1KO1A

Crystal structure of gluconate kinase
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
172
structure length
163
Chain Sequence
TTNHDHHIYVLMGVSGSGKSAVASEVAHQLHAAFLDGDFLHPRRNIEKMASGEPLNDDDRKPWLQALNDAAFAMQRTNKVSLIVCSALKKHYRDLLREGNPNLSFIYLKGDFDVIESRLTQMLVTQFETLQEPGADETDVLVVDIDQPLEGVVASTIEVIKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes during the catalytic cycle of gluconate kinase as revealed by X-ray crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Gluconate kinase
total genus 62
structure length 163
sequence length 172
chains with identical sequence B
ec nomenclature ec 2.7.1.12: Gluconokinase.
pdb deposition date 2001-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ko1A00
1BMFD 1ZM4A 3QXSA 4DLSA 3QXCA 1KOFA 3VR4A 5B64A 2W58A 2V4ZA 4DB2A 1TQ4A 1N6OA 2YVUA 3M0EA 2F1RA 4LHVA 1COWA 1N3BA 1N5JA 5HKKA 1E99A 3RVBA 4DLYA 1AS2A 4ASUA 3THWB 1JALA 1AQYA 1Z47A 3RS4A 1W4RA 1W4AA 2EWVA 1Z83A 1E0JA 3QJYA 3UG6A 1NJGA 2ECKA 3U2QA 2IS6A 2CEAA 3NC1C 1W0KD 5KYKA 3EXAA 2ZS7A 2QG6A 3ZVMA 3LDAA 2IL1A 4C4PA 4M9ZA 5UKDA 3EW9A 2EQBA 3LBNA 3ZS8A 1NI3A 2NO0A 4C3ZA 3KQLA 2QEQA 1G3MA 4KAXA 4M4SA 4MRSA 1A82A 2ZAMA 2FU5C 4AY2A 1TEXA 4HB4A 4JLMA 5FBWB 4ACBA 1ESMA 2BEJA 5EQTA 1Z0JA 2QMOA 3RAPR 2ORVA 2JIZA 2CL6X 2GXUA 2NQ2C 3EAQA 4D4KA 1UKVY 3KQKA 4D2IA 4ZDIA 3MG9A 3QF4B 2A5JA 1OFUX 4J0QA 3L0PA 3BH6A 1UEJA 4UNQA 3TAHA 2ZSEA 3UPUA 1E9SA 1D8TA 2FSHA 2ZAOA 3A4NA 4MYHA 4XSHA 5FTMA 1EX7A 1KJZA 1KSFX 1SXJB 1KAOA 2BM1A 2CHVA 2CLDX 2GCOA 4II7A 4TL7A 3CONA 3WP1B 1VG0B 2IS4A 1NY6A 4NYIR 4PZYA 1Q21A 2V9PA 1FNNA 4ACAA 4IDQA 1MABA 1VPLA 2ZJBA 5GJVC 4DDTA 3LY5A 2OUKA 2IWHA 3LD9A 4ZO4A 3KB1A 5EE9A 1YZUA 1XD2B 5DE3A 1VKJA 1Z06A 3AH8A 4DIDA 2O8EA 3AP3A 3EC2A 2ZJ5A 3HP1A 3SN6A 3MJHA 3WBKA 1Z63A 3RRZA 1TX4B 4Q4AB 4UNSA 4NYIQ 2ZYUX 4A0GA 2WBLC 4PC1A 2V55B 4RD6A 4AC9A 1NSTA 1F5NA 2IT1A 1SULA 3BXZA 4IOKA 4BRWA 5TV2A 1PV4A 2F55A 2DPXA 2D4HA 2R6FA 2F9MA 4GZMA 2WIBA 4GL2A 3VNVA 1KK1A 1ZM2A 3FWYA 1ZW6A 2K5UA 2QU8A 5CJ2A 2XOKD 3BFXA 1HURA 2Z83A 1NN5A 3KB2A 4ZDJA 2ZI5A 4S35A 3WY9A 1N6RA 2Q21A 2ZI3A 1JEDA 4XD7A 5IDVA 3K8YA 4YMVA 1UJ2A 1Z0IA 4GMXA 2BMFA 2EFCB 4QC2A 5AJZA 3K0AA 4RD4A 1TL7C 3CF6R 5D3QA 3HYRA 1ZU5A 1N6IA 2ODBA 3TH5A 3QQ5A 1KHTA 4D4MA 4PC6A 4DC9A 4NTZA 5G53C 3HR7A 1W36D 1AJEA 1LF5A 3P1JA 2BIFA 4R7ZA 3OIYA 4QJ3A 2IWRA 4ZIRA 4V0KA 5KSYA 1OYYA 4NKRA 5KU1A 3PJRA 2RCNA 3I8SA 1U9IC 4OI0A 3UMFA 3J81k 4HLDA 3UMSA 1ZC3A 2C78A 3UIEA 5AUPB 1G3RA 5EE3A 3QPVA 3WBJA 4Q1FA 2O8BA 2NO9A 5F9HA 5BN3A 1QZXA 2W6ID 4JL5A 3RDPA 1NBME 4EPTA 2YV5A 4OI1A 3VHXA 2GF9A 2Z4RA 4I1VA 1R0XA 4DCTA 1VCOA 1K5GA 2KBEA 2RH5A 3PUVA 1J70A 2R6GA 5H1YA 1D2NA 2QNRA 2DYKA 121PA 3RWMB 3AVUA 3BOSA 1W48A 3KKOA 1W49A 2V1UA 4JLKA 3UKDA 4PFSA 5L8VA 4TSFA 1E2FA 3N2EA 3B78A 4IVRA 4C0QC 2H57A 5DI9A 1QDEA 4IXNA 4BFVA 2P5SA 2CVHA 1DAIA 2YHSA 4B3CA 3BB3A 4DUGD 2AD1A 3IUYA 3AUYA 4D25A 1TU3A 2VF7A 4G5OA 4V0MA 3I32A 1G19A 5CIQA 2F43B 3SI7A 1IN7A 1G1MA 1QF9A 1JPJA 1BOFA 4TLEA 4OI4A 1T3SA 5DHFA 1DOAA 2TMKA 3C4JA 1L7VC 3CX7A 3MWLA 2RGNA 2HLDD 4UNNA 5KO2A 1KNXA 1B23P 5CDFA 3ZZUA 3K9NA 1KZ7B 3CRMA 4YMWA 1G17A 2J0UA 4D4JA 3NHAA 3I8XA 4A8JB 2QUZA 3D8BA 3EWAA 4PSKA 1G7TA 1AN0A 3VQTA 1FUUA 1SZPA 4DEXA 3K70C 4Q18A 1W2GA 1YJ5A 1KJYA 2FWRA 2XOKA 1GITA 3LX5A 4WXPA 5FUXA 1UPTA 4C2TA 3IIKA 2BBWA 5FR1A 1SVLA 2J59A 4LJ6A 3WMEA 1UDXA 5DN6D 1E2PA 3I4LA 3KTAB 4LBZA 2JLZA 2AFHE 1Q20A 3NTUA 3BS4A 3SS8A 4OQXA 3P4XA 2D06A 1IXRC 2WIAA 3I5YA 5H70A 1OH8A 4M1WA 5EZ6B 4B34A 1ZJ6A 3ND9A 1OB2A 2PT7A 1N2CE 4MA4A 3C7KA 2B8WA 2D62A 4TLAA 4BFXA 1IN5A 2FNAA 2PL3A 2IYUA 5C4MA 4BQSA 3U4QB 4M21A 3K0FA 1V43A 4IFBA 1FQJA 1Z5ZA 3B60A 1IAQA 3VU9B 3VMFA 4I4LA 4QHTA 1NVXQ 1XTKA 2IHBA 2MSDB 2ZRAA 4IDNA 4LOAA 3QOFA 5CLQA 4LK2A 1NG1A 4BECA 5EUQB 2QTFA 2VEDA 3CH5A 4MYTA 1CTQA 1SVIA 4NDZA 3GD7A 2N1BA 1DAKA 4R2HA 1LFDB 4XIGS 3RYTC 4A8JC 3C8UA 3TUZC 1ZNYA 1N6LA 3QKRA 2P5TB 3QPUA 1QVAA 4MDFA 4PAOA 3RS0A 3I92A 4A82A 2FG5A 4MQBA 4OL0A 4QHSA 1RJ9B 1P9WA 1XD2A 2GAAA 3TUIC 4E5UA 4KU4A 3K0AB 3MRSA 4LX0A 3H1TA 4GSYA 3DOFA 5D3MA 1Z07A 4TT3D 5EUMA 5TARA 2H17A 3QF7A 1ZU4A 2X1VA 3TSOA 5KPDA 1XZPA 1JECA 4BFZA 3CLVA 2PCJA 4JS0A 4YMSA 3LFUA 3PIRA 5JRJA 3N70A 2QBYB 5IK2D 1CS4C 2ZSAA 2RGBA 2WKRA 3P26A 4PAQA 4XSGA 3TE6A 5G40A 3T35A 1G3UA 2A5GA 4S2EA 3UK6A 5TXGA 1QVRA 3CX6A 1VCIA 1GNPA 1U0LA 2OE2A 3GJ7A 4FN5A 3U44B 1W5TA 1ZNZA 1DBSA 3RWOA 1XPRA 3GLFE 5TVKA 1IY0A 4TYPA 1I4DD 1XRJA 3PG5A 2RB4A 5KSOA 3LLMA 4TQAA 4LYJA 3AVTA 2OESA 2AWNA 3D6TB 5JHHB 2ZSBA 4Q1EA 3IHWA 4PHFA 1FFHA 3DZDA 4MYUA 4TL9A 5JWHA 4NCIA 4KI0A 3AF2A 3LA6A 3W6NA 2HT6A 4NONA 1RW4A 4FMDF 1XEXB 3OEHD 5JRZA 4K46A 1DAFA 1WF3A 4B35A 2QN6A 5AUOB 2JLQA 3CWZA 1E1RA 3EZ9A 3SHFA 4PO9A 2RGGA 3IBYA 3TSZA 1T4GA 1VG1A 4DB4A 1RZ3A 1AS0A 1F48A 2WICA 1Q1EA 2XB4A 3BERA 3P27A 4OI2A 3B1WA 4TMWA 5EXPA 1CF4A 4A6PA 2VP6A 3TRFA 1ZVQA 4JBWA 1OLOA 2WJGA 1M7BA 2JIZD 1BKDR 3MGCA 3DKVA 3PUYA 1ZM3A 3CF0A 1E94E 1OJLA 5JZVA 1UDWA 1U0JA 4URWR 4RFVA 4ZDWA 3K09C 1MV5A 3IKJA 3MUFA 4C0JA 3QEOA 1M8PA 1KK0A 4Z54A 1OXXK 2ZSFA 4NYMQ 3S1AB 3I61A 3H4MA 3Q8XB 1YQTA 1ZMXA 3T5DA 2PEZA 2F1HA 1AKYA 1W46A 3NKVA 1E2DA 2CBZA 3K9HA 1LS1A 4ASUD 3WNBA 1KSJA 2ZSDA 5JFGA 2GA8A 1DAEA 2J0SA 1W1WA 3BAFA 2O52A 4L15A 5SZIA 1QG2A 3RS7A 4RVCA 4DT1A 4NBSA 1GWNA 4KHZA 2FA9A 5CM9C 1XTJA 3LXXA 2DB3A 3KTAA 2QA5A 4IEEA 3AKEA 2QSYA 4MGIR 4UKDA 1F2UB 1MO6A 3BK7A 4M1OA 2D7DA 3BH7A 1OFIA 3OFND 3FGNA 2KJQA 2WWIA 4BLSA 1MKYA 3A1TA 1U2RA 4PO1A 5LBIA 4JT2A 3SZRA 1IJEA 4DT1B 2O0JA 4QGHA 2H7VA 2X2FA 1CRQA 5L3SA 2WZQA 1DADA 2JJ1D 3B1XA 4OJQA 1J7KA 2C03A 1YR8A 3AEZA 4EQ6B 3NDBB 2QY9A 5CM8B 5DO9A 3TLXA 1G5TA 2C77A 1ZCBA 3CNOA 3ZQJA 1GRQA 1ZNWA 4FWTA 4L5BA 4G5QA 2NPIA 5HCNA 4BFTA 3LNCA 3W5JA 4OQNA 4O3MA 1KMQA 5LB2A 1E0AA 3GLIA 2ZS9A 1Q22A 1G16A 1P62B 4ESHA 5TMPA 4P3YA 3TNFA 1U8AA 3LRPA 4BLTA 4FMCF 3AP1A 3EWSA 3U3JA 4IEIA 3AF4A 4OK5A 2QM7A 3CR7A 4CIDA 3RABA 2IF2A 2GZAA 4D6PA 2DCUA 1KI9A 2ZEJA 4CDGA 5DISB 4LJ9A 1G7RA 621PA 1NLFA 4A6XA 3SNHA 1KK2A 2QSZA 3AVXA 4A15A 5JSZB 3WYGA 1QHHB 3GFOA 4C0HA 3ZZTA 1MO5A 3GP8A 3IHLA 1KMHA 2G6BA 4OHZA 5CB8A 3RHFA 1OF1A 2A5YB 4P4SA 4KFTA 4ZCLA 2ATXA 2VA8A 1OXUA 2R6CA 4L9WA 3CUEF 2XZLA 3QKSA 4Q7LA 1E2QA 1OH7A 2QRZA 5FBLB 1S0UA 1CJMA 2CMKA 2QAJA 4PQYA 1R0ZA 3QIAA 4GOXA 2JLXA 4QNRA 2BDTA 4DLVA 1QBKC 1KI6B 1M74A 2CE2X 4ERNA 1XCGB 1DTSA 2FEMA 4QL3A 1Z6YA 5G3ZA 1U8YA 3ND8A 1G4UR 1GSIA 4XVQA 2XTZA 4Q1CA 3WRXC 5JBQA 2CCGA 5KDDA 1W0JA 5IK2A 2D2FA 4B3DA 4DSTA 4L16A 2FGKA 2IEYA 2IYZA 4Q9LA 1KO4A 2VYFA 2BJWA 2ZI7A 3I3SR 3NBZC 4HAXA 5FOWA 5AUNB 5IT5A 1TPZA 4QBIA 2DFTA 2KBFA 2ZJ8A 3GLFB 2IS2A 4AI6A 2I4IA 3DEFA 1U81A 1DO2A 3QKTA 2V6JA 2Q9BA 1BYIA 5EXSA 4MKHA 4F4CA 1Y3AA 2GXQA 1AZSC 1U0HC 1E79D 2QENA 3KKMA 5E7MA 1KJWA 2BBOA 5CITA 3CW2A 1NSFA 3FTQA 3CNLA 1XCPA 5TDHA 2BVNA 2F1JA 4AYXA 4QGGA 3SJZA 4LDJA 2ASEA 2ZXUA 1P2UA 1E79A 2J46A 4PX9A 2G1JA 2WJJA 3BGWA 4G1UC 4HEJA 5A0FA 1O3YA 2AR7A 4LJYA 1T3LA 5H8WA 2J45A 3EASA 3QENA 2PX3A 1E1RD 3R9XA 4LUCA 4GBMA 4B6FA 1SKYE 1JI0A 4DVGA 4KITB 3Q7PA 4RZ3A 3THOA 5JJIA 3K70B 4TMKA 1M7GA 4A0FA 3LO5A 3DVLA 4DIEA 3I1FA 5EP3A 3EZ6A 1E9BA 3OAAD 2FFAA 3PVSA 1ANKA 2REOA 3FHOA 5F98A 1HH4A 3B8HA 3JVVA 3VKWA 1S4QA 4GNKA 1OV4A 1W36C 3QBTA 1GZSA 3SJAA 4B43A 2VP5A 4OHWA 4A92A 3K70D 2KWIA 3EA5A 4FMCB 2W2XA 3REFA 3O8CA 3MWJA 3PITA 4GDFA 1XPUA 5BWMA 2GBLA 1HT2E 2HXSA 2N42A 1BO6A 1GFIA 3KUDA 1E2IA 4X8MA 4HUTA 3V9PA 3GLGB 4QNMA 1J99A 3ASZA 2FPLA 3T12A 2W83A 2ZE6A 3NEYA 2GNOA 1CP2A 4KV9A 5BN4A 4HDOB 4D0LB 4CEIB 1JR6A 2QROA 5JEDA 1TADA 2QPAA 1TUIA 1L2TA 2KI5A 3GLHE 2O8DB 3LQQA 3KXIA 2BJVA 3EG5A 4UNPA 4WZBE 1YZQA 5JMTA 4MKFA 1TF2A 1DG1G 4M1TA 1ZD8A 2P0EA 2HYDA 2IUSA 4XTRA 1GTVA 2OG2A 1YE8A 2RKOA 2F3TA 3B1YA 3IDQA 4Q7JB 2ZRGA 1ZINA 4DSUA 2MSEB 2CXXA 3QBVA 3WHKA 1XP8A 2WAYA 1LTQA 2ODEA 2ZRMA 3HPRA 5BW8A 1E3MA 3MJRA 1JR3A 1N0WA 2FF7A 1N6PA 3RRYA 4DLWA 1VG9B 5CYOA 3NHBA 5LD2B 5LB4A 2G9NA 1NVVQ 3LH5A 4JKIA 3AKDA 4BWYA 2ZI4A 3SE0A 2GESA 2F7SA 2O0HA 1MH1A 2B92A 4C0KA 4W9MC 4NCJA 4XWOA 3TAUA 3Q3JB 4F7WA 1OIWA 1E2JA 2Z0MA 1S1CA 4JLPA 5FTKA 2QT1A 1LF0A 1IN6A 1G21E 5FTJA 3UANA 2OCPA 3CR8A 4MKIA 2CCKA 2XX3A 1P9NA 4Q01A 2FEOA 4JSTA 5K8TA 4TLBA 4Y0AA 1N0VC 3FMIA 2PZFA 1JB1A 3Q5EA 3TR5A 1N25A 2UZ3A 1W2HA 1ZUIA 2DWOA 2CDNA 4CZ2A 3GJ4A 2IYWA 5FBQB 1TQDA 1XMJA 3ZGXA 2LCFA 1X3SA 4URUR 4W7SA 4LBWA 3QVVA 1W36B 5EP1A 4G01B 5JCZA 3A6PC 2R62A 3PUZA 1SXJA 1GL7A 3BH0A 4M9QA 3VU9A 4TTQA 2OT3B 5E3HA 3W6PA 1P75A 2JDID 2GJ9A 1YZGA 3NDPA 2WPDD 2PCLA 4JYBA 3U3MA 4Q9KA 4HI0E 1YR6A 3CX8A 1XXHE 3OF5A 4UJ3A 2CNWD 1TF7A 2AK3A 2AKAB 3A1SA 4TTRA 3AGPA 4BZPA 4C9BA 3OFNA 1SXJC 5DLQC 4IOLA 2WJHA 2R44A 3CBQA 5HZKA 1H8HA 4LV5B 2FSGA 4DCVA 2QQ0A 5SZJA 4UXIA 2XSZA 1KTVA 3AM1A 3AVOA 1IHUA 2R6DA 2OEPA 1Z2CA 1X1RA 3IBGA 4MRNA 3GJXC 3DMNA 4EFMA 1GRRA 4RCZA 1FNMA 4BFUA 3KXLA 4NU0A 1L4YA 1BMFA 4B3FX 4IXMA 1NN0A 1KY2A 3T1OA 2WWYA 1W0KA 2GJSA 3GCGA 3KUCA 4MH0R 4CYMA 3U44A 4E03A 5DI3A 1HA3A 3PUXA 4M22A 3LVQE 4WOPA 2C9CA 1G6HA 4CEHB 2WTUA 1G8PA 4A2WA 2E9SA 2GJKA 4IHQA 1VHLA 2LWIA 2WMNB 2QAGC 3LWNA 2ZE5A 3T15A 3U6BA 2Z4SA 1UADA 2WJYA 2QT0A 3ZIAA 3THXB 1WQ1R 2VBCA 2FDCA 2BBSA 1AGRA 1WXQA 1UFQA 3UWKA 1J8MF 3H2YA 3HDTA 4URYR 2C95A 2AD5A 2D7CA 2GF0A 2HJVA 3TQCA 1TF5A 4GZLA 2V1XA 3AF0A 3PENA 2HCBA 2YZ2A 4EPXA 3FMFA 1LB1B 4FCWA 4MITA 3IQXA 1T0JB 3Q5DA 3W3AA 4HLQB 2WWWA 4QXAA 2AX4A 3AGQA 3CF2A 4JVLA 4Q4AA 4TQ9A 1Z29A 1OHHA 4EPWA 2FGJA 2WSMA 3FE2A 1IBRA 2A30A 2IEZA 4G5SA 2Q0HA 2X19A 3FYHA 4ARZB 1G5PA 2XNDA 3LVRE 4L9SA 3TW4A 2P6RA 3K1JA 1XMVA 4DXAA 2QMUA 1QHIA 4CF7A 2CCJA 1GP2A 2GILA 3H0KA 5TB5A 1KDPA 1LNZA 4E07A 4XWKA 2Q6TA 5L3RA 3S1AA 2I1QA 2A7QA 1X86B 4IVPA 3F0TA 3GLGE 1FW6A 1IY2A 4Q1AA 6Q21A 3E5HA 1WCV1 2RGCA 4DLZA 1UKYA 2G77B 1KKLA 5KUTA 3L8ZA 4LHWA 4AYWA 2ODNA 1WMSA 4C2UA 2XSZD 4DLTA 3TIFA 2PLFA 3X1DA 3NH6A 4JBYA 2GK7A 3TUJC 2C9YA 3W6OA 2OCBA 4Q4HB 4JLDA 1RIFA 4V0LA 4WZ6A 1S3SA 2DWPA 2WAXA 1EWQA 2PBRA 1OFHA 2ZYWX 4TQUS 4A9AA 1NY5A 4N3NA 3W8NA 4ZIRB 4LC1A 4JIMA 2J7PA 4GOKA 1MT0A 1M6NA 3F5FA 3W9YA 2FH5B 3QY0A 1UKEA 3PEUA 2CNWA 1SKYB 4PPFA 1Z0DA 2C99A 3SJBA 1G3IA 2JJ2D 4R2IA 1XXHA 1E6CA 1Z22A 1XNJA 4NMMA 2HLDA 3OZXA 4UJ5A 4RKEA 3PEWA 1EFUA 4M53A 1ZIOA 2F3RA 2ZJYA 3PFIA 3U3KA 1DAHA 3OEED 2QM8A 1Q3HA 2CK3D 1D9XA 1M7HA 1XEWX 3MCAA 3G0HA 3GLHB 1NN3A 2PH1A 4PQRA 4GFDA 1NVVR 3K0CA 1E2GA 3AP2A 3EZ7A 2BHRA 4I81A 5FPYA 3EPHA 1Z6XA 4MYCA 5F2EA 4US2R 1SVMA 2GBLC 1LV7A 1NMYA 3SYLA 2VSOA 1ZD1A 4LI0A 4G0NA 1P73A 2REXB 1CR4A 3L8YA 4LHXA 3T5GA 4LJ7A 4V03A 2IUUA 3LV8A 1N5KA 3R20A 2W0SA 4A4DA 1MABB 2DR3A 4Q21A 3RRNA 3W8RA 1FQKA 1XTIA 2O8CA 1KNQA 2ZTSA 1Q12A 2GRJA 3OIWA 1XB2A 3KQUA 2R2AA 3C15C 4PAMA 3FKQA 1RRPA 2Q3FA 2QE7D 3BE4A 2BKEA 2ZRBA 1C9KA 2VPPA 2OO7A 3OE7A 3IO5A 2QORA 3CRQA 4QM7A 1FTSA 2VO1A 1G64A 1JBKA 2NZ8A 3SFVA 5JEEA 5IRCD 2BM0A 2OXRA 2RGNC 2AL7A 1EXMA 4JMPA 1GIAA 4QJ4A 4C7OA 3QSYA 4BE7B 2BCJQ 3QKRB 5DIFA 4YDHB 3T06B 2XEXA 2C98A 2CE7A 1PVOA 4B44A 2MMCA 4QBFA 1AGPA 2G3YA 1NMZA 5SZHB 1JR3D 3NBFA 4M0LA 1WB9A 1XTRA 5FOSA 4TT3A 2WPDA 1X8KA 3VKGA 5GJWC 2OBLA 4XTCS 1KYIA 2F1IA 1NVUQ 2WMOB 3WP0A 4B2LA 3AVVA 4BASA 1S3GA 4M9SA 1TU4A 1X6VA 3BFKA 1W4BA 4I1UA 4UXJA 1OH5A 2OM2A 1G9XA 2E1RA 5F3WB 2ANBA 5LPNA 4QM6A 1G41A 2G88A 4M8NE 5FR2A 2CHGA 4BRUA 4CVNA 4WVFA 3CIOA 1AZTA 4CRWB 1F2TB 5J5CA 2JEOA 2ZROA 1WRBA 1Y63A 2HDNB 4BPBA 2J41A 2NPFA 1BIFA 4E22A 2C96A 4DDVA 3AKYA 4LCBA 5DN6A 4DCNA 5FTNA 1G18A 1JPNA 2ZUDA 4LYAA 4OBEA 3NEJA 1WE2A 2JGNA 3WHLA 5B58C 4DRZA 4ZPXA 3DO6A 2HV8A 3M4YA 4KSCA 3VHLB 4WIAA 821PA 1XMIA 1MOZA 1ZBDA 1IN4A 1GDDA 1IQPA 1GG2A 3CRRA 3VR6A 2ERXA 2W6IA 4ESVA 2QTVB 1K8RA 3OAAA 4AWXA 3QXHA 1ODFA 2F43A 4NE2A 3TVDA 5KHOC 4ZI3A 3OIVA 3QNUA 2JDIA 5E7JA 4US1R 3CM0A 1PJRA 4OHVA 1C4OA 4XVRA 1OFTA 4YMTA 3K0SA 4PHTA 1XF9A 3H84A 2RHMA 1E0KA 1O87A 4QBHA 3W3ZB 3ZLJA 4D0GA 2OXCA 3SU8A 3KQHA 4KBFA 3A36A 2WOJA 5BQ5A 2E87A 4B3XA 1NIJA 2DHRA 3THWA 1PUJA 5KSPA 3SBDA 2VP0A 1CU1A 1ZUHA 4XH9B 1Q57A 1EFCA 1HV8A 5EP2A 3R9IA 3LAWA 4GT1A 4MRVA 2H5EA 1F2UA 1KI1A 4BUJA 3KX2A 2XXAA 1Z8FA 3QKUA 3A1UA 4B2PA 3KKPA 4DCUA 3T1TA 1JXMA 5EE5B 1M1YE 2VF8A 3X1WA 3HJNA 1EX6A 1AS3A 2IYRA 2YWFA 4KYIB 4YXWD 4EAQA 3QXJA 3NC0C 1J90A 3ADBA 3U61B 1A1VA 2ZPTX 4G3XA 1QHSA 1CKEA 1W47A 3KFVA 3QF4A 4DZZA 4TLDA 3GQBA 5DYIA 3EPJA 1RC8A 3ZH9B 1TAGA 3T1VA 2GZHA 3FMOB 4NCHA 4P0TA 1CJUC 1UBEA 5AJVB 1VMAA 3EIQA 1LY1A 1OHHD 3E70C 3K0FB 4LYHA 1GNQA 1XFAA 3C5HA 4POAA 2ZITA 1P72A 4WXRA 2JA1A 1KDTA 3MAAC 4BZQA 1ZNXA 3IO3A 1JR3E 1S2MA 1ZYUA 2VQSA 4KJZA 1Z0AA 4LZZA 3VTKA 3P32A 1Q3TA 2EW1A 2AXPA 3AUXA 2WM9B 4PR0A 5JI2E 1OE0A 1PLLA 2ZI6A 4GRAA 3DDCA 5F9FA 2W2TA 1WDTA 3I72A 4D4LA 4DJTA 5AJYA 1ZIPA 1AQUA 3RANA 4H1VA 2ORWA 2YOFA 2AXNA 4GP6A 3R8CA 3CKLA 3MMPA 5CK5A 1RJ9A 5K8LA 1SHKA 1EGAA 2W0MA 3ECCA 2IBMA 3SFZA 4AKEA 1XJ0A 1YVDA 1DPFA 2YWGA 4K8OA 4URXR 4F38A 3QXXA 1XCMA 3GJ6A 4QHYA 4B47A 4FINA 1LVGA 2HJGA 2IC5A 5B57C 3CH4B 1E96A 1XXHB 4LPSA 4RJLA 1CR2A 4JZKA 2WJIA 2BKUA 1Q1QA 2H1LA 5L3QB 1E69A 2OFXA 4KLZA 1US8A 1KAGA 2YINC 1KZGB 3C41J 4PC2A 3IIJA 3GJ5A 1IXSB 3SJCA 1COWD 4NH0A 3G5UA 4FCTA 4WBSA 3TK1A 1DO0A 2P65A 3ADDA 4ZKDA 1T5LA 1QG4A 1VYTA 1P2TA 1YZTA 4OJKA 2GCPA 2R65A 2CL0X 2IYSA 4TMVA 3TGPA 3KJEA 4HSEA 4C0BA 1BYUA 1RVDA 4JYCA 2G1KA 4X8LA 5IF9A 1W44A 2YC4C 3X2SA 4BLOA 3KJIA 2CK3A 5EE1A 4Q7KA 4N0DA 5E95A 3GPLA 4LRWA 3CNNA 4HDQB 2JJ2A 5CB6A 2VHUA 2BC9A 1VIAA 4AKHA 2CHQA 2NO7A 4MUAA 5CK4A 4B3BA 5KOYA 4QJ5A 1G5RA 4ZV4A 3OEEA 2AKYA 4XD7D 4G5GA 2X77A 4PC7A 4R98A 4UXHA 3T61A 4M1MA 2A9KA 2GKSA 1GKIA 1Q1ZA 1B0UA 4BLRA 1D6JA 1OT3A 3FOZA 4D82A 2XZOA 4BFYA 1RRCA 3RC8A 2CL7X 1CBUA 5GVRA 1TMKA 1N0UA 4R71A 4OQFA 4HAWA 1TTTA 4CEJA 3MD0A 1T8TA 2OZEA 4PHGA 5AJXA 3NXSA 2JLUA 4B74A 3A4MA 5B30A 4NYMR 2OFWA 4HB0A 2RGAA 4DHEA 4AG6A 1GL9B 3AQ4A 4AD8A 3IIMA 4QRHA 1XX6A 2XB2A 1DAMA 2EFHB 1OH6A 3GEHA 1KI3A 4HATA 3F8TA 2JLRA 4QOSA 4EPYA 5FI0B 2F6RA 1N6NA 4PSAA 3IQWA 4MUBA 2ZIAA 3U60B 1A5TA 2J0UB 1R8QA 5HE8A 3IILA 3FKSA 1MR3F 2YJTD 4BLQA 4TZ6A 4Q4HA 4Z8YA 4U02A 4Q9IA 1DE0A 2Q9AA 4O2RA 1T8UA 2PJZA 2QPOA 2P3SA 1IJFA 1NIPA 3PEVA 5BYJA 2H18A 1DS6A 2CJWB 2UZIR 5EXTA 2WKPA 4AYTA 2GXSA 1Z6AA 2YOHA 3B1ZA 4YONB 4DKXA 1YR7A 4U5XA 5JWOA 5C18A 5GVSA 5JS7A 1BH2A 1GKUB 1FX0B 1HT1E 2OBMA 4MRRA 3FHTA 2V7QA 1E9CA 3ZD7A 4TYWA 4JVSB 2WOOA 1AK2A 3HU2A 1NKTA 4EJSB 2A3RA 4JVMA 1LS6A 521PA 1U8ZA 5FUWA 2XTNA 4JLNA 1D5CA 3GLHA 3BWDD 4Q1DA 5EE0A 2IXFA 4PPNA 3DPUA 3I5XA 2DFNA 2HF8A 3RNLA 4FWIB 1DEKA 2QRNA 5G3YA 3K9GA 2WSSA 5DSZA 4RD3A 4YXWA 2ONJA 3EARA 4LHZA 1KSGA 1TUEA 2J5XA 3TSWA 1EFRA 1R6BX 3SQXA 3NIBA 3U7HB 3ADKA 3A4LA 4IDOA 2OILA 3DOEA 3GJ8A 4V0ME 2V6IA 4Q48A 1H8ED 4HDCA 2XZPA 2ZE8A 3K09A 2QMEA 4ZKEA 2DWQA 4DSOA 1CRPA 1Z6GA 1CEEA 5FTLA 2ZJOA 2ERYA 1GAJA 3BJIC 2IYTA 2PT5A 3BD9A 4QKQA 4F91B 4AKGA 4IKEA 1VYUA 4WA7A 1TQ2A 3ICQB 2QQEA 3B5JA 3WXMA 3U7EB 4CT4B 4DLXA 1E2EA 1QHXA 2FN4A 2W2VA 2GWHA 1NNEA 2ZR9A 3GMTA 1NJFA 2EVWX 5C2JB 1OIXA 3VR5A 5FPTA 1GUAA 2A5DA 5C1BA 1WBDA 1JQLB 2XGJA 5CJPA 5GJBA 4GMDA 2MSCB 3BB1A 4LY6A 1GRNA 2Z6VA 4B2IA 2JATA 4B48A 1SGWA 3X1XA 3TQFA 2G0NA 3OHMA 2QPTA 4JLJA 2WWHA 1P61B 3GLIB 1JXOA 3ZD6A 1KKMA 1TNDA 2ZU0C 3KFXA 1IONA 2HCJB 3IEUA 1CJVC 4OHXA 4C30A 4A1FA 1L8QA 1ZCAA 1ZUNB 1JJ7A 2ZRJA 1KDOA 1VCNA 1MRSA 2B7BA 3CB4A 2AHOA 2GK6A 3UWOA 4RFSA 3LBHA 4ABYA 3CPHA 3RLFA 3R8FA 4L8GA 2QP9X 4O2LA 4TLCA 3V4RA 2ZRKA 4P33A 2O8EB 2RMKA 2RGDA 3SDZA 4TMTA 3RS3A 4B73A 5JWRA 4CT5A 1OYWA 2OCYC 4RKFA 1JJVA 2IS1A 1AKEA 2ZQ5A 5G41A 2AK2A 4KODA 4QGAA 1SQ5A 4DEYA 3E1SA 2OLJA 4KFSA 4AIIA 2J87A 1KGDA 1KDRA 1U94A 4NPHA 5JJKA 2XJ4A 1P6XA 1RRGA 4LBYA 3O47A 4I1SA 1XPOA 4CGZA 3PEYA 5D3MB 1KI2A 1P2SA 1P9RA 2NZJA 3AKCA 5DYGA 2ZM5A 1CLUA 1QHGA 1NF3A 4MKGA 4PPGA 1Q1BA 3D31A 3U3OA 4NL4H 2KSQA 4YMUA 2JLVA 1E9EA 3B2EA 1JQJC 4B33A 1YZKA 3ONWA 5JHGB 1T5IA 4YDSA 5HTKA 1A4RA 1D2EA 3ZVNA 2FFHA 5FFMA 4URVR 3V4FA 2BBTA 3O8DA 2PLRA 2KB0A 4V02A 1YZNA 4OKSA 1VG8A 2GHIA 4PZLA 4EFLA 3I62A 3AVYA 2XNSA 1KO1A 2ZR0A 2CJWA 2ZRCA 4LPKA 2FOLA 3TKLA 2GEUA 4RZXA 3ZS9A 2FX3A 1W0JD 1EFHA 5A4JA 3FHCB 3WMFA 4P31A 4A0HA 3P4YA 4NYJQ 4DUGA 4GP7A 2XJ9A 2FZLA 3W34A 4HB2A 5KDOA 1FTNA 1SHZA 2PEYA 3OE7D 4DLRA 5L3QA 3L43A 5EXXA 4TSFD 4JJZA 4QBGB 3AVPA 1X8LA 3CRVA 2VL7A 5JI3E 1G7CA 3AVQA 5DNYB 1ELOA 1XEXA 1RFLA 1N5IA 1GM5A 1R5BA 2I1VB 2QP4A 2WWFA 2KE5A 1JEEA 1NLZA 4PZZA 4B75A 3IEVA 3C5CA 5JCPA 3B9QA 1VCMA 2P6UA 5FL3A 4B32A 2IW3A 1K6MA 2H92A 4DSNA 4M1YA 3D7MA 4W5WA 1NBMD 2DFKB 3QG1A 4F93B 4BEJA 2IYYA 4ZI2A 4OQLA 1ZAKA 2VHQA 2XXAB 1I2DA 3ZZ0A 2O5VA 1K5DA 1RE0A 3T34A 3KL4A 2IXGA 4FD2A 3VNUA 2FSIA 2ZUCA 3VX3A 1YKSA 4EKDA 4G5RA 5A5GA 1W7AA 4M1KA 2AN9A 3KDSE 3GLGA 1IM2A 1R4AA 3GEIA 4YLGA 3B13B 3KXKA 3BB4A 1VTKA 2QI9C 1XD9A 4QG7A 1R10A 5C46F 5LDDC 2WJVA 4KFUA 1JAHA 2NOAA 5JSZA 1OXSC 4Q47A 1E1QD 1II8A 1JAIA 1TEVA 2PMDA 3IPXA 3REGA 3TVTA 3TBKA 5EP4A 4XVUA 1P60A 4X8OA 2VLIA 2ZVQX 2C8VA 1P7CA 4QFMA 4P4SB 4Z1MA 4RCYA 2OCAA 2V3CC 1NKSA 2IYXA 4NHOA 5KPJA 1J8YF 5FUVA 3M1IA 3HU3A 4ITRC 5E4FA 1AA9A 2A78A 1S96A 2R6AA 3CZPA 3DZ8A 5KSZA 1OW3B 2FMXA 5J4LA 1EFTA 1R0YA 3SHWA 4K81B 4JLOA 4D0NA 2ZRLA 2GETA 4MGZR 3WYFA 4Q03A 2IHYA 4HAVA 4HB3A 1UEIA 2GCNA 2NTYC 1NVWQ 1YRAA 3ETLA 2Q9CA 3LW8A 4P32A 4PHHA 4RZ2A 4DDWA 1LW7A 4PO8A 4Q00A 1WBBA 2EYUA 4ZCIA 3EPKA 3KJGA 1CXZA 3HWSA 2Z5FA 5BN5A 4KXFB 5HCIA 4TZ0A 2CVFA 1IOZA 3PCRB 2QGNA 3RSOA 5K8IA 1RYFA 2GCOB 4TN1A 2ZYTX 3PQCA 1GKYA 4RFSB 4Z8XA 1SVOA 2ZRHA 4F92B 1CULC 1HE1C 1GL6A 1FP6A 3NBXX 2QE7A 1XEFA 3W90A 3VKHA 3L2OB 3ZQ6A 3ZYCA 5CYPA 3SOPA 5FPSA 3E2IA 1AM4D 2VP4A 1R7RA 5JJLA 1PLJA 2BCGY 5DI3B 4MRPA 4UQOA 3FB4A 4EDHA 2O8FA 2Q3MA 4JVNA 5FOXA 2VRWA 2V7QD 1JNYA 3QEJA 1QHHA 3QKSB 2G0TA 1QHNA 4JLVA 1MO3A 2BMDA 1CR1A 1GILA 3NBYC 721PA 1Z28A 3B9PA 3THXA 4JT4A 2R8RA 1R5NA 2WWGA 1N6HA 3QG5A 2Z43A 3DL0A 5HR5A 1XD8A 1E4YA 2F9LA 3DHWC 1E0SA 1A2BA 1Q44A 4WZAE 3U5ZB 2PMKA 3SQWA 1R0WA 1YHNA 1XBTA 2ATVA 1A7JA 3MWKA 4FMDB 2B21A 4O25A 1W4CA 2D74A 4C7OB 5EZ5A 1G20E 2YC2C 3U3RA 4PXAA 3GFPA 4TWZA 5B2ZA 4FCVA 1BS1A 4DWJA 2ZU6A 1EFRD 5DH9A 3AV0B 4CEIA 1XU4A 3OEHA 4CEJB 5JS8A 2OAP1 3QPWA 4DCSA 2IXEA 2B7CA 1UAAA 2EFDB 2OAQ1 2YYZA 1OXVA 1VECA 3DM9B 3FKSD 4M1SA 4NZYA 2FPMA 3JVUA 2ANCA 1G4AE 2VTKA 2PJRA 3CRW1 3K9LA 5KNBA 1XTSA 4EQ6A 3PV0A 4Q4JA 3THYA 3FDIA 3SYNA 3UXMA 4B76A 3BIFA 1IN8A 1CJTC 4PSVA 2ZUBA 1HE8B 2SHKA 4OYHA 5FI1B 4WAUA 4CEHA 2B8TA 3UMRA 5KNCA 2JJ8A 2VIIA 3AB3A 5L3SB 1US8B 1AIPA 1RPZA 4LJAA 2J7KA 4H9GA 4LJ4A 3EZ2A 5FBVB 2QGZA 2LKDA 4Q19A 4Q4JB 3THYB 1E2LA 2D3WA 2BOVA 2EYQA 3KQNA 3FVQA 2X8AA 2VP2A 1FMLA 2YOGA 1C1YA 3C14C 1T91A 5E7IA 1G8HA 2WKQA 1KK3A 3BC1A 5AJWA 1QRAA 2BEKA 1XDBA 3TR0A 4KLNA 1KY3A 3R9WA 1E9DA 1G7SA 1XZQA 3B82A 3U7GA 4GI7A 1OSNA 1H65A 2YWEA 1DELA 1Z2AA 3LLUA 3PXGA 1N5LA 1Z3IX 2ZRFA 4W5JA 4ZDKA 4FIDA 1E2NA 1P2VA 3U6KA 2OBNA 5M04A 1SXJE 4OK3A 1OKKA 4F4JA 4Q4LA 4OK6A 4TMZA 2O8DA 1Z0KA 2BV3A 1E1QA 4JSYA 4RD2A 4Y0VA 1E2HA 2W00A 2REBA 1WP9A 2JJ1A 1FUKA 3VR2A 3EA0A 5BXQC 1EG7A 1IXZA 4KVAA 1XMSA 4IDPA 3RS2A 3DKPA 4C0SA 2IF0A 4FMBB 1PZNA 1DAGA 2DBYA 2EFEB 1S8FA 4HLUA 2IUTA 4LC0A 5FPHA 2FSFA 2JLYA 4A36A 2VSXA 2ONKA 2FV8A 1FMJA 2H16A 5AK0A 2W6JA 5JLJA 2I3BA 3X1YA 4KFRA 8OHMA 3ZDQA 4JLBA 2OFOA 3X1ZA 3U7FB 1DARA 2GXAA 1OPXA 221PA 4JL8A 4Z51A 2EU8A 5FL7A 4AKIA 1HTWA 4AURA 1FPMA 3FPAA 1Z6TA 1GNRA 3Q7QA 4XJXA 3ICEA 2WV9A 4URZR 5FPKA 3EPLA 2XNDD 3L0SA 421PA 2QBYA 4RSGA 4KO8A 5AWFC 4UNRA 2HXYA 4Z1MD 5HZHA 1Q0UA 5DGXA 1T9HA 3CPEA 4OQMA 2GTPA 3UATA 5IHPA 5ELXA 4L4UA 3L0IB 1G291 1RRFA 2ZRPA 3N2IA 2FFQA 5J47A 4B71A 1OB5A 1E9FA 1VYVA 3B7GA 2O8FB 4A2PA 3Q85A 1M34E 2UKDA 2BWJA 5J40A 1NMXA 1U99A 4EJSA 3F3YA 4PANA 1UF9A 3EC1A 2QTHA 4ILEA 3QUSA 4KSBA 3AVWA 1ZP6A 3A37A 4IVQA 3WYAA 3UG7A 2YKGA 4TYYA 1KO8A 1I2MA 5H68A 2ZS8A 4M9XA 3ASYA 3OESA 1YRBA 4PTLA 4IFEA 1NLYA 1TQ6A 1EWRA 1OIVA 1G6OA 1Z08A 3RSLA 2Q3HA 4F4IA 3VX4A 2ZRNA 4LYFA 3TMKA 1R2QA 4LJ8A 5GJCA 4FI3C 2A2ZA 4BFWA 5HE9A 2H8KA 1KI7A 4HUQB 1DVRA 2XITA 2OHFA 1II8B 1F60A 2HT1A 3A8TA 1E32A 2QAGB 3A58B 4EIWA 3QVUA 4CW7A 5BYKA 1G8YA 4H1UA 1NBMA 4LSGA 3MWYW 3EIHA 4QGFA 4TL6A 5HPYB 2IX3A 1S9HA 5FOUA 4US0R 4BFSA 2ZRDA 4NYJR 3WNCA 3FFBA 4PPQA 1RYHA 2ZANA 3VFDA 4ON9A 4IRUB 2JLWA 2ZE7A 4IJMA 4KVGA 4IOJA 4P4TA 5AUQA 1UM8A 5CDFE 2JAQA 2WWXA 3L82B 1D9ZA 4LBVA 2P67A 2ZETA 4PC3A 4MDEA 1V5WA 2CLSA 2GJAA 2HEIA 4RD0A 2NG1A 4Q02A 2JLSA 2FZ4A 1GVNB 1HY3A 1VHTA 2HUPA 4RD1A 2IK8A 3I73A 1X1SA 5FOVA 4FW9A 2VHJA 2ZJAA 2ODWA 1ETUA 4XOIA 4MGKR 3LXRA 1N6KA 3RC3A 4C0LA 1YZLA 4HZUA 4JBXA 2J9RA 2BMJA 4EPRA 3KZ1E 3MSXA 2C2HA 2GZDA 1HYQA 3BORA 1G3QA 2CLCX 5AR1A 2C5LA 3KKQA 4HZIA 1P4SA 5P21A 3TJZA 2O8BB 1E2KA 2YNMA 4LV6A 5FOTA 5L3VA 3EIEA 1L4UA 2ZREA 3MFYA 3N5CA 1A2KC 1SXJD 2EWWA 4N0EA 2RHDA 2PX0A 4GOJA 1P5ZB 3GEEA 2VHTA 3BBPA 1YR9A 3VR3A 1FX0A 5J4KA 1MO4A 2IYVA 3QE0A 4M2LA 3U4QA 3K0EA 2RAPA 1FL9A 3MLEA 4GPTA 4HLCA 2J1LA 3Q9LA 3JZAA 4EFNA 2G83A 4JLAA 4IOMA 2NMVA 2ZVPX 2GDJA 1I4TD 1UBFA 1UBGA 3G82C 2RGXA 1YU9A 4IW3B 5J4YA 3LW7A 4HAUA 3RS5A 5J4VA 1M2OB 1PLKA 4E09A 4EPVA 1KMHB 3DMDA 2ZJ2A 1W5SA 1NP6A 2R9VA 5FBRB 2OSBA 1KSHA 2WVJA 3D3QA 3CPJB 4HAZA 5KNDA 1E4VA 2NO6A 3TW8B 1J2JA 2O8CB 3P20A 2L0XA 5CLLA 2QMHA 1XEWY 1NL3A 4A8JA 5GADl 4TYNA 3JZMA 5KTYA 1HQYE 1U98A 1ZD9A 2PZGA 2DFLA 1II0A 1FZQA 1KO5A 3SYKA 2PZEA 1ZC4A 2VSFA 2C9OA 3M6AA 3PR1A 1FP7A 2IA5A 4FXPA 2MMGA 1OXTA 2N46A 3OIUA 5C4GB 3Q72A 2RGEA 4BZXA 2FE4A 5SZKB 1I4LD 4NCKA 3GFTA 4NP6A 3GLFA 5FL7D 1Z0FA 2GAOA 3H86A 4NCNA 4B3GA 4OHYA 4BEBA 1HEIA 4RY2A 1EK0A 4DLUA 2VP9A 3ADCA 3R7WB 3CWQA 3B1VA 3SC3A 3WNDA 2J3EA 1E98A 3AF3A 4B6EA 2FPKA 1T0HB 2LKCA 2HYIC 2WHXA 4EJSC 1NG9A 2YWHA 3NH9A 4LV8B 3O8BA 2JCSA 4KBGA 1E2MA 1R5OA 3GJ0A 3R7WA 5K8UA 4X8HA 1D2MA 3IGFA 4P4UA 4I1OA 3NWJA 3FFAA 2VH5R 3GJ3A 4DBLC 2XTMA 4LGMA 3IPYA 1U9IA 1HQCA 2EFGA 4Q5IA 4R9UC 3A1VA 4TYQA 2DY1A 3VAAA 2GVZC 3LBIA 2D2EA 1ZM9A 3LX8A 3B6EA 4LWZA 5CIWA 4ZCMA 1OKKD 1ZM7A 1T3HA 1DG3A 2BMEA 1NRJB 1F3OA 3CZQA 1CIPA 2V54A 1GOTA 2Y8EA 1FOEB 2OV2A 4Q9HA 2V8OA 4DDUA 3DM5A 4AK9A 4XWAA 1VIYA 2OLKA 2VHCA 2O0KA 2ZI9A 1XWIA 1KIMA 1KI6A 4BLPA 1XJQA 5KDLA 1VDZA 1G8GA 1KI8A 3L0OA 1PUIA 3ZJYA 2A5FA 2ZYVX 4A0RA 4D81A 3CO5A 3LQRA 4EUNA 2QAGA 2ZR7A 3EX7C 4I99A 4LJ5A 3K0CC 1CJKC 4HZUB 4JL6A 4V0OA 3VR1A 2JASA 5HKKD 4WW0A 1SKQA 1SVKA 2J0VA 1HUQA 4U00A 4BGDA 4TMXA 2ZJZA 1ZRHA 1KO7A 2J7PD 4YC7A 5JECA 2W6JD 2WSSD 1EESA 1SVSA 1KI4A 4N1AA 1H8EA 2AFIE 1MRNA 2GEVA 1UBCA 3SBEA 5FH9A 1ESNA 3PUWA 4W5HA 4D26A 4HAYA 4U7DA 3V00A 1NN1A 2C04A 1G8FA 4V0NA 1WA5A 4PQFA 5FUYA 2NIPA 2UVQA 4MGYR 4KCGA 2GVDC 2B6HA 2P6NA 2X2EA 3KKNA 4JJKA 1SVWA 3BRWD 2GEDA 1CR0A 4YQFA 2ORIA 4D80A 3O8RA 3GLIE 3QI2A 3T1QA 4Q1BA 2FFBA 3RRMA 4Q9JA 3A1WA 3HU1A 3C16C 3B85A 5LD2C 3ZIAD 5TY0A 1XTQA 3WMGA 2NO1A 1F2TA 3EZFA 3SEAA 1U90A 4AG5A 2QL6A 3HR8A 3NVAA 2IYQA 2NGRA 4Q7MB 1R8SA 1H8HD 1S1MA 3SR0A 1E9AA 2HF9A 3HPQA 4KYUA 2AWOA 5DHAA 1RKBA 1S9DA 4O0MA 4A2QA 1XJCA 1QHYA 2QZ4A 4Q66C 1ONBA 1E9RA 3NG1A 2P2LA 3ZVRA 2ZRIA 2GJ8A 1UKZA 3HYTA 1IY1A 1II9A 1P3JA 3WRYC 5ANRB 3K53A 1T6NA 4HUQA 3ZVLA 4C0AC 4IDHA 4HYYA 4ARZA 3BFVA 4TL8A 5EJEA 4TTPA 2QP3A 5J4HA 4LHYA 3KJHA 3AF1A 1F6BA 4RZUA 2FJUA 3W5IA 2IYLD 2XAUA 3FMPB 1X8JA 4JKYA 4HLUC 2J0QA
chains in the Genus database with same CATH superfamily
1Z4PX 1ZM4A 3BSSA 4DLSA 1RC1A 2R1VA 1CJSA 2WD7B 2PTGA 1HZZC 1QCYA 2YXBA 1WXHA 3LG2A 1TQ4A 3M0EA 1E7SA 1FW8A 4JC0A 3RVPA 4K6OA 2I33A 1PGQA 3MLAA 4NS1A 3HBMA 2VPIA 5AVSA 1N3BA 3HA7A 5DISB 1RS0A 3RVBA 4KGZA 5LZ4A 2ZW9A 1UAGA 2HXGA 3DBLA 4GLLA 3R24A 1JALA 4CM8B 3HJTA 1Z47A 1UBOS 3W78A 2EWVA 3O73A 1VL5A 4EVQA 3F4KA 1ZK4A 2HIHA 3VYRB 1C7RA 5J2TA 1W0KD 3AUTA 3GDWA 5KYKA 2ZWAA 1FSGA 1P45A 2C4TA 5DFAA 3O8NA 3OWOA 4WFIA 1RKUA 1U04A 2BSAA 5UKDA 4ZZ2A 2FSSA 1WZUA 1TM3E 2AEFA 3CG0A 3E7XA 3KQLA 1HBJA 1GO2A 2QEQA 1DOHA 3HBNA 3UM9A 5ALSA 1RQGA 5EA2A 4MRSA 1G21B 4QQ8A 1L7DA 2C3UA 4X92A 3R6WA 2E1PA 1YACA 4RBNA 4ACBA 2XADA 1A69A 2I4TA 4OMUA 1KOJA 3RAPR 2XRYA 1J07A 3UUWA 1LDYA 2AYXA 4KR9A 3EAQA 5DGIA 3JQPA 1N8NA 4PY2A 3QF4B 1KE2A 4IDDA 1ECCA 2A5JA 1OFUX 3GJZA 3JU3A 4TKVB 3UNXA 3WGZA 4G0PA 2W8ZA 4LZJA 2IOQA 2ZSEA 4EFDA 3S4YA 3RO7A 5H9WA 1E9SA 3LA8A 1VHJA 3IAEA 2VN8A 3A4NA 2ZIXA 3VPCA 2GZMA 2P62A 2OCGA 2BM1A 5D86A 1T9CA 2FPPA 2X1LA 1IWBB 3UT0A 3CONA 1VG0B 3BL6A 2RHTA 1E7QA 1ZMOA 2J30A 3TRJA 3H87A 3ZEAA 4CLHA 2ZCJA 4LZLA 3VVLA 4KXNA 3RC8A 5HM8A 2XMSA 3E15A 3JWPA 4W5NA 4NBVA 3Q0TA 2B2NA 4ESHA 1JSZA 4LXGA 3WIVA 1PFUA 3MT9A 3DEYX 1RM0A 3NPMA 5CNKA 5GJVC 1TCUA 3ZI0A 5ALKA 2B8EA 3D8NA 1IUNA 2K7ZA 3I6QA 4ZO4A 3KB1A 4XOUA 5EE9A 1RHRA 1R6TA 1QMPA 4U2EA 1XD2B 1Z17A 1VKJA 3KPUA 3LO8A 4MCJA 1AGNA 1HTBA 3IT2A 4BX0A 1UWVA 3AP3A 2RH4A 3HP1A 1KEPA 4DV4B 3IMCA 3S81A 3S8MA 3WQHA 2WBLC 4AC9A 5FO0A 1Y6RA 2QRUA 1NSTA 1F5NA 1JIVA 2IT1A 3AHEA 4FS8A 4YJ3F 4ES6A 2B0CA 1XQVA 4JEUA 4MPPA 2F55A 4R81A 5DCUA 3I01A 3KZXA 1I5OA 1N8KA 2A9JA 3RK0A 4YV0A 3VNVA 3DAYA 3VR6H 1ZM2A 4NBUA 2K5UA 2QU8A 3CH6A 2XE7A 5HBGA 4HWRA 1EDZA 3DFZA 3NNNA 2DVMA 1K2WA 4JJGA 3KB2A 3Q3CA 2ZI5A 1ZH4A 1QR6A 3IPRA 4IKOA 4Z0TA 4Z2YA 4S1OA 3WY9A 4BNVA 3BCSA 4JP3A 4H2DA 4WCVA 3VV3A 5IDVA 3K8YA 1Z0IA 4PE5B 1A50B 4BIIA 3KT3A 1TL7C 1TJPB 3CF6R 3KKEA 1N6IA 5A1JA 2ZIGA 3EZYA 5EJFA 2ODBA 4G41A 3TH5A 1TKAA 3OEYA 2YZ7A 4WLVA 4D4MA 1ZIXA 3PR3A 4LZPA 1DWQA 1O6ZA 4DNXA 4OU4A 4DC9A 4NTZA 4D97A 5G53C 4JT8A 3HR7A 5BVGB 3NHZA 4IMRA 3UHFA 5DWDA 3UO8B 4EI7A 4QJ3A 2JIMA 1JDPA 3N76A 4F5EA 3PJRA 4NRDA 3A06A 1FBTA 1U9IC 1SRQA 2A7XA 4BAZA 2C78A 3VPBA 2H11A 4MUKA 2H29A 3PDIB 2QN7A 2YRWA 5EY5B 1J39A 1ETHA 3JD1A 4G1FA 1ENYA 1O95A 3RTBA 1OX6A 1QZXA 2W6ID 4RZHA 1HOTA 4YJ2F 3JYOA 2VAPA 4MK4A 3VHXA 3ZY2A 2GF9A 4GKVA 2VAVA 5L45A 1USUA 2D5CA 3DLHA 2KBEA 2RH5A 2G9RA 1IMOA 1J70A 1N4DA 2FZEA 2YY7A 5H1YA 4EB8A 4J0JA 4F5DA 3IMGA 2QNRA 2WHQA 1J1ZA 3DBRB 1E3QA 1UCFA 4HMPA 3RWMB 1KJJA 1ZN7A 3DT9A 3BOSA 2ID8A 3DEAA 4JGIA 5CYGA 2V1UA 5L8VA 2FEPA 3KRTA 2B4AA 1E2FA 1VI2A 1E1DA 3B78A 3FCXA 4IVRA 4O1IA 3K4HA 5DI9A 4UFPA 4DR5B 2EX1A 3T1NA 2C3YA 2J6IA 1NW6A 4MVWA 3AL3A 4ALJA 2PZBA 3C3MA 5JDIC 4NXNB 4QTTB 1AOXA 2VDPB 2AD1A 3BIJA 1KPGA 1YS1X 4K9OA 5D1NA 3EFBA 4XVCA 1G4HA 3A6ZA 3OSZA 4YNBA 5FP0A 2HDWA 3MJFA 1XWFA 1NV9A 5DSXA 5EIWA 1KEWA 3JQRA 5CTAA 2VDJA 4OI4A 1T3SA 4BB0A 3JSAA 5DHFA 1DOAA 4Q39A 4Q4CA 1MAVA 3TD9A 3N2ZB 3CX7A 2IZ1A 4IUYA 1GZ3A 2DG2A 4P5EA 4IIJB 4MIKA 4QATA 4EWLA 1XDSA 3K9NA 2A33A 3PT5A 4EG5A 3CUTA 2WUWE 4C22A 2J0UA 4YHHB 1QYRA 2OC9A 4A8JB 1Y1RA 4DR3B 5AK3A 1QQ6A 3PX7A 5CAEB 3D8BA 4MV0A 1OROA 2YWJA 3KZCA 2YN4A 3B6MA 3AV3A 2FEXA 2JG3A 3VQTA 3M82A 1SZPA 5LYJB 1M8KA 1MEOA 2X0IA 3DFKA 4RQBA 5A6SA 4Y6PA 2OXEA 3OCUA 3P9ZA 1L0BA 2FWRA 4YRAA 5KREA 1I1HA 1GITA 1BHJA 1M83A 2E5LB 2HNBA 1QRDA 3DTVB 4PZAA 5FR1A 4BUCA 2J59A 3QOXA 5JNSA 4N6OA 5ARBA 3HY6A 1NVEA 1ZMRA 1TVEA 2I6SA 5AW8A 1KFEB 3FCAA 2R751 3BS4A 3IV9A 2D06A 1F6WA 4B1FA 1PQWA 2NZ2A 1U2DC 3DWGA 4I9NA 4L3VA 1G2IA 3I5YA 3A9SA 1BMQA 5H70A 1OH8A 1KAMA 1WUJS 3ND9A 4RETA 2PT7A 5E6UB 1KWKA 3GRRA 4MA4A 3QI7A 2OV1A 3L02A 2I4OA 4DILA 4U7JA 3CW8X 5CA0B 2J6BA 1OBCA 4EI8A 3TG2A 2JAXA 2PL3A 4EG0A 2FOIA 4BQSA 4M21A 5C4MA 4CU2A 3K71B 3OFVA 3K0FA 3PPYA 3K30A 1R12A 3NI2A 1SEVA 3QU9A 4PLWA 3HEMA 4QWWA 5FFFA 3VU9B 1R0RE 3A1DA 3VMFA 3TNJA 2WM2A 1L5ZA 4L8LA 4QHTA 1NVXQ 3PVCA 3DMGA 2R66A 1R8XA 3U56A 4JC4A 4K9MA 3CU5A 4A6DA 5CLQA 1JL3A 2VF2A 4LK2A 1M0WA 3BHJA 4Y2GA 5CT6A 5DEIA 5IT4A 4BVFA 3RIHA 1CTQA 1X7GA 5A71A 1DAKA 2BGNA 4R2HA 4TOIA 3T7EA 4A8JC 2YX1A 3C8UA 4HRXA 4FEGA 1PE0A 2EZ8A 1V16B 4OF4A 3ZY3A 3OZAA 1U5BA 5ALNA 1QVAA 4BKQA 4XFDA 3MERA 4RCVA 2I9KA 4BNFA 1EQ2A 3RS0A 4A82A 1PVVA 4JT9A 4OL0A 4RMNA 3C3EA 3JTEA 3UW3A 1FE8A 3TUIC 1EUCA 3BQNB 1GA6A 1J5XA 4U1RA 5B7PA 2K4MA 3W5BA 4PQGA 4LX0A 2ZZNA 5LQRA 1P7YA 2X5NA 5TARA 1Z07A 4N6GA 3QF7A 3H5AA 2Y9MB 5TGTA 1E5XA 4QDTA 1XZPA 2V7WA 3MCWA 1JECA 4F96A 3BGDA 3PYLA 4MCAA 1Q11A 3M5WA 4OYYA 4KR6A 4QBKA 3IAUA 1TM7E 1ZN8A 2C5BA 2CMFA 1Q7GA 1SCBA 3MT8A 1OFGA 3PIRA 3LPNA 1YIAA 3P9CA 5DVZA 1ADYA 1CS4C 3OHPA 2YICA 2WKRA 1RXYA 4UEQA 2PXAA 5BN5B 4D6YA 3TE6A 3U4HA 4RXMA 4WV3A 2H06A 2A5GA 4QUIA 3EC7A 1JIJA 1XZIA 5TXGA 1QVRA 2PX8A 3OQIA 1VCIA 1ZI9A 4FN5A 4CQJA 1TJ4A 1HNNA 5GP1A 4E1AA 3MTQA 4X1YA 1V95A 2AOVA 2C84A 4XSVA 3E9ZA 3GUUA 4BNXA 2Z8YM 3PG5A 2RB4A 2G8NA 4I14A 3UHPA 3LLMA 3RVJA 4LYJA 3H5RA 5JAHA 3DDHA 2OHIA 2AWNA 2QYTA 3BMCB 3CNQS 3D6TB 1YI0A 4IWNA 3IHWA 4Q1EA 3RC2A 4BO9A 2Q5EA 1FFXA 1DCMA 2X9NA 2FUEA 4K86A 4U0KA 4GZ6A 3JQGB 3T54A 3ILHA 4NONA 4AY5A 2N0SA 4FEEA 3OPMA 1IOVA 3WTBA 2IP1A 1PHPA 2JFQA 4B35A 1CZHA 1KZ6A 1JKIA 3S2IA 1UBHS 3NT2A 1N78A 2ASVA 4AMGA 4AZ0B 1OTYA 3MBKA 4O4IF 1SUIA 1Z68A 4HTFA 4PO9A 3L0DA 1CZOA 4FLFA 3UPDA 2E21A 3TX6A 5CT9A 1AS0A 3O21A 4LXIA 5C7LO 1Q1EA 3BERA 1XSEA 5EXPA 1RHKA 3I1IA 1H66A 4GM1A 2XPCA 5BN3B 2QRMA 4JBWA 1OLOA 1M7BA 3R6GA 1A4IA 3ICPA 1MA3A 2AZ4A 3JALA 4R68A 1KC1A 4NICA 2QW0X 1ECBA 3AJDA 1A4UA 2AG5A 2B5VA 3WYNA 1E94E 4FKZA 3WJAA 6LDHA 5JZVA 2YS7A 4URWR 1SZJG 5BN1A 1BX1A 1LC0A 4OB8A 3F9IA 3GEBA 3V6LA 1VKRA 3EOAI 2OKCA 2ZAIA 1YC2A 4C0JA 3QEOA 1M8PA 1Y89A 5KMGB 4JKOA 4Z4FA 4QEKA 3OZGA 2D1RA 3S1AB 3Q8XB 2NO5A 2QU7A 2YMPA 4GSLA 1GZDA 5AOVA 3T5DA 1Z8HA 2OXFA 2P2NA 4D9FA 5KOJA 1AKYA 3NKVA 1E2DA 4FONA 2BH9A 2OP0A 4OQPA 4EHKA 3ZXSA 1DAEA 2J0SA 2UAGA 4MTLA 1SO8A 4IHAA 4NBSA 3PNSA 3O0TA 4QFCA 2H0AA 4XQGA 1Z16A 4WPGA 3AKEA 3UYKA 2QSYA 4BB6A 2P9QA 4QJBA 2AUNA 4UKDA 3FGPA 1U6IA 1UZLA 4B4OA 4B40A 4M1OA 4F4DA 3PGJA 2D7DA 3BH7A 3T3GA 3FGNA 2KJQA 1PFKA 1MKYA 2GKOA 1FSFA 4PO1A 5CA1B 3DZJA 1IJEA 1EFVA 1Y1QA 1E3SA 3H2JA 4M6WA 1DC3A 4QGHA 4GPAA 2ADOA 2Q5JA 5I5EA 1LW6E 4LAFA 4CBVA 1J7KA 1EVJA 3AEZA 5K01A 2I4RA 2I80A 2L82A 4W9NC 2D13A 2HFJA 4EGCB 3WKAA 1L5QA 3KUUA 3OFSA 5CM8B 2DLDA 1FTQA 4H0CA 4NX2A 4J16A 5LP6C 2WR8A 1E5VA 1PX2A 1XI2A 1ZCBA 2OB2A 3QEMA 3U4IA 3RD5A 5CVDA 4FWTA 4YJFA 1ZGBA 2X1HA 3N6VA 4G5QA 2NPIA 3MF4A 4FZ3A 4L5BA 5HCNA 4G63A 2WP0A 4CMBA 5EJGA 1A95A 4DE5A 3UY4A 2ZT8A 2FUKA 3O31A 4O3MA 3FNQA 1Y6JA 2IY9A 5DTRA 3UCEA 3GLIA 1WCWA 2Z3VA 2O48X 3OBIA 1Q22A 4XGRA 1VKNA 5IH3A 4ZOCA 3VHRA 1DTWA 3ZDEA 4JP2A 4D9CA 2BJHA 5LOVA 4P3YA 1IUKA 1EJ6A 1U8AA 2PUJA 3GAMA 4TVBA 4UAGA 3LRPA 3TNFA 3BM5A 3IUJA 4FMCF 1M2WA 1X80A 1CB7A 3DCIA 4OKIA 4MR7A 4OK5A 1X1TA 2QM7A 1CQIB 2W6PA 2XUIA 3LM8A 3CR7A 2WK1A 4L2IA 5A7FA 2IF2A 2GZAA 2M32A 4HQ6A 2AJDA 3I0ZA 1E6WA 1A9RA 1VJCA 1WB5A 2GTIA 3Q0IA 1OFVA 2IZ5A 4TWIA 4BY9E 1BHSA 1R3UA 2G5GX 4JXJA 3H2KA 3SNHA 2XUZA 4A6XA 4EJ6A 2WSBA 1KEEA 3AVXA 4A15A 3DXYA 2HMVA 4M7WA 1QHHB 4R2XA 3T3IA 3H83A 4DIUA 4C0HA 3PNLA 1RWKA 1EE9A 2NV2B 4P58A 3QA9A 4WKOA 4EMTA 3GZ4A 4B84A 5JTTA 4BO8A 3FNRA 5CB8A 1W8DA 1JNXX 4KH0A 3FPEA 4PQEA 2ATXA 4A8HA 1HLFA 1OXUA 2E4AA 2R6CA 2VA8A 3CUEF 4RVGA 2E4VA 1GCUA 1KYWA 5F7ZA 1E2QA 3KYBA 2PH3A 2X6RA 1NBIA 3ZHSA 5ESDA 4PQYA 2QAJA 5ERYA 2Y92A 5FQNA 3SAJA 4RTLA 1R0ZA 3M33A 1SC6A 2JARA 1UBKS 4GOXA 5BPFA 5HX7A 4DABA 2NYVA 2J07A 4HWOA 3PE3A 4TS1A 2CZGA 3GBSA 3NV7A 4ERNA 4RVDA 1DTSA 2FEMA 4MTCA 2P79A 2GD6A 3PLNA 3QMPA 5F2OA 2F3QA 3AXTA 4O0LA 5G3ZA 3ND8A 1G4UR 2XVMA 4EYEA 1NHWA 3GGJA 5JS2A 1CY1A 1TUGA 2QB5A 3WGJA 4I2VA 4L16A 2ZGVA 1DEOA 2QL9A 3TWOA 4Q9LA 1KO4A 1Y5NA 2BJWA 1MXHA 4A8TA 3TDMA 4CCAA 4QBIA 4NULA 1NMSA 2DFTA 2ZJ8A 2RJOA 4OA8A 5D7BA 3VYWA 3CUUA 3CGWA 3WV4A 3AR4A 4P2GA 3DEFA 1U81A 2P91A 1DC8A 1GGEA 2V6JA 3COPA 3ESRA 1PCXA 2CGEA 2GSWA 3PRKE 3LX6A 1YGYA 2ZOSA 4TVOA 5JMPA 2CJFA 1B76A 1UPXA 3S8YA 3KKMA 4ZOBA 1ACLA 2DXIA 3COWA 1RPAA 1VLJA 3LTEA 1J2UA 4BDSA 4RX1A 1QRRA 3AYXB 1EM6A 3AJEA 3CW2A 4D79A 1ZVVA 5TDHA 1XCPA 4AYXA 3TLGB 2TYSB 3FZGA 3WQSB 1LJUA 2P4EA 3KTFA 1K3TA 1T2EA 3L7OA 4EP1A 4OCZA 1RBZA 3WIOA 4BO6A 1H05A 1MPXA 2GJ4A 3TL2A 4DQVA 1W4LA 4GQIA 1O3YA 1WW2A 2O8NA 1FRVA 1U11A 2IHJA 2BSQA 5T4BA 2BTQB 4QD3A 1G6KA 1MIOB 3SDBA 3PJGA 4LUCA 2WB2A 4S3MA 2C7QA 1T6XA 3LSYA 2F8MA 6NULA 2FPXA 2FG7C 1YB2A 2ZIZA 2O1SA 2UZ4A 1P33A 3EZNA 1Z25A 5JJIA 3THOA 1XMXA 2PZMA 4WN9B 1ZGZA 4YY3B 2QS9A 1C7FA 1U28A 1U2SA 1SPBS 2A84A 2IIPA 2MJLA 1BN7A 3A05A 3DVLA 2IPLA 3PP8A 2CXNA 4FDAA 4WADA 4ZOAA 2CV2A 3PVSA 1A27A 1PG5A 3I09A 4AP5A 2REOA 4OX9Y 5DLYA 5F98A 1CNMA 2VPQA 3JVVA 3VKWA 4GKAA 4Q05A 3D7KA 3FDJA 3IP8A 3QBTA 3R9KA 4P2BA 4AKSA 4C43A 3O8CA 3IAAA 2ZCVA 4PRYA 5BXYA 2GBLA 1Q7BA 3VPFA 3DOUA 1O54A 3NC4A 3TLEA 5JNVA 2OHJA 1KDVA 3WL7A 4QPCA 4QNMA 3E0XA 2NSDA 1J99A 1QYVA 4BB5A 1C50A 1YD7A 2W83A 2GNOA 2ZE6A 5BN4A 3G8BA 3W5UA 5CH5A 2QPAA 4K0RA 3L7YA 1TUIA 1XZ8A 2JIPA 1M6VB 1QC5A 4DG8A 1XVIA 4CQMB 2C4VA 4NXMB 2BJVA 1RXEA 1HYEA 1QFSA 3BWBA 4KXYA 4WZBE 1XQWA 3KYCB 5FX2A 2BGKA 4MVYA 1GEEA 2RHWA 1QKKA 1Y7LA 1LZLA 2CBXA 2HYDA 2IUSA 3DP7A 3I45A 3LPLA 1GTVA 4NU8X 4XTRA 5DHQA 2F3TA 2YWXA 3NTXA 3QYFA 2NUAB 4UM9B 5DU2A 2VK1A 5EIAA 3LIPA 5THXA 2ZRGA 2AUMA 3UT5A 5JCOA 3GARA 2ZVJA 4RLQA 3WWDA 2CXXA 4DBLE 3FI9A 3QBVA 3OUZA 1DIGA 3MB8A 1MAUA 1U1GA 3WHKA 5K3OA 5F1PA 2ZRMA 4RSRA 4XVHA 5BW8A 4FDTA 5LQSA 3GEDA 1N0WA 2GH1A 1EZZA 2FF7A 3ROGA 4JJFA 1VG9B 4GPBA 4CM8A 3BXOA 3WGVA 3WA7A 3TTSA 2XDAA 2FX5A 1IQRA 2G9NA 1M1NA 4JKIA 2B2CA 4J1QA 4LNUA 3SE0A 4B45A 4DR6B 1ZK2A 2WUVA 1RKVA 1MH1A 2IYOA 5F64A 1XN4A 5FWAA 5H9VA 2VT3A 4CKCA 2YN0A 3ZHXA 3A4YA 4RS3A 3IALA 4HYTA 4CKYA 5KTOA 1C41A 5K2OA 3ANNA 2B94A 4YP5A 4R05A 2FX2A 3LK6A 5DP2A 3T3MB 1JLLB 1N2IA 1U2GA 1E2JA 4UEJA 1IN1A 2C8LA 2D7JA 2AN5A 2QT1A 1DC6A 4JP8A 2O54A 2QYSA 1JHAA 3JQ8A 4BVEA 3UANA 3CR8A 4KQXA 4Q01A 1CJBA 4M0UA 4NI5A 4B2YA 1HM5A 1O6GA 1QU2A 5K8TA 2ZTMA 2GZ1A 2PGNA 3FMIA 2CDRA 2H2GA 3EGDB 2UZ1A 2FN9A 4UU7A 3HJGA 2CDNA 3PX2A 5I7FA 5F3RA 2GAFA 4RE6A 1TMOA 2DQ4A 1ZW1A 4QDJA 5A06A 1M75A 4CN8A 2H52A 5SV2A 4QECA 1PT8A 3URKA 3R5HA 3QVVA 1W0CA 1W36B 4G01B 3KSBC 2R60A 4MVJA 4IG4A 3KLNA 1MA0A 4R4JA 4YP0A 4CKEB 1DX4A 1GL7A 4J4BA 3VU9A 4LSMA 3NEAA 4EF4A 2H85A 1LTKA 5E3HA 1QLJA 3A25A 2WPDD 4FYMA 4II2A 4TTTS 1NRIA 4JYBA 4OLAA 4OQ4A 1GNTA 1XTVA 2F48A 2V97A 4EF6A 2HGZA 3RVQA 1ZGJA 3DZFA 1VKZA 1N2CB 4Q9AA 3O6VA 4XYGA 2CLFB 1C29B 4OJTA 3A1SA 1I13A 3SDSA 2Y4NA 4LGCA 3WL6A 4TTRA 4KO1S 5E1DA 3ZDCA 2XQIA 1NVGA 3CURA 1OVMA 1UMCA 4Z9AA 1SXJC 1IFXA 2C8KA 4RORA 2GBPA 1ZXXA 2MYTA 4KO4S 4PYQA 4QPDA 2ZPUA 4BV9A 3ESXA 4EY3A 1R66A 2FSGA 2XSZA 1AURA 3ND7A 1PGNA 1Z4QA 1YCHA 4AJNA 2R6DA 3FIJA 4J9VA 2WJ6A 3ASVA 2E82A 2R8YA 3HGQA 1OLXA 1X1RA 1GRRA 2NTVA 3WGHA 3NUGA 4NU0A 3ROMA 4D45A 4NFYA 3Q87B 4IXMA 1CYDA 4LRXA 1ML3A 4I6EA 3W2GA 2FI1A 4EI9A 1I10A 3ICOA 1GN8A 3AZQA 2WAOA 4U8HA 4W8GA 1VSQA 2X5KO 5JPCA 2ZWOA 4HD8A 3Q3VA 4F84A 1XZBA 2QZJA 3WMXA 4WOPA 1YBHA 4HDSA 1K86A 2C9CA 2GT1A 1AMUA 2P9EA 4E2ZA 4CEHB 3DGFC 2E9SA 1H1DA 1VIVA 3HGTA 3A9UA 3SF8B 3VR4D 5AVJA 1VHLA 3E82A 2BRUC 3K20A 3SEZA 1XZJA 1DKLA 3MOIA 1IUOA 2JHFA 2QT0A 2HM7A 2WJYA 3WHIA 3ORSA 3ZIAA 5DM60 3GEPA 4R01A 1AGRA 5EHQA 5KINB 4IEFB 3ONFA 1USKA 1MLDA 4JP1A 3RK4A 5BQPA 5KJFA 1Z6QA 1T3GA 1TF5A 4C6TB 4TTAA 3UOGA 3ZE7A 1PJQA 4JODA 3VZCA 2V1XA 3PENA 1FJGB 1BHQ1 4EPXA 3FMFA 2O2XA 4QXAA 2A8YA 4HLQB 2Q2OA 1AUOA 2VHXA 3W3AA 4OXKA 3OP4A 2AX4A 1PJ3A 4LC9A 4PBSA 4TQ9A 2NW6A 3E27A 2XMRA 3PTLA 5HCUA 4BJ3A 4RLHA 4EO4A 2C3MA 5F1KA 4EPWA 2WSMA 2HOQA 4Y2XA 4YMLA 2Q0HA 2XNDA 4C01A 3KUKA 4WZBB 2NXEA 3TW4A 2P6RA 4YJGA 2O4CA 3TD2A 5K09A 5LL6P 1VKOA 4RJTA 2QTMA 2B4QA 2DHEA 2VJNA 1XMVA 2XGGA 3AR5A 1CFJA 3I12A 4UHJA 4FEAA 3HDVA 2EEZA 1GP2A 1EBBA 1C4XA 3STUA 4E07A 5CRIA 4XWKA 2Q6TA 2REQA 3QU7A 3F73A 2ZSHA 5DK4A 3E4DA 5I8WA 3KZMA 1Y9AA 1E20A 3E5HA 1MJGA 3NHSA 3PEEA 4X7MA 3PXEA 3CYFA 1F7UA 3A3YA 5A9SB 2ODNA 1WMSA 3WNCA 5LN1A 1HFJA 1Z4JA 5JQGF 1CHNA 1HLDA 2ZQYA 5C8ZA 2C9YA 1GFWA 1UK8A 5AD1A 4WZ6A 1RLUA 5CVCA 2HX1A 1D2RA 1Z5GA 3WLLA 2HZBA 4ROTA 2G04A 1RD4A 1H6DA 3DD5A 4QUEA 4AUMA 4IIGA 1RZVA 3KQQA 4MPJA 1MT0A 1M6NA 1NFRA 1YA8A 1WL8A 3CKKA 4PS0A 4Q12A 5CBPB 3IVMA 1V1MA 3PYXA 4R2IA 1E6CA 1Z22A 4NMMA 3OZXA 4UJ5A 4RKEA 4M53A 4QGBA 1AXEA 3MJSA 3R9XB 4K6CA 2F3RA 2ZJYA 5BQOA 1DKQA 5SY4A 4EF5A 2QM8A 2JFHA 3BXXA 2Q46A 5LZ7A 1DT3A 4Z49A 4W63A 4DA9A 4BLUA 3MCAA 3SX4A 2NXJA 4GFDA 4NOMA 4XE5A 2X3FA 1RFGE 3EZ7A 5JXJA 3HXPA 5FPYA 3VBEA 3U0BA 1ORVA 1P6UA 1SC4A 4MYCA 5F2EA 5JNTA 5TMPA 1P1HA 4PNPA 3GH3A 1Y4DE 1YI1A 1M67A 2VSOA 2QL7A 4ZYWA 3OA2A 1VXOA 3DMFA 2XB9A 3DMPA 4G0NA 1CR4A 4YASA 4EQZA 4KR0A 4HG2A 3EMVA 2JFGA 4IJWA 4KX3A 3IIIA 3IQEA 1Q0LA 3WWOA 2N75A 4N0QA 3SZ3A 5DM4A 1CZKA 3I9NA 1SOWA 3ZWNA 1GARA 1KNQA 1RTTA 2ZTSA 3L7CA 1L7EA 3FLEA 4CM9A 3DBVO 3FCUB 2AEJA 4JV5B 4OJYA 1LWOA 1TK2A 2O3QA 1RRPA 1DI0A 1I3LA 3BE4A 1Q91A 1SCIA 2BKEA 1M0SA 3H9GA 2LD4A 3OQHA 8ABPA 3DDOA 1GPDG 2C9MA 4KHPB 2BZSA 3HP7A 4MQEA 1P0MA 5AHKA 3D3WA 1BDHA 4HNQA 4F71A 1G64A 1Y8QB 3NYRA 4A91A 3JQBC 1JLMA 4QJ4A 4RY9A 1PJSA 5FEUA 4LMAA 5F4ZA 4BKMA 1A9XA 4XB6B 1YQDA 2XEXA 1XZNA 1DU4A 1M6EX 1A8HA 2E5WA 1I2ZA 2QJWA 3FVWA 4NPCA 5HHTA 4QBFA 1AGPA 5KKCA 3CF4A 1H2ZA 3NBFA 4QOHA 4YUXA 3CVJA 4XPIA 2ZWVA 2G5CA 4S1VA 5FOSA 3STTA 3OETA 3JAWA 4ZC8A 3VKGA 1ZUD1 1YIOA 3FUTA 2PSDA 5T5QA 2VVTA 4IS2A 2XNJA 1KYIA 2WMOB 3CKYA 3WP0A 4CQLB 5HOQA 1W29A 4JU8A 3BXHA 2BGIA 3EDMA 4JUAA 4L50A 4QLAA 5JPIA 1VMEA 4M9SA 1TU4A 1X6VA 3SLKA 4UM9D 1C4KA 3HSSA 4J0CA 3TFWA 1DCTA 3N8IA 4MB0A 1WJGA 3E3NA 1EWKA 3OF2A 4BE4A 1MB0A 4XRRA 5BUQA 3WKBA 2E1RA 1XJ5A 5AO9A 3S3TA 3ZWCA 5LU8A 3BD8A 4E13A 2R25B 4BRUA 4M8NE 4IXWA 5IYZF 4JYAB 5KQPA 5T7BA 1P2FA 1QIHA 4YMGA 3CIOA 5ED0A 3VDXA 1WD7A 1MCZA 4BPRA 1A8UA 4PYMA 5DOVA 5J5CA 3SF8A 2JEOA 2ZROA 1WRBA 1E5QA 2YFQA 2HDNB 1AN9A 3A04A 3D6MA 3TO5A 4ER0A 2AZTA 2XDQB 3DTNA 4M0KA 3E48A 1I7NA 4W7HA 4E22A 7ADHA 3KAJA 4KUEA 5EHIA 3AKYA 1YWGO 4DREA 5BSVA 3UWMA 1Z5UA 4XM2A 4DLAA 4K6GA 1CIVA 1JPNA 1NVDA 4IL5A 4QRDA 1SCQA 1WE2A 2H3HA 2JGNA 2FCRA 1BEUB 3B20A 3ICCA 4M0CA 5KJCA 2EW8A 3II6X 2OQ2A 2OZLA 1Q1AA 3R6DA 4HDKA 1U3DA 4HH0A 2EATA 1KVRA 5AKIA 1A8SA 4KSCA 2Q4BA 3VHLB 4KMRA 4DWOA 5BRJA 2O7VA 3GT4A 2HPHA 4PHCA 4OATA 4RH1A 1GDDA 1WXXA 2WIJA 1IQPA 1JLRA 1O94A 5IJ9A 3VR6A 1F12A 2IXBA 2E85A 2JFZA 3HBAA 3LT1A 5B3LA 5T4EA 4CQLA 4UUQA 3RUFA 5FDFA 3UMMA 3OLVA 3ZV7A 4HH4A 4AWXA 1DUSA 1SD2A 3L0CA 4NE2A 5KHOC 3BHNA 5KWVA 4XWTA 4O4HB 1ADFA 4ZREA 4ZJPA 2I4NA 1SBQA 1VL2A 2BFOA 2FY8A 4OHVA 1C4OA 1UL1X 2VNHA 2YQ5A 4PHTA 1JTFA 3V2GA 1O4VA 2RHMA 5JQGB 3JASA 4RL4A 3RSFA 3RTDA 3WLAA 4D0GA 4CDMA 2OXCA 3F71A 3S2FA 3KQHA 2QNBA 5CDSA 1T5OA 2SCUB 3FZYA 2H2FA 1B0PA 4CN9A 1I8TA 2CF6A 2DHRA 1PUJA 3D2BA 3IOCA 4ZOQI 2BEUA 1CDZA 3F74A 4R7GA 1ORRA 1AXGA 1ZZGA 3AC0A 1EB8A 3KYCA 5JZOA 4IUBS 2P4SA 3FDZB 5JE8A 3X2EA 1X77A 3L6BA 4UTRA 1IXKA 3CSUA 1J1IA 2A4MA 2H7CA 1OX4B 3I3OA 4LJKA 2C7BA 2NADA 2X4GA 4MRVA 3M4JA 3QELA 5EGSA 4F3NA 2EW2A 4JC5A 3KX2A 3CINA 5TS2A 4CMIA 3FUWA 3TL3A 4ER5A 1MDBA 3BZUA 3KKPA 2BSXA 2VAXA 2BTQA 1JXMA 3NKLA 3OY7A 4JGBA 5EE5B 4CPDA 1QKJA 3QFFA 3HJFA 4IJ5A 4IG9A 1VMIA 2PFGA 3GUYA 1VE7A 1AS3A 3CE6A 1KDYA 1IVSA 5EJ9A 4G0WA 4P4LA 2I6GA 4EAQA 1VPTA 1ULZA 2WG2A 3NC0C 3DPSA 2P9CA 2QRHA 3R77A 4FOPA 4G3XA 4LXTA 1FC0A 1FA9A 5DBIA 3WLEA 3EY4A 1KERA 4YQYA 5I6DA 5KOHA 1A4XA 4PZUA 3ZUPA 3TYXA 3AI2A 2BGLA 3A1FA 3FPJA 1GT6A 1HRDA 2GO7A 4D8WA 1RC8A 5DYIA 5JCXA 3ZH9B 1V37A 2NSHA 3PHLA 3FMOB 4DY6A 5ISMA 4NCHA 4EB0A 1KU0A 4IS3A 1NF2A 4EHHA 5C81A 1LY1A 1OHHD 3CVVA 1QIJA 1O97D 3FR7A 2JB9A 4U9HS 2BGJA 1VGRA 3QFTA 2O57A 4I8XA 4QTZA 1YSCA 3OJFA 2PVPA 4M8SA 1P4AA 1KDTA 4OU5A 4QO7A 5IUJC 3U40A 4ND6A 3IO3A 2ZZKA 2RDMA 1IUPA 3CT4A 3QFSA 2JGEA 4KJZA 2YV1A 4Q3CA 3GYBA 2OO5A 2IU4A 3RVRA 5A4AA 3NO4A 4PYLA 3AUXA 2ODPA 2WM9B 3ML1A 1OE0A 2QLNA 2HGSA 5HGXA 1A9SA 3IE2A 3QTLA 5A9TA 3VOAA 1BDBA 4R54A 3F6EX 1AQUA 3HUDA 4PG5A 4H1VA 3ZWAA 5T3YA 1YQUA 2AXNA 3ZXIA 4EAAA 1XDDA 2V4MA 3A10A 4B3HA 4EUHA 5J2UA 3E81A 3MMPA 4PCAA 1U31A 5SY6A 4YRKA 1Y9ZA 13PKA 4ZT2A 5FCDA 4FHFA 5K8LA 1AKNA 3WFZA 3WSVA 1XGKA 3SFZA 3PFHA 3PGVA 4MO2A 2X0DA 5T64A 4MGHA 1O94D 3L6EA 2EG5A 3ZWXA 1D1SA 4BVAA 3PQ2A 4D42A 4ZO9A 3SM3A 1RP1A 4MROA 4GKJB 3QXXA 3KVOA 4HGRA 4X1OA 2VTDA 4ITVA 1E18A 2FVXA 1FSSA 1GUFA 1PJ8A 2GPJA 2IE0A 3VOSA 4CKCB 3CUYA 5TEVA 1E96A 1E6EA 4C7KA 4XX1A 1KQPA 3GJQA 4DNFA 5DNUA 2WJIA 3KR1A 5DRTA 5J9FA 3UMVA 1QU3A 2CHUA 3AEQB 4KLZA 1NF8A 2J31A 4OAOA 1CWUA 1GSOA 2GAJA 1KZGB 3C41J 3GD5A 4GVLA 1QYCA 4L8FA 4PC2A 5COBA 3OQOA 2FN3A 2HLPA 4QLBA 1WXWA 2HRQA 3DS8A 3EWIA 3JWIA 4OHCA 1T5LA 1YCGA 2AE2A 4ZKDA 2HU8A 1VYTA 4LW8A 3CHYA 3CISA 2GCPA 3VH3A 2IYSA 4TMVA 3MJEA 3K9BA 4INZA 3TQHA 5AHXA 4X8LA 3X2SA 4GPIB 4BLOA 3U4AA 2I8CA 1LU9A 4R2LA 1D2GA 1SY7A 5JC1A 4H27A 1Q50A 4MVJP 4LRWA 1IBSA 2F8TA 1N2GA 2WF6A 2ID7A 3K5IA 3NAMA 4YGYA 1VSVA 5DGCA 2CHQA 2NO7A 2XTAA 4MUAA 5CK4A 1KKUA 1OR8A 2V7XA 1P5HA 3DNMA 1E77A 4B3BA 4YCMA 2I3AA 3L5KA 1SBTA 1Y37A 5KX5B 3HRIA 3R3SA 1JDNA 4PC7A 4C7XA 2NXCA 4UXHA 4HEQA 1AX9A 2EOAA 2ADFA 3HWWA 1B0UA 4ZYVA 3EH2A 4QICA 4D82A 2W2LA 3IDFA 4BFYA 4O2AA 3VTFA 1L7QA 1XAGA 2PGAA 1N0UA 3FI0A 5CXSA 1R4NB 1H3NA 3K5HA 4P38A 5TGDA 3SZLA 4YAWA 3F5DA 5TIIA 2C3PA 3HCPA 5AVOA 2JLUA 4I5IA 1X1BA 4NYMR 4UREA 1PP4A 2FYTA 4HXGA 2VJYA 3OJOA 4AD8A 3A3KA 4MA0A 1VZ2A 2Z8ZA 3JWHA 2AHRA 4PVDA 4Q6BA 4CLEA 1DAMA 1EI9A 4WBNB 2DE0X 3GEHA 1KI3A 1B1AA 3WE7A 3C48A 1E1LA 1Y34E 2JCGA 4HWSA 5ALIA 3K9FC 1RZUA 1QYWA 1N0HA 3N6RA 1W4ZA 2F6RA 3ANXA 3ESZA 3L7LA 3ZJ5A 1X0VA 4JHXA 5FAXA 1KORA 1FU4A 3IILA 3MHTA 1Z2DA 1GUYA 1CUUA 1OI2A 1OXKB 2QR2A 2EGGA 3ABRB 4TZ6A 3O9ZA 4ANFA 5FFNA 3PNPA 5BUSA 1T35A 2FQ1A 2ZM6B