1KO1A

Crystal structure of gluconate kinase
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
172
structure length
163
Chain Sequence
TTNHDHHIYVLMGVSGSGKSAVASEVAHQLHAAFLDGDFLHPRRNIEKMASGEPLNDDDRKPWLQALNDAAFAMQRTNKVSLIVCSALKKHYRDLLREGNPNLSFIYLKGDFDVIESRLTQMLVTQFETLQEPGADETDVLVVDIDQPLEGVVASTIEVIKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Gluconate kinase
publication title Conformational changes during the catalytic cycle of gluconate kinase as revealed by X-ray crystallography.
pubmed doi rcsb
source organism Escherichia coli
total genus 62
structure length 163
sequence length 172
chains with identical sequence B
ec nomenclature ec 2.7.1.12: Gluconokinase.
pdb deposition date 2001-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ko1A00
4M9XA 1RYFA 3CRVA 2H17A 4QHYA 2F9MA 3B5JA 1VHTA 5KHOC 3UWOA 2RGDA 4MRNA 1CBUA 1J8YF 2PL3A 3L0IB 1SXJD 4GL2A 1ZU4A 4MKGA 1QHHB 2ZETA 4HB0A 4TT3A 4NBSA 4XSGA 2JLUA 1G8FA 1AM4D 1BMFD 1KY2A 1N6LA 3TRFA 1R5NA 1ZD8A 1N3BA 3RS5A 1W7AA 4R71A 1D2EA 3C14C 4ZCLA 2GXQA 3G82C 1LFDB 1XD9A 3BIFA 3FKQA 1F60A 3M1IA 1R0WA 1DAFA 3EZFA 3BFXA 2GCNA 3LX5A 4KI0A 1SVLA 2GHIA 2QMOA 2DBYA 1OFIA 4A8JB 2RAPA 4FXPA 1M7GA 1MO4A 1KNQA 3FWYA 4CGZA 1ZM3A 1CU1A 3PEUA 3AVTA 3QXHA 2BJWA 4C0HA 4LJ5A 5FBVB 2E87A 2VHJA 3NIBA 4XD7A 5G3ZA 5UKDA 1N0WA 1RFLA 4A92A 4IDQA 4D81A 2G1KA 4QHSA 4ZPXA 1F2TA 1XEXA 1VIYA 4KSCA 2W0MA 4R7ZA 3TR5A 5AUQA 3ZZUA 2VHQA 1NN5A 5B30A 4LI0A 4PQYA 3TE6A 4M8NE 2BBSA 4TLBA 3EW9A 2V4ZA 3FMPB 3GFTA 1FUKA 5EXXA 2Q9AA 1OV4A 5FOUA 4V0MA 1NNEA 1J2JA 2HLDD 2F6RA 4OBEA 3C8UA 2WJVA 5TXGA 4IXNA 2ZEJA 3VR4A 1E9DA 1P7CA 2JASA 1U8YA 1AGRA 3U60B 3RC8A 3MCAA 4LYJA 4F4CA 1P2UA 1IXSB 1QHSA 2FFHA 3ZVMA 5HCNA 4TWZA 2NG1A 2WJIA 3T1TA 5BN5A 2A5GA 4CYMA 1AQYA 3RS4A 1Z83A 4TL9A 3P20A 1E94E 3PEVA 2NZ8A 3U44A 1E9EA 2XB4A 1EX6A 4A9AA 3ZDQA 4QJ3A 3K1JA 1AZSC 3TR0A 3T5DA 1AS3A 4HAWA 4O2RA 4L9SA 3TAUA 2C04A 4D6PA 1Q1ZA 2AX4A 5DLQC 1NSTA 1E79A 1R0YA 2JGNA 1IOZA 4IOKA 1OYWA 3UWKA 2WZQA 2ZREA 3SHFA 2J0UB 1F2UB 1W44A 1U90A 1FW6A 1HTWA 2ZJBA 4E03A 1T5LA 3CRW1 4KVGA 4MGIR 1PVOA 4BWYA 2NMVA 2A78A 3A1UA 3LNCA 4QJ4A 2GJ8A 1N0UA 4KO8A 3W5JA 4CEIA 2BM0A 2QZ4A 3D7MA 2R44A 1TF7A 1IN8A 4JLDA 3MWYW 4MGYR 3K0CC 1DAKA 1VIAA 3ADKA 3KKMA 2H1LA 5JJKA 3B82A 4LZZA 2QRZA 2CHVA 1KO7A 2W0SA 3IHWA 1G17A 4D4MA 1UKYA 3BB1A 4D4KA 4NHOA 1KO5A 3FHTA 3GEHA 4CW7A 3GJ8A 2ZJ8A 2FU5C 4C0SA 4R2IA 5FR1A 1QHNA 2WWGA 1DPFA 1JJ7A 1N5LA 1SQ5A 3WYGA 1AQUA 1P4SA 1W2GA 5AJXA 3SDZA 1X86B 4P4SB 4HEJA 2J1LA 1T4GA 4D80A 4QG7A 2N42A 5K8TA 2GEDA 4PR0A 3G0HA 4Q47A 1D2MA 4WOPA 4CEJA 1I4TD 5GJCA 1QDEA 2LWIA 3EZ6A 1Q3TA 3W3ZB 4G3XA 5KDLA 2FMXA 4OHXA 3KDSE 3AH8A 3HU3A 3U3RA 2FH5B 4LHVA 4BRUA 3U4QB 4U7DA 4H1VA 1NIPA 1BYUA 2FN4A 1FX0B 2G9NA 4PPQA 1OB5A 3C16C 4RVCA 1EFUA 3O8BA 1GKIA 3BB4A 2CL6X 1XTJA 5LB2A 1HV8A 1SVSA 1ZCBA 2DWQA 2EFCB 5DI3B 2XZPA 5EP4A 5KDDA 3HU1A 3E1SA 4V0ME 4FINA 2WOOA 1CS4C 1U8AA 1LNZA 2MMGA 3DKPA 2BMDA 4Q1CA 4A0HA 1OKKA 3IUYA 4RD6A 3V9PA 1N6OA 2WWYA 1OLOA 2J9RA 1Q44A 1G4UR 4PZYA 3CX8A 3WNDA 1DAIA 1JJVA 2QT0A 2PCJA 4DBLC 3GLIE 4EQ6B 4ASUA 4K8OA 3VR2A 3EAQA 3KFVA 1EGAA 3CX6A 3RWOA 3AVXA 1IONA 5F2EA 2VYFA 5GVSA 1OXSC 1CRPA 5CIQA 2REOA 4IHQA 4PHHA 1AN0A 1HQYE 2CL7X 2ZSBA 4A82A 3WP1B 2QM7A 3W90A 2J5XA 1SHKA 2REBA 3QIAA 2OHFA 2GJ9A 4X8MA 1VG1A 2IHYA 3N70A 4JS0A 1G291 1MKYA 1OFHA 2GJAA 5AR1A 2Z4RA 1M34E 3JZMA 1AJEA 2IYZA 1QG2A 2J7PA 3X2SA 4Q03A 4KXFB 1S8FA 1NY6A 5ELXA 4TSFD 1IN6A 4RFSA 5F3WB 4TMKA 1I2DA 3TLXA 2YWEA 4IEEA 2Z6VA 4KBFA 4DUGD 4ZI2A 4X8HA 4EJSB 2ZI3A 2CNWD 3AVUA 1IAQA 4E22A 4BLRA 1A1VA 2WWWA 2PMDA 4NYJQ 4IOJA 1XD8A 4GMDA 2ZS9A 4JJZA 4A2QA 5HE9A 4BQSA 1CP2A 5JHHB 5G41A 4LDJA 2B21A 2Q0HA 1SVMA 4BZQA 1A2BA 3I73A 2ATVA 4LRWA 2HV8A 1DAGA 2C9OA 2ZU0C 4DSUA 1SVWA 3AUXA 4LJ9A 2F43A 2W6IA 3QG1A 2F9LA 1U9IC 2CCJA 2DYKA 2Q3HA 5ANRB 4CDGA 1S0UA 4JYCA 2H8KA 4M1YA 3K70D 3U5ZB 1EFTA 3EZ9A 2QSYA 3L2OB 3TH5A 2W2VA 1FL9A 4PO1A 2W2TA 2CEAA 1SVKA 5TB5A 4TLCA 1Z6AA 1TTTA 2J46A 1NVVQ 4EKDA 2C98A 3VU9B 2QUZA 3H0KA 3AF4A 4GZLA 2XSZA 5JSZB 4FWTA 1P72A 2D7CA 3OE7D 3AKEA 1SKYE 4B76A 2ZRMA 1BYIA 3BORA 4C2TA 2ZVQX 3ICQB 1EK0A 1KI4A 4Q9IA 3GCGA 1X3SA 4URYR 3R7WB 2VA8A 1VMAA 4M21A 4UJ3A 2J0QA 3Q72A 1OH8A 1TQDA 3WP0A 2QRNA 4YLGA 3QKSA 2D7DA 4RCZA 3GJ4A 1ELOA 1U0HC 1XJ0A 1QHXA 2TMKA 3P26A 1CR2A 1M2OB 2ONJA 4Q4AA 1ZNYA 4TYYA 2GF0A 4LOAA 2V6JA 4DSTA 2G77B 3K09C 1N5JA 4B3CA 4TL8A 1K8RA 1MH1A 2G0TA 3LX8A 1XPUA 1GRRA 4FD2A 1Z0JA 2HUPA 4XIGS 1SULA 3FMIA 2W6JA 3EIEA 4NCNA 4HLUA 1G64A 3ND8A 5FPSA 4Q5IA 1SVOA 2V9PA 1N6HA 1RVDA 1R5OA 3IKJA 3ADCA 5EXTA 1X8LA 3P27A 4C9BA 3BXZA 2BV3A 3GJ5A 4LUCA 1TEXA 2OCPA 1GP2A 3B85A 4Q7KA 1H8HD 2VL7A 1QG4A 3K53A 4IOMA 5KSPA 3HPQA 4V02A 1KDRA 4GP6A 3SQWA 1Q21A 3TSWA 3J81k 4OJKA 4DRZA 3U7HB 2FNAA 2DFNA 4Q1BA 1II8A 2ERYA 2XGJA 4P0TA 5HKKD 1G9XA 1KMHA 4OHWA 1YZQA 1P9WA 1YZGA 2ECKA 2FPLA 4BFZA 5E3HA 1SXJB 4B35A 1MABA 2HT1A 2L0XA 4FMCF 2QP4A 5A4JA 4MKIA 4XSHA 1H65A 2IA5A 3VHXA 5HZHA 2FFQA 5FL7D 2GNOA 4KYUA 2Y8EA 1YZLA 4WBSA 4B34A 3BWDD 2IEZA 1G16A 2ZYVX 2IHBA 3QVVA 3EASA 3RRYA 2IF0A 1VG8A 2PCLA 4YMTA 4V0NA 3GLFE 1ZUNB 3BC1A 2B8WA 4YMVA 4DSNA 3Q85A 1O87A 2JLSA 1OH6A 4UXIA 2C9YA 1KKLA 4B44A 3EPHA 3SBEA 4IKEA 1Z6GA 2JJ1D 2KSQA 2D06A 2OILA 2AD1A 4YQFA 2G1JA 5DNYB 3GEIA 4Q7MB 5KYKA 4W5JA 1N6IA 3T06B 3K0SA 1KSJA 3LDAA 3A8TA 2WWXA 4MRRA 1UKZA 2HF8A 3QKTA 2NPFA 3SZRA 4NYMQ 3KQUA 5CB6A 1X8KA 2HYDA 1CJVC 3KJIA 5LBIA 4G1UC 1MO3A 2BC9A 3U61B 4LYFA 2QE7A 4DHEA 1Z5ZA 5FTLA 1OXXK 4Q4JA 3PXGA 2JDID 4JYBA 4B3BA 5L3QA 721PA 5JECA 4DIDA 1NG9A 4JLNA 4B2LA 2ZS8A 3MJHA 1E6CA 1LW7A 1M1YE 2NO1A 5JRZA 4HUQA 2OO7A 3PV0A 4DDTA 5FBRB 4OHZA 3CH4B 1OXUA 3TJZA 4JLKA 4BZXA 2R9VA 5KO2A 3AQ4A 3TKLA 3CRMA 4KFSA 5J4HA 1DARA 1Q1QA 4AYXA 3VKGA 1I4DD 3MWKA 4G0NA 4Q9LA 3T34A 1DELA 4D0GA 4AI6A 1CXZA 3N2IA 1G8GA 1CJMA 1IHUA 2HDNB 2XITA 2GEVA 3OFNA 3QPVA 2V1UA 2QAJA 1KO8A 1QHYA 3E2IA 2BKEA 3TQFA 2IC5A 1P2VA 2V6IA 1JAIA 2PZFA 2ZJOA 2O8BB 4QGFA 2IS6A 2OFWA 1OF1A 4TYWA 2BEKA 3SEAA 2PJZA 2IYUA 2P5SA 5IK2A 1DADA 4XWKA 4ARZB 1X1SA 4GOKA 1E1QD 1OHHD 3NDBB 1N2CE 4KJZA 1FUUA 2OZEA 2GAOA 3B1VA 3REFA 2IS1A 4M22A 2VP0A 3QPUA 3T1OA 3K0CA 2WMOB 3BS4A 4RZ2A 1GKYA 4B2IA 1W36C 4KU4A 1ZM9A 2GK7A 3OEED 4Z51A 1YR9A 3FKSD 4B48A 4ITRC 5JCZA 4ZDIA 1YHNA 3M6AA 1YR7A 2QEQA 2FSGA 4JSTA 4UQOA 5DGXA 4JL6A 3VMFA 4F4IA 5BYKA 1SVIA 4DCSA 1HQCA 1QVRA 2CHQA 2ZRCA 2WBLC 1KMQA 1R10A 3RSLA 4BUJA 1W4BA 2AL7A 4A8JC 2G3YA 5TVKA 4FCTA 5J4LA 1NMYA 2VP2A 3I1FA 4KODA 4Q9JA 1YZKA 1XTRA 4AG5A 1XJCA 2QMEA 2C03A 2PZGA 3T61A 4DVGA 1XTKA 4BLTA 1XPRA 1VCNA 1BH2A 4MYHA 3SYKA 2CDNA 3CWZA 4JMPA 1K5GA 2XB2A 3BBPA 3I32A 2HT6A 1DAHA 2QGZA 1E0SA 1E0KA 2PZEA 1E2EA 3EIQA 3EWSA 4IVQA 1OYYA 5C4MA 3FMFA 2LCFA 2QI9C 4GMXA 3ZGXA 2HJGA 2R6AA 1S9DA 5KTYA 4GZMA 1ESNA 4DKXA 2GILA 2QPTA 3DM5A 4QXAA 1YQTA 1G8HA 4IJMA 2CCGA 3OIWA 1F2TB 2V55B 2ZR0A 3CLVA 4KLZA 4Y0VA 4TL7A 4ZKEA 4B3FX 3R8CA 1JR6A 4DWJA 3QF7A 2GWHA 3P4YA 4R9UC 2F1HA 3CBQA 4AY2A 1A5TA 4URWR 4BRWA 3TUZC 4ESHA 1KI7A 1BMFA 1YR8A 1MO6A 1J70A 1OIWA 4IEIA 5FUXA 3PITA 4M9ZA 1NMXA 4DLTA 5K8LA 1P2SA 4KCGA 2BJVA 3CONA 1ZU5A 3KKOA 1Q22A 1LV7A 3B1WA 2XJ9A 4BFSA 2MSDB 3A4LA 2JLVA 1NN3A 1F5NA 3GLIB 1NI3A 3LA6A 3FDIA 2IUTA 3EPJA 3CZQA 3NHBA 1NMZA 3RRNA 4A36A 4YDSA 1FFHA 3VTKA 3N5CA 1G3QA 3KTAA 1WXQA 4KHZA 4EDHA 5P21A 1N6PA 1Z8FA 4BLSA 3QXJA 2IS4A 4UNRA 4PZZA 2NZJA 2PEZA 2WSSD 4D26A 1XX6A 1TUEA 4R2HA 3RAPR 3EG5A 1VHLA 4HZIA 3MFYA 2JIZD 2JLXA 3D3QA 1W4RA 3GJ7A 2X2EA 3BFVA 3CPJB 4NZYA 1DAMA 3F0TA 2QPOA 3LBIA 1R2QA 2EYUA 1L4YA 1S1MA 3B9QA 3DPUA 2BMJA 2GESA 1ZD1A 3CKLA 4YC7A 5FPTA 3HR7A 3LH5A 4NL4H 4LJ8A 5F9HA 3AVWA 2HLDA 1E9CA 1YZTA 1IJFA 5J40A 1Z0FA 2NTYC 1DOAA 4BECA 1M7HA 1R8SA 4UNNA 1EFRA 3OAAA 1GIAA 1D5CA 2IK8A 3KKQA 1GL7A 2QM8A 3GEEA 3I72A 3GJXC 3GPLA 5FPKA 2ZU6A 3LO5A 3OZXA 4UXJA 4AYTA 4AKGA 1W1WA 3E5HA 1DO0A 5J4YA 4WA7A 4LPKA 3T35A 3VNVA 3I8XA 3PCRB 1RKBA 3QF4A 4C0JA 2CLCX 4OI1A 2ZTSA 1Z47A 2EVWX 2XAUA 4H9GA 4M1TA 1NY5A 3LVQE 1E2LA 1KYIA 4DLZA 5EXPA 4TMWA 4PXAA 4NTZA 2GZHA 2R6GA 2E9SA 3HYTA 5B2ZA 2BCJQ 2GCOB 2O8FA 3TSOA 1XXHA 3SU8A 1A82A 4A2WA 1VCOA 1XMVA 1Z06A 1T3LA 2GBLA 1LTQA 4JSYA 4LV5B 4PAMA 4CEHB 1IJEA 1XTQA 3Q8XB 4TTPA 3IPXA 4WVFA 5GJVC 4N0DA 1II0A 3ZVRA 3MG9A 1SKYB 2CCKA 2O8EA 4Q7LA 2QBYA 2C96A 2BEJA 5KSYA 2ANCA 1UDWA 2VPPA 1TPZA 4ZIRB 1Z0KA 2A5JA 4Z1MA 3FOZA 4YONB 3DKVA 3QBTA 4B6FA 4YMSA 1L2TA 1NBMA 2QROA 4PX9A 5CJPA 1G41A 2I3BA 3U2QA 3K09A 1PUJA 3THYB 2ODEA 4HLCA 1HH4A 1GAJA 1D9ZA 1T3SA 2C2HA 2RB4A 3OESA 1FP7A 1H8ED 1CR4A 1P6XA 5BXQC 2WAYA 3TIFA 2ZI4A 3S1AB 3VKWA 2R6FA 2GJKA 2VP5A 2BWJA 3SC3A 1E2IA 1KSGA 3DM9B 4YMWA 2VO1A 4CF7A 2ZRDA 4V03A 4Z54A 3LV8A 1US8A 1KK3A 5AUPB 3SBDA 1G3RA 4LV8B 3HPRA 1PLJA 1KAGA 4FWIB 2VP9A 2NO0A 1T9HA 1RRCA 5J47A 3THWA 3KUDA 2AXNA 1OXVA 4M0LA 1X1RA 1KI6A 4LPSA 4Q1AA 2O52A 3CM0A 4EUNA 4MA4A 1EFCA 1G8YA 1TU3A 4KITB 1ZVQA 3WXMA 2B8TA 1K6MA 3KUCA 3BERA 3UXMA 1W0JD 2ZRFA 5CJ2A 4LY6A 3Q5DA 4NE2A 4MRPA 5BYJA 1KO1A 1U99A 4LSGA 3QNUA 1G8PA 1JNYA 3VFDA 4EPXA 1ZW6A 3GLGA 221PA 3T1QA 2ZJYA 4HAZA 3SOPA 1PLLA 4MYUA 4AKHA 1E2DA 1E2MA 1S96A 2AR7A 2UKDA 2XNDA 4QGHA 3GJ0A 5FBWB 2XOKD 1WA5A 2J3EA 4A0RA 1E96A 4Q1DA 1NG1A 4Z8XA 4US0R 2BKUA 3VR5A 1JBKA 5C1BA 5CB8A 5HCIA 4DLWA 3O8RA 3KQHA 3FMOB 2DCUA 5FI1B 4PQFA 2QQEA 3GLFB 4URUR 3NHAA 3AGPA 3FPAA 3AF1A 3X1XA 2CJWB 6Q21A 5LD2B 4LGMA 2ZQ5A 4RSGA 2GXUA 2ZRJA 3QJYA 1C4OA 3KB1A 3QEOA 3L8ZA 4TYNA 1OXTA 1XXHE 2OSBA 4MDFA 3X1WA 1G5TA 3U7FB 3UK6A 5C2JB 3AEZA 3QPWA 4DUGA 1NVWQ 2YZ2A 5J4VA 3RS7A 1X6VA 5E4FA 4ZI3A 2CNWA 3EWAA 3U3MA 5DISB 3UIEA 2OFXA 4TT3D 4LHZA 2WICA 4JVMA 4Q9KA 1UBGA 3LQRA 4L15A 1JR3A 1NKSA 1IN5A 5DN6A 4YXWA 1E99A 4LC1A 4I99A 1N25A 1FNNA 4QBFA 5CLLA 5CITA 1NBME 2VHUA 5FFMA 3SFVA 4CRWB 2EW1A 2HF9A 2PX0A 3AUYA 1IM2A 4M1SA 1GL6A 1JXMA 2FJUA 1M7BA 2VF7A 1Z3IX 2A30A 4DCUA 4MUBA 1W47A 4TMVA 3SYLA 2DPXA 1T6NA 3ASYA 4PZLA 5TARA 4ZDWA 3W8NA 3SS8A 1COWD 3AF0A 1NRJB 3QKRA 3I5YA 5KUTA 1KI1A 1KDPA 3QQ5A 3PENA 3ZQ6A 3NTUA 1SKQA 2NPIA 3K0AB 1W5TA 1LS6A 2GXAA 2IYTA 3CRRA 5FTNA 1FNMA 3BOSA 4JKYA 3VX3A 4QM6A 1SXJC 1QHHA 2J45A 3AVQA 3A37A 2WIBA 3V00A 1Z6TA 4A0GA 3QKUA 2QORA 1XF9A 2ATXA 1YZUA 1V5WA 2WMNB 3GLHB 3SE0A 5SZIA 2EWWA 4P4TA 2Q9BA 3IEVA 2KWIA 1CIPA 1T8UA 2VQSA 3QXCA 1TX4B 5H70A 4AKIA 4AKEA 4DT1B 1J7KA 3R9IA 1KKMA 1G3UA 3D31A 3GLGE 2XXAB 4NCJA 4I1OA 2ODBA 3LY5A 4B2PA 1XMIA 4O25A 2GDJA 4KLNA 3OEHA 2ANBA 1GZSA 3KZ1E 5KSZA 4A8JA 1FZQA 3RHFA 1NLZA 1OFUX 1ZM4A 3AVOA 2JJ2A 3A58B 4F93B 1RE0A 2XZOA 1TQ2A 3T1VA 1XMSA 2IS2A 4TLAA 5JHGB 4M1KA 2FGKA 5L3RA 4OI2A 5DHAA 4IW3B 1KHTA 4EIWA 3DL0A 2IW3A 3ASZA 2WIAA 3FTQA 4OK5A 1NF3A 2IYWA 1E79D 2AWOA 1M74A 2CK3D 4TL6A 3RS2A 2JLZA 2AXPA 4EPTA 1HE1C 2ZE8A 2CE2X 4PTLA 4M2LA 2IUSA 2CE7A 3TUIC 2RHMA 2QNRA 4L9WA 3GJ3A 4HZUB 2VSOA 2C8VA 5HZKA 2OBLA 4UNPA 4ILEA 1XD2B 3L0PA 4Q4HB 2OCAA 3T12A 3CNOA 1E9FA 5B58C 2X1VA 2G6BA 4FMDB 1CJTC 2IBMA 2DB3A 4XWAA 2WKQA 4N1AA 1U2RA 3RANA 4W5WA 4D4JA 4PPGA 2WVJA 4B3DA 1TQ4A 4XJXA 1KK2A 1UBFA 4O2LA 2DFTA 1JR3E 4FCWA 2WJJA 1J90A 2QY9A 1O3YA 1W4CA 2XJ4A 1KNXA 5FPHA 1UM8A 4TQUS 2FFBA 3TGPA 1S4QA 1F6BA 1S3SA 1VCIA 1VPLA 1E4YA 2OEPA 2J0UA 1F2UA 4W5HA 1ONBA 3GFPA 3WHKA 2ZYWX 2ZAMA 4DDWA 4XWOA 2Q9CA 2GZAA 2ZS7A 1GOTA 2G88A 2GBLC 4M9QA 5H8WA 1ZMXA 3KL4A 3QY0A 4EFLA 3ZZTA 5JWOA 2AD5A 5D3MB 3L0OA 3WRYC 1NL3A 1EWQA 4OQFA 3SNHA 2FEMA 5HR5A 2Q3FA 3LXXA 1S9HA 4JLPA 2NIPA 4RZ3A 4YMUA 3R8FA 4TMXA 5L3SB 4OK6A 1G3IA 2OT3B 4QKQA 2RGBA 3GMTA 1GTVA 2B7CA 5EE0A 1GM5A 1KK0A 4NCIA 3AGQA 1HEIA 1R5BA 2JDIA 2VH5R 4TYQA 4ZV4A 1D9XA 1XEFA 4C7OB 3AB3A 5A0FA 1OKKD 2PX3A 4U02A 2VRWA 4P4SA 1CR0A 1T0JB 2XTNA 2BIFA 4LX0A 4MYCA 5EE1A 1GWNA 2E1RA 4ASUD 1P62B 2OCYC 2F3RA 1IXRC 2PEYA 4RKEA 2WSMA 2OUKA 2WV9A 1ZNZA 3TW4A 3U3JA 4TZ6A 3TVTA 1ANKA 2ZIAA 3QOFA 1OFTA 4HYYA 3UMFA 2CLDX 1KDTA 1BIFA 2FX3A 1M8PA 2BDTA 5G3YA 1ZUHA 1UDXA 2EU8A 4DEXA 4QL3A 1VYVA 3U4QA 4C0BA 2O8CB 3RYTC 2ZRGA 2EWVA 2IL1A 1FX0A 5DHFA 3GP8A 2DWPA 2V8OA 4LCBA 4AIIA 4XOIA 4ZO4A 1Q1EA 4M4SA 1E1RA 3OIVA 3CH5A 2D3WA 4II7A 2RKOA 1XCGB 5DI3A 1PV4A 3I4LA 521PA 3WHLA 4I81A 2GVDC 1HT1E 5FTMA 3IPYA 1Z07A 4O0MA 3EZ7A 4CT4B 3I62A 1XB2A 5AUOB 1LF5A 5G40A 3GFOA 2BBWA 3T15A 3U3OA 3D8BA 2DFLA 3OEEA 4EQ6A 2QAGB 2NQ2C 3G5UA 2JLWA 4NONA 4RD3A 1G6HA 5EP2A 4MYTA 4ACBA 1Z0DA 3CF2A 1UBEA 3AP2A 4B32A 5GADl 4F38A 1MRNA 2I1VB 3DZDA 2RMKA 3IQWA 3KXKA 2IEYA 4RD2A 3BAFA 4DLXA 2GA8A 3LBHA 3PEYA 3R9WA 4PSKA 4JT4A 2FFAA 2ZPTX 3LW7A 3KQKA 3KFXA 2FDCA 1OIXA 3UATA 4MUAA 3MAAC 4BFUA 1TNDA 3REGA 3DVLA 2F7SA 3MWJA 2OESA 3NBXX 2QA5A 3D6TB 1ZAKA 1E0JA 4I1SA 3WRXC 4CVNA 3FB4A 4D82A 1J99A 4PQRA 5FOTA 3THXB 1P9RA 1OB2A 4M1OA 3M0EA 4EJSA 3CNLA 2AK3A 1KI2A 1P3JA 2Q21A 3BFKA 4A0FA 1W0KD 1G3MA 1RRFA 2FEOA 2ZRKA 4LHWA 4PFSA 421PA 5JEDA 1G18A 4HB2A 4ON9A 5KNCA 5M04A 2AFIE 4HI0E 2HXYA 4ACAA 1N0VC 1DS6A 1RC8A 4CZ2A 1Q1BA 4NU0A 4Q19A 5AJVB 2AK2A 3EXAA 4S35A 3W34A 5F98A 3KX2A 3JVUA 4JVNA 3SJCA 4OL0A 2WHXA 3MSXA 1XPOA 1G20E 2HCBA 4NYJR 3GJ6A 1KY3A 4HB4A 1G19A 1NIJA 3K0EA 1W46A 1U8ZA 3RRMA 4TTRA 3K70C 2EFEB 2QTFA 3K0FB 3Q9LA 3BH6A 5EP3A 4A4DA 1KJYA 4F92B 2ZUDA 2W6JD 3ZH9B 2BMEA 2RGXA 5KOYA 1DBSA 4OYHA 1DG1G 4V0LA 5FOSA 1AS2A 3U7GA 1VKJA 2FWRA 2EQBA 3HU2A 1RJ9B 2IWHA 2C95A 4KBGA 4OI4A 3L0SA 1WP9A 2O8DB 2JATA 3CX7A 2IYSA 1NJGA 1ODFA 1E4VA 1F48A 1XJQA 3F8TA 3VU9A 1E2NA 4EPWA 3DDCA 2IT1A 3MUFA 5JSZA 2ZSFA 1EFHA 2Z83A 5J5CA 2EFGA 3RDPA 2JCSA 1D8TA 4NPHA 4QM7A 2ERXA 1UEJA 5H68A 3R7WA 2GAAA 2SHKA 3ETLA 4G01B 1E98A 2KBEA 3LBNA 2YWHA 1XXHB 5K8UA 4QFMA 3KXIA 3LQQA 4B73A 1QHIA 3PIRA 2V7QD 2VHTA 2YHSA 3Q7PA 4O3MA 4B47A 3CNNA 3NKVA 1PUIA 4G5GA 1ZNXA 4WIAA 1WF3A 1Z0AA 3BH7A 2Q3MA 2FZLA 4K81B 1Z63A 1Z22A 2W83A 2QT1A 1EX7A 3AP1A 4LV6A 4TLEA 4JLOA 4NP6A 3BD9A 2CL0X 4TZ0A 2HXSA 1ZRHA 2GZDA 1U81A 3KJHA 4HDOB 2JLRA 4Q7JB 3LVRE 4BE7B 3NH6A 1GITA 2ORVA 3WNBA 5H1YA 2WOJA 2YC2C 3QSYA 3UANA 5DE3A 1KTVA 2ZANA 4QJ5A 3U7EB 1DVRA 4OJQA 4US1R 4LC0A 5F9FA 4UNSA 1Y3AA 2V3CC 1FMLA 3WMEA 2PLRA 4M53A 2ZRBA 2QG6A 4Q18A 3SYNA 2WPDA 2BHRA 2MMCA 2ZUCA 1Z29A 5FTJA 3VNUA 1XEXB 4RD0A 4L16A 1XEWX 4JLMA 4LK2A 4BEBA 4AYWA 1NVXQ 3RNLA 1Q57A 3HP1A 3EX7C 4TN1A 3C5CA 1B23P 2R62A 3A4NA 1SXJA 2XX3A 3I8SA 5FUVA 2PJRA 3OF5A 1WRBA 1MOZA 1U0JA 4NKRA 5IHPA 1GNQA 3FHCB 4BFVA 2NO6A 1NKTA 5D3QA 4WZAE 5TV2A 2BBOA 3UKDA 2GF9A 4GRAA 4HDCA 4EPRA 4TLDA 1WCV1 3FE2A 4BZPA 4MGZR 2ZUBA 2IXFA 3H1TA 3FHOA 2GTPA 1J8MF 2P6UA 4TMTA 1MO5A 1IY1A 3FFAA 4JIMA 4B3XA 5DO9A 4PPNA 4A1FA 3OIUA 3UG6A 3LXRA 5JI3E 1H8EA 2OXRA 4PSAA 1GDDA 3U44B 5JFGA 4HAXA 4L8GA 3VAAA 3Q3JB 2FF7A 2R8RA 5EUMA 3VR6A 4DEYA 3A36A 3ZD6A 3KQNA 3SFZA 5AUNB 4DXAA 3WMGA 2OG2A 1GVNB 1KZ7B 2KBFA 4FMCB 3UMSA 2H7VA 4LYHA 1ZM7A 3F5FA 3SJAA 4IDHA 4WZBE 3FFBA 2HCJB 1HYQA 1BO6A 5JS8A 5C46F 5IK2D 1C9KA 2OE2A 2D74A 3PUZA 5FBQB 4RZXA 3GD7A 3I61A 1ZUIA 4AK9A 3SR0A 4PPFA 1NJFA 1QZXA 1CTQA 4MGKR 4CEIB 4C0QC 2HEIA 2QPAA 4RD1A 4XTRA 4ZCIA 1OW3B 1E2FA 3LLMA 2P2LA 4C0LA 2ZE7A 4EPVA 3HWSA 4NMMA 5CYOA 1BS1A 3KB2A 3QI2A 1TUIA 2J0VA 2MSEB 1SGWA 2AFHE 2DHRA 3IO3A 3TVDA 1FOEB 4DZZA 1UFQA 1ZINA 1FTSA 4Z8YA 2ONKA 2RGNC 5AWFC 1WDTA 5TMPA 3B6EA 3CW2A 3WYFA 4I1UA 3ZS8A 3B78A 2WM9B 1E69A 1XBTA 3MGCA 5J4KA 3B2EA 4OQNA 1MR3F 1TMKA 3IBGA 2J59A 5JRJA 4B71A 1CEEA 3TQCA 5DH9A 4IRUB 5K8IA 1LY1A 3ZLJA 5DIFA 3CF6R 1NVUQ 3MLEA 4G5OA 1KDOA 4JBWA 2O8BA 5JS7A 4MKFA 4AC9A 1D2NA 4CEJB 4ARZA 2P3SA 3BH0A 4XH9B 2ZM5A 4QRHA 3THOA 2ZR7A 1WMSA 2YKGA 1DE0A 1K5DA 5IT5A 2A2ZA 5AK0A 5BWMA 3K9NA 1GG2A 1FQKA 2VIIA 5CM9C 5KNDA 1TADA 1UPTA 3IQXA 3LFUA 4LJYA 5BN4A 1AZTA 2EFDB 2O0HA 5CK5A 4DCVA 3NXSA 4Q21A 4D0NA 3X1ZA 5SZHB 1OH5A 1SXJE 3VKHA 2OXCA 4IOLA 3RC3A 1E9AA 2C78A 1BOFA 4A6XA 2ZJZA 4DC9A 2ZJ5A 2CHGA 3BE4A 3VQTA 2BOVA 4I1VA 2Z5FA 1CRQA 1E2HA 4KVAA 4F7WA 3PEWA 2D2EA 2CBZA 1JAHA 1VCMA 1S3GA 4PC2A 1P61B 5GVRA 5BQ5A 4QNMA 2QMHA 1W36B 4P31A 2YVUA 4M1MA 1HY3A 4MH0R 3CWQA 4US2R 3LD9A 3R20A 3U6KA 2GCPA 4FIDA 2WAXA 1IY2A 2RHDA 3TAHA 5BN3A 2C99A 3CUEF 3E70C 4C0AC 4GSYA 2KI5A 2V1XA 3T5GA 4OKSA 4EJSC 5G53C 2Q6TA 2A5YB 1ZIPA 1COWA 2DY1A 1IY0A 4E07A 3QXSA 4FMDF 4HAYA 4DB4A 4KFTA 2QTVB 3I92A 2Z0MA 4NCKA 1YE8A 1UBCA 1Q0UA 2ZRIA 2ORWA 3A1SA 4PC3A 1UF9A 2YYZA 3HJNA 4TYPA 1QRAA 5EE3A 4B6EA 4PAQA 4Q4LA 2FA9A 5JCPA 4RFSB 4D0LB 3IHLA 4V0KA 2VP6A 3AKCA 5EP1A 1KZGB 1JQLB 3ZIAD 5FOXA 4JKIA 1VYTA 1N6RA 3NH9A 5BW8A 4DSOA 2FG5A 1IN7A 3H4MA 1KGDA 1HUQA 1UEIA 1W2HA 5EZ6B 2B6HA 4KFRA 2YOHA 4L4UA 1HE8B 1ZC3A 2JJ8A 3CB4A 1EFRD 3OAAD 1A7JA 3GQBA 3GLIA 2QENA 4ABYA 4HDQB 1XWIA 4JVLA 4LHYA 1CULC 2JA1A 3NBZC 3A1TA 4Q9HA 2QGNA 1XFAA 4J0QA 4DB2A 2P65A 5EUQB 2F43B 2QQ0A 4FCVA 3B8HA 1Z6XA 1G5PA 2UVQA 4DLYA 1AS0A 2ZJ2A 4NYIR 4OHVA 5B64A 4P4UA 2B92A 2ORIA 4GNKA 4A15A 1EESA 4TSFA 4RD4A 2G0NA 4URZR 2WJGA 3KKPA 3AV0B 2ZYTX 1T3HA 2FV8A 1UKVY 2CK3A 1NP6A 4DLVA 5L8VA 1UAAA 2I4IA 2H57A 4QOSA 2P6NA 1FPMA 2F1RA 1WE2A 4LBWA 3IIJA 2GRJA 2ASEA 1KSHA 4GPTA 1ZBDA 3MJRA 4A2PA 4BFTA 5EJEA 1N6NA 5E7MA 2RGGA 2OAQ1 2P6RA 4LYAA 5DYIA 1E2PA 1KIMA 3RABA 3W5IA 1GKUB 3SJZA 4OHYA 1CJUC 1GRQA 4UJ5A 4JZKA 1QVAA 1SHZA 2ZR9A 1G4AE 2I1QA 1R0ZA 1WBBA 4WAUA 2YJTD 1GL9B 4KSBA 3RS3A 3R9XA 1KI9A 2F55A 3SHWA 3QKSB 4IDNA 3AKYA 3C7KA 3ZS9A 3PQCA 5TY0A 4Z1MD 2BMFA 2NO7A 4AG6A 1EXMA 2ZVPX 1NLFA 1XU4A 3CR8A 2G83A 3MD0A 1NBMD 4I4LA 4Q01A 1P5ZB 4G5SA 4Q4AB 3O8CA 2YV5A 3SI7A 1TF2A 3BJIC 4XVUA 5IRCD 2OM2A 3A6PC 4R98A 4POAA 4P32A 3AKDA 1XZPA 4F91B 4ZCMA 5EE9A 4CIDA 4XD7D 1CF4A 1OJLA 3KXLA 4TTQA 1HURA 5FUWA 1GUAA 4OI0A 2BM1A 3U6BA 1TQ6A 1WQ1R 2GCOA 1G7TA 4DLUA 1F3OA 3I5XA 2D2FA 2ZITA 2VP4A 3IIMA 3ZQJA 3FYHA 5LPNA 3NC1C 4CEHA 1G6OA 2OLKA 4PHGA 1JECA 3RRZA 2VSXA 3W6PA 2VF8A 5CYPA 3OE7A 5JZVA 2ZAOA 3EPLA 3U3KA 3W6NA 4PO9A 3QVUA 3PUVA 2ZJAA 1ZCAA 4DIEA 2QAGC 1II8B 3HR8A 3AM1A 2AN9A 3TK1A 4ZIRA 1KJZA 2UZ3A 1N5IA 2FSHA 1KMHB 5AJYA 3TBKA 4EFNA 4N0EA 3LWNA 3EC2A 2QN6A 4MRSA 1MABB 3A4MA 3SJBA 1KSFX 3THYA 5E7JA 5B57C 2ZI7A 3ZD7A 4JT2A 2VLIA 1KI3A 2FPMA 2XNDD 3S1AA 4X8OA 1XP8A 3RLFA 5FOVA 3VR1A 5EE5B 3NC0C 1L8QA 3W9YA 1ZM2A 2K5UA 2IUUA 4PAOA 2JLQA 4FI3C 5HTKA 4DLSA 3B9PA 1Z2CA 5CDFA 4URVR 2RCNA 4JLAA 4XVRA 2ZSEA 4EAQA 4GFDA 2WKRA 1H8HA 3Q5EA 1JEEA 3H84A 4G5RA 5CK4A 3V4FA 4JLJA 1EWRA 4YDHB 1I2MA 3RS0A 1E9SA 4MKHA 3ZYCA 4V0OA 5KPDA 2EFHB 3IGFA 2PT7A 1RIFA 3LAWA 3PFIA 5HKKA 1YRBA 2D4HA 2A9KA 1HT2E 2YINC 3DHWC 4A6PA 3EC1A 2LKCA 2O0KA 4BLOA 3VR3A 2PT5A 2WWIA 3X1DA 4WZ6A 4IFBA 4E5UA 3W6OA 2VSFA 4TMZA 1YZNA 2ZRPA 1CR1A 1LS1A 1QBKC 3B7GA 1A4RA 2NO9A 3NEYA 4Q4JB 2D62A 5FL7A 4ZDJA 3IDQA 1AKEA 5L3QB 4IDPA 1NN1A 4KYIB 2QMUA 2OAP1 2OCBA 4PHTA 1WBDA 2DWOA 1KJWA 2O5VA 1JXOA 1NLYA 4OQXA 3W3AA 1YU9A 4B33A 4HUQB 4HLDA 1JR3D 1GRNA 4YXWD 5DN6D 4BFXA 1ZD9A 2YWGA 3KJEA 4LBYA 1G21E 1I4LD 3RSOA 2FGJA 3ND9A 5HPYB 2JLYA 4JVSB 2R6DA 4LHXA 4B75A 3GLFA 2R65A 3EZ2A 4HATA 2YOFA 2CJWA 1UADA 2JJ1A 3QE0A 1IQPA 1NN0A 1ZC4A 1JQJC 5IDVA 4C0KA 2KE5A 1AGPA 1YR6A 1CKEA 4C2UA 1HA3A 4LJ6A 4P33A 5FR2A 1TEVA 4UXHA 3B1ZA 1JALA 1G5RA 3DOEA 5DI9A 1XTIA 3L8YA 4IFEA 4BLPA 1XTSA 5CM8B 2AKAB 2XZLA 2GETA 1E9BA 4BPBA 1KK1A 3AVPA 2FOLA 3NBYC 1W0KA 2X8AA 4GOXA 4LJAA 1XCPA 2LKDA 1GSIA 4ZDKA 4EFMA 4PO8A 1PJRA 3ECCA 2W00A 3I3SR 4U00A 1RRGA 2OBNA 1YKSA 4UNQA 3UMRA 3X1YA 5AJZA 3CF0A 1UJ2A 3AF2A 5JEEA 1W36D 4LJ7A 1G7SA 1R0XA 2OBMA 1VECA 2RGEA 3IILA 3C5HA 2A5DA 2GVZC 3WMFA 1RW4A 1OIVA 4LBZA 5KPJA 1Z6YA 2N46A 2RGNA 2WWFA 4PANA 4MDEA 2YNMA 4C30A 2RGAA 3K8YA 3OHMA 1W48A 3OEHD 4D25A 1CLUA 1DEKA 3AVYA 3NVAA 1FP6A 2JJ2D 3QEJA 4RFVA 1OH7A 5JJIA 4JLVA 3KJGA 3DMNA 4OQMA 2BBTA 2HYIC 4P3YA 1E9RA 2FSFA 5C18A 4MITA 3PVSA 4K46A 1T0HB 2C9CA 5SZJA 3OIYA 2J7PD 5CDFE 1Z0IA 2REXB 3QG5A 4BGDA 3K0AA 3WYAA 2X19A 1GFIA 1E1QA 1OHHA 2CVHA 2ZRLA 1E2KA 1YJ5A 4NDZA 1XRJA 2OLJA 3CPEA 2HJVA 2A3RA 5FI0B 4LWZA 1PLKA 2A7QA 2ZE6A 4ERNA 2CVFA 3GLHA 3DO6A 2QP3A 1TF5A 4U5XA 2IX3A 3WY9A 2QP9X 4PC1A 3FKSA 2C5LA 2P0EA 4B3GA 5GJWC 1MRSA 2JEOA 1Q20A 3CRQA 4DT1A 1W5SA 2MSCB 2V7QA 2XXAA 5KU1A 2Z43A 3ADBA 2IXGA 1IBRA 4FMBB 4BFWA 1CJKC 2IYLD 1VTKA 4HB3A 3B1YA 3LRPA 1XDBA 2GK6A 2W6ID 4HSEA 2ZROA 1VDZA 1FTNA 1Q12A 3UPUA 5LB4A 1KI8A 1SZPA 1TU4A 2FSIA 821PA 1N6KA 2R6CA 3K9GA 2IYQA 4QNRA 3ONWA 4RKFA 1E32A 3EA0A 4QBHA 1E0AA 2V54A 4C3ZA 1U94A 2ODWA 2ZRHA 3AP3A 4BEJA 2C77A 2FPKA 2P5TB 4GP7A 4IXMA 2OV2A 3KTAB 3PUXA 2GJSA 3PUWA 4DJTA 4ZKDA 5KDOA 1MT0A 4PHFA 1E2JA 1OPXA 5C4GB 5FOWA 1ZYUA 1BKDR 3NWJA 4Q66C 3C4JA 4GOJA 2IYXA 2XSZD 4Q1FA 2DFKB 5JLJA 2AWNA 4NH0A 3KQLA 3ZJYA 4HZUA 3EIHA 3TNFA 4DDUA 2FZ4A 3IIKA 4TQAA 1DTSA 5SZKB 1XD2A 4F4JA 4Q4HA 3H86A 2J7KA 5FH9A 1FQJA 4ESVA 5A5GA 121PA 3ZVNA 1XNJA 3LW8A 3NEJA 1P2TA 2FE4A 3B13B 1YRAA 3CZPA 1ETUA 3L82B 1ZJ6A 2PLFA 5EXSA 1ZP6A 1S2MA 2H92A 1W49A 4IVPA 2WWHA 1DAEA 4X8LA 3WBJA 1R7RA 1IXZA 1VG0B 3V4RA 2AHOA 2YC4C 4BFYA 3CO5A 4KAXA 4GI7A 2IYVA 3QBVA 1W4AA 1GNRA 4WXRA 3PJRA 1OE0A 1JPJA 3UG7A 2JAQA 4FN5A 4BLQA 4C4PA 2J41A 3N2EA 1Z08A 4CT5A 4E09A 1L7VC 2WSSA 3DOFA 2X77A 3QF4B 2ZI5A 2R2AA 2QU8A 2XEXA 1U0LA 2ZI9A 3DEFA 1GNPA 4Y0AA 5EQTA 4JL8A 2CMKA 2GEUA 3Q7QA 2JIZA 1AIPA 4QGAA 1RPZA 2J0SA 1P60A 4LJ4A 5D3MA 3P4XA 2OFOA 3TUJC 4JLBA 2YWFA 1YVDA 4DDVA 2H18A 1XCMA 4M1WA 1JI0A 5FL3A 2O8FB 5HE8A 4UKDA 1VYUA 5L3SA 1E1RD 4BASA 1T8TA 2ZSDA 1DG3A 1Z28A 3CPHA 3HYRA 1NVVR 4Q00A 2RH5A 3QXXA 3BGWA 2ZI6A 3GLHE 1Y63A 5FPYA 5FUYA 1G7CA 4C7OA 3IEUA 3EPKA 4EPYA 5DSZA 3W8RA 2O8EB 3H2YA 5E7IA 4GT1A 1V43A 2QBYB 4Q02A 3P1JA 2QSZA 2PBRA 5JBQA 4OK3A 1XMJA 1M6NA 621PA 1EG7A 2CXXA 1X8JA 2YOGA 3C41J 4PC6A 2VBCA 1UKEA 3QUSA 3MRSA 5JMTA 4XVQA 3QENA 2KB0A 4AD8A 1JEDA 3L43A 4DLRA 3HDTA 3TW8B 4HAUA 2IYYA 1R6BX 1L4UA 3B1XA 4HAVA 4D4LA 2O8CA 2NOAA 2ODNA 3EARA 5JI2E 3CR7A 4AURA 1US8B 1E2QA 2XNSA 2IYRA 3PUYA 4KV9A 1B0UA 4XTCS 5IF9A 1DO2A 3RWMB 2ZYUX 4RCYA 4JBYA 4WW0A 2H16A 5FTKA 5KSOA 3THWB 1P75A 4DCNA 1G7RA 1N5KA 2QE7D 1KI6B 4AWXA 1Q3HA 4GBMA 4W9MC 4MRVA 3AF3A 2WJYA 3BRWD 4QHTA 2F3TA 3TSZA 3WNCA 3MWLA 3P32A 5CLQA 1JPNA 3SN6A 3FVQA 3ZZ0A 2IWRA 2QAGA 1RRPA 2A5FA 4JBXA 4OQLA 2BCGY 5TDHA 4RJLA 1XEWY 2ZXUA 1QHGA 3A1WA 2AKYA 4W7SA 3DMDA 5EZ5A 4DCTA 2ZE5A 3A1VA 1OSNA 1TL7C 3GLGB 4TQ9A 3BK7A 4KFUA 1VG9B 3JZAA 2B7BA 5JWHA 5LD2C 3OFND 2CLSA 2IF2A 4RY2A 3TMKA 5CIWA 1LVGA 1R8QA 1ESMA 2VHCA 4NYIQ 1IN4A 5JWRA 3ZVLA 1ZNWA 4URXR 1OT3A 3SQXA 2XTMA 3WBKA 1LF0A 5FBLB 8OHMA 1NSFA 1P9NA 4QBIA 2UZIR 4NCHA 3THXA 3MMPA 1R4AA 1FMJA 1PZNA 4B43A 1S1CA 2F1IA 3NG1A 4PC7A 5AJWA 3IO5A 2W58A 4L5BA 4JJKA 2J87A 3PG5A 3M4YA 4GDFA 1Z2AA 1TAGA 1GILA 3C15C 1E2GA 4QC2A 3BB3A 2PH1A 1A2KC 3FGNA 1RZ3A 5DYGA 4B74A 2WTUA 2VTKA 4G5QA 5KNBA 4LBVA 1QF9A 1G1MA 1W0JA 2ZSAA 4JL5A 2N1BA 1II9A 1T5IA 3KKNA 1KO4A 5LDDC 2ZRNA 3IBYA 1AK2A 4M9SA 4S2EA 4Q1EA 4NYMR 2RGCA 5E95A 4PSVA 3ZIAA 3AVVA 1AKYA 1D6JA 2X2FA 3F3YA 3O47A 3RVBA 4RZUA 3CIOA 1T91A 2O0JA 2F1JA 4WXPA 4QGGA 2VEDA 2W2XA 1KAOA 2Z4SA 3PR1A 1RYHA 2XOKA 4QBGB 5JJLA 4IDOA 1AA9A 4HUTA 2IXEA 5GJBA 4IVRA 3K0FA 3ADDA 2EYQA 3K9HA 4HLQB 2WJHA 1ZIOA 2NGRA 3VX4A 3O8DA 2XTZA 1MV5A 4HLUC 2PMKA 3JVVA 4FW9A 1RJ9A 1E3MA 2P67A 4H1UA 5L3VA 2O8DA 3ICEA 2GXSA 2GKSA 4MQBA 2H5EA 2QTHA 1U98A 1U9IA 1LB1B 3LLUA 1KOFA 3K9LA 2BVNA 1XZQA 3NBFA 3K70B 3DZ8A 4Q48A 1P73A 2WKPA 2ZRAA 3QKRB 1WB9A 1JB1A 2WPDD 3VHLB 2DR3A 2KJQA 3EA5A 4N3NA 1C1YA 3B60A 2QL6A 4D2IA 3NDPA
chains in the Genus database with same CATH superfamily
3VXKA 1SG0A 3R6TA 2H17A 4RIGA 2F9MA 3SBXA 2VSQA 4L3WA 4EKIA 1BJKA 1W59A 1FLAA 2LDXA 1M5UA 4MRNA 3JWEA 3L0IB 4GL2A 2PS0A 3CFYA 4WKGA 4ZPJA 4IO1A 2FYTA 1DLJA 1WIWA 3GVXA 3GVHA 1F38A 1KY2A 3Q9UA 2PKWA 1R5NA 3UQZA 3JASB 1ZD8A 2GPAA 5A4KA 5A3RA 3HBLA 2IGBA 1T9BA 1W7AA 1TLLA 1K0UA 2FSVA 3GUZA 2AC7A 4XM0A 5FKJA 3RG8A 3T8YA 3ZZ1A 4LZLA 3JALB 4O4JB 4GLFA 4KOAA 2W8ZA 3G82C 3FKQA 1BQ3A 1NMQA 2B5VA 4NBNA 3SCZA 4PBTA 5ENDA 1DAFA 1IY8A 1LLUA 1ADGA 2CN1A 2IXBA 1UT8A 1L5OA 2GCNA 2WA2A 3BFXA 3M4NA 4RADA 4BWFB 4DR1B 1SVLA 4N03A 3RC9A 4PCVA 3WIVA 4B6SA 1JR4A 5JCJA 1XRQA 2X5KO 1B14A 4FXPA 3OVMA 1LJ8A 4CGZA 3OY7A 1NW6A 3AVTA 4B3GA 5BVGB 4WT7A 3NIBA 2I4MA 1M3SA 3SZ3A 3EWIA 1N0WA 1RFLA 1O08A 3CX3A 3G5AA 3KYDB 5TJHA 4A92A 1VIYA 1K2WA 3TD2A 3OX4A 5AD1A 4R7ZA 3WB2A 3ZX4A 2FZEA 1PGNA 1BD3A 1GQRA 3FTPA 4FNAA 3GFTA 3UAYA 2D0DA 4HMQA 5BWCA 3UPTA 2Q9AA 1TIBA 2PG3A 2BLLA 4P3XA 5J1TB 2Q9UA 3DAGA 4A10A 3KTAA 4DB2A 2OO5A 2CDAA 2F6RA 4J43A 4OGFA 2WJVA 2Q1TA 4KMMA 4IXNA 2WHEA 3WBBA 5L6MB 1FNDA 1E9DA 1P7CA 2KMLA 6YASA 2R8OA 1RRVA 2YXBA 2QVZX 3WBFA 1RE1A 1UIRA 1AGRA 5HIKA 3SEZA 2ZB7A 3IB3A 2I62A 1IUNA 3PUKA 4JY7A 1QHSA 4LYJA 2A9VA 3U3XA 3UMGA 3ZVMA 2OXEA 2NG1A 4EKEA 1SG9A 1TW2A 2WJIA 1W5AA 4I55A 1NW7A 1UMDB 3UJCA 4A27A 4QIHA 4YEDA 1Z83A 1FTWA 2ZPAA 4NATA 4W9NC 1Z6PA 2NZ8A 4GBED 1AF4A 1E7MA 5IAAA 2CW5A 3A7EA 4ZQEA 2X58A 3TR0A 1E3IA 4FOSA 1INLA 1EWTA 3KEFA 4HQNA 4LNUB 5AXDA 4L9SA 3EH1A 3EVDA 2AX4A 4LF4B 1P1BA 1T5TA 2UZ1A 5C5DA 4H6VA 1NSTA 1E79A 1K4MA 4IOKA 2NV6A 4YROA 4X66B 4AQYB 5FF9A 5GIPE 3SHFA 4QELA 4G5HA 1ORIA 2QG4A 3H8SA 3M4ZA 4ZVLA 4P5DA 3DXFA 1BA3A 4Z99A 1CNEA 1CUHA 5JBNA 4MGIR 4U3JB 2WK1A 3V4LA 2AH5A 2N75A 3JTMA 4P5EA 4BOYA 5G4KB 5KKNB 2Y2VA 1N0UA 3NR2A 4KO8A 4QOIA 1GUFA 5LA6A 2OXFA 2W43A 3D7MA 3DMYA 4F2DA 1NX6A 4NE7A 4G23A 1IN8A 4ARCA 2FK8A 3KM0A 2HIGA 4F5YA 2OBFA 1DAKA 1ECJA 1JXAA 1T1JA 1Y5RA 2BFPA 3D4OA 4YP5A 2H1LA 1DC5A 3OLQA 3W5SA 2I33A 5C5CA 4MVWA 3R24A 2GBPA 3JQ9C 2W0SA 2IOFK 3E8XA 6ABPA 4WVLA 1G17A 3ZHSA 4D4KA 3GR6A 4NHOA 2EW2A 2CLEB 2HK6A 3U49A 2WNIA 4MJ3A 3IAXA 3HJUA 3COSA 4M55A 4PYOA 1DPFA 1CUBA 3WYGA 5D7NA 5I9MA 3AILA 1AQUA 1NC3A 3HCPA 1L6RA 4P35A 1LBEA 1E18A 4HEJA 3IOBA 4OYLA 3C1OA 3UHAA 4BY9E 1SUDA 3H3FA 1M6YA 1T4GA 2A0FA 3IL2A 2GTHA 1NHGA 2N42A 5K8TA 2OK8A 4PG5A 1QYXA 4WXHA 2V6MA 3BSFA 1YR1A 1VPWA 2Z9CA 2IE8A 5JANA 2PSJA 5AQ1A 5FWXB 3V8EA 2WHPA 3TLGB 4GKAA 1YDWA 2WHQA 3KDSE 3AH8A 3HU3A 3MS7A 4FNGA 4KMRA 4JBLA 3BQMB 4XUCA 4A5SA 1O4VA 4BFLA 4L08A 4DJAA 5CG1A 4GBGA 4QXQA 5CFQA 3DOCA 4BRUA 3U4QB 2ECFA 5IYZB 1C3VA 3PL5A 3W4JA 4JXZA 2JBAB 1FX0B 4YP9A 1ZR4A 2IBSA 1J8FA 4W9RA 4W8GA 3S68A 3BICA 2AEEA 3Q0EA 4JLSA 1D7AA 3D1JA 3PFBA 2GARA 1GKIA 1PEDA 5G0WA 1QJ4A 2AJDA 1MAUA 3A6DA 5LB2A 4HX5A 1ML3A 1SVSA 3OA0A 4YS6A 2ZUUA 4EK9A 5KDDA 2O19A 1UXHA 1A8HA 1X15A 1X7WB 1YI0A 2A1TS 3G2NA 1RWQA 3KPWA 2WOOA 1CS4C 1KQOA 3NTQA 4QUHA 1JHYA 4WCFA 4ZAVA 3RI3A 3LVBA 4EB8A 1IJBA 2MMGA 4LDPA 4A0HA 5CEEA 3JAKB 4DV6B 4YQEA 3FI0A 3F5DA 3H3JA 3V9PA 3IVMA 2HJ9A 4RD6A 4F9EA 1JDBB 1OLOA 2J9RA 1Q44A 1YDHA 1FVHA 1LK7A 2W2OA 3T7DA 3WOHA 3CX8A 1AQJA 1YOBA 4RVGA 2BFAA 3DOIA 4QOJA 4EQ6B 2VNKA 3W2TA 3VBEA 1C0PA 1VZ3A 3VR2A 4IY1A 1N2HA 3J7AC 2EG5A 3RWOA 1E60A 1ISSA 1UXOA 4NDAA 1EFKA 4LXHA 1J33A 1M10A 1OXSC 4KL8S 1VGRA 3BWCA 3ZD8A 1ISFA 2C2ZA 1AN0A 1CY4A 4UBLA 4O8CA 4C03A 3TQRA 4IG4A 1VGQA 3IP5A 3QIAA 2MOKA 2VJQA 1SHLA 1VG1A 3IXMA 2IHYA 4HQOA 4JS0A 5AR1A 3HMKA 3KEQA 4JB3A 4KK4A 2R25B 2Z4RA 4YN3A 1M34E 3RW9A 4HDAA 4LGVA 1A5BB 5CEJA 4PLCA 2XHEA 4KQXA 2BISA 4Q03A 5ALMA 5IXYA 5TQ0B 1NY6A 3DL4A 1QP4A 3DOUA 3K9BA 4RKWA 4CMKA 3CVVA 4RU1A 1GFWA 2K2QB 4KQEA 1ZICA 3U16A 2FW6A 1EK2A 1BN7A 1YQDA 5KJEA 4RS3A 2JBHA 2CNWD 1IK4A 1I80A 1ODTC 1JX6A 4G41A 3S5UA 4ZJZA 4BLRA 1IZ7A 5FLXA 1A1VA 1LFAA 3E22B 4G5XA 4II3A 4AXXA 1VKOA 2JK0A 5A7GA 2YMPA 4AZ3B 1PZGA 1CP2A 1IZ9A 3MEQA 4DV0B 1QXSA 2Q0HA 5BSFA 4WZAB 1A2BA 3QFRA 5FBHA 4G1EB 5BORA 2AFRA 1PT9A 2MYPA 1EE1A 2IIQA 2ZTVA 3HYSA 4IR7A 3Q1LA 4LRWA 2HV8A 3A7DA 2F67A 3V4OA 4CMIA 1V9SA 1SBTA 3ETCA 5I7RA 3UMMA 1XTBA 2ZU0C 2Y1KA 1YASA 3OURA 5IJWA 2A6PA 1EAMA 1KAHA 3G2QA 3UXYA 4DSUA 3AUXA 4UHJA 3MTBA 5AQEA 4P80A 1TK3A 2F9LA 3H5OA 1OWLA 2BY4A 2Q3HA 4JNCA 1S0UA 4RH1A 2BUAA 2H8KA 3GA7A 4IWYA 4KPUA 3U5ZB 4YCMA 3JW8A 3EZ9A 1S7GA 2IPXA 3L2OB 2JC3A 4JGIA 3F67A 3DEYX 3NTXA 4G4GA 3TH5A 3IAS6 3TLAA 4D9KA 4N47A 4PO1A 2A1UA 2A3NA 3IOCA 2O05A 1EQUA 1IL0A 4LSMA 3AETA 3N7UA 1NUHA 2V59A 2Y4NA 4BZWA 5I01A 2CVQA 4NY1A 2X0KA 3U13A 1W25A 3GUUA 1RM3A 1C9DB 1U0RA 1FVOA 3L3BA 4NV3A 3W6ZA 4OG2A 4FHCA 1TTTA 4L95C 4JB8A 2DJ5A 1IWPB 2VAVA 2WAMA 2WU1A 2P1ZA 3FSGD 3LSYA 4R2KA 1BROA 2YHBA 3M49A 4NH4A 4CUJA 5HM8A 4FWTA 4IUYA 1VP3A 3EQZA 4QVKA 3RK0A 1F12A 5KAMA 1IG3A 2FX2A 1EK0A 4WA8A 4Q9IA 1K68A 4WACA 2J0QA 2VA8A 4M21A 3T3EA 1PZHA 1PQUA 3Q72A 4UJ3A 4F8JA 2ZBEA 1TQDA 2M2IA 2NZXA 3O2NA 2Z98A 4QAJA 3W8EA 2QJRA 4RCZA 4ZTBA 1ELOA 3HLYA 1QHXA 3ZV6A 4MYDA 3GPDG 2ZSKA 5JFTA 5GONA 2OBXA 1B0PA 1Q16A 1ZNYA 2GF0A 3BWYA 2V6JA 3HCCA 3V4ZA 3K3PA 4N8DA 1Y3CE 4QDKA 4B3CA 5CB0A 1K8RA 1MH1A 4IKOA 3MTIA 3X0DA 1GRRA 1Z0JA 2HUPA 3A14A 3AR9A 4XIGS 1SULA 3FMIA 3M1YA 3P2OA 5BR8B 3F9RA 1Q7CA 3EIEA 5FBZA 1ESZA 3RC2A 4JJ8A 4FSDA 4J03A 1GT91 1G64A 3ND8A 4O1IA 2R6ZA 3VISA 2V9PA 2GPTA 5EJ8A 5H9WA 2QX6A 1EFPA 5EXTA 1DTWB 3ZWPA 3PF9A 4LUCA 5EKSA 1C0EA 2OCPA 4CF5A 1P4GA 2NTVA 4IF4A 1QG4A 4YRNA 1U3WA 1W8DA 3HPQA 4BNYA 2GBFA 3DV2A 4PZ0A 5ALDA 4X9XA 3SMVA 4HGQA 3TSWA 4BNIA 3FOWA 4F9GA 3VPSA 1JMKC 2G80A 4FGZA 3U7HB 2FW0A 1C2YA 1EH5A 4YASA 1YVPA 3ZPXA 1II8A 2A4KA 3UY4A 3QMPA 1PNOA 1OAAA 3GGGA 3OCYA 1B8OA 5CX1A 1KMHA 4HAIA 1YZQA 2QM0A 3T9AA 4XFDA 2WF5A 3S29A 4F60A 3NEAA 4NJMA 4G0UA 1AGYA 2XWPA 2QP4A 4MKRA 2FEXA 5A4JA 5KREA 1GNVA 1K7YA 3CEJA 4NZZA 1H65A 1NHWA 2PO5A 3VHXA 5IULC 2ADOA 4UM7A 4U1RA 3WO1A 3G6KA 1BVYF 1TW3A 1YGYA 2Y8EA 3A6GA 3CMCO 4B34A 3H9QA 3MOIA 2IEZA 4IUCS 4J1QA 2QN2A 5TMDA 1A77A 3AIOA 2PLNA 3RRYA 1GR0A 4BMXA 1DWPA 1LQ2A 3DWIA 2PCLA 4R0VA 3SIRA 3WLHA 3ZLUA 4YMTA 2XRMA 1CE8B 3V97A 3O2QB 1AO3A 2VCHA 1ZUNB 3KT3A 4MQ5A 4N7RA 5F76A 4BBAA 1Z2OX 4W5NA 3EK2A 2DP4E 4YMVA 1JDSA 4FYMA 3FN4A 4AB1A 1USGA 1H1LB 2JLSA 1CHNA 2H2AA 4JK3A 1KYTA 1KKLA 5J63A 5K8CA 2GFIA 2QY6A 5L7YA 4EI7A 3SBEA 2JJ1D 5EZYF 4CWAA 2D2VA 4QXMA 2OILA 3HFGA 4U6QA 3G0DA 2AD1A 5LQJA 1MVNA 3MTEA 1HX7A 4BYGA 1TECE 1NYQA 3GEIA 2VHWA 4Q7MB 1EXWA 3WAGA 1HE3A 4RVDA 3K0SA 1RM0A 3CXRA 3A8TA 3MTJA 3UYLA 1UAYA 3V00A 4YRSA 3T3MB 2VDVE 1GQ2A 4J2HA 2HF8A 3SZRA 4BNVA 2HNBA 1EG2A 4E5VA 4DPLA 1M76A 1LC0A 2OZLA 2W6PA 2V7BA 2WE7A 4GQAA 5CB6A 1CJVC 2QV7A 4GUDA 1BEZA 2HY7A 2QMQA 4R31A 3ACDA 3V1NA 4Z7NB 5K0BA 4DHEA 4K2HA 2VUUA 3HSKA 2JDID 4JYBA 4XASA 1C7JA 3D8UA 4B3BA 1L8LA 3LQKA 5TSDA 1XQWA 2B4RO 2DLNA 2ZAIA 4JLNA 4F1KA 3HL0A 1SWVA 2JD2A 2I2CA 3VVMA 3MJHA 4XQGA 1LW7A 2O4CA 1JZQA 3O94A 4E7OA 2QLFA 3GCDA 3Q9SA 4DDTA 4Y30A 3ZWWA 2P90A 2Q62A 4AJJA 3AWDA 4ZYVA 3TLEA 5A6VA 1TD1A 5ECGC 1PEKE 2WYOA 4ZHQF 4EYKA 3S81A 4M76B 2DTEA 2O2HA 4KOEC 1UPFA 5J5VA 3UV6A 4ZQHA 2OQIA 1USUA 5G0VA 1Q1QA 3ZGOA 5IVPA 2PUGA 1NQOA 2Q8QA 3W79A 2BDEA 3T34A 5BR4A 1D1TA 5FO0A 4W9NA 1TLFA 3E5RA 4R1SA 1T8SA 1ZLYA 2H4FA 1IHUA 3OFNA 4X1IA 2FPWA 4NBLA 3MXOA 3C1TA 4B7UA 2X3FA 1BXKA 1MX5A 3EGCA 4ENVA 1VXRA 2I6GA 5C1OA 2QAJA 4UUAA 2F3PA 3T7TA 5H7XA 2EKDA 1D04A 3AC0A 1KO8A 1F1JA 1QAMA 3ODGA 3GGPA 3ENKA 2IC5A 3U37A 3CNQS 5KQMA 4X71A 2V6IA 1JAIA 2A9RA 2PZFA 2ZJOA 3KKKA 4QGFA 3WL7A 2JFPA 2WY2D 3QY9A 4LFAB 4TYWA 4DS3A 1P0IA 2IYUA 4Q15A 4GKVA 2UUBB 1X1SA 2OORA 5EKXA 4YYEA 3WRWA 1RADA 1OHHD 4C7MA 4HVCA 4RKYA 3FPFA 4FQ8A 1OUMA 2IVZA 4G0QA 4M22A 1JIQA 2G8LA 4UDOA 1UIMA 2ABWA 4RZ2A 3BS4A 3NORA 4GM0A 4U2EA 1JTFA 1NBEA 1W36C 1GAXA 4QXPA 2I99A 1ZM9A 2CB0A 3N2ZB 4NZOA 2AI3A 4EFKA 1NW8A 1EX1A 2KS6A 3JQ9A 4Z51A 3FKSD 3LZ6A 2QN1A 5JCZA 4BC1A 2X15A 3QITA 4IQFA 5DNAA 2NP7A 4JSTA 5AYVA 5C0OE 4EZBA 3VI3B 2WUWE 4BE9A 3C8MA 3PCXA 3EHEA 2HGZA 1Z34A 3PSAA 4CFYA 1LH0A 2Y71A 4DCSA 2NSDA 3PQ8A 4W7IA 4KXMA 3RSLA 2C4KA 1W4BA 4RA6B 1JSLA 2B36A 4J1TA 3IC5A 4QTUB 4A6EA 5MFPA 2VP2A 4Q9JA 4IIYA 1Z2NX 7AT1A 1YZKA 3F4KA 3KJQA 1HDRA 3CV3A 4MX8A 2QMEA 1YQQA 1NMSA 3Q2IA 4V38A 3UB4A 3WIUA 3I5UA 1YU6A 1QVZA 2QLLA 2CDNA 2VNIA 3SYKA 3I32A 1J2UA 2BYTA 1LGYA 1RLJA 2HT6A 3EIQA 2PZEA 4MVJG 2HO5A 2O2IA 2VQFB 1I24A 1L8AA 2FG7C 2VCYA 4N5NA 1Z25A 2YVAA 3D1LA 1UM9A 2CLFB 2LCFA 3QLJA 3ZGXA 1XHEA 2EBHX 3MCVA 4M60A 4B6PA 4MSUA 3JY6A 3KR9A 4XR9A 1L5QA 2QPTA 2YQ4A 2BLNA 1OYVA 2C07A 1AKMA 1QMGA 2QZPA 3UW3A 1NATA 4IJMA 5FBRB 3JYNA 2W98A 4E2XA 5K0FA 3OIWA 4RACA 3LHDA 3GCXA 2AKEA 4ZKEA 3C0KA 3ZE9A 3QF7A 2XKJE 1P7PA 4EITA 5F35A 5HHTA 3OJFA 5M3BA 4UUMA 4J0HA 1LJLA 1A5TA 1KJQA 1NJ5A 1Q7GA 1SXIA 2SCUB 3NNNA 4ZO8A 1G8SA 1CFZA 4TN5A 3CZCA 3DLIA 3PNKA 1WUIS 1DCKA 3LIPA 4O08A 4P3PA 4CDNA 1OIWA 4IEIA 2ADMA 4D8VA 4YV2A 3PGLA 4KZPA 4BQPA 4KCGA 4PX2A 3PX7A 4MNTA 5IN4A 1NPTO 3U4HA 1ZU5A 3KKOA 3OPYI 4FQ7A 2XJ9A 3KOYA 1ZZEA 2JLVA 5AKIA 1NN3A 1TJ5A 4HFMA 2XDAA 2F3QA 1SCAA 4HJRA 4X1KA 1J97A 4ZAZA 3ZBUA 3D5QA 1SRQA 5D7BA 3RRNA 3LECA 3VTKA 4A36A 2Q2VA 4RLSA 3EXIB 1SCDA 5BSWA 5JLAA 2B83A 3RSGA 4BLSA 3PDCA 3ELYA 3QXJA 5HS6A 5LQUA 5FYDA 1C14A 1DEHA 1QIIA 3E0QA 1EFAA 2NZJA 1Z8DA 2QV0A 1KAMA 1VLVA 3AX6A 2EFYA 4KQKA 4MS4B 4B7CA 4EYGA 2DC1A 5FEUA 3OZAA 3OOJA 5FWNA 5I7VA 1VHLA 1G2OA 1KY5A 4WH0A 3D4LA 4A3SA 4U0KA 5E1DA 3P5BA 2JLXA 3IPRA 4BV2A 3B5IA 4I5EA 3D3QA 3RVPA 1CX9B 3DBIA 1S2IA 2X2EA 3CPJB 1GQOA 2PGDA 3EH2A 4YUVA 1KRHA 2QRUA 2QZZA 3LBIA 3KQWA 1QP7A 4OLAA 3GY0A 1U7UA 3H7IA 1NXVA 4LCJA 1L4YA 1OX4A 1PS8A 1S1MA 2WJWA 3B9QA 3PWKA 1I0ZA 4XEUA 4JROA 5FPTA 1C81A 3HR7A 3LH5A 1MIHA 2VZ9A 7YASA 3A3OA 4PGGA 2RSLA 4COOA 1IJFA 2FR8A 2VFAA 3KB6A 2E4YA 2NTYC 4PLYA 3OQIA 3NLLA 2R7MA 4UNNA 1EFRA 4TS1A 2VTEA 5HP4A 1O6ZA 1N3LA 1GIAA 1VBFA 3VO1A 5I4KA 2QM8A 1DI0A 3GEEA 5GOZA 3ID6C 3RIYA 5FPKA 2G04A 4TKZA 4AYTA 1KU0A 5L7TA 1DIHA 5JD4A 2GR9A 1V4VA 3SKYA 5AHXA 3MUEA 4LPKA 3C4VA 1VMEA 3O8OA 3PCRB 2PR2A 2BFMA 5CYGA 4YCNA 4C0JA 2HBRA 4MWEA 1HO3A 4M7PA 4DMLA 1FEZA 2JFNA 5B1DA 1ATIA 1K6EA 1QLHA 4WMLA 4ZV9A 1Z47A 5TS3A 2R3SA 1KMMA 3AG5A 4AKSA 4I14A 2VTBA 3OICA 3FWZA 5HUHA 2FETA 4HTFA 1B4DA 1ZOSA 2ZGVA 3QPBA 5LQSA 2W2LD 4PXSA 5EEGA 4C5BA 2PWZA 2NO4A 2V7EA 4PXAA 1AMUA 4MS3A 1TC2A 4C2AA 2O8FA 1AUVA 3TSOA 1XXHA 2JGMA 4Z3OA 1JQDA 2YYSA 3L5KA 4TYMA 2FQYA 2L19A 2VXYA 5JH7A 2ZIVB 4HNTA 1L4EA 2H1FA 1T3LA 1LTQA 2PX6A 3D8SA 5HCUA 2OP0A 4CEHB 1VLZA 1XTQA 1I5EA 4QG3A 1A9TA 1L4KA 4AJ2A 3OD1A 2G06A 5E7QA 5KWSA 4ZQFA 4ARIA 3IPXA 1B0AA 4DE5A 2GPSA 4N0DA 1U3CA 1WSBA 5FUQA 1M2KA 1AN9A 3QMMA 3E1GA 2FPXA 3TXAA 3MBIA 4YLYA 5KWIA 4RHEA 1RHUA 3U4MA 2CHFA 3QIVA 5GY7A 1KRXA 3U9SA 2XF2A 3DKVA 4K6FA 4UU0A 4YONB 5HFJA 5B7QA 1KTIA 5CJPA 1LDEA 1MQSA 1U63A 3OZVA 3ZU4A 1MZVA 3U2QA 4NNOA 3ICPA 4HLCA 5F4BA 2WEKA 5GAJA 1HH4A 3JATB 5LFAA 3THYB 1V16B 1JVNA 4RGBA 4GECA 4DBLE 3P94A 4HG2A 3TIFA 4R7TA 2R6FA 1M66A 2MWMA 1QAQA 1KE1A 2BWJA 1I9GA 3SC3A 4YUZA 2PUFA 1CIVA 1EZZA 3DM9B 1QVVA 4R9RA 5T57A 4DA8A 1IM5A 3ZU5A 4N65A 2XECA 3LV8A 3O1JC 4EY4A 2O2YA 1SBZA 2X41A 3ZU6A 1NT4A 3PXUA 3VU3A 4Q3AA 2DHDA 2VP9A 1VKHA 3VYUB 3UB3A 3WGYA 4PG4A 1XK7A 4UBIA 4AJ4A 4K28A 3THWA 2YY7A 3M83A 3OTWA 3WNZA 4ZHSA 3FF4A 1NNLA 3KALA 3PE6A 1OTHA 1X1RA 5KTKA 3KQYA 1YT5A 1JUDA 2O8NA 1E3SA 2YIVX 2WYHA 3FDZB 3RASA 4YGXB 2XTJA 4MA4A 4BWGA 4EUNA 5BNWA 1NZFA 3I39X 1VLHA 4GAEA 3UGJA 1JV2B 2HX1A 3WXMA 2B8TA 3UXMA 3BERA 3ENVA 1O97C 4LY6A 3CEAA 1FFGA 3JX9A 4KACA 1RXSA 1QQAA 4Q6WA 1N0HA 2J3JA 1DUSA 1PCXA 2X3UA 4LSGA 5CX4A 3GOHA 1AMNA 1RI4A 3L7AA 2WTBA 4P84A 4WESB 4AUKA 3T5AA 3GDFA 4MGHA 2ZJYA 2CNOA 1R9MA 3O75A 1C8BA 3G8CA 4G4SO 3TXXA 1MG5A 1PEYA 2XNDA 4CM9A 1TGYA 4MEJA 1DCTA 4QO8A 5KX5A 2DRIA 1WY7A 2XOKD 4GZ5A 5LKAA 4R3NA 4N5MA 1EP9A 1VMIA 2O3RA 2PA3A 3QEMA 2D0PB 1L4GA 1WMFA 3VR5A 1CDEA 4DCMA 4H6WA 4DOMA 5HCIA 2XNJA 4IXWA 4EL5A 4MVCA 3GDWA 3ZXYA 3T5BA 3V48A 1YSCA 2H54A 1V45E 3G2JA 4CTKA 2QQEA 3T3GA 4YJ2B 4URUR 2W4QA 3Q3CA 2I2AA 1QIHA 3AF1A 5ALZA 4CG0A 6Q21A 1BN6A 2VPZA 3ZBPA 4EUHA 1BVHA 2LUOA 2C88A 2R2GA 3ZCRA 1EZ1A 2EBWA 3R23A 2AOWA 3GROA 1PYGA 7ABPA 3FDFA 1OXTA 2OSBA 5FRDA 3PZBA 2ZSIA 4RMNA 3AEZA 1V47A 4HH3C 2IV7A 3PDIB 4FEYA 4UASA 1CEYA 3TGLA 1Q0QA 3VNRA 2OM6A 3LUBA 3RNOA 4O4HB 3TB6A 3OT1A 3QH4A 3WQSB 5JPCA 4BN0A 4WNAA 3RH0A 3OJCA 1LUAA 5IWCA 2OFXA 3FSRA 4CKBB 2PZAA 4MP3A 5REQB 5BVHB 5IAOA 3B2NA 3DEHA 3RU2A 16PKA 2PX4A 2WICA 3LNTA 3IT2A 4JVMA 4Q9KA 1JG6A 2DHCA 4I2NA 3JQ7B 3LQRA 4IV5A 2G67A 1CEQA 1IN5A 1NKSA 3G8BA 3KZKA 4QBFA 4YXWA 1N25A 1FNNA 1QX4A 2V8BA 1A8IA 2HJRA 1X3LA 1GCOA 4QUJA 2VHUA 4F6RB 2AW5A 4CRWB 5LP6B 3WNVA 2HF9A 1ORWA 1FSFA 2HMVA 3P9RA 4KQFA 3ZGVA 3ZX5A 4XFKA 1JSRA 1O94D 1RS0A 2C4MA 2OAGA 2PZ8A 2NVWA 1ZKMA 3DMRA 4Y3UA 1Z3IX 2I4OA 2A30A 1L1FA 5I9LA 1SXPA 3FFXA 3AERB 1JBQA 1IIRA 2Y6UA 3W8NA 4DA4A 4UFPA 4BNJA 1YFLA 3AF0A 4I66A 4TKMA 4WFIA 4Z4CA 2HLHA 5KUTA 1KI1A 3LRXA 3OOHA 1A9XA 4KGVA 1PFUA 3EG9B 1QPGA 3FAZA 3GJTA 4O2BA 4G8DA 4CLRA 4MPJA 4UM8B 3M5PA 4RF4A 1T1EA 4BKUA 5EQDA 1W5TA 1XAIA 2IYTA 2JS7A 2O0MA 1EFDN 4ME6A 4OCZA 4QJIA 3S2FA 1DWQA 3DDUA 4BP1A 4LTDA 2WHRA 1DC7A 5FTNA 1JG2A 2I5PO 1YB6A 3LSTA 3PS9A 4OQYA 2FLKA 3A37A 3CW9A 3VUEA 3PHCA 1KZYC 3IAM6 1P2GA 2RBKA 2QORA 2WMNB 3JASA 4OMUA 1V5WA 2PJUA 5D00A 2W8BB 2EWWA 2WIFA 4LVNA 4YFVA 4P4TA 3U48A 1YIDA 1KYQA 5DZSA 4IGKA 1RKVA 5GIOE 4AKIA 3JALA 2QE6A 4O4JA 5HZGA 4ZXFA 4CKYA 1N7GA 1FP1D 1KKMA 1G3UA 3D31A 4PYNA 3PCTA 2XXAB 3ZBQA 3GELA 3LY5A 3QPCA 4I1OA 2PANA 3LPNA 4AICA 3GHHA 4KRFA 1U0OC 5ABPA 1QH9A 3OEHA 3WGMA 2ANBA 2Y1FA 3KZ1E 4ZMSA 2Y76A 2HHLA 1FZQA 3SDBA 2H7XA 2FWPA 4XPIB 4AJOA 2IYPA 3A58B 2BONA 5BVGA 3CQ9A 3LUDA 3T1VA 2I2XB 2CV2A 1KAEA 3OBIA 5AOVA 3KYDA 2VUTA 4M1KA 2FGKA 5A6SB 4BEWA 1KHHA 5DHAA 3LUCA 2JCBA 3DL0A 3FTQA 3ASZA 3ICWA 1C9JA 1NF3A 1P6UA 2DHQA 1E79D 4IH9A 2GT1A 2IBTA 3ZJUA 1EAYA 1NVGA 4AY3A 2CK3D 3OTGA 3RS2A 2O59A 5CH8A 4EPTA 1DU4A 3DMTC 1XA3A 1Z39A 2CE2X 3O9ZA 1PD0A 1LQTA 3KQTA 1XYGA 3E7WA 1UPBA 3PR2B 1EUDB 3QI7A 5IVHA 3JCZA 4LHEA 4MUKA 1ESDA 2NZ2A 3ITKA 4ZVKA 1E77A 2VSYA 1QPBA 5HZKA 2CNKA 4QD3A 3K4HA 2FRDC 2AMJA 2JFWA 4Y2HA 5DGCA 4YO7A 3ILXA 3OETA 2K2WA 3L0PA 1PWEA 1VIMA 3C1AA 3PGMA 3GH3A 4I9FA 4Q4HB 3UT6A 1E9FA 4DBZA 4FS3A 1BXZA 4LSZA 1L5MA 4C5CA 2DB3A 1CJTC 1CK4A 3JSAA 2WKQA 2CMFA 2F1KA 4NC9A 4R3WA 3ZNQA 5I7HA 1UMDA 4E1BA 4W5WA 1ZWKA 1M6WA 1C7ZA 2OV6A 3B52X 3WZMA 1TQ4A 3WHIA 4NSNA 3HR4A 2VUSA 4OHMA 3GCWA 2ZR8A 1FBTA 4LNUA 1J90A 1OZHA 5AVQA 2QY9A 1FMFA 1JIUA 3LUAA 4OQZA 2Q1XA 5CDYA 1FJHA 3E53A 1UM8A 4TQUS 1TYDE 5JSKA 1QRUA 3RBXA 3TGPA 1VCIA 4YO8A 5KJ1A 4W5HA 1F5SA 3GFPA 4QPNA 1D4OA 1XUOA 2ZYWX 1LBHA 4DDWA 2W11A 3SQNA 4MUXA 4U3JA 2GZAA 3L05A 1GOTA 1KEEB 2GBLC 4ENUA 5G4KA 4K6MA 2RCYA 3DCYA 4BNLA 3TDMA 2B30A 3ZZTA 2FUNB 2XA1A 1IBCA 5JASA 1JKXA 1IFXA 2XRFA 2VWGA 3L0OA 4DM4A 4HDMA 1HXHA 3L4SO 4OQFA 5CGQB 4AIRA 3H75A 4DR5B 3O8LA 4KR3A 3RAGA 3LXXA 1Y3IA 3D4BA 4JLPA 3ZUPA 4EG6A 4L28A 4YMUA 1JKJB 3F6CA 4G81A 4R4JA 3EQ7A 3BA1A 4TMXA 2GA9A 3FR7A 3U0BA 2QLBA 5TJ9A 2AZ4A 2HF7A 3X2FA 1G3IA 2OT3B 3OMLA 3VU8A 5AW7A 2GO1A 2H11A 2CWWA 1GTVA 2B7CA 3CEHA 2R68A 1P5HA 5DYWA 3TAXA 3IUPA 1H2HA 4L50A 2DQYA 2VH5R 1NWCA 3HVHA 4FWBA 3VC7A 3W7VA 3ZU2A 2I4TA 3ZCUA 5I7SA 4C7OB 1QFJA 5A0FA 1GV0A 1WXXA 2AMFA 3BPSA 5C5EA 3CZRA 1TUGA 2WIDA 4QUIA 3WA7A 1LKZA 1JWAB 1XRLA 1GTJ1 4L4SA 2XTNA 3UJPA 3H0EA 1MLDA 4EYSA 1GV1A 3GDHA 2OCYC 2XMSA 4KW7A 4CQMD 1ODSA 3VR2D 4LDRA 1FNSA 4JOCA 3T99A 5JXHA 5FWXA 3TW4A 1ANKA 5IJAA 1A5SB 1OFTA 1OLSB 2ACKA 2D59A 1DKRA 2ATEA 2JFXA 2M1XA 4FIZA 4H7IA 1KDTA 1L1RA 3DGEC 4EGCB 3OWHA 4KWEA 2BDTA 4EHKA 4DEXA 1Y9DA 4J1SA 3U4QA 1NR7A 4OBBA 5IYZA 3C3PA 1AKNA 1N2XA 3MUOA 3SAJA 2JBAA 1FX0A 2E4AA 1UFKA 5CNJA 5DHFA 1APBA 3UMYA 4LCBA 5BSHA 3A27A 1TYCA 4KMSA 3PLAE 1H22A 4HN9A 1T6ZA 2X0NA 3OIVA 3HY3A 6NULA 7MDHA 1TCVA 1M8JA 5HVNA 2RKOA 4MVJI 1ENYA 1MJHA 3Q9NA 4FEAA 4K03A 3THSA 5AKGA 1X7WA 2GVDC 1HT1E 3TQSA 3IPYA 4BU1A 3HY4A 5CR9A 3UGQA 3WLKX 4WOCA 5K3OA 4ND8B 3JAKA 2VYQA 4WOKA 3IFSA 4DYHA 1CUEA 1RHQA 5AUOB 3AHHA 1AXRA 4C88A 2ZAGA 5DEOA 4EVIA 2BBWA 1YDMA 3D8BA 1RYYA 3HM2A 1OZFA 1P0PA 1MW8X 4EQ6A 5F77A 3G5UA 4OSEA 5TMEA 1JLSA 1G6HA 4P36A 4Y6LA 4BVGA 5M29A 2GEBA 1UBEA 3DPIA 2PTHA 2YDXA 2GZ2A 3PHGA 3H99A 5GV8A 4F7DA 4F38A 1LBSA 5K99A 5H3HA 4RD2A 4DLXA 2G63A 3LBHA 3CVWA 2VDPB 4G1MB 4AQ7A 1PDVA 2FFAA 3V2GA 5CA0B 5MF6A 2QN7A 3KQKA 5ECYA 2J6CA 1EK6A 1MFPA 2VUIB 4HH0A 2Y9MB 3CUSA 5GM1A 4JJ6A 4X6LA 4IGIA 4ABTA 4LF9B 2ORED 1T24A 1UEXC 3OLXA 3WC4A 5TQ0A 3NBXX 2QTLA 2WZCA 1PUXA 2E55A 5EZQA 3W9UA 4D82A 1DEOA 2G9RA 4MVJD 1R74A 3L40A 3GRRA 1MPXA 1OTXA 1OB2A 4M1OA 1LRJA 3BD6A 3OLCX 3N3BC 2OYRA 2Q21A 3BFKA 5E9JA 1NTOA 3QWBA 4AJ9A 1L4HA 2VJKA 1G3MA 3E22A 3BRWA 4LHWA 4PFSA 2WG0A 1U3DA 2VBGA 5TVGA 4JR1A 3BFJA 3C85A 4J16A 2GEKA 4AZ3A 4F85A 4Z7OB 4BJ6A 5DSXA 4HT3B 3K0BA 4WZAA 2PQMA 1KEWA 1QG6A 2JGIA 3VH1A 1N0VC 3WQRA 4URFA 4CZ2A 3EVEA 5AJVB 4NU0A 1TKCA 2AQKA 1MNAA 3EJWA 3Q8MA 3PVCA 1TCAA 4DSAA 2XMGA 2I55A 1DXQA 2Q2NA 4I1IA 1MTZA 4Y2UA 1NFFA 2W37A 3EC7A 3EEFA 3MSXA 3RFTA 3WK6A 4ALKA 3RRJA 2P4HX 3DLBA 2HBYA 2Q5QA 3VZBA 5JS1A 1P8AA 2JAOA 1IZZA 2HU2A 3MJDA 5AM3A 1W46A 1U8ZA 2WNHA 3K70C 2FZGA 3CZ5A 3GT4A 4H15A 4CLXA 4N41A 4A4DA 2W6MA 3BH6A 5DRTA 1N2IA 3W9BA 2ZUDA 1KZHA 5KOYA 4M0EA 1T5BA 2BMVA 3DVAB 4OYHA 1MQAA 2OGSA 4V0LA 3QWIA 3U7GA 2W2KB 1UBSB 1VKJA 2EQBA 2FWRA 2VAXA 3GT0A 3HU2A 3T5CA 4BZZA 2YIMA 2I0FA 1WP9A 4HVAA 3NHWA 2JATA 5CDHA 4XWWA 3JARB 3IE1A 2JVJA 3AJDA 1NJGA 1HNWB 4KREA 4O2AB 1NVDA 3EY9A 1TCBA 3S6JA 1F48A 1ZXXA 3F8TA 4NV1A 2HAEA 3QWFA 3IAHA 3QVXA 1KBQA 3KSMA 5EIBC 4A26A 3R5HA 1JIIA 5LMCA 2CMDA 2HSWA 3D81A 4GOLD 3MQFA 4K40A 5AHOA 5K3SA 5J5CA 3F73A 3G5LA 4KQ6A 1IB0A 2FMHA 1ZGGA 4NU6A 3IMKA 5H68A 4L02A 3LT0A 4PRLA 3O03A 1MN6A 4D43A 3L6OO 1M5RA 4M0CA 2Q6LA 4A8TA 4QFMA 2DJIA 1V71A 3GL9A 4UHDA 1I3MA 4U9HS 1I4OA 3X43A 5F51A 1LI7A 1N3IA 4I4IA 3VDRA 2K87A 4Z3KA 1WF3A 3BRSA