1KO1A

Crystal structure of gluconate kinase
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
172
structure length
163
Chain Sequence
TTNHDHHIYVLMGVSGSGKSAVASEVAHQLHAAFLDGDFLHPRRNIEKMASGEPLNDDDRKPWLQALNDAAFAMQRTNKVSLIVCSALKKHYRDLLREGNPNLSFIYLKGDFDVIESRLTQMLVTQFETLQEPGADETDVLVVDIDQPLEGVVASTIEVIKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gluconate kinase
publication title Conformational changes during the catalytic cycle of gluconate kinase as revealed by X-ray crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 62
structure length 163
sequence length 172
chains with identical sequence B
ec nomenclature ec 2.7.1.12: Gluconokinase.
pdb deposition date 2001-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ko1A00
1MABA 3TRFA 3GPLA 2QBYB 5ELXA 3H0KA 4R2HA 4MYTA 1U2RA 3U3JA 3LV8A 3HJNA 1T8UA 3CRVA 4QBFA 2QMEA 3Q72A 5JS7A 1U90A 3GJXC 3O8RA 2YV5A 1GNQA 2LKCA 2Q21A 2ZRCA 1U8ZA 4PC3A 1XXHA 2VP2A 3IIJA 4I4LA 4C30A 3OF5A 4O2RA 3WBJA 2WAXA 3FOZA 1IM2A 3OIWA 2ZM5A 2R6FA 2ZR9A 2C95A 2XZLA 2H5EA 4LOAA 1CR1A 4RVCA 1SVSA 2JJ2D 5TY0A 4YXWD 1FQJA 2QTHA 4PC1A 2Q3HA 4EPRA 5FPTA 5LPNA 4UNRA 4QBIA 4S35A 5JECA 3MUFA 3ZJYA 4MH0R 1E9SA 2JLSA 1B0UA 1IN4A 1OHHD 1W4CA 1KSGA 4KBGA 2FFQA 2BBWA 3KTAA 1VG1A 3THXA 4KFUA 1VCNA 3TAHA 5EZ5A 5KO2A 2C77A 3LAWA 2GZDA 2CL7X 3VKHA 1UAAA 1SKYE 4GI7A 2RGDA 3GLHA 4BRUA 2JJ8A 3H2YA 4M1TA 3GJ8A 4URZR 5F9FA 2D74A 1Z06A 3HP1A 4JYCA 4RFSB 1M7BA 1FNNA 2V6JA 3SNHA 4BFTA 3LFUA 4X8OA 1WE2A 4X8MA 2V3CC 1VYUA 2W2TA 5JWHA 4NYJR 2J0UA 4MDEA 2ZRKA 2G6BA 3MAAC 3SU8A 4B6EA 4D81A 3N70A 3UANA 1UEJA 4PHGA 5CLLA 3RDPA 1SVOA 4ABYA 3DM5A 1G6OA 4QKQA 2IYSA 4Q1BA 1P60A 2V54A 1U94A 2E87A 3O8DA 4UKDA 2PCJA 4KSBA 3NVAA 4OHZA 1MABB 1VG8A 3T61A 1N6RA 2ZRAA 1EGAA 4LBWA 3PEUA 2AK3A 1OE0A 4HI0E 3BRWD 4YMWA 2F55A 4LY6A 2VIIA 2OFWA 4KV9A 4TYQA 1EFRA 2ZS8A 5FTMA 5AUNB 4NYJQ 4C2TA 3QG1A 4XJXA 1TQ4A 4GP7A 4WAUA 5FPKA 3DM9B 1XXHB 2H18A 1PZNA 2ZUCA 2R9VA 4YQFA 4PAOA 1TF5A 3K09A 3VHXA 1AS0A 3L2OB 3OEED 3QXCA 5FOWA 3TUZC 3ADDA 2JEOA 4Q02A 3ZDQA 1SHZA 4Z1MA 4NKRA 1Q3TA 2JDID 1J2JA 2ZRBA 3C8UA 4ZO4A 1KI6B 4IDQA 5DYIA 2ZJ5A 1G19A 4AYTA 4U5XA 3HWSA 4GOXA 4K81B 5AR1A 4NMMA 1KKLA 2OCBA 4JKYA 2CE7A 3EPHA 2NO1A 2J1LA 2BOVA 1CJMA 5FUVA 2ZS7A 4G5OA 2XNDD 4B2IA 1VCMA 2CDNA 4HDOB 1QG4A 1QRAA 3LQRA 2GXUA 2HXSA 4A0HA 4M1YA 1Q22A 1FP7A 2A7QA 4IHQA 1E69A 1X3SA 2QUZA 3B7GA 4BFVA 4GT1A 1AA9A 2ZU6A 1YZUA 2ZS9A 3IQXA 3NH9A 4A1FA 4DCTA 1T3LA 2QEQA 2AWNA 1VTKA 2B8TA 4QBGB 4EJSB 3CW2A 4JL5A 2DWPA 4PR0A 1OH7A 4Q21A 4PO1A 4URYR 3SS8A 4IJMA 3U7EB 4US1R 5AJWA 4V0LA 1CXZA 1JXOA 3RNLA 1Z0KA 5G3YA 1E2LA 2H57A 2Z5FA 1G20E 3VNVA 5E95A 4NONA 2OXCA 1ZYUA 3MWJA 4U00A 2H17A 2O0KA 1Q1BA 3RC8A 3X1DA 3OEHD 1V43A 2DHRA 3BH0A 1R0YA 5BYKA 1TF7A 4HAZA 4TQ9A 4BLPA 3W5IA 2GJSA 1MO3A 4D0LB 4QM7A 3S1AA 2IWRA 1E3MA 5BXQC 3U4QB 2GZAA 4LYAA 4DBLC 1OKKD 2IYLD 2QQEA 1T91A 3HPRA 1E9CA 3ICQB 2DWOA 2ODWA 2ZJAA 5K8UA 2X2FA 5EE9A 3UATA 1Z5ZA 5DLQC 1NVUQ 2XNSA 2VHQA 4UJ3A 1ZCBA 2A5FA 2GXQA 2VP0A 3NBYC 1GZSA 1E1QA 1KI8A 2HLDA 4DLXA 4XD7A 2BKUA 1CKEA 5E4FA 3I5XA 4YONB 1E0AA 4CEIA 1E2MA 1CR4A 2ZRMA 3AKDA 3AVYA 3QKTA 5TMPA 4BFZA 4MKIA 2WSSA 5EUQB 1HT1E 3QKRA 3TK1A 3CPEA 1QDEA 2QE7D 1DO0A 2KB0A 2QTVB 3PEYA 2NZJA 1AGPA 2F6RA 1A2KC 3U3OA 1J70A 1OB5A 5E7MA 1TNDA 3FWYA 4M8NE 1CU1A 3KXLA 2JLYA 2O8FB 4DLYA 4XIGS 4YMSA 1G4UR 1WXQA 2EYQA 2JCSA 4EFLA 2GVDC 5EXXA 1PJRA 3ZVMA 4XWAA 1ETUA 4CDGA 3IHWA 2GJ8A 4DEXA 2NG1A 4BQSA 2ZYWX 5JHGB 2VEDA 5KSPA 1TQDA 4DIDA 3QE0A 5CK4A 2V1XA 3KX2A 4OHVA 3RRZA 1RFLA 3W6PA 4DDTA 1IHUA 1XEXB 3RVBA 2GBLA 1M7GA 4I99A 1US8B 3RS4A 1PLLA 3NG1A 4ARZB 4DCNA 3U7FB 4LUCA 3EZ7A 5SZHB 1Y63A 4FD2A 1OFUX 4B44A 3OAAA 5C2JB 1R8SA 2C96A 1Q44A 1QHIA 1KSHA 1DAHA 1G5TA 4Z8XA 2OZEA 4G5QA 2JLQA 3KKOA 3S1AB 1BOFA 2XAUA 3KJHA 4KODA 4JS0A 1GL7A 5JI3E 2DFTA 3KQHA 3SYNA 4D4LA 1G3QA 4KFTA 5EQTA 1N6LA 3RS7A 4ZCMA 5SZIA 2WAYA 3IEUA 3IUYA 3B5JA 4A36A 3BAFA 4RZ3A 3GJ3A 1S8FA 2RHDA 3VAAA 1OB2A 1T0JB 4JLVA 2WKPA 5A5GA 2JLWA 2OSBA 4CEIB 1G17A 2F1JA 1W36C 2HT1A 4A8JC 3KJEA 4Q5IA 3B1ZA 4GDFA 1YZTA 3CNOA 1ZINA 3X1XA 1FL9A 2IHYA 4Q4LA 3BH7A 1Q57A 4QL3A 1A5TA 5HE8A 4W5HA 1NVXQ 1TUIA 4ZDKA 2XGJA 1DVRA 1WMSA 1T5IA 3Q5EA 4TSFD 4WIAA 4MDFA 3W9YA 3VU9B 5DI3A 2F9LA 2WJGA 3EPLA 5H68A 3MLEA 4LJ9A 5CK5A 1H8HD 1E1RA 2PLFA 2QPOA 4Q9HA 3RSLA 4BFUA 1NY5A 3W6NA 2EFHB 1LS6A 2FG5A 3L0OA 1E2QA 3W90A 1X1RA 1PVOA 3CX8A 2IT1A 4MGKR 4E07A 2QG6A 3C5HA 3KKQA 3PUZA 1D2NA 1UM8A 3FYHA 1KNXA 4LHYA 3DKVA 4JT2A 4KFRA 4XVUA 4GSYA 2I3BA 4LK2A 1RVDA 1Q21A 5BWMA 2A30A 4LYFA 4UQOA 1FOEB 1DAIA 1FP6A 3H1TA 5K8TA 5FOXA 5C4GB 3TLXA 1IY0A 1R6BX 2W00A 3FHOA 2I1VB 2CL0X 5KUTA 3GD7A 1O87A 1LY1A 1IJEA 1G291 1HV8A 4CRWB 2BM1A 5LD2C 1N25A 5CIWA 4UNSA 1MRNA 4X8LA 2QENA 1O3YA 1ZVQA 3KL4A 2WMOB 4Q1FA 1CF4A 4UJ5A 4BLSA 2ZXUA 5TXGA 3NDPA 1D6JA 1D2MA 5AWFC 5A4JA 3PUWA 2OM2A 2XOKD 2NZ8A 1F48A 2A78A 3D31A 3EZ2A 3FMIA 4PHHA 1LV7A 2GJ9A 2CK3D 2GCOB 2AKYA 1PLKA 3NHBA 4Q03A 1ZNXA 1D5CA 4C4PA 1Z28A 3GLIE 2GWHA 1KSFX 4NHOA 1GKUB 3OFND 1N6KA 4DRZA 2HV8A 2MMCA 1WCV1 1UEIA 5B64A 4WZAE 1RRGA 1F2UB 4DLZA 1P9NA 1OW3B 3RHFA 1R4AA 1SVMA 2YINC 5KU1A 1G3UA 2W2VA 4C0JA 2QORA 4JSTA 1X8LA 3M4YA 4MKHA 4GNKA 1HEIA 3BXZA 4HAYA 1G18A 2O8DA 1IOZA 2V4ZA 2A9KA 2WWXA 4PX9A 3ZIAA 1B23P 2G0NA 1IXRC 3QBTA 2J7KA 2P67A 2X8AA 4BPBA 1XMIA 3EZFA 3HYTA 4RD4A 4C7OA 3EZ9A 2AK2A 3W34A 1MH1A 1A7JA 1KO4A 1DAMA 1G3RA 2CEAA 1S2MA 1KOFA 1Q12A 2G9NA 5GVRA 3FKSA 4RZUA 2H92A 5AJYA 4LX0A 1W7AA 2CJWB 4TMZA 2N42A 1LTQA 4HYYA 1XF9A 2J0VA 3KJIA 4PO9A 3VR3A 4EFMA 1DPFA 5M04A 4DC9A 1A82A 3IO5A 2EWWA 1YRBA 4IW3B 3TGPA 2OE2A 4O3MA 1AN0A 3B13B 4KHZA 2ZJYA 2P6RA 2GEVA 4OL0A 1MV5A 5J4LA 4HUQA 2OBMA 2F1RA 2ZANA 2E1RA 2OCYC 2ZE5A 4PO8A 3WY9A 1XMJA 4KLZA 2G88A 1JBKA 3MRSA 2JATA 5BYJA 1XBTA 3I72A 4OQLA 3VX4A 3QVVA 4OK3A 2AXPA 2XZOA 1G41A 3SFVA 4MRNA 3C5CA 2YKGA 1N0UA 3P26A 4JYBA 1P9WA 4YMUA 3VKGA 3U7GA 1PLJA 2QP9X 4C0HA 4TL6A 1P2VA 2HDNB 3QIAA 4JVSB 3QSYA 1CS4C 1IAQA 3LW8A 5LB2A 3GFTA 5BN5A 1GP2A 1XNJA 3GEHA 4XVRA 2HCJB 3KFVA 4HSEA 1OXSC 2DB3A 3QOFA 3H84A 2O8DB 1RW4A 2MMGA 3KUCA 1DTSA 1ESMA 3FE2A 5DN6D 1GL6A 2ZEJA 5JHHB 4EKDA 3QPWA 3O8CA 2VP9A 4GFDA 2J5XA 2BIFA 2EFDB 4C7OB 2ZR0A 1UKYA 2GXSA 3QI2A 4URXR 2QAGC 3RRNA 3HU1A 3P1JA 1XXHE 2F3RA 4W9MC 3THWB 1SXJD 3UXMA 3OESA 2NIPA 4TLAA 3EWSA 1CJVC 4HAVA 4IOKA 1BS1A 3V00A 2LCFA 4AY2A 1LFDB 2ATVA 2D62A 1NVWQ 5FBWB 4HLCA 2ZPTX 1X8JA 2REXB 3UG7A 2ZSAA 2CNWD 2BV3A 3B1WA 3FFBA 4Q48A 4S2EA 3U6BA 3BS4A 2IUUA 4XH9B 1Z63A 5CIQA 3E5HA 1Z8FA 1E9BA 4FCTA 4M22A 1ZD9A 1P72A 4R9UC 3I92A 3CH5A 2OILA 2P5TB 1E0JA 3OZXA 1U9IA 1Z6XA 1ZD1A 2VSXA 3PG5A 3GQBA 5C18A 4ACBA 3CWQA 4V03A 1JR3A 1ZUIA 1YZLA 2IYWA 1W46A 2IUSA 4O2LA 4IDHA 1E2IA 4MGYR 5AJZA 2UZIR 4Q9KA 5FOVA 1U81A 2AD1A 2UZ3A 5JS8A 3ZD7A 4LRWA 1G8HA 3QNUA 1W4BA 2XSZD 4MYHA 1W2HA 4D6PA 3R8FA 3SR0A 1JAHA 3ZVNA 2BCGY 2V6IA 3SE0A 5TVKA 3A1UA 1RE0A 2ZITA 3TVTA 2HJGA 2XTNA 4IXMA 4D82A 3A1SA 2PJRA 2ZJ2A 1AIPA 5L8VA 1RC8A 4QHTA 5TV2A 2GDJA 4ON9A 1N6HA 3OHMA 2DY1A 2QBYA 3AF3A 5P21A 1OIXA 2ZREA 2CVFA 4LYJA 4JLMA 3U7HB 1NL3A 3KQNA 5KSZA 1E9RA 3TAUA 5FUYA 1SXJB 2ZETA 4R7ZA 4BEJA 4N0EA 3AP2A 3VKWA 3B6EA 4B33A 3O47A 1D8TA 3DO6A 3L82B 3V9PA 4PQRA 3TW4A 3B78A 4KI0A 1FZQA 2AFHE 1E2DA 1DELA 1KJYA 2WJVA 3B60A 3T1QA 4NCJA 4TMKA 2O8CA 1DS6A 1S1CA 1U8YA 2L0XA 4Q01A 3B8HA 2IL1A 4ESHA 1UFQA 4C0SA 2OV2A 1D9ZA 2G77B 3LLUA 3MWLA 4C3ZA 4M53A 4CGZA 4G3XA 3CO5A 1MOZA 4LC1A 1Q1QA 2FZLA 5DSZA 4GRAA 3I61A 3LLMA 3NBZC 3A4MA 4DZZA 1OLOA 3EARA 4P3YA 2VF8A 2ZJOA 2XJ4A 4MRSA 1XCPA 2ZYTX 4QHYA 2PCLA 4TN1A 1MRSA 4HATA 3CF6R 1K5DA 4Q9LA 3UWOA 1E0SA 1W2GA 1T8TA 3UK6A 2Z6VA 1QVRA 2ZI9A 1D9XA 3WMGA 1ZM7A 2IS1A 1SVKA 3U44B 3IILA 5HKKA 3CRW1 2X19A 1XPRA 3EXAA 3W5JA 2JLVA 2ORWA 5JLJA 1EG7A 5KNBA 2ZIAA 4MGZR 1G3IA 3NIBA 2W6ID 1RZ3A 4HLQB 3VNUA 5EE5B 2PH1A 4KSCA 2XXAB 1M7HA 3UMSA 1EX7A 2ONJA 3LBHA 4TQAA 3UIEA 5FL7D 2DWQA 3N2EA 4OJKA 3ONWA 2C99A 2WPDD 2HEIA 4A2PA 2QI9C 5LDDC 2XB4A 3ND8A 3TSWA 3KB2A 4B76A 3K0CC 1BMFD 1GVNB 3VHLB 1JPJA 1E2HA 1KO5A 2WIAA 3HPQA 4Q1DA 1P61B 1ZIPA 2CMKA 4TYPA 3KFXA 1GKYA 2KI5A 4IVPA 4LV6A 5HZKA 5H8WA 3GEEA 3OE7A 3K53A 3C15C 4W5WA 4Q7MB 2FEOA 2IYVA 1G64A 2FSIA 4WZBE 2ZJBA 3TQCA 3CPHA 4M4SA 4LGMA 1TL7C 1E98A 1W5SA 2WOJA 4NCNA 2O8CB 3SQWA 1R8QA 4AD8A 1HT2E 2ZRIA 2JJ2A 4YXWA 3SC3A 1KI6A 3SOPA 1COWD 4JLOA 2QP4A 3MWYW 2JLRA 2B7CA 3AKYA 5JBQA 2ORIA 5UKDA 1OHHA 1TU3A 3IPXA 4NL4H 1RPZA 3ASYA 1XPUA 1IBRA 4C0AC 4DDWA 4GMXA 3F3YA 2OLKA 5LB4A 4LBYA 3EWAA 4CF7A 2P6UA 4US2R 3BH6A 3KB1A 1RKBA 3KXKA 2NOAA 1N6OA 4XWKA 2AFIE 4MRPA 1BYUA 1JQLB 2WZQA 1Z6GA 2FN4A 3O8BA 2WKQA 4QM6A 1NN1A 4JVLA 3AB3A 2GF9A 4JMPA 3F0TA 4G1UC 2J3EA 3VR6A 4EJSA 1W47A 2MSCB 1R10A 4HB3A 5G41A 4Z54A 1Z6TA 4OQXA 4TT3D 3FMPB 1LVGA 2Q9CA 5CM8B 1G5PA 4C2UA 2UKDA 1WBDA 4K46A 4NCHA 2P2LA 1KK3A 4BFSA 2G3YA 1AZSC 2XTMA 5E7IA 3TMKA 1KNQA 1WDTA 2R6GA 1AKYA 2QT0A 5C46F 1TUEA 2AN9A 4B3FX 1T3SA 1T6NA 1X6VA 1K5GA 3U3MA 2V9PA 1KMHA 2WJYA 3LDAA 2VLIA 3WMFA 4Z51A 2QM8A 1QHGA 2OCPA 1NNEA 3BD9A 2WSMA 3U4QA 1NMXA 2G1KA 1PV4A 1F2TA 3OEEA 2Q3FA 3CONA 2JDIA 4B71A 1N5IA 2GZHA 3QG5A 1G16A 1LW7A 1R2QA 1G9XA 5CDFA 3REGA 2NTYC 4PXAA 3ZGXA 5DGXA 3W3AA 2OAQ1 5CB6A 2CHQA 4IFBA 2QTFA 4XSGA 3VMFA 2F1HA 5JJLA 4P31A 2V8OA 4LCBA 4IXNA 1VCOA 2IX3A 1AJEA 4TZ0A 3RANA 3NXSA 3KKPA 4DB2A 1JJ7A 1GRRA 2VSOA 1JEEA 1GDDA 2KBEA 2ZQ5A 3BC1A 3FB4A 1XJQA 4ZIRA 3KKMA 5KPJA 1BH2A 2O8FA 1ZNZA 2OFXA 3PITA 1JECA 1IY2A 5DE3A 5J4VA 3GJ4A 2JIZD 4KJZA 1I4LD 1EK0A 1VMAA 1MKYA 1Z6YA 1WF3A 2NPIA 1E96A 4QNRA 4TMVA 2ZRJA 1F5NA 4OHYA 1MO5A 2CBZA 1G21E 3T34A 5EJEA 5JRZA 3X1YA 3QUSA 1Z0DA 2NGRA 3TE6A 1RIFA 4F92B 2VTKA 4OHWA 1VG9B 3AF1A 3SN6A 3VTKA 1XEXA 2IS6A 1N6PA 4AKHA 1US8A 1J7KA 1KI1A 2PZFA 2NPFA 4DT1B 3I8SA 3LBNA 3K9NA 4MQBA 1LF5A 3OEHA 1NMYA 4ARZA 821PA 1YZQA 4E22A 1Y3AA 2ERXA 4MKGA 1NF3A 2D7DA 2W2XA 1FPMA 1GWNA 2ZRLA 4FWTA 1N2CE 4Y0AA 2NO0A 2FSGA 1JJVA 2GKSA 2QQ0A 2WV9A 1AM4D 2GVZC 2R6CA 3E70C 5EXPA 1T9HA 1KMHB 2O0HA 3FTQA 1BIFA 5F98A 4A6XA 3SBEA 1OKKA 2ZI5A 4KVAA 3JVUA 4HEJA 3GJ6A 1F2TB 4LJ8A 4JVNA 3CF0A 4F4CA 3SBDA 3MMPA 2ZR7A 1E2GA 4EAQA 3T5GA 1KI2A 4L15A 1FMJA 1VHLA 3VFDA 4DSUA 4IDOA 4M1OA 4WBSA 2ZU0C 2CXXA 4RJLA 3ZS8A 4XWOA 3DPUA 1K8RA 3PUVA 4HLUA 3PFIA 4JBWA 2BBOA 4DEYA 4JLBA 4LSGA 1L4UA 3U5ZB 3NWJA 1I4DD 1W36D 3K0SA 2PZEA 1YZGA 5KNCA 4ZIRB 2GNOA 621PA 3M6AA 4LJ7A 4PPNA 3W3ZB 3DZ8A 3MD0A 3VU9A 4LC0A 5FFMA 4KITB 2FE4A 1QHHB 2CLSA 1D2EA 2YHSA 3EG5A 2VHUA 1SKQA 1VCIA 3NBXX 1ZM9A 1EFTA 1AQUA 3EASA 4B3CA 3CIOA 1LF0A 3QXXA 1QBKC 1OYWA 4LJ5A 4L9SA 2LKDA 1TMKA 3CB4A 4AWXA 1Z2AA 4O0MA 2J87A 1OH5A 3AUXA 2IW3A 2C5LA 1VIAA 1R5OA 2REOA 2BBSA 2ZROA 3A1TA 1YQTA 3U2QA 3K70D 3SZRA 4L9WA 1X86B 3BB1A 1YR6A 1DADA 1HA3A 2TMKA 4EDHA 1EWQA 1LNZA 5KSOA 2FPLA 1XRJA 1ZC4A 3B9QA 3VX3A 4EQ6B 3TSZA 3REFA 1YE8A 1CJUC 1YZKA 1OFIA 3OIVA 1ZU5A 1M74A 3TH5A 3DMDA 2YJTD 3T35A 4QC2A 1ZIOA 3AVXA 3LNCA 3KZ1E 1PUIA 3RRYA 3ZQJA 2QSYA 2D2EA 3TUIC 5CYPA 4GMDA 1ZM4A 2RGGA 2PMDA 4N3NA 1VYVA 1Z0AA 5F2EA 2WM9B 2GXAA 1KZGB 2J0QA 2OG2A 4LBZA 1OJLA 2R65A 3LY5A 1FX0A 3MSXA 4IEEA 2W0SA 2GCOA 1E2PA 1W5TA 4I1SA 4NE2A 4MKFA 3LX8A 4TL9A 2IYUA 3D6TB 4QXAA 1KO8A 1K6MA 5DHFA 3K0EA 1DAGA 1TTTA 1DAKA 4G5SA 1F2UA 2GILA 5CYOA 1P3JA 2MSDB 1ZM3A 1WP9A 4OBEA 4A8JB 1R0XA 4TSFA 4L16A 1XD2B 2ZSBA 4TYNA 2OCAA 1WB9A 2ODBA 2IYZA 3U6KA 3F5FA 3PR1A 1H8HA 4TTQA 1T3HA 3ZLJA 5SZJA 3ZYCA 1CRPA 3TJZA 2GTPA 4FINA 2H1LA 1P2TA 5TDHA 2CHVA 1AGRA 3GLFB 2PBRA 2I1QA 2HF8A 2ONKA 3K70C 4ERNA 4Q00A 2FPMA 3NBFA 3HR7A 2AL7A 2ZI3A 1T5LA 1TPZA 4GOKA 3AV0B 1GG2A 3DVLA 5JCZA 2EVWX 4BLRA 1YHNA 2PX0A 5KTYA 1R5BA 3EA5A 1JXMA 4Q4HB 4TMTA 1SKYB 3ZZTA 3QKSA 2CJWA 1OV4A 4PPFA 2W6JD 1E0KA 3KQKA 2IXEA 3N2IA 3ASZA 5HE9A 4A0GA 4KO8A 4PPGA 3T06B 4ACAA 3ZVRA 2GBLC 3CNNA 4DDVA 4PC7A 2A5YB 4CEHA 2GRJA 3B85A 2Q9BA 5AK0A 1ZMXA 1RRPA 2YC2C 2XOKA 2HJVA 4CVNA 1NJFA 2QPTA 1E9FA 3EC2A 1U98A 4IOMA 2VPPA 3TQFA 3Q5DA 3GFPA 4ILEA 2VBCA 1JR3E 2CK3A 1FX0B 1G4AE 3PV0A 1UJ2A 2EFEB 5KSYA 1HQYE 3A36A 3LRPA 4KXFB 1Z6AA 1VG0B 3OFNA 2ZRDA 1E4YA 4JLKA 1W0KA 1J90A 1J99A 4FW9A 3WYAA 1NMZA 5F9HA 2VQSA 2OFOA 1E79D 5EP2A 4NPHA 2YNMA 4RKFA 2O5VA 4B47A 3SEAA 1FTSA 2G83A 5FL3A 3WXMA 1H8ED 2C03A 3I1FA 2IYQA 4V0ME 4PSAA 4Q7JB 2BJWA 5CM9C 1W0JA 4B2LA 3IHLA 2FJUA 1XPOA 2N46A 3R9XA 5JSZB 4A9AA 3SJAA 3FFAA 1HE8B 2FOLA 3IBGA 2EW1A 3ETLA 1FW6A 1ONBA 5BN3A 1HUQA 2R2AA 5D3MA 4OI0A 3FGNA 4EPWA 2YZ2A 3ZS9A 1JR6A 3THWA 4XSHA 4YDHB 1XTIA 3GMTA 3CR8A 1II9A 2BC9A 4B3BA 4HB4A 2BJVA 2F43A 1ZC3A 3WNBA 1HY3A 3QKSB 2GHIA 5KDLA 2YWHA 2HT6A 2XB2A 2R8RA 1WQ1R 3IO3A 2Z0MA 4CIDA 1S9DA 2HUPA 4BRWA 1DG1G 4DCSA 2QROA 4Q1EA 1VYTA 3SDZA 1BO6A 4CEHB 1OXTA 1P2UA 3RWMB 1NBME 3FMFA 2BDTA 4DVGA 4ZDIA 2ZSDA 4L8GA 3QXJA 4UNQA 2VHCA 4AI6A 4DSOA 1JB1A 1L2TA 1OFTA 1NG1A 2JJ1D 2RGCA 2X77A 4YDSA 4EIWA 4M9QA 4A82A 2GJAA 1E2JA 2FF7A 4DWJA 1IXSB 5B58C 1A4RA 2R62A 5DYGA 4G0NA 3JZMA 4OK6A 1CP2A 3D8BA 2IEZA 2PL3A 4PSVA 521PA 1U0LA 2HYIC 1E99A 3QF7A 121PA 1F3OA 3K0AB 2QM7A 2GEDA 3R9WA 3K9HA 5FI1B 2ZVPX 4A92A 3MCAA 2PEZA 4JSYA 1XMVA 4N1AA 4KU4A 5KPDA 5CITA 2RGNA 4KBFA 5FPYA 4ZDJA 1N6NA 4OYHA 1PUJA 4AURA 1M34E 2QZ4A 5IK2D 3W8NA 4D4JA 2IYRA 4HDQB 1E9DA 3RC3A 1KYIA 3BJIC 2ZI7A 4AK9A 4I1OA 3AH8A 4OQFA 1XTQA 2QMHA 2PMKA 2VA8A 2VP4A 4P4SA 3LXXA 4B75A 4Q7KA 3QJYA 1TQ2A 5DN6A 1E9EA 4FMCB 3UMRA 4Q4JB 3CX6A 4CT4B 5HCNA 2QRNA 1KTVA 2Q9AA 3WNDA 3X1WA 4HZUA 4CEJB 1OXXK 2RGXA 4BZQA 1NI3A 1U0HC 2WJHA 1C4OA 2V7QD 2AR7A 4M9SA 1E2EA 5D3MB 5KYKA 2OBNA 5EUMA 1SXJA 4Q18A 3E2IA 2QRZA 2AXNA 3AF2A 2F43B 4NCIA 3SHFA 1NSFA 4PQFA 1YU9A 1KY3A 1YR8A 2QAGB 2YOHA 3QEOA 4A2QA 3EIQA 2G1JA 3LBIA 4KYIB 4P33A 1TU4A 2HF9A 4DUGD 4EUNA 3MGCA 2IYYA 4DDUA 4RD3A 5G3ZA 3FPAA 4QFMA 3T1VA 4WVFA 3SHWA 3WNCA 1KDTA 1IQPA 4LPSA 4X8HA 4C0LA 4YC7A 1EWRA 4PC6A 1E2NA 1XDBA 2CNWA 2VHJA 1SGWA 1ZBDA 3WBKA 1BYIA 2F3TA 4F38A 1KMQA 3NKVA 3U61B 3WHKA 2CL6X 1ESNA 1UDXA 2PX3A 2CLCX 1T4GA 2Q6TA 2YYZA 1Z3IX 3DOFA 3PEVA 4EPVA 4MYUA 4B34A 2B8WA 1I2DA 4KFSA 721PA 2QGNA 1II8A 2FA9A 4U02A 2YWGA 1Q1EA 4EPXA 1NIJA 5HZHA 1P9RA 2YVUA 3KJGA 3WYFA 3U44A 1G6HA 1G7RA 3RYTC 1HE1C 2QU8A 4BEBA 2XSZA 4PSKA 3TW8B 1FQKA 2VL7A 4JL8A 4IVQA 4LJAA 3U3KA 3U60B 1SVWA 3A4NA 1J8MF 3WP1B 4B3XA 4JJKA 3RLFA 2XXAA 4PPQA 4HB0A 4MA4A 1GAJA 2IBMA 2KBFA 3CPJB 3R9IA 3MJHA 1JNYA 4JLJA 4P4SB 2OBLA 4D25A 2A5JA 2IEYA 4ZKEA 4PTLA 4LJ6A 3WRXC 5K8LA 2FGJA 4V0MA 4P0TA 1L8QA 2ZYVX 5KDOA 3LW7A 4HZUB 4E09A 5D3QA 3AP3A 4TYYA 3C41J 3K0CA 4A0FA 2ZUDA 1NP6A 4C0QC 2O8BA 4BE7B 4F4IA 5A0FA 3CWZA 2GAAA 3GP8A 1XTJA 3QKUA 4FI3C 1Z08A 2J41A 3IKJA 2CCKA 4OHXA 1NKTA 3BFVA 1OH6A 4M1KA 4XTCS 2DPXA 4C9BA 5CDFE 4YMVA 4LHWA 3UPUA 3VR4A 1MT0A 3B82A 1UBCA 1SHKA 3G0HA 3AGPA 3I4LA 1E2FA 4JLAA 1NLFA 3TR5A 4F7WA 2P3SA 3M0EA 4TLBA 4CT5A 4GP6A 4OI4A 2YOFA 2BKEA 4P4UA 4Q7LA 1Z83A 4MUAA 4Q4AA 1YJ5A 3CR7A 4IKEA 4B32A 4Q9IA 1NBMA 1FTNA 2ZSFA 4RD1A 2Z4RA 4AKEA 3CH4B 4DLRA 3ZZ0A 4K8OA 2ZSEA 4ASUD 5B57C 1GITA 4B3GA 2O8EA 3C7KA 1C1YA 4D0NA 2QN6A 1TQ6A 5DO9A 3SJBA 2NQ2C 2GAOA 2GK7A 4C0BA 1OIWA 2RH5A 1II8B 5HPYB 2ANCA 2VRWA 3WMEA 2C9CA 1U9IC 2QPAA 2VF7A 5H1YA 3G82C 5BN4A 3TBKA 2C8VA 2IF0A 2WTUA 4FMBB 2W6IA 2EFCB 4LZZA 5JWRA 5GJVC 2QSZA 1E94E 5FOSA 4DLWA 5FL7A 2H7VA 4AKIA 3MWKA 4M9XA 2J9RA 2QP3A 4L4UA 2WPDA 3HDTA 4PANA 5HCIA 3AKCA 4QGFA 1KGDA 4DCUA 3CRRA 3DKPA 1A1VA 4LV8B 1Q3HA 4RZXA 3GLGA 3THYA 3H86A 2F1IA 1BMFA 1QHXA 4LI0A 4D4KA 2WWFA 4HZIA 2IS2A 1NSTA 1KK0A 1DG3A 1LB1B 1XD9A 3VQTA 3ADCA 3LQQA 3LA6A 3AKEA 2J7PD 5BQ5A 2CCJA 4B48A 4UNPA 4LJ4A 2O8BB 5EE1A 4IDNA 1KSJA 1CEEA 1NJGA 3CBQA 3FVQA 4B73A 2G0TA 1MO6A 3PCRB 4UXHA 5EP1A 3AGQA 4Y0VA 2Y8EA 1Q20A 3Q7QA 1G1MA 2JLZA 3IPYA 5KOYA 1COWA 2B7BA 3JZAA 1XB2A 4AKGA 1XCGB 1KZ7B 1RYHA 1S96A 2XEXA 4Q4AB 1RYFA 5FPHA 4B6FA 3OE7D 4DCVA 2NO7A 1CULC 4WW0A 3DL0A 1XZPA 4II7A 4IEIA 3LX5A 4XTRA 4D4MA 1IN8A 3KXIA 4TLDA 2O8EB 4WXRA 3CF2A 1G8GA 1R0ZA 2GETA 2QL6A 4ZCLA 4UNNA 2OLJA 4PAMA 3QENA 2BMJA 4I81A 4NYIR 4LYHA 5J4YA 3BFKA 1U99A 4ZPXA 2ODEA 4GPTA 4BLTA 4MUBA 1DO2A 3GLFE 3Q7PA 3B2EA 3AP1A 2QNRA 3EW9A 1P6XA 3QBVA 3Q3JB 1DARA 4TT3A 3EIHA 3ADKA 1KIMA 1KO1A 3GJ5A 4C0KA 2GEUA 3DZDA 5DHAA 1GRQA 4PHFA 4B43A 1TADA 1IN7A 1NVVR 4RFVA 5B30A 4FCWA 4DT1A 3H4MA 1ODFA 1ZW6A 4JLDA 1II0A 4JBYA 4NYIQ 4PAQA 4A0RA 1GUAA 1KHTA 3GLGB 3THYB 3FHTA 5FUXA 2IA5A 2GF0A 2JASA 2GCPA 4D26A 3SFZA 1KAOA 4PQYA 3EX7C 2I4IA 4AG5A 1JI0A 2RKOA 5FBQB 3C4JA 2JA1A 3NHAA 5DNYB 1OH8A 4V0NA 3CLVA 2J0SA 4QBHA 1DEKA 4B74A 1KAGA 1W49A 4RCZA 3IIKA 2NO9A 2JAQA 1ANKA 2KJQA 3L0PA 1HQCA 3OIUA 2PLRA 4JIMA 4WA7A 3UMFA 4TWZA 2PT7A 4BZXA 2DCUA 1NVVQ 4MRVA 4BGDA 2OESA 4QGAA 2R6AA 4IVRA 1OYYA 2J59A 1SZPA 3GEIA 1GTVA 3AVUA 2ZE7A 1VHTA 4URUR 3EIEA 2FSFA 5BW8A 1P75A 1EFRD 2KWIA 2XNDA 1IXZA 5C1BA 5DISB 3WHLA 2KE5A 2P0EA 4RCYA 3KQLA 3CM0A 4M1WA 4HUTA 2R6DA 4IFEA 1IN5A 1YZNA 1QHSA 2WMNB 2FGKA 1SULA 2WWWA 5FI0B 5G53C 4Z1MD 2JIZA 2D06A 1QHHA 4URWR 4QHSA 1R0WA 1CBUA 2V55B 5CJ2A 3LD9A 4JBXA 1N5JA 2C2HA 1AK2A 2PT5A 4Z8YA 4I1UA 5JZVA 2QA5A 4O25A 5AJXA 2PEYA 2D4HA 4KLNA 4KAXA 2ZRNA 5DH9A 3KTAB 4BECA 3AVTA 4RZ2A 3THXB 2OO7A 1G8FA 1SVIA 1EFUA 2EYUA 2FEMA 3A4LA 4LHZA 1RRFA 4LV5B 4WOPA 4EJSC 1ZP6A 2MSEB 1QVAA 3GLHB 3TIFA 1GKIA 4W5JA 4OJQA 1HH4A 5JJKA 2ZI4A 3GJ7A 4EQ6A 3R20A 3ZZUA 3IEVA 5EE3A 3BWDD 1R5NA 2P65A 4MGIR 4DLSA 2WBLC 3I62A 5IF9A 2ZE6A 4R2IA 1Z0FA 1SQ5A 2J0UB 4P4TA 1XP8A 4UXJA 2ERYA 2NO6A 3RABA 5HTKA 2QY9A 4KYUA 2FFBA 2DR3A 2HXYA 3TVDA 5KNDA 1CLUA 3GFOA 4HAXA 2QGZA 2QT1A 2YC4C 3R8CA 2IWHA 5JJIA 4NBSA 4GL2A 1YR7A 1FUUA 1G8PA 2IXFA 3W8RA 5FTNA 2WWHA 3CX7A 1W44A 4QJ3A 3Q9LA 2XZPA 5J4HA 4NU0A 2AHOA 1CJKC 5EXSA 3K09C 2C78A 1CR0A 2VP6A 1KK2A 3GJ0A 4R71A 4JJZA 3VR5A 5FR1A 2YWFA 3LO5A 2QE7A 1IONA 2EU8A 1C9KA 3R7WA 3I32A 5G40A 2BEJA 4ZKDA 3PENA 4HB2A 2A5GA 4JLNA 4A8JA 1XX6A 2DFKB 1GRNA 2XJ9A 2BHRA 1OF1A 1NKSA 4QJ5A 1XD2A 1UKVY 2O52A 1FUKA 2ZAMA 1IN6A 1E1QD 3F8TA 2WWGA 4G5GA 2HLDD 4D80A 4XD7D 2PZGA 1Z47A 4MITA 3WRYC 5IT5A 1QHNA 4DJTA 4ITRC 2RB4A 1WBBA 5J40A 3P4YA 2UVQA 3GLFA 2EFGA 3JVVA 1KO7A 1KI9A 2WSSD 4TQUS 5E3HA 5JRJA 4RKEA 4CYMA 5TARA 5CJPA 3RS2A 4KCGA 4DSNA 4AIIA 4POAA 3D7MA 2ZE8A 2BM0A 1ZNYA 2P6NA 4ZI3A 3AVQA 3P27A 5FH9A 2CE2X 3BBPA 4Q4HA 1NIPA 3BFXA 1AS3A 4PFSA 5JEEA 2FSHA 4BWYA 1ELOA 1OSNA 2WOOA 5AUOB 1YKSA 3DDCA 1BKDR 2BMEA 2ATXA 2O0JA 2FH5B 3EA0A 4ZCIA 4B2PA 2RAPA 3CNLA 4BFWA 3A1VA 1ZU4A 1ZUNB 2P5SA 1OXUA 2Q3MA 2WKRA 3E1SA 3EAQA 3NC0C 1FFHA 4OKSA 5EP4A 3T12A 4B3DA 5EP3A 5J4KA 2SHKA 4LBVA 2FU5C 3L43A 1F60A 4B35A 3A6PC 2Z83A 3P4XA 5L3QA 5EZ6B 4G01B 2NMVA 2LWIA 2X2EA 4TMXA 1KI3A 3IBYA 3LWNA 1S9HA 5LBIA 1VECA 4JT4A 2WJIA 2REBA 2J45A 4OK5A 3CZPA 2H8KA 4Q47A 1W48A 3MFYA 3IIMA 2ZAOA 1XJCA 1UPTA 1NN5A 3OAAD 1ZM2A 4LPKA 1XD8A 2ANBA 3THOA 4Q66C 3B1XA 4AYXA 1GIAA 2DFLA 4OI2A 5JMTA 1MR3F 5FBLB 3I5YA 2C98A 3L0SA 4V0OA 3R7WB 1M6NA 1W36B 3X2SA 4IDPA 1EFHA 4IOLA 2ZRFA 3FDIA 2FPKA 4HLUC 3AEZA 4HAUA 3AM1A 3Q8XB 1IY1A 1KDRA 1EX6A 6Q21A 2WHXA 2RGAA 3ND9A 3N5CA 4LJYA 4H1UA 3Q85A 1NLZA 1RJ9A 5JSZA 4M21A 4OI1A 2GCNA 1P62B 3QKRB 5JFGA 1TEXA 2BBTA 2OXRA 1S1MA 3I3SR 1Q0UA 3DEFA 1GNRA 1EXMA 1SXJE 3CZQA 3OIYA 3A58B 5CB8A 4W7SA 5IHPA 5KHOC 1X1SA 3TKLA 3K70B 1JALA 4LDJA 3BB3A 4XOIA 3DHWC 4NH0A 4YLGA 1Z29A 3PVSA 3T1OA 1UBEA 1W4RA 2W6JA 3QXSA 2FWRA 4H1VA 1E1RD 4TZ6A 1ZD8A 5AJVB 4QGHA 4ESVA 2WICA 2VH5R 1M8PA 2FMXA 4OQMA 5FPSA 3W6OA 4V02A 5TB5A 4LWZA 2VSFA 4DKXA 1G8YA 3HU3A 3D3QA 1M1YE 3CRQA 4J0QA 3PQCA 3KUDA 3ZQ6A 2YWEA 4F93B 2JGNA 5L3QB 1XEWY 3K1JA 2C9OA 3C14C 4PC2A 4P32A 3MJRA 2BMDA 3K9LA 4HAWA 5LD2B 4DB4A 2D7CA 1V5WA 2K5UA 1DE0A 2ZRHA 1G7SA 1CR2A 1G3MA 1OIVA 1S0UA 1OT3A 1Z0IA 1W1WA 3L8YA 4R98A 5IRCD 2QMOA 4BASA 3K0AA 1OFHA 1UKEA 1XMSA 5FOTA 4HDCA 3U3RA 1MO4A 4FCVA 5L3VA 1TF2A 3AF0A 1S3SA 3M1IA 5FOUA 5E7JA 3DMNA 1AZTA 1E79A 4N0DA 1YVDA 1P7CA 1QG2A 4QG7A 2CLDX 3QVUA 5C4MA 4NP6A 1Z07A 3NH6A 3T1TA 3V4FA 1H8EA 1E4VA 1Q1ZA 4RD0A 1XTRA 4CZ2A 1GM5A 1AKEA 2V1UA 3NEJA 2N1BA 1RJ9B 1TX4B 4QNMA 4Q4JA 1GL9B 3I8XA 3AVOA 1P4SA 4CEJA 1W0KD 4EPTA 2Z43A 2WJJA 3PJRA 3SQXA 2WWIA 4ZDWA 2BCJQ 1AQYA 1DOAA 1I4TD 2OHFA 3LVQE 5DI3B 3UWKA 1CIPA 1TAGA 1KKMA 2Q0HA 1ZNWA 2AWOA 2D2FA 1KY2A 4QRHA 3MG9A 2QAGA 3HU2A 3B9PA 4WXPA 1AS2A 4TMWA 4AG6A 1UBGA 2QAJA 1R7RA 4FWIB 4FIDA 3UG6A 1VIYA 3ICEA 2JLUA 1W0JD 2RMKA 2WIBA 3C16C 3ZIAD 3GCGA 1N6IA 2HCBA 3FKQA 5GJCA 5J5CA 5FUWA 4LHVA 1KK1A 2OAP1 3ECCA 4WZ6A 2CCGA 2JJ1A 2OEPA 5L3SA 4RSGA 2E9SA 3ZVLA 3BK7A 4TLEA 4EFNA 4URVR 3AVVA 1N5KA 3FKSD 4YMTA 2IYTA 2BMFA 3UKDA 2A5DA 4Q1AA 4HLDA 4PHTA 2EQBA 4NYMR 1YR9A 3BB4A 4I1VA 1VPLA 4KVGA 2BEKA 3NC1C 3KDSE 3LXRA 1N0WA 1P73A 1IJFA 1WA5A 3EPJA 3SJCA 4TTRA 2VO1A 1XEWX 1JEDA 3VR1A 3BOSA 3HR8A 4GBMA 5AUPB 4PZLA 2FV8A 4CW7A 2R44A 3T5DA 2GA8A 1NG9A 1S3GA 4FN5A 2PJZA 5IK2A 3FMOB 3QPUA 1XFAA 2VP5A 3BERA 3EPKA 2IUTA 1GNPA 1NN0A 1QF9A 1FMLA 2Z4SA 1NRJB 2B21A 4LHXA 4DHEA 5F3WB 1QZXA 3LVRE 3WP0A 4Q9JA 1GOTA 2RGBA 2CVHA 4NYMQ 1KI7A 3DOEA 4E5UA 2IS4A 3K0FA 3X1ZA 3GLGE 2GESA 3AVWA 1N5LA 3G5UA 4A6PA 5JCPA 4A2WA 3L8ZA 4TLCA 4H9GA 1Z2CA 2A3RA 2WVJA 2V7QA 3IDQA 2HYDA 4MYCA 5FTKA 4ZI2A 3RS3A 3AQ4A 1WRBA 2FX3A 1T0HB 5J47A 1ZUHA 2B92A 1P2SA 1KJZA 1JQJC 3NEYA 3ADBA 1JAIA 3QEJA 4BFXA 4DUGA 2ZI6A 2JLXA 1E32A 2FFAA 4OQNA 4A15A 4NDZA 2ASEA 4FMCF 1VDZA 2GJKA 4JVMA 3I73A 4PZZA 2EWVA 4QGGA 1P5ZB 4JZKA 4M1MA 1GILA 4BUJA 3RS0A 1EFCA 3RWOA 4DLVA 1YRAA 5L3SB 4JLPA 3QF4A 1L7VC 1XCMA 4M2LA 5GADl 2W83A 3CUEF 2W0MA 4DIEA 1OXVA 5EXTA 3PEWA 4JL6A 5GJWC 3TSOA 4M1SA 3BIFA 2C04A 3RRMA 1N3BA 3B1VA 1HTWA 2OT3B 4G5RA 2YOGA 2ZJZA 1JPNA 4U7DA 2KSQA 221PA 3PXGA 3SYKA 4M9ZA 2ODNA 3KKNA 5JI2E 4TL7A 2FNAA 1CJTC 1GFIA 3QPVA 3KQUA 2ZYUX 3RAPR 1DAFA 5JEDA 4HUQB 1E6CA 3EC1A 4RD2A 4GOJA 2WWYA 1A2BA 3A37A 2IC5A 2ZRPA 1G7TA 2DYKA 2BWJA 2XX3A 3GLHE 3L0IB 3K9GA 3HYRA 1ZJ6A 4DLUA 4PZYA 2C9YA 3IQWA 3WYGA 5IDVA 3A1WA 1OPXA 4A4DA 2W58A 4F4JA 3K0FB 1JR3D 4BLOA 2RGNC 2AKAB 1TEVA 3TNFA 3T15A 2VHTA 2F7SA 1XEFA 4TYWA 3GLIA 2CHGA 5B2ZA 1GSIA 2ECKA 1QHYA 5EE0A 1NY6A 3VR2A 4FMDB 4GZLA 5FBRB 2DFNA 2IYXA 5GVSA 4BZPA 3ZD6A 1LS1A 3ZH9B 1KDOA 2RHMA 3BORA 4DLTA 5K8IA 2ZVQX 2BVNA 3B1YA 3IGFA 2ZRGA 4Q19A 1XZQA 4V0KA 4US0R 2VYFA 2IXGA 1SVLA 1Z22A 4NZYA 4DXAA 1N0VC 2RGEA 3QQ5A 2J46A 2GK6A 2AX4A 1SXJC 4BFYA 4ZV4A 5DIFA 4JKIA 4EPYA 4AC9A 1CRQA 5H70A 2IHBA 2DBYA 1Z0JA 4BLQA 3PUYA 4FMDF 4NCKA 2FZ4A 2IK8A 4NTZA 4FXPA 4F91B 4Q1CA 3PUXA 3QF4B 3CKLA 1F6BA 1UADA 4ASUA 5JWOA 1NN3A 3A8TA 1G7CA 2F9MA 5KDDA 3LH5A 3RSOA 3J81k 1NLYA 1XTSA 3CRMA 1XTKA 2FFHA 4QOSA 1W4AA 5SZKB 5HR5A 4MRRA 3K8YA 1VKJA 2A2ZA 2X1VA 3BGWA 1HYQA 1H65A 2RCNA 2XITA 3AF4A 3PIRA 4GZMA 1XJ0A 5DI9A 5FTJA 1L4YA 1S4QA 4L5BA 5GJBA 3TUJC 5L3RA 1EESA 1HURA 2IF2A 3QY0A 2AD5A 3SI7A 2ORVA 1U8AA 8OHMA 1XU4A 3P32A 1FNMA 1KI4A 1UF9A 4UXIA 4IRUB 2ZUBA 1NBMD 4E03A 1XWIA 3SJZA 4D2IA 1X8KA 1E2KA 3RS5A 2D3WA 3NDBB 2H16A 5FR2A 4AYWA 4TL8A 1UBFA 1ZCAA 3EZ6A 4RD6A 3SYLA 3V4RA 4D0GA 1J8YF 5FTLA 4RFSA 3BE4A 1G5RA 3AUYA 3P20A 5ANRB 2QMUA 3FHCB 4IOJA 5HKKD 3GLIB 5CLQA 5AUQA 2ZTSA 1E9AA 2J7PA 2FDCA 1CTQA 2OUKA 2ZJ8A 4M0LA 1DBSA 1I2MA 1DAEA 1KJWA 2XTZA 1ZAKA 1RRCA 2B6HA 1UDWA 4TTPA 4DSTA 3TR0A 5FBVB 1KDPA 1UKZA 421PA 4RY2A 3QXHA 3NTUA 1ZRHA 3AVPA 1U0JA 4XVQA 4QJ4A 1M2OB
chains in the Genus database with same CATH superfamily
3TRFA 5IP5A 3DMHA 3SQLA 4DV7B 3H0KA 3U3JA 1MCZA 4UUMA 3WLPA 5C8VA 4X92A 3ABSB 3I9V6 3TSAA 4GQAA 4QBFA 3UCXA 7ADHA 1QIGA 2E4ZA 3GJXC 4L73A 2PZ8A 2QNBA 1BNCA 5IF3A 1YV9A 1PR2A 4PC3A 3V2GA 2VP2A 1EFKA 1RQ2A 4I4LA 3OF5A 4ZU6X 1HNWB 2C57A 1PEAA 3GMIA 1UZMA 1F6DA 2ZM5A 3DYIA 3LK6A 2WSYB 1PZHA 4MCAA 3MPUA 5FFNA 4DV4B 2XZLA 4OXKA 2JVIA 3CFYA 5F7ZA 3MAJA 1WTAA 3D6HA 1MQAA 1ORTA 1C9EA 1TDJA 4OIMA 3CBGA 1ZGBA 5TY0A 4BNGA 1PVVA 2QTHA 3L18A 1Z4NA 1FPQA 3WO1A 3PC8A 4S35A 1P80A 4GXTA 4MH0R 4DMCA 5BSGA 2AOUA 4QBKA 1PK9A 1CSEE 4UVDA 1TT5B 5EEHA 3TCXB 2LW7A 3CEPB 1L1EA 2PS1A 2QJFA 4IHKA 4JQCA 2Y77A 4U9HS 5EGSA 2OGZA 3IB6A 4PYLA 4B84A 1DCFA 3THXA 1ATIA 1GJRA 1JG2A 1EJ0A 1TO2E 3MJ4A 2CFIA 2OYRA 3UB4A 2CL7X 3DEIA 1Z6QA 2W2KB 3AXTA 3GYGA 2HU7A 3DE2X 4K6OA 2P91A 3VKHA 3GLHA 4EY4A 4CQMD 2JJ8A 5JDIC 1QV6A 2FOIA 1FJHA 2Y3IA 1KXJA 2EDCA 2YBDA 2X5JO 3RK4A 5LLTA 5F9FA 1Z06A 4UU8A 3S2YA 3IUBA 4PVCA 4RMGA 1M7BA 1FYVA 3G5TA 1FNNA 2BGWA 2XYHA 3C3XA 5THKA 3LFUA 3L01A 1WE2A 4GYKA 1UMBB 5BW4A 4MHTA 3R5JA 4NYJR 4Q3LA 4L4XA 4MDEA 3E9MA 3GVHA 5KYWB 3SU8A 2X1HA 5GPBA 1PGPA 4WESB 5E9AA 1PWHA 1UEJA 5KQPA 3HY4A 4PHGA 3RDPA 4B3JA 2DTXA 1M0SA 4FBGA 3EPRA 3TN7A 4L4ZA 1IL0A 2CLOB 4Q1BA 1QKJA 4HQLA 2V54A 3STHA 5JVDF 3H9QA 4OOFA 3LRTA 2HLPA 4XCQA 1P29A 2PCJA 4RE5A 3BICA 4D99A 1MABB 1VG8A 1HOXA 2IIQA 2CNOA 1DKMA 2C3MA 2P4QA 3QVKA 1N6RA 3FLMA 4LBWA 2A9PA 1B6RA 1E5QA 4BNUA 2HUNA 3TQIA 4D8UA 2W7TA 1K3FA 2OFWA 3O1IC 4KV9A 4TYQA 5COQA 1EFRA 1UC9A 1Y98A 1ULZA 1TZCA 2V7EA 2ZTVA 4NYJQ 2GO7A 4W9RA 2YXNA 3B38A 3QG1A 5CLFA 4YCLA 1TQ4A 5KKNB 5FPKA 5KNLA 2H18A 3FNIA 3QI7A 1U3TA 1QGYA 1OV6A 3GDOA 2I6QA 1F8XA 3BJRA 3L2OB 3VHXA 5EA2A 4MP3A 4BTLA 3QXCA 2VI5A 4ZTZB 1PJQA 3C0KA 2QZJA 3QA3E 4YRIA 5BWCA 2JDID 2ZRBA 4HBZA 4MVJM 5BRNA 2PFKA 4OB6A 4IDQA 4FYXA 2R47A 1G19A 2DFPA 2J3MA 1B1CA 1FFAA 3JASB 4RHFA 4OTZA 3QNMA 1QYCA 5L45A 1SUWA 1ZN2A 3MLAA 1MXHA 4Z5XA 5JQGA 2Y0BA 2NO1A 3OU7A 3R8XA 1VPEA 1E89A 2BOVA 1CJMA 1NBAA 5FUVA 4G5OA 4H17A 3R44A 5I7EA 1DPGA 3GRKA 3K15A 2LV8A 4XUGB 4XGKA 4B2IA 2QTVA 5G4KB 3ZN2A 1UZAA 4LFCB 4BNLA 1KVTA 3LPLA 5DX0A 1I5OA 2B35A 3KZVA 4XPZA 2CZCA 2PGJA 1U7PA 3QYJA 3G5MA 4BFVA 5BV8A 3VHQA 4TKVB 1RXUA 4OQZA 4A1FA 2O5RA 2EF0A 4DCTA 5L53A 1G8AA 2J5QA 4MS1A 5DM2A 4IIJB 5DSTA 2DWPA 2ZT7A 4TYMA 4L5CA 3PSHA 4X61A 4KMMA 5BQPA 1CQPA 2X58A 1ECGA 4PO1A 4URYR 3URKA 4NH4A 2O9JA 4IJMA 2IHVA 4O59O 3HM9A 3T3DA 4BRZA 5AJWA 1CXZA 4M76B 2PKQP 2DQZA 3FI9A 2ADOA 2XUDA 1EQAA 2R00C 4JP8A 5CFQA 3RFVA 4LCEA 4HGQA 3PI7A 4PEVA 1FFSA 2OXCA 4M99A 5AM2A 1ZYUA 1WABA 2H17A 1U1CA 3WTBA 4BO0A 3N6XA 3L6OO 3K1YA 1BEUB 4XWWA 4FYVA 3ZGNA 4HX2A 4RH3A 4RTJA 3DFUA 4RF5A 3IV9A 3N0RA 4G9BA 1TF7A 4HAZA 3ZDYB 1XKXA 1JLRA 2GUGA 1J8QA 4IAOA 4LMBA 3MHPA 1MJHA 1E3MA 4B6PA 4JEIA 5BXQC 1GPAA 2WFAA 4C6SA 2JHAA 1OKKD 1RQNA 3LZCA 1P77A 2QQEA 2WDZA 1THGA 1IMOA 3C6BA 2DWOA 2ODWA 4EKGA 2AS0A 2ZJAA 3DYVA 3PEEA 4HC4A 5C3UA 1Z7WA 1M1XB 5I7RA 1SCQA 5AK6A 2VHQA 4UJ3A 4YCAA 5E8RA 1CQWA 1R9JA 2GXQA 3E3NA 1GZSA 5JO9A 1O9HA 1KI8A 3PXDA 3WLKX 4D9JA 3OUTA 4KHPB 2JVKA 2I9KA 1M0EA 2BKUA 5E4FA 4NFLA 3X43A 4IXTA 5T4FA 1E2MA 3OZWA 1CR4A 2ZRMA 3HB1A 4BJHB 5DYTA 3HKCA 4IBOA 3MBIA 4ARCA 1T5BA 2NX2A 4RDIA 2JFBA 3E27A 5G02A 4EX7A 1HT1E 4DNXA 1AGYA 5IKMA 3DV2A 2ONYA 3JQ8A 3O4RA 1KH2A 3CPEA 3QRWA 4L22A 7AT1A 1AA6A 1YHYA 2FAXA 1AXEA 4X94A 1DRKA 2NZJA 2XQGA 3C6QA 5EJMA 5HF9A 4BBAA 4C4AA 1A2KC 1J70A 4FEEA 3RSSA 3GCZA 1A8UA 1XQ9A 3HYNA 3PRJA 1JDNA 2O3JA 4G07A 3U3ZA 3K8ZA 1MC5A 3RYFA 1UXIA 1Z45A 1RKVA 4QTTB 1G4UR 4YMSA 5ALHA 5TQ2A 1ZSYA 5CVTA 1G4HA 4HX9A 4ZYWA 1B73A 1Y6ZA 3WGMA 4XWAA 5HYVA 1ETUA 2V8BA 4N0QA 4D98A 1RQGA 1YS4A 2GJ8A 4DL9A 2NG1A 5IWCA 2ZYWX 4EMTA 3DLAA 1M2WA 1PWEA 5K8VA 2C7OA 5EIFA 3IBFA 1NR1A 3G1UA 4U7HA 1EMDA 2I71A 2FK7A 3QU7A 4I8XA 5CK4A 4CV3A 1FNCA 3HDHA 3SQOA 3A7EA 4DBVO 3PDIA 5IUNC 4DDTA 1WDLA 1G5HA 3C43A 3RG2A 4M7PA 3UAYA 1M7GA 4I99A 4DADA 1JIKA 2LR0A 3RS4A 4CPDA 3UJCA 4QRDA 4BVEA 4ARZB 5J2TA 1OI4A 3IXLA 3EZ7A 4IJ6A 3WX0A 3B3GA 1VKHA 5AKLA 1X1EA 3HH8A 1OLSA 2ZIVB 3HVKA 5HW0A 4Z8XA 2PUTA 1EUDB 3IHKA 4LMPA 2PV7A 4C4YA 8ADHA 2XTJA 4DW8A 1BOFA 2QR5A 2XUQA 4JS0A 4ZRDA 1NW6A 2DFTA 1V1MB 2IXDA 4K9DA 4DQVA 1J09A 2CVPA 3TDMA 2F3SA 2BRUC 3U4IA 1N6LA 3HCRA 4IR7A 4WZBB 1U2ZA 5JXGA 1PFGA 5A2QA 3IUYA 1HT0A 2O57A 3B5JA 5AI9A 5ECYA 3MYYA 1WMEA 2OCDA 5FNVB 4P93A 1OB2A 3VAAA 2JLWA 3K6RA 2WKPA 5BRJA 2OSBA 2PH5A 4DQKA 2EOAA 3DCNA 4CEIB 1DX6A 2XOEA 2Z9CA 4KNVA 3X3HA 1W36C 4A8JC 1W52X 3HUUA 4OSOA 2OO3A 1YZTA 3COVA 3PD1A 4MR9A 1ZINA 3FPLA 3ZCSA 5ALPA 4FJ2A 3GVIA 4EUKA 2QXYA 4W5HA 4F96A 3L4KA 2PSDA 4DMHA 1ECJA 5IJ9B 4MV4A 4NQRA 4TSFD 1RLMA 4WIAA 1LRLA 4D9MA 1HSOA 2K7ZA 2ZUEA 2NUAA 2Y1KA 2CWDA 3MLEA 4LJ9A 1EZZA 2HF7A 3UK7A 1H8HD 2PLFA 4RNCA 2GM3A 1V3QE 4R9NA 1YGYA 3T6KA 3JQAD 3W6NA 4OQ4A 2FG5A 4ALKA 1KVSA 2VXOA 5DYNA 3L0OA 3W90A 3CXUA 1X1RA 1PVOA 1V11B 1YL7A 1XKTA 2WUDA 1A0OA 4PXSA 3G7NA 1G21A 2AJTA 3C5HA 3KKQA 1GO2A 3L8GA 3R0QA 4GLBA 4JEHA 4JJIA 2HU2A 4LOIA 1UM8A 1MU0A 3VJMA 1B26A 1UJ6A 2PYDA 3FYHA 4BVFA 4LHYA 3DKVA 1AMOA 4KFRA 4J4HA 4LK2A 1CERA 3JQRA 2GZ3A 2X5OA 1Q21A 5IJXA 3QX9A 3PPYA 4I9NA 4DY6A 1U7OA 2F48A 4LYFA 4UQOA 4X20A 1XMXA 5IUKC 4CLHA 2HDOA 2P4SA 1DAIA 3O2QB 3WLEA 2KS6A 3CF4A 1EVLA 4OV6B 5C4GB 5A04A 1YXMA 5CB4A 5K8TA 1JDBB 4NBTA 1IY0A 2GZRA 3FHOA 4E12A 2F00A 4DM3A 1ETHA 1QUEA 2CL0X 2ZB2A 3GD7A 2NVBA 3JAKB 4E3WA 4MVJP 4NZOA 3KTFA 3ESDA 2WJ6A 1IJEA 4HN4B 4C2BA 4EF4A 1G5IA 1C4KA 4X8LA 3BJZA 2QL7A 1O3YA 3U4DA 1WP4A 1CS0B 1VJRA 3E58A 3OIFA 2H65A 2VP3A 3C98A 4KRXA 4UJ5A 4BLSA 3D5TA 3NDPA 3OZTA 1NTOA 2VWPA 3ETNA 5JS2A 5IW8A 3PUWA 4REQB 2XOKD 4JFRA 1N9KA 2PYZA 2Y1CA 1PR1A 4Y6LA 4BN0A 3TIVA 3EZ2A 3FMIA 5JSKA 5M3BA 2NSLA 3BMQA 2BGGA 4N6NA 1Y82A 5KJEA 3FTEA 4Q03A 3WQRA 1V48A 1FRZA 3PBKA 2I3DA 3BGOS 3DF9A 4JI7B 2JFVA 3A3YA 3OFND 4MQFB 2DQ4A 1U7WA 1WCV1 1XYGA 1UEIA 4XM1A 5B64A 4KAFA 4G2TA 4KGZA 2JAXA 3PPIA 3QEBZ 1WXXA 1JHQA 2ICAA 2QYOA 4X6YA 5KU1A 2W2VA 2QORA 3UWDA 2HRDA 5BQOA 1YA8A 1T24A 5JPCA 3M4YA 4RKWA 2OMKA 3UCFA 3ZLVA 2O8DA 4WT7A 3JQAB 1SU4A 1P7YA 2E49A 2UZ4A 1G5QA 3MF4A 2O1XA 2D1YA 1N5DA 2WWXA 1JA1A 2W8ZA 2YS6A 3ZIAA 2XT9A 1R16A 4R69A 4C20A 2BTEA 2G0NA 3CWCA 3QBTA 4FZVA 4DJFC 5HF6A 4M86A 3OZDA 3CLSC 4BPBA 1XMIA 3EZFA 3QU5A 1EP3B 4QDTA 4MV1A 1MH1A 1A7JA 3WMWA 3NUQA 1CP3A 1DAMA 1G3RA 3DJFA 3QYAA 4IKOA 1I3KA 1S2MA 1KOFA 4ND8B 3AL2A 3UB2A 3MTJA 1DBQA 2G9NA 1YBFA 4TKZA 3U19A 4RZUA 4L6CA 3BXOA 4RLHA 5HHTA 5CA0A 3RC1A 2H4ZA 1QRSA 1JHPA 3AZOA 3AHIA 2YJ4A 2CJWB 3MS7A 4LX0A 3RTGA 1GUDA 3O4IA 3AIMA 2N42A 1GQOA 5KCMA 2BEWA 2J0VA 3HFGA 4BAZA 3FDZA 3HLKA 1N2CB 1R74A 2WWRA 5CXUA 5I5EA 4YJ2F 1GHTA 3G1WA 1P5JA 3E53A 3TGPA 2O59A 3H1PA 3IDOA 1AN0A 4ZP1A 2ZQZA 4R68A 3CKYA 4MB6A 4C2AA 1MV5A 1VXOA 1R8JA 2OBMA 2F1RA 2PS9A 2ZANA 3KPVA 1XOIA 3WY9A 4ZK6A 1FXUA 3P2KA 4HWKA 4A2CA 3MRSA 1I6MA 1SH7A 4OFZA 3E8MA 1AUVA 1XBTA 1PX2A 1M5TA 3I72A 1SKUA 3I6MA 2PSEA 3QVVA 3LA8A 3TLBA 2G5PA 3P0JA 3T3OA 2FWAA 1X1TA 3I2KA 3SM9A 5LOVB 3IP5A 4G5YA 1SQFA 3P26A 1SK9A 2IUYA 3HI4A 1NC1A 1T0BA 3OIGA 3QLVA 4YMUA 5LP6B 4JXJA 3E3MA 2QD1A 1HNNA 4WOCA 1PK8A 3C3PA 4G8JA 4TL6A 2J09A 1ARZA 1X74A 2AMYA 3AHJA 4L9RA 1IAQA 1G1AA 1Q11A 2DJIA 1QUFA 3DT6A 5LB2A 3AVUA 1V26A 3I42A 1GP2A 1FDIA 3M2PA 1Z62A 4XVRA 3WWYA 3WIUA 3MSCA 3SVZA 4D7AA 3OOHA 2HCJB 4EJMA 3KZXA 2BMWA 3E7WA 2PD4A 4KYVA 3ZWQA 3D4LA 3KUCA 4LZNA 1DTSA 2FEKA 4X7PA 2YXBA 3GZNB 2P75A 3D5QA 3EWNA 1GLGA 5EZYA 3QPWA 2AA3A 2WJZB 3NWPA 4AO7A 4PQGA 1OU4A 2VP9A 2GPBA 4LVCA 5ICFA 4GFDA 2J5XA 4YP5A 4B9AA 2ZR0A 1EGMB 4XE5A 4ENTA 4URXR 4Q3NA 2BF7A 4B81A 2O3UA 2PKXA 1C7IA 1XXHE 3V1MA 4W9MC 2CHEA 3N8DA 2D54A 4Q3BA 3VMMA 1T5HX 2AC4A 1CZNA 4NZZA 3K2IA 4HAVA 3P9IA 1LFAA 2VPYA 5LZ4A 4FGKA 3D1LA 4HNRA 4L75A 3K1TA 1RRKA 1L5VA 3CNBA 1SEVA 4CCYB 1IBMB 4DV1B 1ZVMA 3BKXA 3R3SA 4EZEA 3PE4A 4MMXB 5J9FA 3TSYA 4NI5A 3AB7A 1CNFA 4IQFA 4AY2A 2ATVA 1NVWQ 4B3IA 4KQ9A 4D8TA 3UBTA 2REXB 3PC3A 3M83A 3JWGA 2XR1A 3OWOA 1RI3A 4LDAA 4Q48A 3U6BA 1NJ2A 2IUUA 3C6ZA 1EXVA 2WTBA 3CH5A 7YASA 1NXXA 3RVLA 4CLDA 5DNWA 2IXTA 1M6EX 1S02A 1ZD1A 2X9VA 1U1DA 3H8WA 4QPCA 2WY2D 1USUA 5JJBA 2QDKA 1R6XA 5C18A 4V03A 3LUFA 1YZLA 2XV1A 1W46A 2IUSA 4J1SA 3ZCXA 1HYGA 4NCXA 1E2IA 4MGYR 1R00A 3S99A 4Q9KA 5TSDA 1DDIA 2AD1A 3CIFA 4TX1A 1R4MB 1RXVA 2WT4A 4LRWA 3TEJA 1RWQA 1IWBB 4RBNA 2XSZD 2EW2A 4RAQA 2NTVA 4TMFA 2BCGY 4ZZIA 3SE0A 3HZHA 1QO7A 4MWCA 1MC4A 1TCAA 2B8EA 3TVTA 4YB8A 2HJGA 2XTNA 5GONA 1QGDA 4MV3A 1FLDA 4HNSA 5B3AA 5IVDA 4ZI7A 3R6TA 1RI2A 5ECGC 3OZSA 3GNQA 2A0KA 3A1SA 5HJ7A 3J7TA 1FYWA 3ZW8A 2MTBA 2MOKA 2YVKA 4FOSA 1ODJA 4QHTA 9LDBA 1RC8A 1N6HA 3PHCA 3PP8A 3CH6A 5BSTA 3AF3A 4F4UA 4IMJB 2VF5X 3GCXA 3IPRA 4H27A 1RLIA 4UE6A 5EWJB 5ULLA 2F2TA 5KJ6A 5GINE 1QK4A 1Y7HA 2OD9A 2J6IA 3NORA 4HVAA 4D02A 4LYJA 2YRXA 4TXNA 2CHUA 4N8EA 3ZE6A 5ILOA 3U7HB 2H1OA 3HKDB 1XUOA 1STOA 3JWPA 1ABFA 2AMFA 1P7ZA 3DFKA 3RVKA 1L5WA 4Q1VA 4F5YA 5JW6A 2FSVC 3D54D 3KKLA 1NUPA 4B33A 2RARA 4I66A 5TRTA 3DO6A 2XECA 3L82B 2E6UX 5BSUA 4DILA 3B78A 4DYDA 1FZQA 2AFHE 1I7PA 1ISGA 5C7YA 2XMPA 3HY3A 2C61A 1OBHA 4O2AF 4ESHA 2IL1A 4BVLA 3BILA 3Q0EA 4NMXB 2CNBA 2BEUA 2KX7A 4Q93A 1OPRA 1C8VB 1ZS9A 3QVWA 4M53A 4CGZA 2ZSIA 2VVTA 1JA0A 4XEUA 1ESZA 3IALA 1TT5A 1PV2A 1LX7A 3A6HA 4UMDA 1AX9A 2J3DA 2W6MA 4S05A 2AN3A 4GRAA 2QE6A 3I61A 1RBMA 3F2IA 3LLMA 3TL2A 1A7AA 3LT2A 1QLHA 4AWBA 4DZZA 4AJIA 5SYAA 1R15A 2VF8A 2JA2A 1MVLA 2C4MA 2G1AA 3GJYA 2ZYTX 1WBJB 2PCLA 1ZK4A 4HHEA 4KE6A 4QHYA 3VOSA 4HATA 3FOFC 3CF6R 3PCTA 3WE7A 1DEXA 1YC2A 4Q9LA 2JARA 3FRJA 1WSAA 3TQQA 1PJSA 1T8TA 4KQJA 1QVRA 5FORA 2Z57A 2PSFA 3WMGA 1ZM7A 1SVKA 3GCWA 1QIEA 3IILA 4DR1B 5ALGA 5FPPA 1NATA 1SY7A 3IPCA 1N2GA 4OHKA 3PNKA 4UPVA 1GG5A 2AQIA 3WVNA 4IYRA 2ORWA 3RBAA 5B1YA 5JLJA 4LOHA 3JD3A 5KNBA 1PDVA 2ZIAA 3I45A 4MGZR 5A1JA 3F97A 1JFFB 1U0FA 1ZRSA 1AKVA 1EWKA 1H2AS 1JSLA 2M9MA 3NDIA 4HLQB 4HGNA 4KNWA 4MWTA 4WEQA 3RD5A 2XXAB 1ZG3A 3O6VA 1Z5OA 4RANA 1XZGA 4TQAA 3GIWA 5FL7D 4J6EA 3QSGA 2MSWA 4OJKA 3PUHA 3ODGA 1T15A 1U5BA 4JU9A 2FMFA 3BGDA 2UUPA 5LDDC 2A9OA 1PR4A 2Z2XA 3RT1A 4CGYA 1N4AA 1OCEA 3IQGX 2CT8A 4DMKA 3HPQA 4XGRA 2FOXA 2FYTA 4Q1DA 3ICWA 1ZIPA 2GEBA 3D6FA 4XVHA 2BMAA 1WPQA 2EF1A 3NNDA 4GQBA 2X0IA 4UOEA 2Q8QA 1EXWA 3OTIA 5AI0A 5EIHA 2PUDA 2QUBA 2LIVA 5LLDA 1B8NA 2ZJ6A 3TCKA 1I5EA 2W37A 4QO7A 4B5LA 5M34A 2W4QA 3NRJA 4CR7A 1NXPA 2PG3A 4OLBA 2XCUA 4RCVA 1ISPA 3UAOA 4NCNA 3VKUA 2O8CB 4IIXA 3GFSA 3HZOA 3AXSA 5ALRA 1V8FA 3SC3A 3TJMA 3UQYS 1POWA 1K0FA 1DX9A 1UH5A 3BZUA 1W1UA 4UU1A 4OQEA 5HCUA 3U4AA 4IIYA 3WJ7A 2JLRA 3JASA 5IMBA 4BGIA 3PGJA 5JBQA 4E6EA 2PKCA 4QEDA 2RJNA 1TU3A 2NV2B 1SBZA 1Y5IA 3NM6B 4FFLA 4URHA 1IBRA 4KXNA 1P1RA 3SC2B 2XRYA 3P71T 4GMXA 3KT6A 1OJ7A 2VHXA 4D9FA 3IVXA 1VA5A 4LBYA 3KOYA 1U1IA 3EWAA 4M0CA 1RBZA 2J32A 5G4KA 2I67A 4AY6A 1NOJA 1HBJA 3UYLA 5K0FA 1IPEA 5G0WA 2NOAA 1N6OA 4XFDA 1F6WA 4CQMA 2AFIE 2XMDA 2D1QA 1JFLA 4HCJA 1GUFA 2FN4A 4TKVA 5DWQA 2PJUA 3O8BA 4EX6A 1E66A 2HPVA 4EMSA 4ZYUA 5BUZA 1NN1A 3IA7A 3AB3A 4JMPA 5C53B 4IIJA 3Q12A 1QHFA 1IBCA 3LX4A 5HDBB 5A62A 4BKPA 1TC1A 1YUNA 3OUUA 4LYGA 4C7XA 2MSCB 1R10A 1AUPA 3EXHB 4Z54A 2X6QA 5HQ3A 2VDUE 1YB6A 3ZHUA 1IM5A 3GZ4A 5DP1A 1ZGCA 4U7PB 4E5VA 2JBWA 2P2DA 3N07A 1CQJA 1G0OA 2Q9CA 1SC4A 2BY4A 3KQVA 5ERGB 4N49A 4BYMA 1M34B 1GPLA 3H1FA 1KFJB 3F7MA 1KK3A 4K46A 4BFSA 4ZJYA 5J2UF 2FLVA 3TRJA 3TMKA 5BT9A 4J2TA 3TJRA 1WDTA 4BB6A 1Z2DA 2X0EA 4DMLA 2R00A 3PVCA 4LSWA 4DOMA 4EW2A 3KWFA 1AHPA 1TUEA 3IAFA 5REQB 2C5EA 1T2FA 2CF6A 1JU4A 3GELA 1XTPA 2R96A 3OOYA 3UJ6A 2QQ5A 2QRVB 1T3SA 4BBZA 2ON6A 3U3MA 4PSDA 4F9GA 5ITZA 4F3KA 5GZ1A 3UB3A 5AVSA 2EKDA 8MHTA 2BFMA 3TLZA 3ISTA 4CV0A 4HMQA 2QM8A 4JEMA 3R5KA 2WSMA 4BNNA 2VJLA 5F5LA 2YWXA 2G1KA 1SBTA 3ABQB 1F2TA 3H7IA 4BLWA 1PV4A 2QLBA 3JARB 2HSZA 4FFOA 4DRXA 2XBMA 3KU4A 3ZV5A 3D3JA 2JDIA 1KYQA 1FRFS 1K5PA 1N5IA 1NF2A 1YHZA 1RRVA 3E8SA 3MGKA 3NUGA 4MR8B 4XZ3A 5HG0A 3V6MA 5IULC 1XZ8A 5GZ6A 4IJUA 3EQ8A 4KDCA 4ZT2A 2OAQ1 5KVCA 5CB6A 3PC4A 2R4UA 5CXSA 1VYHA 2OQRA 2ZRQA 3NOOA 2ZUFA 2F1HA 4CMBA 4P31A 2H6EA 2QTAA 2V8OA 4RVGA 1TJ5A 3EUEA 2C84A 2DKFA 4JMLA 4YLEA 1MT3A 2XVAA 4W9NC 5IAEA 4KYTA 3SKYA 3AKZA 5DEIA 5E4JA 2E4XA 1GRRA 3NPAA 4HY3A 2VSOA 4KRYA 1RYMA 2ZBPA 3VPSA 1PG2A 1ZNZA 1JDUA 2OFXA 4B4UA 3MMNA 3AL0C 2JIZD 1I0LA 3GJRA 3HM2A 2HX1A 4N3AA 4YUAA 4IRMA 1I4LD 1B0ZA 3HC7A 4R6XA 1MKYA 1EP9A 1Z6YA 5A1TA 1IBKB 3TGWA 2NPIA 4EI9A 2FPOA 1V7PC 4LXYA 1NQ5A 3S2EA 1A95A 1L8AA 3Q3HA 3K0BA 1QKKA 1NRXA 3T34A 5EJEA 2FJ0A 3HACA 1XZMA 1Z0DA 3HKBB 2HBZA 4PLWA 1Y7PA 4I0WB 4ML3A 4MVJE 4F92B 7GPBA 1DFIA 4BX2A 2BR3A 1TTPB 2RHGB 1WUJS 3AF1A 5EERA 4C4OA 5EHXA 1N6PA 4IUBS 5JFOA 5ITSA 1KI1A 1LXCA 2BSXA 3Q0IA 3BGIA 3H2JA 4DTCA 4MQBA 1LF5A 4ARZA 5DMHA 4MKGA 1NF3A 3UAXA 4KL8S 2D7DA 2E4AA 2ZRLA 4AJ2A 1RWBA 2EFJA 2FSGA 1FSSA 1R88A 2WV9A 3GB9A 4GLLA 4XX0A 4B6GA 4EF6A 1KMHB 2BELA 1NLUA 1MHTA 2GKOA 3B70A 1BIFA 1UFKA 2V97A 4MUHA 5F98A 1OKKA 1V1MA 1DINA 4KVAA 5TVGA 1YZFA 4B6SA 5CG2A 1TYCA 2DFDA 4MIKA 4MKXA 1KJIA 4WZBA 4F4CA 4UNIA 3BL8A 5J23A 2CZQA 3MMPA 1QB8A 1JT2A 1G42A 2VQ6A 3ZCPA 3H16A 2CLHB 3F9RA 1KI2A 1IUPA 4L15A 4JOCA 2D7JA 4FHDA 4TT8A 3ZBQA 5C7LO 4TV8A 4UCWA 3VFDA 4AUKA 3MVEA 3NEPX 4KPGA 4IDOA 4DSUA 4O2BB 4AZ3B 1PYOA 1V8OA 2CXXA 3PJFA 3ZS8A 1TZBA 1K8RA 3ZI4A 4AS3A 3PUVA 2GEFA 3PL1A 4H6VA 2COEA 1THMA 1U0TA 2YV1A 4P6VF 1I4DD 3AUAA 1HLDA 3WMXA 4TXHA 3ZDXB 3SHTA 2NNWB 1N2BA 4NC9A 5G2OA 4UULA 5IJ9A 621PA 3M6AA 3NV9A 4BMSA 4LC0A 4BWGA 3ITEA 1K8ZB 1QHHB 2EEZA 2CLSA 3IP1A 2ONCA 4J9VA 1H4QA 2O8VA 1LDNA 5I8WA 2V7WA 2QX4A 2ZK7A 1XK6A 4B3CA 2HD4A 1P8JA 5K3SA 4BO5A 3PLAE 1LF0A 3G8CA 1QBKC 4H7PA 1RAAA 3B2NA 4L9SA 4RVHA 3OD1A 3BXHA 4CI0B 3AUXA 2PNJA 4M0UA 4CTJA 2ZIUB 4OGLA 1JSRA 4XIIA 4XQ9A 1O6ZA 2REOA 1R5OA 2G71A 2BBSA 3CTPA 1AY0A 4N7MA 2LCQA 2IOQA 3C3WA 1U7DA 2JKYA 3GEPA 3KT0A 4PLHA 3O5AA 3HWX1 4PCLA 3FPFA 3BRQA 4L9WA 1YR6A 2TMKA 3PNLA 4QEZA 5F51A 5KYGA 1B6GA 2YZMA 1LNZA 4PRYA 2JAHA 4ESOA 3W5AA 1IHOA 2FPLA 4R8MA 3VX3A 4EO7A 3REFA 3COZA 1MGPA 3RBZA 1OFIA 3JAKA 3UMMA 3U56A 4J9UE 4TVOA 3X2FA 4GYYA 1X77A 3HLYA 4IICA 4P36A 4RESA 6CHYA 3GO4A 2CJYA 3IEXA 4XYMA 4MWSA 1RR6A 1PUIA 5B58T 3BK2A 3BXEA 3ONDA 2OZLA 5CYPA 2HA3A 4DXHA 1HFWA 2AI3A 4GMDA 3M9WA 2CEKA 2COKA 3V7NA 1ZM4A 3MW8A 2PMDA 1WD5A 3UJ3X 2F3QA 4GLJA 5IC4A 4GKJB 1DKRA 4GX1A 3ZDEA 2WM9B 1E5XA 4CR8A 3CNQS 1C3XA 1OJLA 1N32B 2P69A 1ONPA 2R86A 4YCCA 3W78A 1HL7A 1YRQA 1EKXA 2P9EA 3AETA 1U2EA 3DPIA 3G8BA 3RJMA 4MKFA 1HG0A 4K2HA 5IX8A 3LX8A 2JIRA 2R7KA 2E5WA 2IYUA 4OH1A 3JPWA 4DIOA 1XIVA 1Q7EA 1KO8A 4MQFA 4TXJA 2QVYX 3DVQX 3LTEA 3G13A 1TTTA 3RAFC 3IA2A 1LJUA 5CYOA 3VR6H 3NWEA 4FC7A 1C80A 3R3HA 4LF4B 2XUKA 3WIOA 1MW8X 3CSUA 1R0XA 4ISCA 4TSFA 1OX5A 4L16A 1T2NA 5ECDA 1WB9A 1N34B 4BMOB 1YCGA 4W1QA 2IBTA 4CKYA 2BYTA 2IYZA 3PR1A 3KXPA 1H8HA 4UEWA 1T3HA 3UOWA 3ZLJA 1HF3A 1I3OA 5SZJA 3RSCA 1H6AA 2HV9A 3JQAA 4TRJA 3VZDA 1CRPA 3N8HA 4GGPA 1H42A 1P2TA 4K1LA 1XCOA 3UEOA 1AGRA 2JF0A 3VXKA 1TRHA 3GLFB 5G0SA 1SK8A 2Q0SA 4ERNA 4Q00A 2C2WA 3NBFA 2PE5A 4U2EA 5GQSA 4K9PA 1T5LA 1TPZA 2FRDA 4BP3A 3AV0B 1Q7RA 2FR1A 4ZO6A 4J4TA 1ODIA 3W2EA 2VJBA 5JCZA 1QTQA 1YHNA 5AKXA 1T26A 2PRJA 3IE0A 2RHBA 2G70A 1QNFA 2VZ8A 3TZLA 2X6RA 1JJFA 4U8GA 5C8YB 3QKSA 2Q4RA 2VTEA 2CJWA 2X1MA 2ZSHA 4X1IA 1USGA 4URVR 1O4VA 2G4CA 3ASZA 3KZKA 1X0XA 2R79A 4IQGA 2QRKA 3TOZA 4F2WA 1N2CA 3HDVA 1NJ1A 3HXLA 1X70A 1FDVA 2WB2A 2H63A 4U0JA 4ZCSA 4AAYA 1ORWA 3C6XA 1KAMA 1ZL0A 2CVZA 4YAUA 2HRBA 2GRJA 3B85A 1T9GR 1FS5A 2Q9BA 5AK0A 1O54A 3PTAA 4CEHB 1RRPA 3OZFA 5U4XA 4WVLA 5ALFA 3TTVA 3T54A 2XOKA 3SY8A 5HFAA 4KR6A 4INAA 4YJKA 2VPPA 3GFPA 1A76A 4ILEA 5IJWA 5JBNA 3CZ9A 1JR3E 3ZKWA 3LHFA 1G4AE 5HX7A 3PV0A 1UJ2A 2EFEB 4JGIA 1HQYE 2UVPB 2RHLA 3MTAA 4YUYA 5J1SB 4X71A 1U6KA 1N2SA 2X2PA 1X1DA 3JAWA 1Y7TA 2N3ZA 3DXYA 3OFNA 1J2UA 3GNTA 4IY1A 2QIPA 1J90A 3V8PA 2O0LA 4TS3A 4AQDA 3LUGA 3ZW9A 2VQSA 1MB4A 1OTYA 3RFXA 4ER7A 5EVJA 1Q6ZA 3UMCA 1P5RA 1BW9B 1VJGA 3KS9A 5JCJD 1FTSA 2G83A 3TZQA 2R8EA 5K0TA 5JAPA 1WCIB 2LDXA 3QU2A 4BVKA 3GY0A 2O2YA 5HTOA 3WJAA 5AM4A 3E8XA 1FZTA 2ZXEA 4EK9A 5AKEA 5DTQA 2OXFA 3L6UA 4AZ0B 3CLRD 2JFZA 4RKYA 4F85A 1E7RA 4PSAA 2R1VA 4Q7JB 3UTDA 4NV3A 3H18A 4ZVLA 3GZNA 4D43A 4B2LA 2FJUA 1QF6A 2X0JA 3PA8A 2ZJ0A 4A9AA 2B1RA 2ZTHA 5E3JA 2FUCA 3TEFA 3E3LA 4WKBA 3ETLA 5K1ZA 3MGAA 3BPSA 4OM8A 1DWUA 2R2AA 2AZTA 3PR2B 3CMCO 3N8NA 5JXIA 4EB6B 2CV1A 2GB4A 1JIUA 1SUDA 3M49A 3H11B 2YWDA 3DBIA 1II9A 1Z25A 2A9RA 2BC9A 3MEQA 2BJVA 5AXCA 3TCNA 4B3BA 2ID9A 1BVRA 4L0DA 4QUIA 5TEWA 2WW8A 3AG5A 5KDLA 2XB2A 1GTSA 2R8RA 3FR7A 3BXFA 3MYRA 2YXLA 4AJKA 4CCYA 5JALA 1S9DA 1U7XA 3EHEA 3HCAA 5BW6B 4X84A 4F8JA 1Y8RB 2R11A 4AFNA 1RPJA 1HSZA 4WFKA 4NBVA 4Q1EA 1I80A 5C51B 1IXYA 4Y9RA 4D0SA 1R18A 2I9PA 4O4LB 1YDHA 3TLGA 3TXAA 3W7AA 3RWMB 5JY6A 5EWJA 1O57A 1A4XA 3FMFA 2WZDA 1SZCA 4K87A 4L8GA 2WD9A 4UNQA 4C04A 2VHCA 3FZGA 4MV9A 4FZRA 4MVJF 4LMAA 3ISVA 1JB1A 1Z88A 4YO7A 3AFHA 4LQLA 3ZY3A 1DZIA 4I08A 5HOEA 4L6AA 4EZBA 2HK6A 1E8NA 3FGPA 3THSA 4MWEA 2FF7A 2X40A 4KBYA 1IXSB 2ZUSA 2R62A 1F51E 2QTGA 4G0NA 1QC5B 1CP2A 2DPYA 4HGYA 4KB5A 5CGZA 3ZLTA 3H17A 4UFNA 2HSJA 3BULA 3W04A 1NULA 5KNCH 1ZWKA 2L2QA 3QF7A 2ALJA 3T94A 121PA 4D57A 2P9BA 1RKUA 4GSLA 4ZI5A 3ZGLA 2GEDA 3R9WA 3F7TA 4A92A 2QMYA 3HO8A 4MKRA 4KACA 2PEZA 2IIBA 4JSYA 3VDXA 2C0QA 2GFIA 3DONA 2OORC 5NLLA 3LQ4A 1ZUWA 5HIIA 4RA9B 4KBFA 5FPYA 3UTCA 4RHEA 5KTPA 3OJFA 1A8IA 1GA4A 4HNQA 3AY3A 3UXEA 3VPDA 2AI2A 2TS1A 4MIYA 3RC3A 5LZ7A 3TLJA 1N7IA 2ZI7A 3ZGYA 4B1FA 1K1EA 1N8KA 3AH8A 2FQXA 4NPCA 4OQFA 5HJ5A 4DQ0A 2FWJA 4P8RA 3LHIA 1SUIA 4XYLA 2V96A 4B75A 5B7PA 3FWNA 3ZOKA 5LWQA 4FGSA 3GLVA 2OOKA 1E60A 1H2BA 1ORRA 3N2GA 5JPIA 2R0QC 1V9SA 3I4CA 2DLNA 4W5NA 5HIAA 2Q9AA 3IUMA 3LVBA 5IDWA 4CEJB 4BZQA 1GQQA 1NI3A 1U0HC 1E7MA 1E6WA 1QCZA 2V7QD 3L49A 1RPNA 3HKDA 2BCEA 1J0XO 3Q2IA 2DF8A 4M9SA 1TCVA 3A1FA 4WJZA 5BN3B 4LDQA 2JD1A 3TW6A 4GXQA 4Q18A 4CNBA 4Z4CA 2HQOA 2E