1KO1A

Crystal structure of gluconate kinase
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
172
structure length
163
Chain Sequence
b'TTNHDHHIYVLMGVSGSGKSAVASEVAHQLHAAFLDGDFLHPRRNIEKMASGEPLNDDDRKPWLQALNDAAFAMQRTNKVSLIVCSALKKHYRDLLREGNPNLSFIYLKGDFDVIESRLTQMLVTQFETLQEPGADETDVLVVDIDQPLEGVVASTIEVIKKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gluconate kinase
molecule tags Transferase
source organism Escherichia coli
publication title Conformational changes during the catalytic cycle of gluconate kinase as revealed by X-ray crystallography.
pubmed doi rcsb
total genus 62
structure length 163
sequence length 172
chains with identical sequence B
ec nomenclature ec 2.7.1.12: Gluconokinase.
pdb deposition date 2001-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ko1A00
3I32A 1PUJA 1WE2A 2ZM5A 1X3SA 2XX3A 1FP7A 3NXSA 4FI3C 1NSFA 1OFUX 4B3XA 1S1MA 1ZC4A 3OIYA 5TV2A 4JBXA 3WRXC 1E0SA 1NMZA 4E09A 5LPNA 1QHSA 1KDOA 2ZRJA 2JJ1D 3Q9LA 1KZGB 2W2XA 5CB6A 5KOYA 1AGPA 5F2EA 2JLZA 3VKHA 4R2IA 2QQEA 3B82A 3A4LA 3EAQA 3WP1B 5A5GA 4UNQA 1U0JA 1LFDB 5KPDA 3MFYA 2WPDA 1T91A 3U3JA 3LQQA 3QF4B 3ZS8A 2NQ2C 2FOLA 1W2GA 5LD2B 2AWOA 4IDNA 4W9MC 3QXXA 4NYJR 3RVBA 4BRUA 2D3WA 4HDQB 2ZIAA 3BJIC 2WKRA 4JLPA 5C1BA 5GJVC 1KIMA 1GNRA 2PZEA 1A5TA 1L4YA 3FVQA 2VSOA 1KJYA 4QJ4A 4OI0A 1KY3A 3PUWA 4WZBE 4D0LB 3R9WA 1UBCA 4PAQA 1ZYUA 3K09A 3UMFA 3TUJC 3UATA 2WKPA 1HQYE 2VP0A 3CPHA 3IKJA 3UG7A 4BEJA 5B30A 3SN6A 3HU3A 4R9UC 5GJWC 1A4RA 4HLDA 1IXZA 3QQ5A 2OFOA 3GJ8A 5DI3A 1U0HC 4DCUA 3GEEA 4XWKA 5JI3E 1WP9A 4X8MA 3QSYA 3MUFA 1C9KA 1G21E 4CEIA 2NTYC 1QVRA 4GT1A 1K5GA 4DLTA 4CGZA 421PA 3RRYA 721PA 5JEDA 4RZ2A 2OLKA 5JJIA 1OXTA 2ZYWX 3I3SR 4II7A 3QKSA 4B35A 4KXFB 3AVYA 2NPFA 2WIBA 2AK2A 3HU2A 3U3KA 1U2RA 4YLGA 3U6BA 4DDUA 4QJ3A 1VYTA 3AF3A 3IPXA 4ON9A 1W7AA 3LWNA 3EW9A 4A0GA 5AUNB 3UIEA 4B2IA 2A5JA 4BFWA 1N5LA 1XEWY 3CRVA 4U5XA 3EIHA 3TUIC 5K8UA 2CXXA 2XOKA 5DE3A 2O5VA 1IOZA 4OI2A 1VCNA 1J2JA 2O0JA 2GF0A 4JBWA 1LY1A 4JLBA 1Z3IX 2NO6A 3N70A 4M9XA 1VG1A 5AUOB 2ZRFA 2AKAB 3AB3A 3Q72A 4GPTA 5F3WB 4M1YA 2F1HA 1KI2A 1CXZA 5BN3A 1SVWA 1E2FA 2HV8A 2AFIE 4PAMA 5FPHA 2RHDA 3TBKA 4Q9KA 5BN4A 2C95A 1HV8A 4NCNA 4PC7A 1XEXA 1L7VC 2GXAA 1QHHA 2V1XA 1E9AA 1N0WA 1G7CA 1F5NA 4CYMA 4RVCA 4CZ2A 2EWWA 4AYTA 1FMJA 2WSMA 4Z1MD 4HAZA 4TQUS 3QPVA 4Q19A 1PUIA 3BOSA 4XVQA 1TUIA 1Z0JA 1Q1BA 1UM8A 2ZYUX 2AFHE 2WJJA 2MSEB 1ZINA 4F38A 2IXEA 1KAGA 1SKYE 2D7CA 5FFMA 4M1SA 3GEIA 2ZRPA 2FSGA 3NBFA 2F9MA 5F9FA 3T34A 1TAGA 4EPYA 2QG6A 4I1VA 4KHZA 4D4MA 1JXOA 3L0SA 2XITA 4EFLA 2PX0A 1B0UA 3RS2A 2YV5A 1T4GA 2V9PA 2O52A 3PG5A 4EDHA 1QZXA 5FTNA 2FGKA 2D7DA 4LJYA 1XJCA 3CB4A 1WMSA 2IYXA 4QBHA 3G5UA 1KOFA 3FTQA 2VO1A 4MYTA 3KFVA 3OIVA 4KVAA 4JVMA 4QC2A 4ZDIA 4LHVA 5L3SA 2F1RA 1GG2A 2PZFA 4PHFA 2A30A 3D31A 1ZMXA 3AGPA 4NYIR 1XEXB 3NBZC 1T0HB 4TTRA 5GVSA 4ZCMA 3IHWA 3KKPA 1XCGB 4KFUA 2RGBA 4ZPXA 5SZIA 1NN5A 1SZPA 3CF2A 2VHTA 3SYKA 5FTJA 1E9BA 2B7BA 4FWIB 1XD9A 4A8JB 4KLNA 4LV5B 2OXRA 1ZC3A 4PTLA 3VU9A 4RFSA 3VNVA 1MO3A 3WBKA 3BC1A 1MR3F 5AR1A 2QPTA 1KKLA 1KK1A 5FTMA 2OEPA 4ASUA 4CF7A 4D80A 3TQCA 4Q03A 1W46A 1FQKA 5G41A 4PPQA 1LS1A 4ILEA 4LV6A 3LX5A 2ZRIA 5JRZA 3SFVA 1NG1A 5JMTA 2CHQA 1YE8A 3WYAA 2ONKA 3VR1A 2CE2X 1WCV1 3E1SA 4FXPA 2ANBA 2D62A 3JZAA 1IY0A 3EG5A 1GIAA 2HDNB 2ZE6A 3QXJA 1P9RA 2LKDA 1NL3A 1W5SA 4OQFA 1YZNA 1YR6A 3QBVA 5FL7A 5HCIA 3RWMB 3TAUA 1W47A 3BBPA 1RE0A 4XTRA 3RABA 1OPXA 1TUEA 2P6RA 2C78A 2H16A 4RD6A 5L3SB 2ONJA 3D6TB 4GOKA 5F9HA 1P5ZB 2W58A 4AG5A 4PQFA 1KI7A 1Q57A 2N1BA 2C9OA 5EE0A 1E32A 1P9NA 4FMDF 4JVLA 5EXPA 3ND9A 4DLWA 5AJXA 3TLXA 4KODA 1Q0UA 3VTKA 1T3LA 5CYOA 4TYNA 4EIWA 4KBFA 4A8JA 1ETUA 3NG1A 5JHGB 5KDLA 1XF9A 2F6RA 2P6UA 2O8EB 4D4KA 4Q9IA 5AJWA 2DR3A 1G7RA 4RCYA 4UQOA 4R71A 3JVUA 3U44B 5H1YA 4UNPA 4Q9JA 3CX6A 3KXLA 4LWZA 4UNSA 2X19A 5CB8A 4XVUA 4EPVA 2JCSA 4GP7A 3IBGA 1XXHB 4IKEA 3GD7A 3WNBA 4WAUA 1M34E 4LHXA 3U7HB 3AVUA 1ZD9A 2QGZA 4ZDJA 3KDSE 1R0ZA 2WICA 3QXHA 4OK5A 3X1ZA 3TSWA 1P72A 1HA3A 4I81A 2QAGC 5FTLA 1AIPA 1IN6A 1QHYA 5FPTA 2QBYA 4TLEA 4Q66C 1N6PA 2QN6A 2QUZA 5FUXA 2VP2A 4LI0A 2DWQA 5AUQA 1KZ7B 3AF2A 4BE7B 3LLUA 1COWA 3CPEA 5BYJA 1IQPA 3AVOA 4RD3A 2QMEA 1AS3A 5DLQC 4XSHA 1E2EA 1XMSA 2YOFA 3K09C 1J8YF 3REGA 3CW2A 2O8CA 1NSTA 3ND8A 4TMXA 1KGDA 4NCIA 4GNKA 2IS6A 1W4AA 1W0JA 2CBZA 2ZSDA 4UJ3A 2O8FA 4S2EA 4BFSA 3K8YA 3U3RA 3NDPA 4DIDA 1E6CA 2MMCA 2PLRA 1YZQA 2ERYA 3F5FA 4PX9A 5LB4A 5FI0B 1E1RA 1OXVA 2YC2C 2ODBA 1OIVA 2JDIA 5C4MA 4EJSB 3KKMA 5CJPA 3IIJA 3L0IB 1DADA 4KU4A 3QKUA 3CWQA 2C98A 3T61A 1YQTA 2CNWD 5K8IA 2GZAA 1Z6GA 2C77A 3DKVA 5ELXA 4Q1AA 5IHPA 2FZLA 1ZVQA 3DZ8A 4NP6A 4X8OA 4R7ZA 1GRNA 4KCGA 2DB3A 3GLIA 1Z0IA 3E70C 4HAUA 3C7KA 3FMOB 2H92A 2FU5C 4RD4A 2V7QD 4YMTA 5FBLB 2PH1A 1AGRA 3GLGA 1F2TA 1UJ2A 5FPYA 1DPFA 2GF9A 2YHSA 1N0UA 3TMKA 1OH5A 2IHYA 1KAOA 1OKKD 5AJVB 4LCBA 3BFVA 3ZQJA 2R6AA 3B1YA 4Z8XA 4D4JA 2CVFA 3P20A 4JIMA 2NZ8A 1ZM2A 2CK3D 5JHHB 3QVUA 4HSEA 4PSVA 4JT2A 5TXGA 4Z54A 2PMDA 1HT1E 2B21A 2AR7A 4Q02A 1P60A 4BQSA 1G8HA 3GQBA 2Q3FA 1N5JA 1N6OA 4QM7A 1KNXA 2AXNA 1NJFA 2H18A 4ESVA 4NU0A 1X1SA 3WMGA 4JLJA 3U61B 2H8KA 1G19A 4G01B 4Q4JB 2GJ8A 2WIAA 1XCPA 2BBTA 3F8TA 4TTQA 1W2HA 2XNDA 1MRNA 4Y0VA 3GLHB 4B74A 3LXRA 3AP2A 3ZQ6A 5EUMA 4P32A 3A36A 1A7JA 2A78A 5JJLA 1RRCA 4QL3A 4AWXA 2V6JA 2J9RA 1GL9B 3M1IA 1RYFA 4Z51A 4NCJA 1YR7A 1N5KA 1FZQA 3IO5A 3QF7A 4US0R 4DWJA 1GUAA 4B34A 3CNNA 1LB1B 2VIIA 3NHAA 3H4MA 4AC9A 4TMKA 2P6NA 3PITA 3FDIA 3TRFA 2WMNB 2RKOA 5FTKA 1LF0A 2FFAA 2XJ9A 4OJQA 4YONB 4LBWA 2OFWA 1YKSA 3THWB 3ASYA 2ATVA 1H8EA 3SU8A 3P27A 1NBMA 1M1YE 3SBEA 3BS4A 1SXJD 2IYVA 3TVDA 3GEHA 2WAXA 2IX3A 4MGZR 4QGHA 2CCGA 2BDTA 4P4SA 5JEEA 3W8NA 4MUBA 2EW1A 5AJYA 3SJZA 4L5BA 2C99A 1R6BX 3VNUA 1U81A 2I1QA 1X86B 5CM8B 3KXIA 1KK3A 4M4SA 3FMFA 4NCHA 1YU9A 5B64A 5IF9A 5TDHA 2B8WA 2CJWA 2QT0A 1BYIA 4HZUB 2ZJ5A 1TU4A 4D0NA 2X77A 3Q8XB 3R7WB 3SE0A 3UPUA 3BORA 1KMQA 3EA5A 1DO2A 2A7QA 1VG0B 1G3UA 4G1UC 5HE9A 1HURA 4NBSA 3QG1A 1US8B 5JS7A 1EX6A 1DOAA 4K8OA 1KO4A 4JJZA 3ZIAD 2ZEJA 1EFHA 1SVMA 1RJ9B 3K0AA 1SHZA 4NPHA 5D3QA 1MABA 3O8BA 4EQ6A 4D26A 3BIFA 4PSAA 1DE0A 3ECCA 3C41J 6Q21A 2W83A 3KUCA 1S3SA 1XPRA 2GHIA 2CL6X 4M9ZA 3RRMA 3I5YA 1TF7A 2AKYA 2HUPA 4P4SB 1FX0B 2ZYTX 5IT5A 2ZJBA 3T1QA 4QFMA 5D3MB 2RGGA 1KJZA 2OG2A 5SZKB 5TY0A 3GPLA 2GJ9A 1KO5A 4L16A 3SS8A 2GETA 4KVGA 1QHXA 4D6PA 2XXAB 2OM2A 1R4AA 4NYJQ 1E2HA 4C3ZA 1ZNZA 2P5SA 1CR2A 4ZCLA 4HZUA 1RFLA 4TMWA 2OFXA 2ZSEA 2JASA 3CZQA 1U0LA 4TZ0A 1EFRA 3PJRA 3B6EA 2IS1A 1F48A 3SJAA 4KYUA 4QBFA 4U00A 2HLDA 5FOUA 4C0KA 3K1JA 4LHZA 4LPSA 2GXUA 3BXZA 4KI0A 1VPLA 3A58B 2ZUCA 1A82A 4PHHA 1E2GA 5EP4A 4Q7JB 2WJIA 1CR1A 4L9SA 4OJKA 1JR3E 1ZP6A 2J45A 1OFIA 2AXPA 3R7WA 1JPNA 2VP5A 3OE7A 1RRFA 1SKYB 2R44A 4WVFA 2WWWA 4HDOB 3WYFA 1ZUNB 4JYCA 2FWRA 3EARA 4DC9A 5JFGA 4YMWA 4QHSA 5CJ2A 4DCVA 3CRQA 1FUUA 1G18A 2PBRA 1UDXA 2IYSA 1LTQA 2DFLA 1X6VA 3KXKA 4KITB 4XJXA 1X8KA 2R62A 4V0NA 3QI2A 2NO7A 1ESNA 2IYZA 3A37A 4JLMA 2ZRGA 3CO5A 2QI9C 1ZU4A 1XTJA 4NDZA 1AN0A 4Q21A 5EP1A 2VTKA 4BLRA 1XB2A 2HYDA 2JLRA 2AWNA 3AEZA 1CLUA 1EX7A 4DLYA 4MKHA 5LD2C 3CM0A 3ZVNA 3MWKA 1W5TA 3LY5A 4EJSC 1EWRA 4URZR 1LVGA 4LC0A 5B57C 2AL7A 4Q7MB 3CLVA 4QHTA 2OAQ1 2IXGA 2YOHA 3P26A 1MRSA 1KO7A 4M53A 3EXAA 2O8CB 4C0LA 4CEJA 4HB2A 2ZJ2A 4BASA 3OAAD 3L8YA 3PENA 2GJSA 1YJ5A 1GL7A 2QP3A 4MITA 1N3BA 4XD7A 3GLHE 2X1VA 3U2QA 3NBXX 5AJZA 1U98A 3AV0B 3ZVLA 1S4QA 5E7IA 4PHGA 3QKTA 4CT5A 5FOSA 2P3SA 1E69A 2WOOA 2REXB 2HJVA 3AGQA 4JLOA 4G0NA 4PPFA 2ZR7A 1N6RA 4Q1CA 4TLBA 3REFA 3T5DA 3QPUA 3EZFA 1NN3A 3IIMA 3ETLA 2OILA 3TVTA 1PJRA 2E1RA 3BAFA 1CJTC 1D2NA 2YWFA 3AF0A 4LHYA 4NL4H 2QM7A 2SHKA 2IUSA 3EA0A 4TYPA 3DOEA 1R5BA 4BZQA 1LV7A 3K9NA 3MCAA 2Z83A 1E9SA 3R9IA 4LRWA 1RIFA 3W8RA 1NVWQ 1Z2AA 2ZI6A 2BIFA 4D2IA 4IOLA 1BOFA 2XJ4A 1YHNA 2GBLA 3NC1C 1G64A 5JWRA 4FIDA 2XB2A 4OI4A 3U3OA 3C5HA 4Q18A 5TB5A 3VMFA 1QBKC 3LAWA 3K53A 4Q4LA 4C7OB 4A36A 1E3MA 3ZIAA 3RS5A 4MRRA 5FOVA 2KWIA 3THOA 3UWKA 1FMLA 4PPNA 3I8SA 4Q7LA 2WMOB 3N2IA 1VCIA 2ZJOA 2VHQA 4RFVA 1T3HA 4RKFA 1OLOA 4DDVA 1P4SA 4EFNA 3BB4A 4U7DA 1XMIA 4TN1A 1MV5A 2OE2A 4BZXA 1N6NA 2DBYA 2VHUA 1CP2A 1XX6A 5BW8A 2UVQA 2ZROA 1XEFA 3KB2A 3P1JA 3BFKA 3IHLA 4AKEA 1U8AA 4IFBA 3U3MA 1ZM9A 1WA5A 2CJWB 4KV9A 2WJGA 3IO3A 3PFIA 1WBBA 2IYLD 4IEEA 1TTTA 1N6HA 4B71A 1D5CA 3J81k 2HCJB 2P67A 3NEJA 3TH5A 4B2LA 3MGCA 3LV8A 3WHKA 1BYUA 5G40A 2A5DA 5TARA 1RJ9A 1P7CA 4KSBA 2DPXA 4E03A 4JKYA 3PUVA 2YVUA 4HDCA 2VP6A 4WXPA 4DLXA 4ARZB 4M9SA 5P21A 4JLKA 4A0RA 4ZKEA 2BKUA 4WBSA 5KNCA 1A2BA 5TVKA 1M74A 1E2DA 5BXQC 1SVKA 3I1FA 1GKUB 2GKSA 3ICQB 2QMUA 1NF3A 2ZYVX 2J0QA 1Q21A 1F60A 3A4NA 3LDAA 5JCPA 1DAIA 1TL7C 2PCLA 4IRUB 3O8CA 3DKPA 3MWYW 1HUQA 4HI0E 3B60A 4M1TA 5L3VA 1F3OA 1XXHE 4G5GA 3LRPA 1AS2A 1XWIA 1U9IA 1VYUA 121PA 3TW4A 1FPMA 4BPBA 2AK3A 2D2FA 2OZEA 3JVVA 3B13B 2ZRMA 1JPJA 4D25A 5EE9A 4URVR 4JLDA 1GNQA 1YZTA 2N42A 5KNBA 4IVQA 2FN4A 2RHMA 4C4PA 4LBZA 1G8FA 1P75A 1VG9B 1HE1C 2G6BA 2B92A 4LY6A 4TT3A 3L2OB 5JBQA 5J47A 4D4LA 1M8PA 1D9ZA 1Z0KA 2PCJA 3WBJA 2DFNA 4TL9A 5IDVA 1I4DD 1F2UB 2OLJA 3PUYA 4YQFA 1CF4A 1JJ7A 3B8HA 3GLFE 3W5JA 1UADA 1IAQA 2GRJA 1ZD8A 4MKGA 4A1FA 3BH0A 4A92A 2QMOA 4HB0A 4W5HA 1EFUA 2Z4SA 1MKYA 2YNMA 3KKOA 4V0MA 2GVZC 4B44A 1Z83A 4JLNA 3RHFA 3PEWA 1Q3TA 3EWAA 1BMFD 2V55B 3WHLA 1AA9A 1F2TB 3LQRA 1BO6A 2CVHA 2OO7A 4M1OA 3AQ4A 2A5GA 4CIDA 3L0OA 4A15A 1GP2A 3I4LA 1CRQA 3VFDA 1OXSC 2ZJYA 3TJZA 3K0FB 3GCGA 4B3FX 5FUYA 1MT0A 4DBLC 5KTYA 2CCKA 2JJ2A 3FHCB 4BUJA 2VQSA 3KTAB 3K70C 1SHKA 1ZM3A 1TPZA 3WNDA 3GLGE 4ZDWA 4QBIA 3A1SA 3FMPB 4CEHB 2VF8A 3CF6R 3TAHA 3QBTA 5CIQA 3LBIA 3DHWC 2J46A 3OEED 3FGNA 3RAPR 1CJUC 4DXAA 1VECA 4NMMA 1K6MA 2FSHA 1OB2A 5EUQB 4FMCB 2I3BA 4Q4HA 4A2PA 5GADl 4DLVA 3U6KA 4OHVA 1W0KA 4H9GA 1E99A 2WZQA 3MWLA 3OFND 4FWTA 1GWNA 2H57A 2WVJA 2YOGA 4TSFD 3U44A 4AKIA 2MMGA 3D3QA 2J0SA 3KKNA 5EE3A 1R2QA 4G5OA 2VYFA 2P2LA 2ATXA 3CNOA 2VL7A 4UKDA 3HP1A 2H1LA 4D81A 4CDGA 4F92B 3LX8A 2BMEA 4A9AA 2QEQA 1Z6XA 4C0JA 1CEEA 2REBA 1IM2A 2ZITA 5J4LA 1S0UA 1NMXA 2BCGY 2QROA 4OBEA 3QUSA 1UAAA 4DEYA 1TX4B 5J4YA 1XTIA 4YXWA 2QNRA 5H68A 3BK7A 1I2DA 4JL5A 3B2EA 2XTMA 1OSNA 1SKQA 1OYYA 2EU8A 1TU3A 2ZI7A 1QHHB 4HLUA 4OQXA 4QGFA 5KSYA 4RZXA 3U4QB 3SQXA 3PIRA 2JLQA 1XZQA 2WSSA 4NTZA 1OHHD 2C8VA 4Y0AA 4PO8A 4HB4A 2ZR9A 2PL3A 2CK3A 4LJ9A 4I1OA 2C9YA 2GILA 2GK7A 4BFTA 1WRBA 1R7RA 2DFKB 2GTPA 3ZDQA 1NG9A 5J40A 2BJVA 4RZUA 3PVSA 4DUGA 4P0TA 1G1MA 3T5GA 4NE2A 4Q1EA 3ZH9B 5G3ZA 1D8TA 3NEYA 4R98A 4AD8A 1G4UR 3QF4A 4LJ5A 2BM0A 2F3RA 1II9A 2EFEB 1IN7A 2BWJA 2GCPA 2ZR0A 1GL6A 2BOVA 2OESA 3HU1A 2WJHA 1TNDA 3FMIA 3SFZA 2QMHA 5HKKD 2FF7A 3M4YA 4Q5IA 2RGNC 2V54A 2VRWA 3KX2A 2ZSFA 2RB4A 3EWSA 1E96A 4FW9A 1XRJA 4MKIA 4RD2A 4BRWA 1MH1A 3PXGA 3BRWD 2NO1A 4XH9B 4DB2A 1MO6A 4LK2A 1NVVQ 1UBFA 2W6JD 2UZ3A 3WMEA 1JI0A 4ZO4A 3VHXA 4JZKA 1KO8A 1FX0A 2E9SA 4PO9A 4CEIB 4PZLA 2OXCA 1MO5A 2VA8A 3VQTA 3A6PC 4I1UA 2OSBA 2ZPTX 4AKGA 4B43A 3HJNA 4NYMQ 3IGFA 3X1YA 5CDFA 4A6XA 3THXB 2GAAA 1L8QA 4C0SA 1EGAA 1Z0DA 4JSTA 3A1TA 4HUQA 3BH6A 3GJ5A 1DVRA 1IBRA 1KMHA 1E0KA 1YRBA 1QRAA 3THYA 1TADA 4QXAA 2BM1A 2DY1A 2AN9A 4RFSB 621PA 4Q4AA 1IXRC 3W90A 1O87A 4DCSA 1D2EA 2LCFA 1P2TA 2WKQA 1G16A 2DWPA 2ZANA 4WZ6A 3FKQA 1CBUA 4YMUA 1NN1A 1DELA 3T06B 1E2KA 1IONA 4B73A 1W36B 1II8B 2VEDA 4U02A 4DDWA 4A4DA 4IJMA 2Z6VA 3HPQA 1E79D 4PZZA 1W36C 4O25A 2J3EA 1FP6A 3K0EA 3FWYA 4QM6A 3SC3A 1GITA 3RRZA 4E22A 1EG7A 3EZ2A 3EIQA 5KU1A 4M8NE 4WA7A 5F98A 1Y63A 2J41A 4QHYA 2KBFA 4MYCA 2RGEA 3B1ZA 1R0YA 2E87A 4TL8A 2JLWA 4F91B 2F43B 3AM1A 2Z5FA 2PEZA 1N6KA 2NZJA 5KNDA 5EJEA 4R2HA 2QM8A 1JEEA 3B78A 4TSFA 5KYKA 1MOZA 1ZD1A 3WNCA 4DSNA 2HT1A 4NH0A 4ZIRB 2IYUA 1Z5ZA 2WAYA 2HEIA 3TR0A 1Q12A 1Z8FA 4JL8A 2FFQA 2JIZA 2RGAA 3I61A 1U9IC 2ZAMA 2FPKA 3FFBA 3RC8A 4YDHB 1XXHA 4PHTA 3I5XA 1GZSA 3GJ0A 2VHCA 2AD5A 2ZAOA 2GCNA 4CEHA 4LYJA 2ZI5A 1QVAA 5CK4A 2ZRHA 1T5IA 3X1DA 3DVLA 4TYYA 2BEJA 2OHFA 1IN8A 4HAWA 1EFTA 2JEOA 5KSZA 2ZS7A 2EFDB 4AIIA 1US8A 1JBKA 1E98A 1OT3A 4V0LA 5L3QB 4BFZA 1AZTA 5DGXA 5FPKA 2WWGA 2C96A 2IYRA 3EC1A 3QPWA 4BFXA 3NHBA 1WF3A 2QAGA 3EC2A 3G82C 1SVOA 1WBDA 2D2EA 3SR0A 1G3IA 4A0HA 2ORWA 2REOA 4GFDA 3O8RA 2FMXA 3I8XA 4Q7KA 4OHZA 5SZHB 4AK9A 4KSCA 3CR7A 2G9NA 2ZJ8A 4L9WA 4V03A 2Q9AA 1E9DA 2XOKD 2JAQA 1W36D 2N46A 2V8OA 3T1OA 3QXCA 1NI3A 3CUEF 5HKKA 2Z0MA 1OXUA 5EXSA 2FV8A 1TF5A 3Q7PA 4NHOA 1XZPA 2XSZA 4EPTA 1XCMA 2R9VA 4ACAA 2RAPA 4ZCIA 1XTSA 2AD1A 2J87A 1T8UA 1W4CA 3OHMA 4E07A 3UMSA 3N2EA 4LJ7A 5C4GB 1JAHA 1Q44A 1X8JA 2IYYA 4URUR 3PCRB 3AVVA 1BIFA 4HB3A 4QRHA 4DJTA 1S2MA 4URYR 5HZKA 1G5PA 4RKEA 2BC9A 4A82A 3LA6A 1ZW6A 2J0VA 3GFOA 4PANA 1GNPA 1U99A 2FFHA 4JLAA 2F9LA 1CR4A 2H5EA 4IOKA 3LBNA 4OQNA 4AYXA 5CM9C 2VSFA 5DHAA 3NDBB 3UKDA 1E1QD 3VR2A 1AM4D 3ZGXA 4MA4A 2V3CC 2FH5B 1KI1A 1COWD 2GZHA 3KL4A 4KFRA 1G3MA 1UBGA 4LHWA 1Q1ZA 3IPYA 4P4TA 4JYBA 1E9RA 2DWOA 2ZI9A 3NWJA 5HPYB 1ZAKA 3QNUA 2J5XA 3AKEA 3UG6A 5JZVA 4MQBA 1FFHA 3K0CA 3OF5A 1Z63A 3NVAA 4LPKA 4V02A 2HJGA 1NVXQ 4IOJA 2PLFA 4NYIQ 4Q4JA 4PPGA 1G20E 4LUCA 1JB1A 1G5RA 4JKIA 4LBYA 1SXJE 1XTKA 1OB5A 3SZRA 2H7VA 2B7CA 3T12A 2AX4A 3DMNA 1JQLB 3BFXA 1VIAA 2CEAA 4WOPA 1O3YA 1IY2A 2FSFA 2ZVPX 5FH9A 3EZ7A 3GLIE 1P9WA 3C16C 3DM9B 5L3RA 1UKYA 2PZGA 4YMVA 4DCNA 1QF9A 1V5WA 2ORVA 2QTHA 1E9CA 2FJUA 1QHGA 4XWAA 1OIWA 2QP4A 1XPUA 3TR5A 1Z08A 2PT5A 3DMDA 3U7EB 4IXMA 1RRPA 1KK2A 2D74A 3FFAA 1T6NA 4N0DA 2UKDA 2EFCB 2XTZA 5GJBA 3EASA 2KBEA 3FYHA 3R8CA 2GJKA 2J7PA 3V4FA 4HAXA 2NIPA 3IBYA 4DSOA 2QBYB 1ZNWA 5FR2A 2GZDA 1RPZA 3DPUA 1GILA 1G5TA 3BD9A 1QDEA 2JIZD 5KHOC 1UFQA 2OBMA 3ZVMA 2XZLA 2ZU6A 2G83A 1OJLA 3K9LA 5FL7D 1Z28A 1JQJC 2VLIA 5CLLA 1S96A 1ZM7A 3LBHA 4GSYA 3THWA 4IDQA 1KY2A 2GEUA 2DHRA 2FSIA 1F6BA 3B5JA 4HEJA 1NVUQ 3T15A 4B2PA 4HUQB 2QRNA 2PJZA 3PUXA 4EPXA 3I92A 3UANA 2G77B 3W3AA 4ZKDA 2NPIA 3K9GA 2CLDX 3VR6A 2A3RA 4YDSA 1DG1G 4V0KA 1SVIA 2QT1A 4GMXA 2WM9B 2FGJA 2TMKA 1HQCA 1GTVA 3K0AB 3MD0A 1KSGA 1M7BA 3CKLA 1JR6A 1BKDR 1YZLA 5LB2A 1GFIA 2OAP1 1JALA 5H8WA 3W9YA 4TL6A 1KSFX 3CBQA 3QIAA 3JZMA 4KYIB 2A5YB 4JJKA 5G53C 1XNJA 4PXAA 5CLQA 3RWOA 1ZRHA 4ZDKA 5TMPA 3O8DA 3CRRA 4G3XA 1HE8B 1HTWA 1GDDA 4NKRA 3AVTA 3VKGA 3AP3A 2NOAA 2ODNA 4Q1DA 2NG1A 2K5UA 4C0HA 2GAOA 3MRSA 3B7GA 3AVXA 2XSZD 2IYTA 2O8DB 2XEXA 2IEZA 4M9QA 5AWFC 1YVDA 3RC3A 1XTQA 4O3MA 4IFEA 1G7TA 4ITRC 1ZNXA 4NYMR 4DLSA 2ANCA 3SHWA 5IRCD 1KI8A 1TQDA 1U8ZA 5DI3B 1G3RA 5FOWA 3VU9B 4JL6A 4LDJA 1QHIA 821PA 5M04A 2Q6TA 5FBQB 5BYKA 5KO2A 2GESA 3U60B 4KBGA 4BECA 4Z1MA 1XD8A 1JJVA 5DIFA 1H8HA 1P62B 4RJLA 4GDFA 2VBCA 3LVRE 2QL6A 4L4UA 3K0SA 3MMPA 4KO8A 4MYUA 2BBWA 2G88A 1OV4A 2C04A 2HF8A 4GOXA 3GJ4A 1DBSA 4UNRA 1P2VA 2OCYC 3BE4A 4BLTA 1KK0A 1UKZA 2JJ1A 3LLMA 4WXRA 2J0UA 4F4IA 4Q9HA 1VG8A 4B47A 2JJ2D 3AF4A 4ABYA 1R0XA 2ORIA 1RC8A 3M6AA 4BFUA 3G0HA 3KKQA 1TF2A 2MSDB 1HH4A 3S1AB 3CH4B 4W5WA 4GI7A 2W6ID 4TTPA 2HXYA 3GLFB 2EYQA 3MAAC 5H70A 1NN0A 1R5NA 5HR5A 5JI2E 1Z06A 5HE8A 5J4HA 1FW6A 4BWYA 3OFNA 1FNNA 5L3QA 2JLXA 1N5IA 2V7QA 3E2IA 1A1VA 1S9HA 1JXMA 3O47A 1Q20A 2G0TA 2Z43A 3RSOA 1NVVR 4JVNA 4PQYA 1OFHA 1Z22A 2R65A 1XD2B 3PUZA 4I99A 3LXXA 3TKLA 2WTUA 4B32A 4LJAA 4F4JA 1Y3AA 3NTUA 2OV2A 2QE7A 3AKDA 3KZ1E 1ZUIA 4WIAA 3EZ6A 4BGDA 4GZLA 1G4AE 1RW4A 2FNAA 1SGWA 1NY6A 1IN5A 1XP8A 2G0NA 2LWIA 2PT7A 3A4MA 4Q1FA 3RS4A 4YXWD 1WQ1R 4DRZA 2O0KA 1NKSA 1OW3B 1YZKA 1UKVY 3DEFA 4OHXA 2J7KA 1J70A 3FKSD 2P65A 4UXIA 4WW0A 4IEIA 5KDOA 3K70B 4AURA 3VR3A 1OHHA 1VCMA 5DHFA 4B33A 2O8EA 1DTSA 5JJKA 1HT2E 1FOEB 2C03A 3B85A 3MG9A 4PFSA 5EXXA 3OE7D 2D06A 5JS8A 4P3YA 3NKVA 2FDCA 1E2PA 3AH8A 4QGAA 2GXSA 3U7GA 1G6OA 5CYPA 2WJYA 4TLCA 1ZCBA 1PV4A 4KAXA 5K8LA 1QG4A 4BLSA 3NH6A 3OIUA 1LS6A 3IEUA 2BHRA 5EP2A 4MGKR 2WWYA 2Q3HA 1JR3D 1NNEA 1PVOA 4C9BA 5C18A 4B6FA 4CRWB 3E5HA 4FCTA 1G41A 3MSXA 1CJVC 3HR7A 4G5QA 2EVWX 1EESA 3C5CA 3AVWA 4B48A 1MO4A 4Q01A 4JBYA 3QG5A 4DIEA 4V0OA 1AQUA 3K0CC 3T35A 3OESA 3FE2A 2GEVA 1XMJA 1KKMA 2F55A 2GDJA 2ZREA 3IQWA 5C2JB 1AZSC 2OCAA 1CS4C 5FUWA 2IEYA 3V9PA 1Z2CA 5IK2D 4TMTA 1NRJB 3GLHA 1KI9A 1ONBA 1XFAA 1PZNA 2W6JA 2HXSA 2YZ2A 4HLUC 1E2IA 1M2OB 4MRVA 4TYQA 5E4FA 2RGXA 2VF7A 3B9PA 4XD7D 2L0XA 3AVQA 1NY5A 4PC3A 1E2NA 2ZSAA 5B58C 2DFTA 2H17A 3LFUA 1CTQA 2VPPA 2BEKA 3H0KA 5CIWA 3TGPA 1L4UA 1JECA 2CCJA 1EWQA 3ONWA 1K5DA 4ARZA 4GP6A 1NIJA 1BS1A 2NO9A 2ZS8A 5E7MA 3R9XA 1OXXK 2IWRA 3VX3A 5EP3A 3RS7A 1T0JB 2J1LA 4KJZA 2F3TA 4GZMA 1N25A 1H8HD 4X8HA 1I2MA 2KB0A 2BV3A 2QP9X 2XNSA 4DSTA 4N3NA 2YINC 3QJYA 3ICEA 2HT6A 1W0JD 2LKCA 2EFGA 3KQNA 2IYQA 4QNMA 4IOMA 1WDTA 1Q1QA 2P0EA 3KJIA 1E2LA 4EKDA 4F7WA 1Q3HA 1LW7A 3NH9A 1E1RD 3B1XA 1E79A 2O8DA 2EFHB 5CK5A 1HYQA 1BH2A 2FA9A 4MRNA 3T1VA 3KQHA 1JEDA 1VTKA 5AK0A 1ZNYA 3VR4A 1RKBA 1Z07A 1KI4A 5AUPB 2CMKA 2IYWA 1S9DA 4QNRA 1UPTA 2CNWA 3Q5DA 1OYWA 3EIEA 1VHLA 5E7JA 4ASUD 4S35A 2BJWA 4E5UA 4LGMA 1OF1A 4BLPA 2ZE8A 4ZI2A 5HZHA 3ZYCA 3KQUA 4UXJA 4M0LA 4TYWA 4QGGA 4A8JC 1K8RA 2Q0HA 1YR9A 3KJHA 5UKDA 4B3BA 3UMRA 3D7MA 1RRGA 3NBYC 1IN4A 2I4IA 2P5TB 2Q9BA 1R10A 4I4LA 4JMPA 4RSGA 4A2QA 2GNOA 4POAA 3GP8A 1Z47A 4KFSA 5J5CA 2KJQA 3IDQA 3K9HA 3U7FB 3CIOA 1ZM4A 4GRAA 2X2FA 4BLQA 5DYGA 4YMSA 3RSLA 2QE7D 4M1WA 1GSIA 1P61B 3ZLJA 4Q48A 3VX4A 2CLCX 4DHEA 3ADKA 5EZ5A 1II8A 4PC1A 2OCPA 2XXAA 2ZRBA 2ZE5A 5A4JA 3MWJA 1EK0A 4BLOA 3PQCA 3T1TA 4G5RA 3X2SA 2J59A 1R8QA 2GCOB 2O0HA 3HDTA 2FG5A 2XGJA 4LJ6A 3WXMA 2O8BA 1UDWA 3QVVA 4EFMA 1TQ4A 4IDOA 3W3ZB 4D0GA 4AI6A 2QTVB 1W1WA 3N5CA 5B2ZA 1P6XA 1UEIA 3HYRA 2HYIC 4IVRA 3GJXC 4O2LA 3WP0A 1N6IA 2XZOA 2IA5A 3KQLA 4C0AC 1TEXA 2XNDD 1VIYA 4BFVA 1DAKA 2RH5A 2QU8A 3M0EA 4DCTA 2WWHA 5L8VA 3THYB 2ZRAA 4W7SA 3QEJA 2CE7A 4OK3A 4M1KA 4EAQA 4MH0R 5GVRA 4QKQA 2IBMA 1PLKA 1JNYA 2JATA 3GLIB 3IQXA 4EUNA 3AKCA 1CIPA 5K8TA 4D82A 3TSOA 2IF0A 4HLQB 4QJ5A 3SYLA 3FOZA 4X8LA 3B9QA 4TT3D 2ECKA 1NBME 1E4VA 4PSKA 2IUUA 2KSQA 2GVDC 1H8ED 4NONA 1Z0FA 1NBMD 1T8TA 4DLZA 3H86A 5IK2A 3IIKA 5EZ6B 2D4HA 1SXJA 2V6IA 3FB4A 3IILA 3TW8B 1I4TD 1KNQA 2HF9A 3F3YA 3CNLA 2Z4RA 1XJ0A 1J99A 1R5OA 1SVLA 1ANKA 3CZPA 1Q1EA 1W48A 5DN6D 2QAGB 1R8SA 3GLGB 1BMFA 1QHNA 3QEOA 4B3GA 4HLCA 1AS0A 1CU1A 1II0A 3R20A 3IEVA 2ZRLA 2ZTSA 3RANA 1M7HA 3LW7A 1PLJA 4Q1BA 3X1WA 1XTRA 1E1QA 1Z6AA 4PC6A 4PQRA 4URWR 2IXFA 2G1KA 2WWFA 2B6HA 1VDZA 2Y8EA 2JA1A 4LX0A 4EPWA 4FMDB 1U8YA 1DARA 2JJ8A 2DYKA 2NMVA 3KFXA 3VHLB 4N1AA 3U4QA 1N2CE 4OKSA 3GFTA 3W6NA 3QOFA 2OBNA 5KSOA 1J7KA 4HZIA 5HTKA 5JLJA 4UNNA 1KTVA 5KSPA 1F2UA 3HYTA 3EPJA 2FX3A 1CJMA 4OHYA 1HEIA 4JSYA 2IWHA 3AUYA 5GJCA 4AG6A 1CR0A 3SJBA 2ZUDA 1H65A 2GEDA 4UJ5A 4FMBB 2XAUA 3MJHA 4OHWA 1OKKA 2EWVA 5ANRB 4B75A 3L82B 1KI6A 1AKYA 1ESMA 2CHVA 3EPLA 2QTFA 1KHTA 4DT1B 1Z0AA 3CWZA 2ODEA 4FMCF 3WYGA 3BERA 1FUKA 4L15A 4TWZA 1NKTA 3CONA 4TZ6A 1XMVA 1EFRD 3Q3JB 4TMVA 2WBLC 4BZPA 2QORA 2HLDD 5BQ5A 1DAEA 4PC2A 1T9HA 3C15C 2ASEA 4Q9LA 5JECA 3SEAA 3L43A 3W5IA 2BMJA 1E9EA 4XOIA 1NLYA 2J7PD 3FPAA 4EPRA 2CHGA 4OK6A 3VR5A 3ZZ0A 3ZVRA 4F93B 1ZIPA 2VP9A 2IL1A 3RYTC 1KDRA 2WSSD 1S1CA 2WHXA 3CH5A 1S8FA 2O8FB 1X1RA 1M6NA 4AYWA 4ZV4A 2YWGA 2IK8A 5JWOA 4HAYA 2PMKA 5DISB 4Q4AB 4NZYA 2OBLA 1C4OA 1B23P 2C9CA 2G3YA 2HCBA 5FBRB 1U94A 4IW3B 3UK6A 4DUGD 2Q9CA 2QRZA 3A1UA 1C1YA 3F0TA 2IS4A 1MABB 3RS0A 3I73A 2BCJQ 2QAJA 3IUYA 3QY0A 3EX7C 4H1VA 1LNZA 2IF2A 5FOXA 3TK1A 1EXMA 4EQ6B 4LYHA 3RDPA 2ZI3A 2GBLC 4Q4HB 5DI9A 4G5SA 3ZD7A 2A2ZA 2R6CA 3B1VA 1UF9A 5CDFE 2ZU0C 1GRRA 2YJTD 1DAGA 1CRPA 2FZ4A 4QBGB 3A1VA 1E9FA 4J0QA 1OE0A 3WMFA 3LH5A 2J0UB 2FFBA 2VHJA 3FHOA 3Q7QA 4TLAA 1DAMA 3X1XA 1E2MA 3MJRA 2F1JA 2QSYA 1VMAA 2RMKA 2AHOA 1VHTA 2X8AA 1QG2A 4DEXA 2IS2A 4PZYA 3GLFA 1JAIA 4WZAE 3CX8A 2IT1A 521PA 1G6HA 1ZUHA 1CJKC 1NLFA 3OAAA 3KJGA 4ESHA 1KSJA 2Q3MA 5CITA 3WY9A 1IJEA 2FPMA 1N0VC 3KUDA 3LD9A 4MRPA 1D2MA 2DCUA 1G291 3QKRB 4K81B 5C46F 2EYUA 1FNMA 2ZQ5A 3ADBA 4KLZA 2XZPA 3DO6A 1E0AA 4OL0A 2W00A 2I1VB 4OQLA 2FE4A 4OQMA 2FPLA 1TMKA 1CULC 1SVSA 5JWHA 3SQWA 3PEUA 5KPJA 1R0WA 2OUKA 1G8YA 3WRYC 4MGIR 1NP6A 3OEEA 4F4CA 3SYNA 1AKEA 4HYYA 3VAAA 4A6PA 1OFTA 3KQKA 2EQBA 1FQJA 3AF1A 1RYHA 1UBEA 4RY2A 3KJEA 1NMYA 2FEOA 2QY9A 2V4ZA 4IDPA 4C30A 1ZJ6A 4TLDA 3ADCA 3PR1A 2YC4C 2R8RA 2QPAA 4H1UA 2VH5R 3SI7A 4LYAA 4GOJA 2CDNA 1TQ6A 1FL9A 5DO9A 1DEKA 1NLZA 4B76A 3BH7A 5FI1B 5JCZA 5EE1A 1GKYA 2BMDA 2GA8A 1IJFA 2W6IA 2JLVA 1S3GA 2ZETA 3P4YA 4DZZA 5JSZB 2KI5A 5HCNA 4ZI3A 4LBVA 4DDTA 4URXR 3C14C 3MLEA 4C0QC 1T5LA 3D8BA 4PR0A 3SHFA 4LZZA 4DB4A 2WV9A 3OZXA 3EPHA 4Q00A 1OH8A 2BKEA 1YR8A 3LVQE 3UWOA 2CLSA 5E95A 5FPSA 1XPOA 3Q5EA 4I1SA 2UZIR 2R6FA 1XBTA 3R8FA 2QZ4A 2ZS9A 4CEJB 3PEYA 3P4XA 1FTSA 2XTNA 2IW3A 2IUTA 221PA 3TIFA 3AVPA 2WWXA 1TEVA 1Q22A 1ZBDA 3EZ9A 4MYHA 3CPJB 5BN5A 2ZVQX 3AP1A 4PO1A 1E2JA 2R6DA 2QENA 3FKSA 3TNFA 1W4RA 1Z6TA 4DLRA 3DDCA 3P32A 4JLVA 4LOAA 1V43A 3LNCA 4MUAA 1E94E 4ACBA 1WB9A 4AKHA 2VSXA 4RZ3A 4LC1A 4YC7A 1DS6A 1CKEA 3LO5A 2WWIA 1VYVA 3DL0A 1ZU5A 1Z29A 4M22A 2WOJA 4US1R 1KO1A 4NCKA 5LDDC 4FINA 4MDEA 3KTAA 2YWHA 3OEHA 1JR3A 4GMDA 4M21A 4B3CA 1A2KC 2RCNA 1NJGA 4JVSB 4GL2A 4JS0A 2RGCA 2BBOA 4KFTA 5KUTA 5LBIA 1YRAA 2ZE7A 3PEVA 3ASZA 3C4JA 5A0FA 5JSZA 2QGNA 3V4RA 4B3DA 1T3SA 2YWEA 4OYHA 4FD2A 5J4KA 4DKXA 1P73A 4MRSA 3TE6A 1AJEA 3ZS9A 4B6EA 3K0FA 3CR8A 4W5JA 1NIPA 1ODFA 4C2TA 2NGRA 3B1WA 1IXSB 3HWSA 3ZJYA 4XWOA 3ADDA 1KDTA 1D9XA 5JRJA 3DOFA 3A1WA 2NO0A 4QOSA 5FL3A 3AKYA 1EFCA 1M7GA 3TSZA 1E2QA 1G9XA 5EE5B 2ZJZA 5FOTA 2CL7X 3ZZUA 1KI6B 3CRW1 1I4LD 2GCOA 2OT3B 3H2YA 2WJVA 4DVGA 2IC5A 4AY2A 4PAOA 2W0SA 4QG7A 3QKSB 4IHQA 3RRNA 2VP4A 2GWHA 1J8MF 4P33A 1ZCAA 4JT4A 5DNYB 3BB3A 4FCWA 4IDHA 4L8GA 2Q21A 4BEBA 2GJAA 2F7SA 3A8TA 3W6PA 5FBWB 1X8LA 4TL7A 1DAHA 1E4YA 1GAJA 2JDID 4LYFA 2ZI4A 4RD0A 1XU4A 4BFYA 5EXTA 4HAVA 2GK6A 4XIGS 2W0MA 3EPKA 1G3QA 1G8PA 3THXA 1U90A 1YZGA 1XDBA 2WPDD 3K70D 4Q47A 3GJ7A 5KDDA 2O8BB 4N0EA 1LF5A 4CVNA 3L8ZA 5EQTA 1J90A 5BWMA 4IXNA 4TMZA 4IVPA 1W0KD 3PV0A 4OI1A 1G7SA 2ZJAA 4LJ8A 1FTNA 4LV8B 2C5LA 1KI3A 2A9KA 1OH6A 4DSUA 3CX7A 2W2VA 1XJQA 3I62A 2JLSA 3FHTA 4TQAA 1GVNB 2ZRCA 2RGNA 4C2UA 1UEJA 1GOTA 1SQ5A 2MSCB 3C8UA 3QENA 3UXMA 5E3HA 2V1UA 1SXJB 3I72A 4FN5A 1XEWX 4A0FA 1GM5A 1P2UA 1P3JA 2GXQA 3NC0C 4XTCS 3RNLA 1SXJC 1DO0A 1IY1A 1OH7A 4FCVA 1N6LA 1TQ2A 2ZRNA 3SOPA 5FBVB 3RS3A 5DSZA 2JLUA 3HPRA 2XB4A 4HATA 3ZZTA 1AQYA 1UKEA 1G17A 1GKIA 4C7OA 4MGYR 2ERXA 2G1JA 2PJRA 2ZSBA 4K46A 1P2SA 4O2RA 3Q85A 3BGWA 3CF0A 2ODWA 4Z8YA 3SBDA 3SDZA 3U5ZB 2JGNA 3TUZC 2RGDA 3SNHA 2A5FA 2YKGA 3W34A 5J4VA 4P31A 2QPOA 2ZUBA 2R6GA 3QKRA 4CW7A 1VKJA 1KYIA 1E0JA 3ZD6A 3H1TA 1PLLA 3LW8A 3SJCA 4P4UA 4US2R 2YYZA 1KMHB 4CT4B 3AUXA 4UXHA 1YZUA 3W6OA 2QQ0A 4DLUA 1W49A 2X2EA 1KDPA 4C0BA 4MKFA 8OHMA 4HUTA 2OCBA 3TQFA 4EJSA 3V00A 4ZIRA 3BWDD 3H84A 1AK2A 4XSGA 2CL0X 2F1IA 3CRMA 3DM5A 3OIWA 4MDFA 1HY3A 3HR8A 1L2TA 1ELOA 2QSZA 3KB1A 4GBMA 4O0MA 5DH9A 4LJ4A 5FUVA 4TQ9A 4A2WA 3NIBA 1GRQA 2ZRKA 3DZDA 1RVDA 3OEHD 2JLYA 1SULA 2PX3A 4M1MA 1RZ3A 1D6JA 1DG3A 2R2AA 2ZRDA 5D3MA 1ZIOA 3GMTA 4RD1A 4RCZA 2BMFA 2QA5A 3VKWA 2W2TA 4M2LA 5G3YA 2C2HA 3S1AA 5SZJA 1W4BA 2IHBA 3QE0A 1W44A 2B8TA 1OIXA 2PEYA 1XD2A 1G8GA 3QXSA 5FR1A 1IHUA 4V0ME 3RLFA 3GFPA 1KJWA 2FEMA 1DAFA 2BVNA 3GJ6A 2BBSA 2ZXUA 4DT1A 1WXQA 4LSGA 4XVRA 3GJ3A 3L0PA 5DYIA 3BB1A 1VCOA 2F43A 1Z6YA 2KE5A 5DN6A 1KSHA 4ERNA
chains in the Genus database with same CATH superfamily
2OV8A 2FXIA 3D6VA 3BJRA 3ZVKA 1L7QA 5T64A 4F1WA 4Y9RA 1PUJA 3C98A 3HVIA 4BKPA 2K7FA 3DTVA 1N2HA 1OREA 4PYMA 4UQLA 1EJ6A 4J7UA 1REQA 5EIOA 4BAUA 1S1MA 1KQOA 5HUJA 1E0SA 1YBVA 3VPDA 4E1BA 5EHGA 1KDOA 2FP3A 4HMOA 1EK2A 5KOYA 5JNUA 1AGPA 1TM3E 4P8RA 5TQ0B 1MBZA 4R2IA 2X0DA 3UFXA 4UOZA 1UFRA 5JH7A 3CEHA 2PGXA 3KOYA 3WP1B 3PD1A 3PHHA 3PGA1 4F5YA 4D46A 3QMMA 2AXEA 3HNRA 1GLGA 4FYMA 3M6IA 4C0WA 5KPDA 3PVZA 3N8IA 4M98A 3MJ4A 2NQ2C 2WFLB 5LD2B 3DEAA 2AWOA 1U1EA 2PYIA 4MIEA 4IDNA 5JZ9A 4W9MC 3DQZA 3IR6A 2R4UA 4G0MA 2PR2A 3EGWA 4G5FA 2SICE 4BRUA 1Z12A 4JLPA 4N18A 5C1BA 5GJVC 1KIMA 1GNRA 4QYSA 1A5TA 2BKXA 4BAGA 2O2DA 4MV1A 4CM4B 5IH7A 1E58A 2WW8A 1Y8AA 2VSOA 2QX9A 4Q93A 1TO2E 1UFKA 3Q8WA 1UP6A 3WGLA 4EBBA 2WZCA 5H4GA 2QR2A 4EUSA 1H0RA 1W59A 1EX9A 1YRWA 1Q3KA 2B1GA 3ANYB 3JU3A 2PX4A 2VP0A 4RGVA 4WFKA 4HGNA 2EL7A 5EUCA 5LDHA 4NIMA 3LF1A 2NU6A 2CFRA 3HU3A 2IE8A 4BMYA 4HWSA 2VAXA 5FO0A 2VYND 1V8ZA 3I6BA 4ZJPA 5DI3A 5I7OA 1U0HC 5CA0A 5KQLA 3LKZA 5JI3E 4KRXA 4YRAA 5M7EA 4GXRA 3MUFA 2Q7OE 5I3ZA 2O23A 1JG3A 3ZK8A 1NFRA 5I7EA 3EVTA 4HEQA 3TQRA 2EBFX 4DTIA 3ERCA 1GAQA 4MVCA 4BB9A 1NVTA 4GT1A 4BU0A 5ELMA 4E2YA 4F21A 5AM4A 4D9JA 1L5HB 5KOIA 3P45A 3A6KA 4GEKA 5D6NA 3MYYA 4LXYA 3I4CA 5JEDA 3WGQA 3IMCA 2MWMA 2QRMA 2DR2A 3DKKA 2OLKA 4LC9A 4LMPA 1OXTA 4NRDA 2RONA 1S2NA 4JUIA 1GNTA 3AVYA 3KO8A 2CV0A 4JI3B 5K0BA 2QLBA 5GPBA 3HU2A 3JARA 3U3KA 4YLGA 1OZ0A 2FUEA 4BNFA 3B53X 3SLRA 3IPXA 3IOEA 3UWDA 1MORA 4RPCA 3LWNA 1KS2A 3EW9A 5DRYA 3RYIB 3C6ZA 3UIEA 3GDFA 2G5GX 2BEVA 4F1KA 2WI8A 2HA7A 3PXAA 2F8MA 4DL9A 2ZG6A 3D0KA 5ALYA 2A0XA 2EF0A 3TUIC 1MV8A 3A4TA 3A9SA 2OB1A 4Q9NA 2O5VA 4PCLA 3FI9A 1E77A 1RC0A 4IDBA 4JLBA 2GF0A 2RGYA 3L07A 4KGZA 4PO3X 4LNUB 1I1NA 1QLWA 2NO6A 4GMFA 1DQZA 3TD6A 4J7XA 3VZQA 1J1UA 5CPFA 1ONNA 2CMHA 5F77A 3EUFA 2F1HA 3FPEA 3HCBA 4M1YA 4E5PA 3F46A 2CKMA 5JXHA 1FUIA 5FPHA 1ST2A 3TBKA 3ZCPA 4ZFNA 3ESQA 3FYUB 3BXEA 3MCWA 1F0PA 1IQ0A 2R96A 1OBCA 5CEJA 5HQTA 1XEXA 3OMXA 5CBKA 4A27A 3WDSA 4PQEA 5F73A 2XD9A 2GXAA 1RMYA 2EQAA 2XOXA 1N0WA 2OXTA 1MEEA 2XNCA 3JASA 1JZTA 3EXFA 4PPYA 2XKBA 2VCEA 3VOBA 4CYMA 4L57A 4AYTA 4TWRA 1Y6QA 1X2EA 2CXSA 4CLEA 4FOTA 5EHZA 3RUFA 1Q1BA 1UM8A 3BXHA 2AFHE 2WJJA 3W0LB 3TIGA 3WWPA 4F38A 4POOA 4ZMBA 1PFVA 4JODA 3WMWA 1U2EA 1TJ3A 1TA4A 2O3UA 3A10A 3OETA 1QAMA 4M1SA 2JD2A 5FADA 5FFMA 3HL0A 4OM7A 3TLZA 5F9FA 1L4FA 3T34A 1TAGA 4MW9A 2QG6A 1R37A 1QB8A 3KEQA 3AOGA 1V3QE 1E64A 5A3QA 2AE1A 2ZIZA 1W94A 2HO4A 1B0UA 2PRIA 2YV5A 3V33A 5CHEA 5KI6A 4UDYX 1OWMA 3FN4A 1F9AA 5FTNA 1J21A 2HA4A 4HC4A 2QSUA 2YHIB 4LJYA 1Y7TA 4I8IA 3ZK7A 4EQZA 4MVJD 2L82A 3UHFA 3FTQA 3KFVA 3OIVA 1XRLA 1SCDA 1EQ2A 3RYIA 3ZE6A 4B3SB 5I5EA 2F1RA 1GG2A 1Y3DE 1DC8A 2PZFA 4JGGA 2A30A 2ODAA 3AGPA 4FX5A 1C4XA 4RGBA 2Q7XA 1T0HB 3QWBA 4TTRA 4PG6A 4B85A 1ULSA 1XZDA 3JQGA 3TFWA 1DQPA 3IHWA 1DJOA 1K98A 1XCGB 2HF7A 1L4KA 1S89A 1RXYA 2RGBA 3HFGA 4LXUA 5JBIA 5FTJA 1PTJC 2VA9A 5KJFA 3DR5A 3OFVA 1AKMA 2OTCA 4FWIB 3TN7A 3WLPA 4EG3A 4HGOA 4KQ1A 3FDZA 4GO1A 1YA8A 4EG1A 4YRMA 2ZXFA 2YL2A 4LV5B 3H05A 1F8FA 4GX2A 5LUBA 4BKRA 1FP4B 3E81A 3EH2A 2OXEA 3JALA 3I42A 1NKVA 4ZCQA 1PJAA 3HSSA 2CNKA 3W7AA 1KK1A 3I8OA 2O7VA 1BHSA 3E5NA 1T1JA 3TQCA 3OY2A 1UODA 4Q03A 4ITVA 4UMDA 3E03A 2DECA 5IN5A 4F2WA 3FTNA 2MYUA 4GPZA 5EMKA 1C8KA 2D5CA 1AKTA 2RGUA 4ILEA 4UUQA 4WD3A 3LX5A 5C0OE 5JDIA 3F3SA 1T3ZA 1D0IA 5DW3A 4MROA 4OXRA 5JRZA 5KWEA 1GTJ1 1N2EA 4RWEA 2CHQA 1V48A 1HEUA 4FEEA 4LY0A 2VK2A 1CUGA 1YE8A 2GFIA 4QODA 2ONKA 3WYAA 5DLYA 2D62A 5ALTA 1IY0A 3NPAA 2I54A 3PYLA 4BP8A 5HYVA 1ABBA 2D4AA 3QVKA 4WOKA 2LKDA 3ZWOA 4GF5A 5KVAA 4OQFA 4JJ8A 1MX3A 2WIKA 1M0SA 1A8HA 4Y6OA 2RHJA 5IYZB 4CR6A 3RWMB 4AUMA 1PWZA 4S04A 3AFOA 2AZDA 1D4FA 4B79A 2HR1A 5B12A 1KZYC 3B5EA 1B8OA 4JX9A 4RV5A 3M7IA 5M2QA 1JXAA 1OPXA 3RB8A 1E7SA 3RTBA 3ZEIA 4TVSA 2C78A 1KAMA 1GG5A 4KKVA 4AX8A 4CNBA 3K05A 2ONJA 4EITA 4GSKA 4K1XA 3FOAA 3D6TB 1VJ0A 2G4CA 2W58A 1IFXA 3DHYA 1DINA 1KC1A 1IRIA 1GSOA 2BUCA 2ZPUA 3KK0A 4R8LA 2RD2A 4FMDF 3GJRA 4DIBA 2ZJ7A 3ND9A 1REQB 4KODA 3GGJA 4RDCA 1T8YA 1Z34A 2Q0SA 3VTKA 4LF5B 3HWWA 3NG1A 1K0UA 2WIJA 1XF9A 2CVQA 3ANTA 3L79A 1JLKA 3AL0C 2V4UA 3L3BA 3CC8A 5A0VA 4K9LA 4KDRA 3HGMA 1Z75A 4DREA 4F4UA 3USES 4X3PA 4NEHB 2FFJA 3BL6A 2OVBA 4RCYA 4TGLA 4UNPA 5HILA 4OB8A 3DHNA 4UNSA 3NP7A 5FUQA 1YS7A 3D1LA 4XVUA 4W5RA 2JCSA 1XHFA 1RXWA 3D54D 1U7OA 3GD7A 5KX5F 2YNMD 1Z4KA 4C5BA 3AVUA 3O94A 3KDSE 2WICA 4OK5A 2FWBA 1Y4AE 1MA0A 1PT7A 1P72A 5AM3A 1NONA 4X3OA 5HW0A 1Y9DA 3H18A 3KOZA 4DLLA 1QQBA 1VLQA 1RHKA 2YTZA 3A25A 1CHNA 5FEMA 3UO8B 1N6PA 3NXKA 4LRSB 5JNWA 4UULA 2DWQA 4H7IA 2LDXA 5KWIA 4ZA2A 2H0RA 3LLUA 2HQOA 2TMDA 3AVOA 1NUSA 4KPGA 4EHBA 2QMEA 4RGQA 5DLQC 1URPA 1YZFA 3T7JA 2BJHA 1HFJA 1WAMA 1U2GC 1GU7A 2HLPA 2O8CA 1XCOA 2NU7A 2YJ5A 3WLFA 1KGDA 4H7EA 3LLVA 2IS6A 3RADC 2ZSDA 2O8FA 4XCQA 5DLDA 3K8YA 4HWOA 3U3RA 4DIDA 3JTEA 1FVXA 1RI1A 2YW2A 2MMCA 4DMHA 1XAGA 3F5FA 2ERYA 3H42B 3R5JA 2V6BA 5LB4A 1E1RA 4UE6A 1OXVA 2RI0A 3OE5A 1QH0A 4UVIA 4ADSG 4RSRA 4UD2A 1CDDA 2ZP1A 1PEYA 4EJSB 1OA1A 1FXWF 2QF7A 2Z09A 5CJPA 4CNQA 4Z2AA 3TOZA 2C98A 4NR0A 5B36A 3U3DA 1GNVA 2GZAA 3V7UA 1LTHR 5FLXA 2P90A 1EK5A 4ZU1X 2FZLA 1BC5A 4C07A 4C7XA 1DEXA 1BRMA 1JEOA 2HA6A 4RNDB 4X8OA 3CINA 4BU1A 2H4YA 4DILA 2B82A 1DJQA 4PZ0A 4DW8A 4KCGA 1SA0A 1HK7A 3WGOA 5F7XA 2DB3A 1M2EA 1GL3A 1LNQA 3E70C 3EZYA 4HAUA 4IP0A 3RQIA 3T9DA 5I48A 1V7CA 2R1VA 5CA1A 2BTQA 2H92A 4Q05A 5TMEA 1NRWA 2FP4A 5J5AA 2V7QD 3TEFA 4YMTA 2B83A 1HWYA 1AGRA 1F2TA 1UJ2A 1OH5A 2I6QA 1KVRA 4XUCA 1TVCA 1OKKD 1GDHA 3WQSB 3BFVA 5ALUA 4Z49A 4QOFA 3ZKAA 3GUVA 1CYEA 2H11A 4JIMA 4YRZA 2HRCA 1T1SA 5D3ZA 3WLJA 3QVUA 2IOFA 2CMFA 4HSEA 1RLTA 2HUNA 5TXGA 1NGSA 2EZ8A 1SCJA 3JWPA 4F5DA 2C82A 2WU3A 5DM60 1JU9A 1SBHA 2BFAA 2ESRA 4Q02A 2VJPA 1K6XA 1GRVA 3JS5A 2GPWA 3GQBA 4QM7A 4CMIA 4HN2A 1ADGA 1OU0A 1GR0A 1L5OA 3I6IA 1T4CB 4M7WA 3UUGA 5KTRA 5KS2A 1X1SA 1WCIA 6YASA 3OZSA 3IOMA 4OP3A 4JUAA 2GX6A 1SCUB 3WFIA 2Q8NA 1G19A 4Q4JB 5A4AA 1VJRA 1XYYA 4NX2A 2XYPA 4MW7A 3WLRA 1M0TA 1W2HA 2XNDA 1MRNA 2JGMA 3SHOA 5F7JA 4GICA 2H1FA 3RLIA 2PGOA 3EQ7A 2A78A 3P2OA 4P32A 4QL3A 3HE3A 4G86A 4AWXA 2J9RA 1Q0SA 2OZPA 2SCUB 1NZFA 1WSWA 1ATIA 3K8QA 3M1IA 4JSRA 4P3PA 4HGRA 4WNAA 1LKZA 4OAOA 4RELA 3SIPA 3WSVA 3VYTB 2XA2A 3QF7A 5A3VA 4MO2A 1GUAA 2PPLA 4R5HA 3AHIA 4BO5A 4I3HA 1EWTA 1QLJA 2YXPX 4OGWA 1Q0HA 2C42A 3NHAA 3H4MA 3D43A 4JUCA 1P33A 2RKOA 1Z73A 2B0JA 4MP6A 5K6AA 2FFAA 3M1LA 1I1HA 2QYSA 1BX0A 2VKQA 4YMLA 3P27A 1NBMA 1IB6A 3SX0A 1U1DA 3SBEA 1SXJD 2CXNA 2IX3A 4HH1A 3IT1A 3LUKA 3EZGA 4MGZR 4BX8A 3K73O 3W8NA 1KS9A 4IG9A 4MUBA 1Z68A 4BMCA 2D0IA 4P98A 5AJYA 1J2EA 3ME5A 4U9UA 2O54A 3VNUA 1JFFA 4BN4A 2NUBA 1KK3A 3JAKA 4FGKA 5B64A 3CE9A 4JJ7A 2O2IA 3GQBB 3I0ZA 3MINB 3KL2A 4XEUA 3BQNB 5LBTA 1TU4A 1PJ3A 4C6TB 1LC3A 3PNBA 1KQFA 3ZWCA 3INNA 1JLMA 2A7QA 2XTAA 2AEJA 5HF6A 4G1UC 3ZE1B 3DB2A 3NI2A 2Q4OA 3QG1A 1US8B 2BFFA 3FNEA 3LT4A 4FLMA 4O1HA 4UTXA 3PK0A 4K8OA 4JJZA 1FJHA 2DQKA 2ZEJA 3SIXA 1SVMA 2AUTA 4E70A 3IBSA 1QGED 1SHZA 4NPHA 5ETJA 3W2HA 2WYIA 2ZWAA 1U7XA 1A72A 3AI1A 5DRTA 3FTCA 3WWCA 4N48A 3VNRA 1YQEA 5AJUA 5AKGA 5A5EA 1JHVA 4BDSA 2WQ7A 3VU3A 1LQTA 3KAJA 4K86A 2ORYA 2Z3ZA 4LXGA 3QLVA 4JR2A 1DCMA 2W83A 3KUCA 4WA8A 5DWQA 5EPUA 3PEFA 5F52A 4EMTA 2WUWE 3BGSA 4M9ZA 3RRMA 2W2OA 3I5YA 4PM4A 1EB9A 2FPWA 2BE7A 1XLTC 1ABEA 5K3BA 4ID9A 1KR2A 4E5VA 3B3QA 4GVLA 3BWEA 1GG8A 3EVFA 3FPLA 1F8XA 4A6DA 4F9GA 1U2SA 4NPCA 2DLDA 1JIIA 1KO5A 2A3NA 2IEAA 2AX3A 2R25B 4YACA 3V5NA 1WKBA 4M76B 1SPBS 4CLOB 4F4FA 3TTUA 5CFLA 3KAQA 4NYJQ 2FPPB 1GA1A 5K0ZA 2VZLA 2X9GA 4QOEA 3V9AA 4PWYA 3E18A 4ZRNA 5BUSA 4KGDA 3CNEA 2Q46A 2QJTA 5ALIA 3FAKA 2OFXA 3MZ0A 4HQLA 2IS1A 5KTSA 2HRRA 3LCJA 1SKMA 1IEVA 1QYCA 4CDRA 4KYUA 2X3UA 1R6VA 3IAHA 5FOUA 4FQ8A 3QVSA 2XRMA 1KVUA 3E9CA 3K1JA 4NBWA 4Q39A 1U0RA 2GXUA 2FW6A 2X0KA 4KI0A 5GINE 1VPLA 2V9CA 2ZUCA 1A82A 3AHEA 4PHHA 5TR9A 4EF4A 1RXUA 5DYNA 1RDFA 2PSFA 4OJKA 5ECYA 4NVRA 1MB0A 4MS1B 5EFZA 5CDTA 1OFIA 3R7WA 1LRKA 3H4TA 3N9IA 3NAZA 3UKJA 1JPNA 1P3Y1 1PJTA 4RAOA 5DNWA 2WWWA 3OTIA 1Y4UA 3EARA 2DUUA 3BSSA 3D4LA 4FFPA 1DWUA 1IZ0A 3AR2A 3RIGA 1XDWA 1GV1A 4ZHQA 1CZKA 4BVKA 2PBRA 3H9JA 3ZXIA 2AJLI 1Z3CA 2NTJA 1LTQA 3DGFC 3KLBA 1NHWA 2IQ5A 4L3VA 4QYIB 4R31A 5CVEA 4YRTA 4AJ9A 5JCXA 3ELBA 3U5TA 1M2JA 4F3KA 1H2XA 3ADOA 4N6OA 1TVEA 2BF4A 3ZDCA 1ZU4A 2QJWA 1AN0A 2HQRA 3IUNA 5HHTA 4KAAA 4B7CA 3OQJA 5FJIA 3VBCA 4BEWA 2JLRA 3H7IA 3RAEC 4A91A 4MKHA 3QUAA 4DANA 4WACA 4W5TA 2IPAB 3ACBA 3OCUA 5H81A 3CCCA 3RM3A 5A9RA 3MWKA 3ZVNA 3LQ2A 2Z2JA 2X1HA 4E4TA 1Q7RA 1ZMOA 4XWYA 1OI7A 1NAHA 3ID6C 3PLRA 4Q7MB 4KV7A 4Q9AA 1QANA 2H3EA 2HA0A 2YOHA 1V1MB 4N0MA 1Z35A 2X8WA 3DMRA 4RTNA 3N87A 4WJZA 1MG0A 2Q99A 2ZJ2A 4K9DA 4MZDA 3PXEA 3EDRA 4BASA 4C05A 5K3EA 5C5CA 4N0QA 3H8VA 3PENA 1NNLA 2ZJ0A 3GIWA 2OO3A 2RJOA 3UOWA 5JNVA 3R0JA 3VH2A 1E3EA 4XCVA 1R4NA 3ZI4A 4GS5A 2JGJA 3GLHE 4CFZA 1QO0A 4BTLA 4LFAB 3TLJA 1S4QA 2YVQA 3EEOA 4P5PA 2HWKA 2P1DA 2JLBA 2P4SA 2OSVA 3KVVA 2REXB 2HJVA 3IB3A 2GYUA 3IPLA 4Z1OA 1N6RA 4QBTA 3T5DA 1NN3A 2C9BA 2JHPA 3NO4A 3TVTA 4NCAA 1PJRA 2E1RA 3BAFA 1CJTC 5CBPA 2BHLA 2OV3A 1UP4A 1HRKA 1WUTA 1X7ZA 2LCIA 3C97A 3DOEA 3KZCA 3VSEA 1LV7A 2H2AA 2QK4A 2VRNA 1LBQA 3K9NA 1BWQA 1E9SA 3MCAA 2GERA 3K15A 5FWAA 4BGIA 3W8RA 4GKKB 4MAAA 3Q2IA 2IXAA 3V34A 1BOFA 1VPVA 4XQGA 2FRDC 4H0NA 4PLPA 3U19A 1DBIA 2ACKA 4KXWA 3ORHA 4ENTA 3U9TA 2OENG 2C83A 2VDWB 2YASA 1Z4MA 4M0DA 3O5AA 4RIEA 2QD3A 3C2QA 4EB6B 3WIVA 4FSDA 1VPWA 2B8EA 3NTXA 2PYZA 2XNKA 4QSMA 3D6UA 1Z7GA 4PS1A 4IJUA 1UFVA 2Q2QA 2ZVJA 3IAEA 5JAQA 2UVPB 4CI9A 4EHHA 1L4MA 4MRRA 4DIOA 4QASA 3C3PA 3THOA 2P9TA 3VPHA 2AVNA 2FY8A 2NVBA 4Q7LA 2WMOB 3N2IA 5B55A 5BQFA 5JYCA 3AERA 4I2NA 4I5FA 3R4CA 5JAPA 4MUNA 4RQBA 4YDRA 5EMHA 5CYGA 1P4SA 2AG8A 2XUZA 2OE2A 2DRIA 2DX7A 2OYRA 1CP2A 2M6KA 3GPDG 1XX6A 3RBXA 5BW8A 5IJ9A 3BFKA 3VO9A 1N7IA 3IHLA 1PL8A 4P5EA 3J7TA 1T4MA 2C07A 2CJWB 4KV9A 1GKLA 1PT6A 1TMYA 1N6HA 2JL1A 3KE9A 4GYJA 1D5CA 2HCJB 3FCUB 1NVMB 4HYTA 2NSYA 4HNTA 1YK1A 3AIOA 1N4AA 1N5DA 3T5TA 3HDYA 4B2LA 5HKOA 5E1MA 1ST3A 1JFLA 3LV8A 1G55A 3N0XA 4ENRA 1JAZA 3VTZA 3DE2X 4DUZB 2VDLB 2JCVA 4LI3X 5ENZA 5CW1A 1O95C 4CQMA 1P7CA 1UC4B 5FKJA 3U4CA 4A3SA 3T1HB 3AY0A 4QQ8A 4JKYA 4WXPA 1O97D 4HDCA 5DBOA 1YWGO 4M9UA 4Z7JA 3ZBUA 2J3KA 4A0RA 3R3ZA 1KFJB 1JJFA 2WA1A 3ZHTA 1ZLXA 3R5TA 5T6BA 4AXBA 1KJIA 2QZZA 5IDYA 3MGKA 3CEJA 3D9QX 2D7JA 2RSLA 3UK7A 4EJ6A 4AUEA 4RLSA 5BXQC 1AHNA 1NUHA 2DBZA 3CW9A 4OM8A 4RZIA 3LFTA 1NF3A 2P3QA 3NDJA 2J0QA 3IP1A 1Q21A 2O7RA 1L9XA 3SM3A 3A4NA 4I46A 1YQQA 1JHYA 4K7JA 2OHXA 2BFEA 4BCDA 3DKPA 3PXXA 4H7DA 3O8CA 2FEAA 3UEOA 4MIYA 3B60A 2HCTA 4KZPA 1F3OA 1XXHE 1L9KA 1R0SA 4XDHA 1HBJA 1N0HA 2WMDA 4J2OA 4BO0A 4YAJA 1Q6YA 1AV6A 1EDZA 4BPBA 1ECPA 4Y98A 4TV9A 1XDSA 2Q28A 4AY6A 1PQPA 1ZSNA 5LZ8A 1ILEA 1S8OA 3MWDA 4ZGGA 2NP7A 3AJRA 6GPBA 3AIMA 2GPJA 1Z4LA 4AFNA 3JQPA 2N42A 3KYDB 1EVZA 2DUMA 3E2PA 4B2YA 3M34A 1Y3FE 1G8FA 2G6BA 5F12A 3QW2A 1RI4A 1QVZA 2B92A 4YB8A 3IERA 5T67A 4DA8A 4F9TA 1BHJA 2UYGA 3AQIA 1M8PA 1FFDA 4EFDA 3BDVA 1I4DD 2J3DA 1F2UB 2G36A 1KMCA 2OLJA 5BMVA 5HIAA 3B8HA 3SQNA 3ZWXA 1XZNA 1IAQA 1ZD8A 4IBOA 2AG1A 2X0RA 4BS9A 2FSVC 4A1FA 1RWBA 4DQLA 4OFBA 3BFPA 3X2EA 2CXHA 3RUEA 4WBNF 3Q87B 1ARZA 4W5HA 2F64A 1EFUA 4MQMA 5AI4A 1WO8A 2WYOA 4B44A 4JLNA 3C1AA 3DNPA 3RHFA 1Q3TA 2HPZA 3EWAA 5H5JA 4IQ8A 3S40A 4LX8A 2P77A 3K1YA 4UPDA 1LPSA 3D5QA 3LQRA 2OO7A 3K6JA 4DUPA 1T43A 5M5BA 4ZT5A 4D92A 1W8IA 2XIQA 4FDAA 3BGOS 1CIJA 4JJIA 1RKXA 3VFDA 3TJZA 4IJ5A 3K0FB 4I55B 3LCRA 1U8FO 2VP3A 4OMUA 1WW8A 2CCKA 2VAMA 2JJ2A 4CG3A 1J56A 4L07A 3KTAB 4UASA 1LK7A 3MBOA 4AZ0B 3AFIA 3TEMA 5I4KA 4DNPA 3CF6R 4IZIA 5FAXA 2DH5A 1J0XO 1LK5A 2J46A 5CGZA 1CJUC 2Z9CA 2OBXA 2HSJA 1AC5A 4H6VA 4QGBA 3TXAA 5IULC 4R2XA 5EUQB 1OB2A 1YRHA 2I3BA 4A2PA 5LBUA 5L6MB 1JH8A 1JG7A 2LIPA 3NBAA 5K45A 1M2VB 1UBJS 3RR2A 3KHUA 4LDAA 3OFND 5LL6P 4FDUA 1JLSA 2WVJA 3DDSA 3F9RA 5F64A 4G1MB 1R0BA 1AKVA 3ICPA 2EHDA 1TZMA 3HKBB 3KKNA 2HWXA 4G5OA 4X7MA 4BQPA 1KEZA 4QPPA 1LPMA 4IH1A 4OCZA 2P2LA 4QULA 4MDHA 3CNOA 5CXXA 1R0KA 4UTVA 5LQAA 4LJRA 1ADYA 5AKYA 2P4QA 1A8QA 1DAPA 2BMEA 3IOYA 3GHYA 1CEEA 1KYVA 2WUGA 1CUWA 3DBOB 3MS2A 2B34A 5TF0A 4PNEA 5HVNA 3SS7X 1DKLA 1VP3A 3UQZA 4R1NA 3KOXA 2BCEA 1P1FA 2WHEA 1DKMA 1PNOA 3CG0A 3TSYA 4MV3A 2BELA 4TPKA 2PZMA 5J4YA 1XAIA 3NC4A 5H68A 2H2FA 2FR8C 2ZYIA 4JL5A 4FE4A 2WIFA 3B2EA 4M89A 5KIAA 1EDBA 2XTMA 3DE7X 4JI5B 1OYYA 1A4UA 2I3ZA 2E48A 1NBIA 1QHHB 2ZI7A 3HDHA 4HLUA 5CHYA 4RS4A 3SSAA 2OD7A 3PIRA 4PVDA 2VDPB 3H65A 3P9SA 4RADA 2OPHA 4R40A 1RJFA 5CFMA 4DTCA 2PL3A 4LJ9A 5HTOA 2C9YA 2QUKA 1WRBA 1KH3A 4NI5A 4LDRA 3KWJA 3SY8A 3ZDQA 1NG9A 1T24A 3AY6A 3KTDA 4B6QA 4XIJA 1GTL1 3PC2A 3CVYA 1XZIA 3BWYA 1VL8A 3B7WA 3H8SA 4ENPA 4NPAA 1N2XA 4NE2A 4DUYB 3CLRC 2WTEA 3ZH9B 3NU1A 3WDLA 1B6TA 4DMRA 3NEYA 1ODJA 1G4UR 4M0PA 4LJ5A 1NF8A 5EMMA 2QUJA 3BSYA 4M0MA 1II9A 1GTRA 4WMLA 2YFQA 2JAHA 1PKXA 3WWOA 3GUUA 3NEAA 3HU1A 2BOVA 4REQA 3LE8A 4EZBA 4U2CA 2NZVG 3AEKB 4GLLA 3HXTA 4IIDA 5ESRA 4IGIA 1CE8A 4TMYA 1ZL0A 2J4DA 3KX2A 2ZSFA 4IAOA 2CW5A 3T3IA 1HG0A 3MLBA 2NYAA 4JUBA 4DPMA 4ECEA 2MR6A 4RD2A 1LDGA 1MH1A 1WF6A 4IIGA 4KK4A 5LU9A 2BH9A 1VCHA 1KH1A 2ZB2A 5KTOA 1RZVA 2E0IA 2XVZA 1EDDA 2QM0A 4C4ZA 1H1TA 1MO6A 3QUTA 1NVVQ 4LK2A 5SICE 4OFWA 5AK4A 2PMEA 4ENQA 3RVMA 3WMEA 1PN3A 1JI0A 4G63A 2YV3A 3BKWA 1YBMA 1NJSA 1Y8CA 2XUDA 3AC0A 4JZKA 3SZMA 4D9NA 4PZLA 4ITUA 2VA8A 4RACA 2P91A 4H4DA 4J9UE 4W6QA 5I4IA 3IHKA 1FMTA 1GQRA 1RLJA 4GOMD 3T52A 4RIGA 4R51A 1DCTA 3DHVA 1V11B 3TX6A 2WFMA 1U9CA 1VKNA 5HMMA 3THXB 1EEXB 1M2WA 2IY9A 3QFTA 3LC2O 4GPBA 1L8QA 4C0SA 2VKTA 3LT0A 1C9NA 1Z0DA 2COKA 3IPAA 3A1TA 4JSTA 3DTYA 4W99A 3GJ5A 1DVRA 3PFWO 2YDXA 4MB0A 5E6RA 5IU6A 1RAAA 1YRBA 5EI5A 3THYA 2QRGA 5IN4A 1YDMA 1HYBA 3N0WA 1IEQA 3W4JA 1IN1A 4Q4AA 4DA6A 1UBKS 1O87A 4DCSA 5CCXA 1SQGA 3FRJA 3G0BA 1P2TA 2QTZA 4U7HA 2QLLA 2RHOA 3PUHA 4K9RA 3S28A 4NAHA 4WZ6A 1CBUA 1VGVA 2NUTA 1IONA 2ZYSA 5LQCA 1II8B 5ITZA 4E32A 2YY7A 5TJHA 5L4LA 1QM5A 4A4DA 2Z6VA 1RWPA 4OAPA 2MHCA 2X76A 4RVHA 1VL2A 1XOIA 1NPTO 5EIEA 3RRJA 3K0EA 1WPRA 2Y68A 3DWEX 3DQPA 4YALA 4IQFA 2C7QA 4Y6QA 3EGVA 3CZ4A 1EG7A 3EE6A 3EZ2A 2NSJA 4OO3A 4M8NE 1BD4A 4L9RA 5A02A 3WYBA 1Y63A 3E7WA 3IX7A 4MYCA 4NMWA 1PZGA 2AG5A 3R09A 3KQTA 2Z5FA 4KDEA 1N6KA 1RHUA 3N07A 3VNSA 1NQ5A 3ONEA 4R68A 5AM0A 4ZJUA 4JQSA 4R2HA 5EJEA 1JEEA 5CT9A 7AT1A 4C6TA 1XK6A 4FFMA 2Q5OA 1XDUA 4IXWA 1CJBA 3GMSA 1YB1A 3WNCA 3ETDA 4NK4A 1Q7CA 3FPGA 2JBWA 5CFNA 2HT1A 3K4HA 3OQBA 1ECGA 2J8ZA 1RAHA 4EG4A 2HEIA 4M36A 3TR0A 5L45A 1NQOA 2V4MA 4XX1A 2VYNA 3LGSA 5GONF 3I61A 2FFQA 2JIZA 4W63A 4B5KA 3WNZA 3EDOA 3R0QA 4Z0HO 5MN5A 1XXHA 1GZSA 2RK3A 2ZB8A 5EN4A 2P6MA 5DYTA 2AD5A 2HU2A 4JBHA 1OFVA 4CEHA 1ECJA 1P4AA 3DE5X 3QVTA 4LYJA 2YHIA 4XR4A 3DVLA 3G0IA 4N65A 4NEGA 2ZTMA 4L3OA 4HAWA 5A4MS 2Q3CA 2JEOA 2W42A 1HNXB 4EMUA 2Q5IA 1R88A 2ZS7A 5G1PA 3P9YA 4AIIA 9ATCA 1JBKA 2Z04A 3FPCA 1K4YA 1LVHA 1WKCA 2VRBA 2WD9A 3UOGA 3OOYA 4JP1A 4Q3DA 1OYVA 2EZTA 1I9GA 5F4ZA 2ZDHA 2C4WA 4GPD1 1RWWA 3WJAA 4DG8A 1QH1B 4MGEA 1ZZEA 3STVA 3MBIA 4GRDA 5CT5A 2PUVA 3SR0A 1G3IA 1USWA 3HGQA 4JASB 5G0WA 3WRYA 4A0HA 4BO9A 2ORWA 1VSTA 2O1XA 2REOA 3GVXA 5J2UB 4OHZA 3VBEA 4EYSA 4C4XA 3IKLA 3KB8A 4FLFA 4CKXA 1SD5A 3K2IA 5LQSA 5LYJF 3BVPA 1E9DA 5IKPA 4HNRA 4BATA 2N46A 1SWVA 2V8OA 5KWSA 1EFAA 4MQEA 5ALXA 3W5VA 2JFUA 3QXCA 4B6SA 2NADA 3JQFA 1JQKA 4BQRA 3L4JA 3OX2A 1NI3A 4HDAA 3EEQA 1PNQA 3IR5A 3BTVA 1OXUA 5A7HA 3HCRA 5AFSA 2V7PA 1V71A 3E61A 3DF7A 1N3IA 1VE3A 3PQ2A 4GUAA 3C6QA 2O5RA 2RAPA 1K1EA 1OLSB 1XTSA 2AD1A 3GUZA 3G2KA 3DS8A 4UUBA 4YUYA 1HDZA 4EYGA 2R79A 3E9DA 3UMSA 2C9MA 3NWPA 5C4GB 3KJFA 3WR5A 1BA3A 1YD7A 1E20A 2R3SA 3PQ7A 4JOBA 3H2JA 4EEZA 3RC1A 2IYYA 4DM7A 3PCRB 2VDUE 1BIFA 2W6CX 2YCLA 2ZBPA 1W96A 3DBRA 1C0EA 3PU6A 4GKAA 4H0FA 4QRHA 5AICA 1S2MA 5AW9A 3BRCA 4URYR 5HZKA 3Q3VA 1FLVA 2F8SA 4TWBA 1Z5GA 1OOEA 5F1OA 1EDEA 5A04A 2SKEA 3BXGA 3GFOA 4PYJA 5GWXA 4IILA 5K99A 1T5TA 3K1AB 2E82A 3H8WA 3I23A 5LYJA 2FFHA 2JZNA 2W6OA 1M1NA 3UUFA 4AJKA 3CUKA 4OQPA 2P62A 1GADO 3LBNA 4ZAVA 4AYXA 3KHTA 1OAAA 3V4LA 1U1IA 1LSJA 2TSYB 1GARA 2P7HA 1FYEA 3M82A 3P9ZA 4K9KA 1AM4D 3PWSA 3RUPA 1T6ZA 4JP5A 1G9TA 5CNMA 3QYAA 2AG0A 4X1KB 4IHJA 2GZHA 3N0RA 3ABZA 7REQB 5JDCC 2NZYA 3HXLA 3I6QA 4OHMA 2FZCA 1Q1ZA 4LHWA 5AW1A 1LBIA 3L4SO 1MJGA 4HUJA 4RL6A 1XZBA 5HPYB 2J5XA 3MLAA 4XPIB 4KVFA 4PIVA 3OF5A 4C1BA 2WUEA 1K6EA 3NVAA 4LPKA 4V02A 1NVXQ 1ULZA 4DGQA 4LUCA 2GPYA 4IFTA 3O92A 1MIOB 3P2YA 3NQ41 1G5RA 2D54A 1PW5A 4DV2B 1XTKA 3FW1A 1Y8QA 1ZH6A 3A6JA 4L85A 4DVJA 5KKNB 2B7CA 3LCVB 2AX4A 3RIEA 2IKQA 1JQLB 2WIGA 2RHRA 3BFXA 3WGKA 1CY2A 4QOIA 4A8HA 1UMKA 4CMIB 4Q15A 2FW0A 1RWNA 1XL0A 2IP4A 4L5IA 1Z8DA 4ZOQI 2HSDA 2QDKA 1WULS 4EW1A 5FH9A 4IIFA 4TV8B 3UK1A 1YJXA 3D3EA 3DM9B 4OGLA 4ZI7B 2G70A 3WB2A 4CF6A 2PDAA 1P0IA 2MSKA 3LVFO 4GDMA 3DD1A 4H6WA 1JP7A 1E9CA 1G59A 1QHGA 5BWBA 2QP4A 2E6KA 3QTBA 3TR5A 1Z08A 2PT5A 3U7EB 4IXMA 3A2MA 1SCNE 1EMDA 1FCJA 5FRDA 2IFTA 5GJBA 2XTZA 4NFSA 3R0VA 1V8FA 3EASA 2IU0A 3RE1A 3RREA 4NFLA 4AX4A 3ROFA 4HAXA 5JMWA 3IBYA 4DSOA 2CJFA 5ERGB 4KNWA 3U13A 2J32A 2JIZD 2SNIE 4FKZA 2FMUA 2ZRQA 3R5HA 3ZVMA 2G83A 3UHAA 1JIVA 1V9LA 1FDTA 3P8ZA 4FC7A 4HYEA 4EUHA 4Z53A 5IVDA 1JQJC 2JGIA 2VLIA 1EI9A 5CLLA 3EZXA 2E7ZA 1JBQA 1R8YA 3DZBA 1KY2A 3T94A 2GEUA 3ZWVA 3B5JA 1UAGA 3OY7A 3RI3A 1KEEB 2HBRA 2ZTLA 1ETHA 2W4IA 4MLDA 4NQZA 2QRNA 3TLKA 3VKFA 5FDFA 4MR8A 3G23A 4CKEA 4FILA 3H11A 5CA0F 1XMOB 1JFTA 1RMQA 5ABPA 4XXHA 1TMGE 1BDJA 1OWPA 2WSLA 4YQYA 1I14A 4UVDA 1PO7A 2QT1A 1LJUA 2FUKA 5HEKA 4J2HA 4TKVA 3MC1A 3K0AB 3NP9A 5HQJA 4D99A 4F1JA 3E8XA 1M7BA 1U8UA 1YIDA 1BKDR 1TTPB 1ZWKA 3E48A 1YZLA 3KT0A 5F76A 5A3SA 4FKMA 1NW8A 1YMQA 1Z8HA 4D96A 5H8WA 4ZT6A 4I6EA 2W2KA 4FHDA 3X1KA 3DLTA 1ACLA 4KYIB 2A5YB 1IMJA 3WLTA 1XNJA 2JH9A 3RWOA 2QVBA 2WG1A 1RLMA 1ZOPA 4ZDKA 3O8DA 1XG5A 3IVGA 1M1XB 1HE8B