3G1HA 2NXHA 3OTRA 5AZ0A 1PTDA 4Y9AA 3MUCA 4TVCA 1K9FA 3BURA 5H8PA 4J1OA 9XIMA 3BZJA 3PZNA 4IH3A 3W7NA 2GUBA 3U2CA 5LGZA 2PODA 3TEVA 3MI2A 3W2NA 3R6IA 3C52A 3QRHA 1W1TA 3AHZA 1FOBA 2W79A 4QDMA 3DHDA 1QATA 3LLDA 4EF9A 3M0LA 1POJA 1ZALA 3TTSA 4E4FA 3W38A 1LUCB 2TYSA 3UPWA 1FDJA 4MDPA 4EPKA 4UR8A 4KGLA 1JYWA 4FALA 1FH7A 1P0EA 4CNUA 3QVQA 4LNYA 2XVNA 1VFFA 2CCRA 3L67A 3LXAA 3GR4A 3WDPP 3HV9A 1WDSA 3MBFA 3W2LA 4ZFCA 4GIRA 3FK4A 4LCQA 1V6WA 1PZ0A 5HWJA 3VNJA 1XYCA 1AZ2A 4WKHA 5KSWA 2DIKA 2OWWA 5D9OA 1VPXA 4BI6A 2YL6A 4JIQA 3KXQA 4S39A 4H7ZA 3NPWA 2C14A 1D2KA 1VCFA 2P1FA 3QV7A 1J8VA 3WUEA 3BLFA 4FR6A 3W73A 4XO7A 2QCHA 4LCSA 1EIBA 5HPCA 4IUOA 3SRFA 4L5ZA 2WNWA 3B06A 1E9YB 4L80A 4HK6A 1F07A 1I60A 2Z1XA 3GTHA 1YDOA 3AIVA 4A3RA 3SJNA 1D8CA 1QNSA 4ZB5A 4LBSA 1JAEA 2A7NA 1Q6QA 3WLMA 2BASA 4RKAA 1KTNA 4Q8QA 4JTLA 3AYTA 2CEQA 2WHLA 3A12A 1M7OA 4DWSA 3KVJA 4E4PA 3MW7A 4UTUA 1XDJA 4JS3A 3KOFA 4LAUA 3RK8A 4JN8A 5D37A 1OX4B 2PF8A 3CTTA 3ZSTA 4JDYA 2WCSA 2OZTA 4MZYA 2ZWZA 1K7FA 1YX1A 1K3UA 1E1FA 4A21A 5AC8A 2J74A 4HT3A 4QNWA 2OKOA 4B4HA 3HQOA 1XLIA 3C6CA 3BLOA 1MW2A 3PTDA 1TV2A 2PRMA 1P4CA 1FCVA 4O54A 3UG8A 1BVNP 1R0MA 3GC4A 3N9RA 4E2DA 3MUAA 3ARUA 3SCSA 2X7VA 5BOOA 2QCFA 4DI9A 2YB1A 5G1MA 2ISFA 4UBPC 6XIAA 3QKEA 3EWWA 2XJ7A 2Y4SA 2WVUA 3AYVA 4AD5A 2H8XA 3MV11 3WJWA 1NDVA 3VC6A 1XLLA 3FAXA 2YX0A 5D9NA 2ICSA 2F7FA 2BODX 4P8XA 3MHGA 2NVDA 2FKPA 5CC3A 2ZX8A 3W1RA 2PLMA 4XZ9A 1MNZA 4A3HA 4L9ZA 4QFUA 2C6QA 3NQGA 4D6FA 4C7GA 4NJGA 5HNRA 2BVYA 4F48A 4P5UA 5F1VA 3WMCA 3ARRA 1JZ6A 3FJNA 3L5LA 3M5VA 3E2RA 1V7YA 3GB6A 3Q2DA 3SCQA 4DNMA 3SUTA 5A6JA 2AAMA 5DCEA 4NT0A 2BLEA 3GNDA 2Y61A 2RGMA 1ZS2A 1UR4A 5AN7A 2NZLA 3K1GA 3WUFA 1K6WA 1MWOA 3VO0A 4U5KA 4NJIA 4GPNA 3PTQA 1OFRA 4NXSA 4GFIA 1NDZA 3QR1A 4QJ5B 3UVAA 1W9PA 1R8LA 1ECQA 1XG3A 1EX1A 3WELA 5JU6A 3OYXA 4L65A 3IAQA 3HOJA 1NDWA 1UH2A 2OJPA 4U28A 2DVXA 4QDPA 3QN3A 1FKWA 3RU8X 3VX0A 1SFSA 4LS2A 4DF2A 2ZZ7A 5BCAA 3UJSA 1Q7QA 3FY1A 3GNRA 4J9JA 4RE0A 3DC0A 4MNJA 2H90A 4NJHA 1IR1A 1ZJIA 2V2DA 3C2YA 2FDSA 3WLJA 1Z8AA 2WWDA 3C0QA 3RAOA 5CAHA 3TMLA 5DMMA 4BK9A 3OVGA 5CPLA 3LPOA 3CT2A 4L6OA 4LOCA 4B3LA 4YCOA 4UQAA 2J7BA 5HNTA 2XIMA 5M5DA 2XIOA 3K4DA 2F61A 3ZVIA 3PFRA 1UWIA 4QRNA 5HNUA 1T41A 3LS9A 3IVSA 3L4VA 1L6FA 4KEVA 4RE2A 3VFLA 1UG6A 3WL1A 4WJXA 3LHVA 1OEPA 4QS6A 4O1DA 1XYAA 3BGJA 4JFWA 1VLIA 4W86A 4GY7A 1YTEA 1QUMA 4UTKA 2Q01A 4JIHA 1UROA 3LGDA 4I9TA 1KFEA 4LBUA 2ACRA 1A5OC 3ZO9A 1JCMP 2R9RA 1Z7AA 2XZ7A 4AF0B 3NEHA 4OGZA 1LP6A 5C6MA 3DN5A 4C6LA 4ZQOA 4ZOCA 1I2OA 4PTMA 3LHWA 4FX8A 4M6VA 1N2VA 1OT1A 1X39A 4FLQA 3KM8A 4UQDA 1S5MA 3TTOA 4IIHA 1RCOB 3P0WA 1XYBA 4JTIA 3HB9A 3W86A 1RY8A 1LZOA 1VYPX 1LT8A 3CEUA 1DJNA 2JBMA 3CUGA 2QVNA 1XSKA 3UCDA 3KP1A 1UYQA 5BW6A 2ISDA 2GUYA 4G6CA 2F84A 3PJWA 4QG8A 1T5AA 3LERA 3O0FA 2QCLA 3RYSA 4JKMA 3PBVA 4B9ZA 4YXGA 5LNUA 4B2DA 4HHPA 1GG1A 2PLJA 2VVNA 4JDBA 3HJZA 1JD7A 3AROA 3KOYA 5HWMA 4MKNA 4CNPA 4OUIA 2GOKA 2WWCA 1HQTA 3OG2A 4ML4A 2RAGA 2PUZA 4JXCA 1XXXA 1Z42A 3POHA 1GHSA 1ZB5A 2FZ9A 4MJ4A 4L1GA 1XIJA 4IT1A 3CYVA 4J3UA 3BTNA 1ZZMA 4GYPC 1BKHA 1XLMA 1KFLA 3R0KA 3VKAA 1EDQA 5D33A 1HJUA 2JQXA 3N2XA 2WVSA 1AVAA 5HAOA 5DMYA 4Q8UA 3EOSA 1XC4A 1R2SA 3IIVA 1MFVA 4MZ1A 4DY1A 3M41A 4AIBA 4KWSA 5IBXA 5K4XA 2YPIA 4UFIA 2PZNA 4IQEA 2VGGA 3URBA 4S3KA 5HMDA 3TMQA 4PB5A 1DXIA 1QHPA 2J9YA 1ZENA 3WZ0E 4LF1A 3RCNA 3SBFA 4G7EB 1RK5A 2GZXA 3EEGA 4R85A 3DKJA 5A95A 1JEZA 4ACYA 3GHRA 1TMQA 4GQQA 1XFCA 1TWIA 2FYMA 3CZJA 2D73A 1VFUA 2OSYA 4OIFA 4DF1A 1ONWA 3BL3A 3MP3A 1R85A 1TPEA 4ZO9A 3VIKA 1C8XA 3PNUA 4QBXA 2XDFA 3AIRA 4GKTA 2XH4A 2Z7KA 1Z48A 1E0WA 1YRRA 2VUYA 4QG9A 5IDIA 1NWUA 2E9BA 1ZGDA 5BU9A 1YHTA 1VBJA 2PTDA 3R4IA 1UOZA 4PYSA 4P7QA 3PK7A 1UKPA 3DYPA 3NURA 2I5IA 4IP5A 1EF2A 4BQ4A 4F40A 1SPQA 1EZ2A 4XSMA 2OR2A 4X9SA 1J5TA 1AJ2A 1R86A 4XZIA 1D3HA 3WDRA 2XSBA 1JDCA 4KT2A 5LNWA 2QCNA 4ADUA 5TAOA 1BGAA 3EAUA 2DZTA 1KBIA 1PWMA 2ABAA 1Q6DA 4CN6A 4PRTA 2Y5SA 4JTRA 1EWEA 4GG9A 1UZ4A 4DLMA 1OFOA 3LSCA 1IEIA 4WY0A 1XLJA 3SY1A 5H8MA 1Q6GA 1MZHA 2YDQA 3EWYA 3VNKA 3VUSA 3DH7A 3U4FA 1CW2A 4XZHA 1CIUA 4QR6A 3LLFA 3C0SA 2E5BA 3KVMA 3N6JA 4RW3A 3ITYA 2R24A 1R3YA 4MB1A 4JOMA 1P0BA 1T8XA 3JUGA 2WOQA 3VOHA 2XFFA 4N9DA 2E9MA 3LEPA 4FR1A 3UR7A 2OSWA 3H24A 1J18A 3GR8A 4JY9A 3U0HA 3RGTA 1GQJA 1GOQA 1UMYA 3T0BA 1MZRA 4L6HA 2OSXA 2O9PA 3E5PA 3HPSA 1F76A 3TTEA 3CMJA 2IPWA 4MWAB 4A2RA 1PPIA 4K38A 3ABSA 3IJ9A 3S2JA 3KS5A 3VNYA 1EH9A 4OECA 5AY7A 3HIJA 3QHMA 2E4TA 2Y5JA 3WLPA 4NAEB 3GXDA 1CYGA 4XK2A 3E74A 1W1VA 1QFEA 3LRMA 3P2VA 2AGKA 3W22A 5D4YA 3FYPA 4L4LA 1OC5A 1SYTA 2A3EA 2WHKA 1BQCA 1V02A 3PZVA 4UXDA 3S9IA 4RNJA 4XWUA 3IRDA 3VU2A 3AQUA 1UPPA 5GPRA 3UEQA 1Y65A 2P10A 5FAJA 2Y63A 1E6SM 4KWWA 3C3UA 3OVQA 3M0IA 2GSJA 1GONA 4JNMA 1LL6A 1XIBA 2X0HA 3TN3A 1PKNA 2VNCA 2Y1HA 5DY2A 3REQB 4GQRA 3CYJA 3GSMA 3TJ4A 1T7LA 1UIOA 2GSEA 3BVJA 1XKJA 1FWFC 5JVLA 3F1QA 1W1YA 1W5OA 2FTPA 4IG2A 3EB4A 3STCA 2DFAA 3H54A 3A3HA 3A5FA 4JL2A 4FK9A 2OYKA 4ZEPA 4G8TA 6REQA 3VM5A 3ISIX 2JFEX 2J8FA 1KB3A 1CXIA 1B5TA 4TTGA 2XN1A 2G0WA 3TC7A 2WM0A 3AZRA 4FNQA 3B8VA 2HISA 1IGWA 3VDGA 3LLXA 2HSAA 2VD8A 5HQLA 3OP2A 2Z1BA 5E0FA 3WBAA 4GQ0A 3DG7A 4PCNA 3FVMA 3DOPA 1SZFA 1PTGA 3TV8A 1C93A 1W0MA 3CUIA 4LAKA 1MUMA 3ZS4A 3H7VA 5FAGA 1G6CA 3PP7A 1MNSA 3ZR5A 4WJ8A 2A3BA 1WDDA 1X6NA 2VZOA 3KOWA 3L65A 4WR3A 1HKMA 5M3WA 3M7WA 3AU6A 4IGSA 4MZ8A 3LBCA 1Q4NX 3KS6A 3VIJA 4J3ZA 2CIPA 3S1UA 5I24A 2X42A 2RUSA 4YWIA 4DWSD 1B9ZA 1IYXA 3S0CA 3T6CA 4WKFA 1SSDA 3W1TA 1OM0A 4E6MA 1E1CA 3RMEA 4TXEA 3LBMA 4C5ZA 3GDBA 4O13A 5EPDA 4LB4A 3U7BA 2NLYA 2IPGA 4GVIA 4XG1A 3QQ1A 4GIAA 4IJRA 3NPXA 1TQJA 4DWSC 1WKYA 3H7UA 5BXTA 1P6WA 3TA9A 2E9LA 4H01A 3U5UA 4YVXA 1FP8A 2E6AA 2NSXA 3FSUA 3C5QA 4CNOA 5A6KA 3CUXA 1ZHAA 4B90A 2G3FA 3BOFA 3LPFA 3PPGA 5CLWA 4YL2A 5I5RA 4DEFA 4XQ6A 1AL7A 2E1DA 4A6GA 2PDIA 4ASTA 2BMBA 3O6AA 4I5UA 1XS2A 5FF4A 1DWGM 1TV5A 4UZUA 4TIMA 3NQCA 3V5CA 1RA5A 4NZ4A 2C1GA 3N18A 3CL8A 1LOLA 5FJTA 2XGZA 1WO2A 1AW1A 3PANA 1P0DA 3TYUA 3H22A 4C6NA 1V02E 4DQWA 5EBUA 3V1PA 4Z0JA 1OFPA 1FHVA 3KRSA 3DHUA 2HEJA 5DEZA 3HGJA 1ME7A 4N9CA 1RXOB 3B8TA 2BXYA 1PDYA 3JR2A 3WSUA 1BXNA 6TIMA 3SW6A 4AIOA 4LYPA 2CXGA 2PGEA 2X1RA 4NRRA 1SZRA 3GTFA 4XBSA 1V6VA 3STPA 2GVLA 4TV5A 1RK6A 4GIYA 3B8IA 4YN5A 3ALFA 3LPGA 4K39A 4C5YA 5I3DA 4GKLA 3LM7A 1WV2A 4RDWA 4W88A 4AD2A 1BQGA 1M03A 1XCXA 1GVRA 2I16A 3GIPA 3W2MA 1YTDA 4HZ6A 1Z41A 1S2VA 3T8QA 3BV4A 4QGCA 1RD5A 2WNQA 2ZX5A 2FZMA 2HMCA 3UNTA 3N19B 4NIRA 2ESCA 2PWVA 3ES8A 1TPFA 2WKGA 1RALA 1UZDA 2XN2A 1JI1A 5TBOA 4KFOA 1KM4A 5FF2A 1YPFA 4TVDA 1GNXA 4OT7A 3N04A 5EYWA 1V6UA 3DUGA 2FMNA 1XDMA 9XIAA 2WJDA 3CUHA 4EAYA 1UD3A 1MSSA 1DBTA 3W9ZA 1U5VA 4J40A 1V3MA 2R1PA 1W1IE 3BLLA 4GRSA 3Q65A 1TA3B 3SGUA 2DZVA 3I4KA 3RNDA 4LUTA 2AMGA 3EDFA 3MUZ1 1LQ0A 2GK1B 1JGIA 4LC6A 3MY9A 1NH6A 3ZWSA 3U48A 1LQAA 1FCUA 4L9YA 4J2MA 2NV9A 5C9XA 3BSGA 2W5FA 2OEMA 4HCHA 3M46A 1RQHA 3ZJ8A 3UWYA 2PDWA 4UNIA 2O9RA 4YYCA 3P0XA 3LG3A 2Y89A 3EWBX 4K37A 1YNYA 1U1HA 4M80A 2W27A 2D3NA 3LHZA 1RP9A 3KOXA 4EAMA 2D3LA 3RHGA 2DY3A 3TDFA 4P7OA 4JFSA 4B91A 3N13A 3ZQ9A 1DORA 2TPSA 2E77A 2GQ8A 3QMRA 1WP6A 3LNPA 1EC9A 4M29A 2JKEA 5JQ9A 2CLEA 3BG3A 2OCZA 1V03A 3DDMA 2H3BA 1F6PA 3BJTA 4M82A 4O1FA 4UTJA 5FL1A 4KBXA 3E2QA 3B3DA 4JTQA 2PTWA 4YTUA 4POCA 4AAJA 3KRUA 2VFEA 2ISVA 3BICA 3OQEA 3MO4A 4R9OA 1WDWA 4RDYA 3PZGA 4HPNA 5AECA 1GYNA 3NQEA 5IHSA 4K68A 2JE8A 2EPOA 1KFKA 1RPXA 1UH4A 2QS8A 4QEHA 1TPWA 1GQNA 4JHMA 3WLKX 3NZQA 3CIXA 4O14A 4XVDA 3HGOA 3CH0A 3KCLA 3V1HA 3TW6A 4B2DD 4FS9A 1T0OA 2TAAA 2D0HA 2ZYFA 3WQVA 5DY3A 4DJEA 1C29A 2NVAA 5T9BG 1QNOA 1RCQA 3B8UA 3T0DA 4XUYA 1IGSA 1DKWA 4NUWA 3RITA 1FVPA 4MNKA 3UVIA 4GUGA 1JRBA 1H0GA 4LQ1A 2BOEX 4IJBA 4PZVA 2Q3RA 3UJRA 3O1NA 5M2FX 2DQXA 1VEOA 4KWOA 1XLBA 2CZDA 3WDIA 1V3JA 2Y70A 1RP8A 1EQCA 2YBTA 1E71M 4HMEA 3IIPA 3GE7A 3L7RA 1M9HA 4DPQA 3VIPA 3F2BA 1B2YA 3UG5A 4HCLA 2J75A 2ON3A 3L4WA 4H4IA 1IQ8A 1J11A 1V3KA 1KBKA 2XFRA 1TFVA 2O9OA 3BE7A 3EEZA 3SY8A 3BW4A 3QV6A 4B15A 4NNCA 2W67A 4IIDA 3LXCA 3CZLA 4IF2A 1TV7A 1BYDA 1V77A 1UC5A 4ZQNA 2IKIA 2JKAA 4CCZA 3GNXA 5D2TA 4PTXA 1PIFA 4N2YA 4NZ5A 1PB0A 3TYZA 1H7NA 1EJVC 3O16A 4M81A 3W2KA 4KERA 3HMJG 3TJIA 4DJFA 2KX9A 2V67A 4HD5A 5C2GA 3FS2A 2NVCA 4K8HA 2ZWYA 4RZ6A 3F4NA 1Y7VA 1A5KC 4H9ZA 5T8GA 2FTWA 2VD9A 2GDUA 3VIFA 1U33A 4IQDA 3UW6A 4PRRA 3ARXA 3DXIA 4ZTXA 3W29A 3TC3A 4FMVA 4R7OA 3U6WA 4ZO6A 1N8IA 2E8ZA 3WJSA 1TVNA 4KPLA 5G1TA 1OX4A 1SJCA 3W7HA 3SDOA 4L4MA 1EJ7L 4LNCA 4A3UA 2NXGA 3H7RA 1M6JA 5CGTA 3PG8A 1KTCA 1HIZA 5G1YA 2E6DA 2V3GA 1TTJA 1B90A 2BOFX 2G3IA 1NWRA 1UA3A 1UUOA 5JH1A 3UESA 3ITVA 3CAVA 2BHYA 4GGBA 1OZMA 1FWHC 1MO0A 1J12A 3P5ZA 2QV4A 3BGAA 2ZXQA 3EKLA 1I0DA 2P8CA 3RUBL 1RUSA 3W7PA 3VKCA 2FZNA 4WDUA 3ZZ1A 5FF0A 2QJHA 4TOQA 3IUDA 2VC9A 1LCOA 1H62A 3KZSA 5IXEA 2J78A 1HJVA 1WXYA 2AMXA 3QFWA 2ACSA 4DBDA 3AI0A 3W07A 4R5EA 2GGGA 4ZL1A 4HCDA 4H9YA 1Q8JA 1KQZA 2C71A 3GNPA 1LM1A 4DUVA 1QNQA 4RR4A 2NW0A 2VOMA 4HN8A 5C71A 3KTXA 1MRAA 1YPIA 3OHMB 1PKLA 1RJPA 1W5PA 1EBGA 3K5XA 4LVDA 3A9BA 4M7SA 1F4HA 3NDZA 2XSXA 3RILA 4YTTA 2HS6A 2V5KA 2ZZ4A 3CZEA 3Q94A 1TSIA 3VNDA 4PL1A 4GLEA 1DYSA 2UY5A 3NQ8A 1VHCA 3GXPA 2OYMA 4HTYA 1H4PA 4J7RA 3OW1A 2ANUA 4F0LA 2PU1A 4UOZA 3E49A 1XC6A 3KCOA 2A7RA 1BG4A 1EEXA 1T96A 3KX6A 3UCCA 4HZ8A 3S5OA 5AVNA 2DT3A 5MF5A 4UFMA 4ORMA 3UG4A 1WX0A 4HVXA 2BVWA 4MSSA 2W4XA 1PYFA 1E4IA 4JTFA 4TV6A 3H4WA 1OZQA 3NQAA 5K2ZA 5I23A 4KCVA 3WLRA 1WUEA 3UJ2A 1J0IA 3W1LA 3A4JA 2O7SA 5J5DA 2IQTA 1QNPA 1PUDA 5HJXA 2QPUA 5I00A 4IPNB 1JGMA 3MKVA 2I9UA 3SAZA 5HANA 3D47A 2FVMA 3CUFA 1Q3NA 3P60A 1JZ7A 4MYXA 4L4PA 4M3PA 2AL1A 1QBBA 3SUSA 2J47A 2X40A 5I3FA 1SZGA 5AHMA 4PCFA 3WF3A 4GYJA 3WLTA 5ABFB 3VZXA 1QW8A 2XM2A 3E5BA 4MY9A 5FI8A 5BU6A 2BY3A 1V6XA 5FJUA 2VR2A 3SGGA 2Z6JA 3B9NA 1P48A 1W3HA 4JIRA 4K8GA 1XLKA 2YCLB 1I2QA 3PSWA 4P2VA 3LYEA 4MMWA 1TZZA 7ODCA 3VNLA 1JDFA 1FHLA 1KV5A 1UKSA 2PF0A 3TNBA 3TN4A 1LWJA 1LLZA 1DOSA 1J96A 3PWIA 5I03A 2XH7A 2PP3A 1UKQA 2VEPA 4O4WA 3ZT6A 3EA1A 4DZIA 2R94A 3INPA 1BVWA 3WLNA 1LORA 2B7QA 4AISA 7CGTA 3GRIA 3SY5A 5GVJA 1OC6A 3RJYA 2D2HA 3UY7A 1TREA 2W62A 2X0SA 4HSOA 2QDGA 2DT2A 4XKYB 4C6DA 1XIFA 4AF0A 2RKXA 4J3WA 5CJ5A 5J8LA 3KVKA 4UOQA 4US6A 4C7DA 2D20A 3MZ2A 4LYQA 3N9SA 3SQLA 3TCEA 4JNZA 1OIFA 5M1TA 3BANA 5E0KA 3RR4A 4AEOA 4N7QA 1XL9A 3GDKA 4AW7A 1A4LA 1XQKA 5KMYA 2Y88A 3ANVA 2BP1A 2V82A 1F7BA 4IICA 1KWKA 3MMUA 4NJJA 4AHQA 1HVQA 2YZRA 5B7ZA 4DZAA 1Q85A 3T1GA 5LZLA 3QPYA 1F74A 5REQA 4MFEA 1WKEA 3LENA 1K7EA 4RL3A 2GJXB 2HNHA 1GPFA 3IJIA 4TX9A 4M5PA 1CLKA 2X09A 5D03A 1GVEA 1NOFA 3OOQA 2RFGA 2NT0A 2OKTA 1BGGA 1J4EA 3I3EA 3TSMA 1SGJA 3W37A 1US3A 2EXOA 2GLKA 2PTYA 1KBJA 4LYKA 1H1ZA 3DFYA 3IJDA 2ZC1A 1LLOA 3BLPX 4B3ZA 3EWCA 3TU9A 3A24A 4JTCA 5DANA 4YVVA 1DE5A 4K3ZA 4MYAA 1F8IA 1AODA 2YIHA 3LCLA 1IZCA 3BCFA 1TCMA 2OODA 3PC0A 1VJIA 4F3HA 3VGGA 2FIQA 3DECA 1SU5A 1CXFA 2BY1A 4P7RA 1T8QA 4GY1A 5LSMA 5DXXA 5FD0A 1JULA 4UOJA 5K9DA 2GGEA 3EPOA 3LRKA 2XYLA 2VX5A 1SZEA 2CZVA 1HL8A 3ZT7A 3SI9A 2YGYA 4QLKA 3T7VA 5EMUA 2FMOA 4Q8NA 1SJAA 2Z1SA 3RU6A 4EWND 4Q4KA 1HJQA 3VAVA 1MFUA 1KFJA 3VDBA 2NXIA 3UNDA 1XRTA 1AH3A 4D8AA 5CSUA 1KXTA 3VGFA 3TROA 2VENA 1F2JA 4IXXA 1PXGA 1W9UA 3O15A 4BZYA 5C2XA 1WZKA 1W91A 4DXVA 1O60A 5GNXA 3LNMA 3HA1A 3MPGA 1ADSA 4D6EA 3ZMRA 3KBNA 4GNJA 3V35A 1EB3A 4S3JA 3FA4A 5K9CA 3P5YA 5AYZA 3E0VA 3VOJA 1TVLA 4UCFA 2VO5A 3W72A 3HFTA 6CGTA 1A5CA 2BBFA 1ME9A 1IXNA 5HINA 4X61A 4HPGA 1LQ2A 3UR8A 2G3MA 1UJQA 2WSQA 5F1UA 4M1RA 1UB3A 1XDLA 4LW7A 4O1EA 2VTFA 1JL8A 5LNRA 4M6UA 1A47A 1BEUA 4PMVA 3SQMA 4IWWA 4M19A 4YWSA 4DWSB 2FGBA 4I5XA 4I7VA 4FOKA 1JQVA 2V5CA 2G97A 1FWJC 2V3EA 3NXLA 3CUJA 5LHFA 3T42A 5K4ZA 2OX1A 1ZJBA 3HPZA 4Y9OA 3CHFA 3EDDA 1H50A 4W85A 4V2XA 4QNEA 1HZYA 4MY1A 1AZ1A 3TTQA 1MQRA 2IQ0A 1GQLA 2EF9A 2DW7A 3WD1A 1L6YA 5IRPA 1W3TA 2PA6A 1JXKA 1UP3A 3CQ0A 3AAMA 1IXQA 4PUJA 4LV4A 1H7RA 3C2VA 4CU7A 3SRHA 1LTDA 5FJJA 5BMWA 4S38A 2HJPA 5H1WA 1QT1A 3EKZA 5EY5A 1J0ZA 1KXQA 4PH6A 3KW3A 4S1FA 3AIBA 2QEZA 1VRDA 1W37A 2ZICA 3ABRA 3JS3A 1O5XA 4MM1A 1VR6A 2DEPA 5CBJA 1YE6A 2WMIA 1PEZA 3IIXA 3FSTA 2R1NA 3QZAA 1XLHA 2A1YA 3ANYA 2QPXA 1BF6A 2O92A 4HKPA 1K70A 6XIMA 4BF7A 1XQLA 3WK2A 1WE5A 1XLEA 2QJMA 3PUOA 2PFHA 4W4QA 3VUPA 4NZ3A 2Y8VA 1NWTA 5HMEA 4LALA 4DJED 2HPMA 2CLFA 3A47A 3CAWA 2EG6A 1CPUA 8CGTA 1JZ4A 3GUGA 1BPLB 1J5SA 1OGSA 4NAFB 2VDHA 2QJIA 4FOJA 1A5NC 2G5WA 3UYCA 4JTEA 3VNIA 4YU1A 3GBEA 3H4XA 3REQA 2ZTJA 1XBZA 1K02A 4JX4A 3PPFA 2J88A 5DRIA 3BOXA 4EKJA 2FH6A 3AALA 3W1XA 4JYEA 2HBXA 3WF2A 4GJJA 3CL6A 2E25A 5CC6A 2BDQA 5CXPA 4NILA 4DJEC 1KR0A 4PUEA 4R27A 4HNUA 4LUSB 3GM8A 1S5VA 2WNZA 2EQDA 4WDWA 2Z6IA 2PTZA 3WLLA 5AOUA 4KEUA 3I7RA 3TZNA 2PWGA