1KO1A

Crystal structure of gluconate kinase
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
172
structure length
163
Chain Sequence
TTNHDHHIYVLMGVSGSGKSAVASEVAHQLHAAFLDGDFLHPRRNIEKMASGEPLNDDDRKPWLQALNDAAFAMQRTNKVSLIVCSALKKHYRDLLREGNPNLSFIYLKGDFDVIESRLTQMLVTQFETLQEPGADETDVLVVDIDQPLEGVVASTIEVIKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gluconate kinase
publication title Conformational changes during the catalytic cycle of gluconate kinase as revealed by X-ray crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 62
structure length 163
sequence length 172
chains with identical sequence B
ec nomenclature ec 2.7.1.12: Gluconokinase.
pdb deposition date 2001-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ko1A00
1G3UA 1U0LA 1XMVA 4IXMA 2V3CC 4U02A 2PEZA 1FMLA 3AKCA 4ZKDA 2J46A 2ZYWX 2IS6A 1OSNA 2ZJZA 4ACBA 2Q21A 5JRJA 2CNWA 1E9RA 4L16A 2QY9A 1NVVQ 4FINA 2A2ZA 2ZU6A 1R0XA 2BMFA 4GZMA 2ZRMA 5JEDA 2HJGA 3QPWA 4JT4A 2XOKD 3QKTA 1GG2A 3CR8A 1E4YA 4PFSA 1CBUA 1VTKA 1DBSA 3IQWA 1J2JA 1VIAA 3B1WA 3H2YA 3K70B 1RYFA 1TX4B 3H0KA 5J40A 1OH7A 4C3ZA 2CJWB 3SN6A 3EIQA 4MITA 4BLQA 4R2IA 4ABYA 4CEHB 1N25A 5JEEA 2OFXA 2OCYC 5FTJA 2AN9A 4B71A 3L0OA 3E5HA 1TTTA 4RCYA 4CT4B 2A78A 4A0GA 2EYQA 1TQ6A 4MA4A 3FFBA 1R5BA 5CYPA 1CJKC 4JVMA 3SFVA 5KNDA 2YINC 2PX0A 1ZD8A 4O2LA 1IN5A 3QF4B 4E22A 5K8LA 2GF9A 3THYB 2VP9A 4DUGA 5F98A 4Q4AA 1N5JA 2G0NA 2KBFA 2CL6X 4Q4HA 4V0KA 4N1AA 2W58A 5BW8A 4D0NA 3R9XA 3TIFA 4H1VA 3TH5A 2ZE6A 3LO5A 5CDFE 3GMTA 3KXKA 3Q85A 1DAEA 5JJLA 5FPTA 4FMDB 4B2IA 3W90A 1R5OA 2XNDD 4U5XA 1ANKA 2C5LA 2C8VA 4POAA 1XD2B 1E9FA 1WF3A 4V0OA 2A5JA 3C41J 1HT2E 3NEJA 4RD0A 1CJTC 4NYJQ 1NJFA 3CH4B 3SHFA 3EZ9A 1XPUA 3W3AA 2C9OA 2GVZC 2EQBA 1QHYA 2FFBA 2W2TA 3CR7A 3HP1A 1W1WA 1WB9A 3KJIA 3FMIA 3Q9LA 2YOHA 4QHSA 3UWOA 2CE2X 2OO7A 4C2UA 1AM4D 1MT0A 5IDVA 4E07A 4N0EA 1Z08A 1ZW6A 2OHFA 1E2IA 1GSIA 5H1YA 1KNQA 4JYCA 5FFMA 3VR6A 2CJWA 3REFA 4NH0A 3M4YA 4A82A 3BH6A 1GIAA 1JR3D 1UFQA 2OT3B 1W4CA 1BOFA 4CEHA 1U9IC 1IN4A 1B0UA 1OIWA 1T6NA 4TMWA 3E70C 2NPFA 3GJ0A 4MKHA 2VHTA 4V0NA 1QHIA 2JEOA 2IYSA 2NPIA 2W2VA 1TNDA 3A1WA 3FWYA 2ZS8A 1EFRA 3BFVA 5AUNB 2ZSEA 3EASA 4HUQB 1N0UA 3EG5A 1OKKA 2A5FA 2H57A 1D8TA 2GJKA 3OIVA 2VSFA 3THYA 2IHYA 4GSYA 5FBLB 1W47A 1N6KA 3SDZA 4WBSA 2F55A 1OPXA 2D3WA 2NO6A 4DWJA 1KO5A 4LGMA 1ZUNB 3T1QA 1FUKA 5FL7A 1DE0A 1UBFA 1P75A 1D2MA 4DKXA 1DAIA 1EFTA 1KJZA 1P4SA 4TSFA 4UJ5A 3PEYA 3AF3A 4PHTA 1IY2A 2C98A 2DFKB 1S3GA 4AYWA 2XJ4A 2W6JA 1Q1ZA 3OE7D 1E9EA 2Z6VA 4HAUA 3CRVA 1XD2A 3U61B 2CCGA 5EE9A 1SVLA 3WBKA 4E03A 1BO6A 4KV9A 2WTUA 4R9UC 4HDCA 4P4SB 5HR5A 1VG0B 4QGFA 2J3EA 2CVFA 2YHSA 3CZQA 2X2FA 3PQCA 4TQUS 1VMAA 2PT5A 2ZRDA 4LHWA 3U5ZB 2IYXA 2VH5R 2W0MA 1HH4A 1DEKA 1Z6GA 1ZIPA 3WHKA 2QAGA 3RVBA 4DCSA 1Z0IA 2OEPA 4ARZB 3WRYC 1WMSA 2QZ4A 4LYHA 4KXFB 3AVYA 5D3QA 3ADDA 2GJ9A 1A2KC 4RY2A 5BYKA 2WAXA 3GJ3A 3TSWA 2GZAA 1AIPA 1CJMA 3UKDA 2CLCX 3CF6R 1FOEB 3EWAA 4EQ6B 3F0TA 2ZUBA 3FMPB 4Q7MB 1DAHA 1VKJA 4HUQA 5H70A 4DLWA 4ZIRB 1E2FA 3CX8A 4DSOA 1M8PA 1N6LA 1W0KD 4GI7A 4BGDA 2NQ2C 5FOWA 2DHRA 3LH5A 3T61A 4K46A 1Z29A 1E2NA 5UKDA 4YMTA 4NTZA 4CGZA 1E3MA 2EWVA 4MH0R 4V03A 2ZREA 1E0JA 2X2EA 3E2IA 5HTKA 5KTYA 2ZJ5A 5HPYB 3GLFB 2ZJ2A 2FGJA 3Q5EA 1OH5A 2P3SA 4MGYR 4AYTA 3N2IA 1II8B 2QENA 3K70C 1RPZA 2QN6A 4G5SA 1Q0UA 4IKEA 2BCGY 1JNYA 4MRPA 3F3YA 1FZQA 4FXPA 3PCRB 1SHZA 2C95A 3O8DA 4IXNA 4RD6A 2RGDA 2W6ID 4QBIA 3VR2A 3AB3A 1EFHA 4Z1MD 1RRFA 5EP4A 3RS4A 2CHGA 4B32A 4B3DA 2O8FB 4P4SA 5EXXA 1R4AA 1I4TD 2PCLA 4IOKA 4JLVA 1N5LA 2GESA 4MRSA 3BBPA 3C4JA 4DCUA 4XVRA 3REGA 4LBWA 2YKGA 4M9SA 1T5IA 5ANRB 4W5HA 3NC0C 3WP0A 1M6NA 4HB3A 3RABA 5KNBA 5C2JB 3Q5DA 1KDRA 3PUXA 3BIFA 2FSGA 2BBSA 4O2RA 3RS3A 1N0WA 2ZSDA 2LKCA 5SZJA 3U7EB 4D4KA 3KJHA 2FPKA 3NBYC 1G64A 1NI3A 3SYKA 1NLZA 3WNDA 4OQLA 1UBCA 3LFUA 2VTKA 3IPXA 4Y0AA 4GNKA 2ZXUA 2REBA 4QHYA 3HYTA 3B5JA 5AWFC 1ODFA 3CUEF 3RWMB 2IS4A 1N6PA 2G1JA 3U6KA 4TLEA 1ZM4A 2IYRA 4B3FX 2IUTA 2AK3A 2CLDX 3GD7A 1P2SA 2JAQA 5AJYA 2WJJA 1VG9B 2WWXA 1FW6A 3GLFA 2J7PA 2HCBA 3PEUA 2WV9A 1GP2A 3MMPA 4WIAA 1D6JA 2RHDA 4US0R 4FCVA 3ZZ0A 4DRZA 5FBRB 4JL5A 2C9YA 4P4TA 1G21E 4NDZA 2AD1A 3J81k 3DM9B 1XMIA 3LX5A 4BLSA 3LLUA 2FU5C 4GMDA 1IY0A 4B2LA 3GLGE 1UKYA 1D9ZA 1YU9A 2BEKA 4PSKA 2J41A 2ZITA 5SZIA 5JS8A 3LW8A 3WNBA 1ZM3A 1YZNA 3V4RA 2O8FA 2A3RA 1E99A 2IC5A 2EYUA 4QGAA 1S8FA 2J1LA 2YVUA 3LVQE 2QP4A 4FMDF 2MSDB 3QI2A 2ODEA 3LLMA 2O5VA 3SYNA 3KQUA 2IXEA 1UBEA 4HI0E 1UAAA 1JQJC 3RC3A 5CIQA 4ERNA 5JSZB 1NKTA 2XGJA 2R2AA 4RD2A 1M7HA 3P27A 3FPAA 3ZDQA 2PBRA 2WWIA 2J45A 1FX0B 3CB4A 2JATA 5FUYA 2NZJA 4JVNA 1J99A 4YONB 4ZV4A 3V9PA 1DVRA 2JLUA 4JLNA 1II0A 1A5TA 1ZC4A 4M4SA 2WVJA 5HKKA 3ZD7A 2ASEA 2I4IA 1AGPA 1L8QA 2OFOA 3OHMA 1C1YA 1HE8B 3SC3A 4X8OA 1QBKC 5J5CA 5BYJA 4BLTA 3AGPA 1QZXA 5BN5A 2YYZA 4Q21A 5KUTA 3DHWC 3LY5A 2ZIAA 4KSCA 3U2QA 2A5DA 3C8UA 1NNEA 1XZPA 2GK6A 4KHZA 5FR1A 3D7MA 4KYUA 1EFUA 4Q7KA 2OAQ1 2A5YB 3BB4A 3TVTA 4BPBA 3G5UA 1UPTA 4PSAA 2YOFA 4R7ZA 2ZI7A 3U7HB 4A2WA 1HQCA 3ND9A 3I61A 2V1UA 4C2TA 2AFHE 2TMKA 1NIPA 3NDBB 2FA9A 1GKIA 1LFDB 5AR1A 1NMYA 4DDWA 2DWQA 1U90A 3EA5A 1E96A 4QRHA 4TYYA 1DELA 5FOVA 3AF1A 4MRRA 4QM6A 3B2EA 3CNOA 4DSUA 4QJ5A 2B21A 2BKUA 3X2SA 2O8BA 3M0EA 3DM5A 2BMDA 3UK6A 2VSXA 3GLHB 4HZIA 1G3MA 1WE2A 4EUNA 3LRPA 4NCJA 3AKDA 3HJNA 2WJGA 2NGRA 5JSZA 2V6IA 2VRWA 2G6BA 1KSJA 2IEZA 2JLSA 4DB4A 1BYUA 1QG4A 1XZQA 2ZRFA 2F1IA 3EZ2A 3NC1C 4R2HA 2H7VA 4MGKR 3BH0A 2J0QA 5FBQB 2O0KA 1GITA 1E69A 1FX0A 1G20E 3X1YA 3FOZA 3UANA 1U81A 2D62A 3QIAA 2OXCA 5EE1A 5HZHA 4D25A 3FHCB 3KQHA 4GBMA 4OBEA 1XX6A 4EPWA 1T5LA 1W0JA 3WYAA 1J90A 1OXTA 1KO8A 3GJ7A 4JMPA 3BK7A 4ZCIA 3ICQB 4XIGS 721PA 4OQNA 2JIZA 1OXXK 4MKIA 1KI2A 4EJSB 4KSBA 3B13B 3B1YA 4M1YA 1Q1EA 5JJIA 3ZH9B 4BLRA 1N2CE 5GVSA 3QKRA 2QRNA 3IIKA 3L2OB 1R8SA 4HAYA 4PR0A 3SJBA 3QG5A 2J7KA 1Z0KA 4LJAA 1KI7A 1J70A 4TN1A 5AJVB 3C16C 4TMKA 2YZ2A 1G9XA 3KXLA 1ZU5A 3HWSA 2BC9A 1OE0A 4LI0A 2Q9BA 2HUPA 1SVKA 1YVDA 1HV8A 3VR5A 4BFSA 5KDDA 1YE8A 2V8OA 4PC6A 3IHWA 4Q01A 3KQKA 4URXR 2XAUA 3AV0B 3GLHA 4JL8A 1N5IA 3PJRA 1Z28A 4MKFA 5DYIA 2JJ2A 2NIPA 2VYFA 3C15C 2ONKA 2WSMA 4U00A 3LWNA 5FTLA 3VNUA 1PUJA 2ZRBA 1FTNA 3QXHA 2PLFA 3DMNA 2CDNA 3KTAB 4C0HA 2C96A 5HCIA 1YRBA 1PLJA 4MYHA 2ZRAA 4IDQA 4LV5B 5AJZA 4DLTA 2DFNA 2R44A 4C9BA 4PX9A 2ZAMA 1E79A 5E4FA 4ZDWA 2JA1A 3W3ZB 5E3HA 2JDID 2ZJAA 1Z0DA 3CPEA 4Z8YA 4JL6A 1QHXA 2GCOB 5EUMA 4GP6A 2BJWA 2EFCB 1U8YA 2YV5A 1VCNA 2QG6A 4MDEA 3AVQA 1COWA 4OI2A 2F9LA 2XZLA 4UXJA 5E95A 3B82A 4A8JA 1ZC3A 4BFTA 4EJSA 1F60A 2ZR9A 2PH1A 1ZM2A 1NP6A 1L2TA 1PJRA 2OSBA 5CLLA 1F48A 1UF9A 3BGWA 5FBVB 3QSYA 1UEIA 1TUIA 1E1QA 1XEWX 1WBDA 2FG5A 5EE3A 3DZ8A 4UNNA 1LS6A 3QXSA 2YOGA 2IT1A 1JPJA 4B33A 1X8JA 4TMZA 1GTVA 2IK8A 3QVVA 2Z5FA 5JCPA 1N5KA 4BFWA 4BFUA 3VU9B 3X1WA 1ONBA 2MSCB 5F9FA 5D3MB 3DKPA 2FFQA 5M04A 1Q3TA 2ZR0A 2MMCA 1DAFA 3TQCA 2R8RA 4QBHA 2FPLA 1VPLA 2BDTA 1SQ5A 5JI3E 5FTKA 4AI6A 4KJZA 4KFRA 3IDQA 4RFVA 5DLQC 3AVUA 1KJWA 4V0MA 4YXWD 5IHPA 2ONJA 1NKSA 2IWRA 3MRSA 2VSOA 4Q00A 5F9HA 1QVRA 2BBOA 1G17A 2PEYA 3LVRE 4JT2A 4I1SA 4QXAA 2ZTSA 3C14C 2ERXA 3W8NA 2ZRCA 4LYJA 4ZDKA 3EPLA 4NYMQ 2Z4SA 3AVWA 4WOPA 2IW3A 2OBLA 1P2TA 4ZPXA 1KSFX 3T34A 2WM9B 4C0BA 1WP9A 2GK7A 3L82B 1NN5A 4XTRA 3EW9A 3THOA 4PC2A 2VF8A 2ZYVX 5L3VA 4YC7A 2QI9C 2V9PA 3GEIA 4JYBA 4N3NA 4NBSA 5J4YA 3T35A 5JHHB 4GOKA 1G3QA 4BWYA 4NKRA 3KDSE 2PCJA 3B9PA 3OESA 2N1BA 3D31A 5DN6A 3RHFA 3VMFA 3ZIAD 4HAXA 5L3QA 2YNMA 5KPDA 4JLKA 3FYHA 1XEWY 3N5CA 1BH2A 2I1QA 2J5XA 1KIMA 3GJ4A 4OI4A 5IRCD 1Q44A 1LW7A 3KL4A 1E2GA 4PQFA 5B30A 3H86A 1CJUC 1SHKA 2ZSAA 3NBZC 3A4MA 3EXAA 621PA 2WPDD 1W46A 3NEYA 3UXMA 1AA9A 2ZS9A 4DHEA 2ZI9A 3VKHA 2R6GA 1XMSA 1RFLA 4U7DA 4AKGA 4FCWA 5JMTA 3CRMA 3N2EA 1MKYA 3QPVA 1TQ4A 3CLVA 1YR9A 2RGBA 4TLAA 2PMDA 4Q02A 2GZDA 2HYIC 2FDCA 1E2MA 4OHYA 1FP7A 1CULC 3P20A 3A1VA 3QVUA 3TNFA 1NG1A 1OXVA 2QM7A 3KKPA 4B76A 2GJAA 1XXHB 3DZDA 4HLDA 1AZSC 1U0JA 1ZD9A 3KUDA 3WMGA 1G8PA 1S9DA 4GOXA 4EJSC 4OQXA 1UADA 3GFOA 3CZPA 4H9GA 2X1VA 2QE7D 1OYWA 4BRWA 3UMFA 2FSIA 2RKOA 3EIHA 1AS3A 2DWOA 2QMOA 1H8ED 3NH9A 5TY0A 1G6OA 1OHHD 4ZKEA 5JWHA 1NIJA 1W4RA 2QORA 1JBKA 3NXSA 1TMKA 4RZ2A 4EPRA 4BQSA 4LV8B 5LB2A 3SE0A 4AD8A 4B34A 4EPXA 4G01B 3ZVNA 3SZRA 2PZFA 3MJHA 2GHIA 2V7QD 1QDEA 1XRJA 2FX3A 4LJYA 4URVR 3EA0A 5FUXA 1DS6A 1IAQA 4JKYA 4PHGA 3WXMA 3B1VA 3GQBA 1II9A 3QKSB 1GNRA 3TE6A 3TGPA 1E6CA 1M34E 1PLKA 1PUIA 2AKAB 2WWGA 4Q9KA 1YZLA 2HXYA 4LJ5A 4M21A 2P6NA 4S2EA 5LPNA 1JAHA 1KYIA 2VQSA 4RJLA 3KXIA 3LX8A 4NYIR 3GLIB 2Z43A 5EZ5A 3MJRA 4JVLA 4CVNA 2O8CB 1NN1A 1TU4A 1HQYE 2ZETA 5H68A 2XB2A 5HZKA 2HLDD 2DFLA 4II7A 1QHHB 1DAKA 6Q21A 1FFHA 4AG5A 1PVOA 2FFHA 2OESA 2BEJA 3NBXX 1CRPA 4V02A 4JBYA 5KSOA 4GT1A 4JLAA 1XTIA 2CK3A 3QF7A 2XJ9A 4XD7D 1NSFA 3DEFA 4OI0A 2PJRA 2VO1A 4UJ3A 3MG9A 3PIRA 2OM2A 3TMKA 3FFAA 2QQ0A 5KO2A 4YQFA 4NONA 1IXRC 2QGNA 4OQMA 2QGZA 1G8HA 1RKBA 2BKEA 3I72A 4NPHA 4TL8A 4TLCA 3SHWA 2JCSA 3KB2A 3NG1A 1D5CA 2VP2A 4AK9A 3MFYA 5F3WB 5FOUA 3ZZTA 2R62A 4UXHA 3ZYCA 2X19A 2JLQA 3BE4A 5DO9A 3VR3A 3WRXC 1XJQA 2HF9A 5JFGA 2FEOA 3R8FA 3BH7A 2GAAA 4FN5A 3SJCA 3QKSA 4Q47A 3CPHA 4BZQA 1VCIA 2R6FA 1Q1QA 2GJSA 3IKJA 4IRUB 4PHFA 2QL6A 1MOZA 4QGGA 4TMXA 5G53C 1SVWA 1AS2A 2XTZA 1A1VA 1E2DA 4P33A 4OHXA 1HE1C 3GLIE 3I3SR 2V1XA 2D4HA 1FNMA 1QVAA 5KSYA 3GLIA 1WQ1R 4IVRA 4YLGA 5DH9A 2O8CA 1VECA 4LOAA 1K5GA 4XWOA 4IDHA 5G3YA 5C1BA 1ZP6A 2P5TB 3BB1A 1T3HA 1P72A 3KX2A 4TL7A 3OFND 4TWZA 5EE0A 3T1OA 5K8IA 3K0FB 3BOSA 1MABB 1LF5A 3QXXA 2W00A 3KQNA 2DCUA 4BFYA 4D81A 4D6PA 1JXMA 2FZ4A 1YKSA 4Q1DA 5C4GB 1EESA 1G7RA 3FHOA 2OFWA 4BZPA 1TQ2A 1Z8FA 3NVAA 2L0XA 2C04A 2ZYTX 3FMFA 3QF4A 4RFSB 4PTLA 2GZHA 3UG6A 5DYGA 1IJEA 1N3BA 2OCAA 1OJLA 1G41A 1MV5A 1TQDA 1Z6AA 3TBKA 4EAQA 1UKEA 1P2VA 3PEWA 2BJVA 4RD3A 1F2UB 3LBNA 1PLLA 2J9RA 4KODA 3TUJC 3FE2A 3P1JA 3IHLA 5IT5A 1SVSA 3ECCA 3NTUA 5CJPA 1CLUA 1KO7A 2Q3MA 3O8BA 5C18A 1CS4C 4H1UA 4C0LA 2VHQA 2ZJBA 1OFHA 2I3BA 2Q3FA 3F8TA 5CK4A 3ZD6A 3I32A 3KB1A 4YDSA 2ZVQX 4OI1A 2ZJYA 5BQ5A 2RGAA 2SHKA 4BE7B 1AQUA 4FIDA 2WWYA 4IEIA 5J4KA 3CPJB 2EFHB 4AY2A 1MO6A 4IFEA 4S35A 3RSOA 1NVXQ 4M1SA 4A6PA 4US1R 4WVFA 4F93B 2NO7A 2WBLC 4XSGA 3AH8A 1UJ2A 5H8WA 2ZSFA 4KCGA 3PEVA 2G83A 2ZRLA 1KJYA 3Q72A 5JBQA 1M7BA 2GILA 4MUAA 5L3RA 2FMXA 1XBTA 2NZ8A 3BFKA 2WJVA 1A82A 2RB4A 3G0HA 3K0FA 2CL0X 1MABA 4M1OA 4RZUA 1XFAA 4Q4LA 1NLYA 5DI3B 4PQYA 2VP5A 1AKEA 1GL9B 1E1RA 2HXSA 4D0LB 2XSZA 221PA 5JZVA 5DI9A 1I4LD 3C7KA 2B7BA 4MDFA 4OYHA 2JJ1D 3M1IA 4K81B 2UZ3A 5FPYA 4QC2A 1PZNA 2OCBA 4RFSA 1E2EA 3RLFA 3AGQA 1BMFA 2Q0HA 4KFUA 1XP8A 1CJVC 5DHFA 3CO5A 3TRFA 1MO3A 3MAAC 3LW7A 1KAOA 1F2UA 4HAZA 3CRW1 4TT3D 3IEVA 4IDOA 1HUQA 4GOJA 2D7DA 3LQQA 4EIWA 3UIEA 1E2PA 2H16A 3EARA 5G41A 1JB1A 1RZ3A 4PC1A 1D2EA 3QBTA 2AX4A 1UDXA 4BFZA 2IS2A 2H18A 3BS4A 1TPZA 2AWOA 4TTQA 1EWQA 2RAPA 3JVUA 3I62A 4HATA 4KU4A 4QM7A 2ZQ5A 1K6MA 1KO1A 2JLYA 3ICEA 1W2HA 1ZUIA 3CM0A 3H84A 5LBIA 2OCPA 4JJZA 3T06B 2V54A 2ZPTX 3FKSD 3GJ6A 3PXGA 2WSSA 2D2FA 3CWZA 1TL7C 4RD4A 1EGAA 1F6BA 1G19A 1X86B 3I92A 3R7WB 4M9ZA 3I73A 2BOVA 4AC9A 4PO8A 3QOFA 3IBYA 4ARZA 2Y8EA 1UM8A 1X1RA 3RRNA 4IOMA 3SYLA 3SU8A 1K8RA 4EPTA 2WJIA 3OEHD 5HE8A 4DEYA 3SBDA 1R5NA 4EQ6A 3R9IA 2QPAA 1H8HD 3FKQA 1EK0A 3DL0A 4E09A 4ZIRA 2BBTA 1IONA 3BAFA 4OJQA 4Q1CA 1YZKA 4DJTA 4GZLA 4RZXA 3LAWA 2JASA 4Q18A 1G7CA 4NP6A 3U3OA 2RGCA 3GPLA 4R98A 3GLFE 2GA8A 1GOTA 1A4RA 4Z54A 2IUSA 4B75A 3BWDD 1P60A 1MO5A 3BJIC 2FNAA 3KUCA 3NHAA 3A58B 1NBMA 2FJUA 2GXQA 3SFZA 3VHLB 2GBLA 1II8A 3D3QA 2ZE8A 2GWHA 4L9SA 3CF2A 3OEED 2XXAB 3ASYA 3U3RA 1ETUA 4LPSA 4TQAA 4DDUA 3RSLA 3HDTA 1ZCAA 1VYVA 4LJ7A 3DOFA 2HT1A 3QPUA 3A6PC 3CWQA 3QG1A 3IBGA 3VQTA 5CK5A 1S0UA 4C0QC 4HDOB 1JR6A 1G8FA 1EWRA 1KZ7B 2F1HA 4BASA 4PAQA 1DPFA 1UDWA 4LYAA 5LD2B 1T3SA 2GNOA 4J0QA 2GRJA 1KDPA 5EP1A 5G40A 1KTVA 1P9NA 1U8ZA 4LUCA 4C0AC 1GRRA 5KU1A 1A2BA 1KK3A 1XCMA 2XZPA 1SXJD 1ZD1A 2XNSA 1ZNYA 3AM1A 4ZI2A 5IK2D 2FSFA 3QEJA 1JQLB 2WKRA 4ASUA 1GRQA 4I1OA 4PO1A 5JECA 4B3GA 1OB2A 1LVGA 4GDFA 1G1MA 4M1TA 1ZNZA 4A2PA 4TL9A 2QROA 1XTQA 3LA6A 2AK2A 3FTQA 4TMVA 5CIWA 1FMJA 1DOAA 1G5TA 2CNWD 2VPPA 1Y3AA 4HAVA 1IHUA 4MKGA 2IHBA 1E2QA 1XJCA 4RKEA 3CIOA 5HE9A 2P65A 3JZMA 4CEIB 1CR1A 2XOKA 5DISB 2F3RA 4EDHA 2R9VA 3WYFA 1FL9A 2WKPA 3O8CA 4X8LA 3VTKA 4DLUA 1OW3B 1KZGB 2KSQA 2ZE5A 4QBGB 2XXAA 4Q66C 2J87A 4IVPA 2E9SA 2YWHA 3CW2A 3RDPA 5BWMA 2B6HA 1NVWQ 4AURA 3P4XA 4PHHA 2GXSA 1KKMA 4DLZA 1N0VC 1GFIA 2VHCA 3EC1A 2Q3HA 3IO3A 1W4BA 2J0UB 5DNYB 3THWB 1XD9A 4ZO4A 1S2MA 2CL7X 1LF0A 4DB2A 4IJMA 821PA 3IEUA 1VYTA 3EZ7A 4G5RA 5C4MA 1YR7A 3FB4A 2V55B 4QGHA 5CB6A 3HPQA 4MQBA 4CT5A 4DC9A 4DUGD 1CU1A 4AKHA 3OZXA 4L8GA 4NE2A 5FPSA 3ZQJA 4TZ0A 4IOJA 1L7VC 3B7GA 3M6AA 1EFCA 3TUZC 2NG1A 4LSGA 2HDNB 4G3XA 3ZZUA 3VR1A 4EPYA 4PC7A 1WBBA 2BM1A 2OG2A 2GBLC 3T1TA 2ZSBA 3B9QA 4F38A 2XNDA 2KJQA 3F5FA 1G4UR 5KDOA 2GAOA 2CCJA 4M1MA 5F2EA 4MYUA 5GJBA 3K1JA 1XWIA 3B60A 1T0HB 1W4AA 2B92A 2RH5A 4ITRC 3U60B 1E0KA 1CXZA 4KBGA 4CEIA 3K0AB 4MYTA 2R6CA 2IYUA 1W48A 2Z83A 3K09C 4NYMR 1W2GA 4D82A 2ECKA 3ZQ6A 3CKLA 3C5HA 3U4QB 4LC0A 5CLQA 2EFEB 1TU3A 1Z6YA 3K70D 3FDIA 2K5UA 4AYXA 1BIFA 1IXZA 4RKFA 4B6EA 4JZKA 1SKYB 1TEXA 4LK2A 2IBMA 3HR7A 1G16A 1MRNA 4KBFA 4D26A 1JR3A 1JJVA 4JIMA 1GKUB 2ODNA 3GLHE 4Q1AA 4DDTA 3ZVLA 2F1JA 4M9QA 2CLSA 3VHXA 1MH1A 3RS7A 1XD8A 1EFRD 2DPXA 3THWA 2P2LA 5B57C 2F1RA 4I81A 3W6PA 1OKKD 1VHTA 4AIIA 4YMUA 2REXB 5TMPA 4TTRA 421PA 1ZRHA 5DE3A 1I2DA 4HB2A 4M2LA 2D2EA 3Q3JB 3L0IB 3BC1A 4KFSA 1IXSB 4ZCLA 5KDLA 1BKDR 3C5CA 3A8TA 1Z3IX 1ZJ6A 4JS0A 1G5PA 5FL7D 2DBYA 1P6XA 1E2HA 1Z0JA 2P6RA 4TLDA 3AP2A 4TSFD 5TVKA 1U98A 4Q9IA 3TAUA 4M22A 4ZDJA 2HV8A 3OE7A 2W6JD 5GVRA 4PZYA 1X6VA 2ZJOA 2O52A 1R7RA 4US2R 5JS7A 2GCNA 4KYIB 4GP7A 4QJ3A 2ERYA 4LC1A 4MRNA 5KHOC 1DO2A 2N42A 3K0AA 5L8VA 2QAJA 2ANCA 2W2XA 3ADBA 4QG7A 3B1ZA 4CRWB 5AUPB 1P5ZB 5LD2C 4LHXA 3W5JA 3A37A 1W36D 3U4QA 5L3SB 1ESMA 3EZFA 1GL7A 5E7IA 1JAIA 2JLXA 2UZIR 1E0AA 5FBWB 4YMVA 1AKYA 5FH9A 4A2QA 2CXXA 3FGNA 5E7JA 2ZRGA 5CM9C 3QXCA 2A5GA 8OHMA 1HT1E 1XTKA 2ZR7A 4KI0A 1A7JA 1ZNWA 4JBWA 5AJXA 1US8B 4XSHA 4O0MA 2J0VA 4V0ME 2PJZA 2RGEA 4PSVA 4ESVA 1F3OA 3MCAA 5CYOA 3IILA 5LB4A 1RE0A 5P21A 1MO4A 3SOPA 4CZ2A 1W0KA 3GFPA 4D4JA 1VG8A 3ASZA 3O8RA 1AK2A 3KTAA 3BORA 1NVVR 1E9BA 3DDCA 4DSNA 1I4DD 4UNSA 1F2TB 2G77B 2O8DB 5EZ6B 1DARA 2EW1A 4KVGA 3TAHA 2OV2A 4V0LA 2OE2A 1OXSC 1R0WA 2WWHA 2ZI5A 3CBQA 5CITA 3VX3A 2Q9CA 2QP3A 4TYNA 2GCOA 5EXSA 5EQTA 1G8YA 1ZNXA 2OZEA 2OLKA 1KY2A 5CM8B 3R9WA 1Z2AA 1KMHB 4LDJA 5TARA 3K0CC 3ZLJA 2W6IA 1RRGA 5A5GA 2DYKA 2HF8A 4Z1MA 1E9CA 1KI6B 4OHZA 4HZUB 1M7GA 4HEJA 5J4HA 2UVQA 1ZMXA 2H8KA 4LJ4A 2GEUA 2ZRKA 4C4PA 3WMFA 1K5DA 4L5BA 4O3MA 5L3SA 2RMKA 2AR7A 4PAOA 1GUAA 1J7KA 2OLJA 4DXAA 4UKDA 2CMKA 3FVQA 3CF0A 1WCV1 1SXJB 2P67A 2KBEA 3AKEA 3I5YA 4P4UA 5FR2A 3HR8A 3VU9A 1KK2A 4P31A 5K8TA 2ZROA 5DGXA 2ZJ8A 5D3MA 4A6XA 1FTSA 1GZSA 3B8HA 4KAXA 1US8A 3Q8XB 1HY3A 3MSXA 4XVUA 5KPJA 1TEVA 2O8EB 1G4AE 3PENA 1SZPA 4LBZA 4OKSA 3RANA 1KGDA 3QY0A 4WXRA 2GEVA 4A92A 3CNLA 1LB1B 2EFGA 3OAAA 1XCGB 2B8WA 2IYWA 2IEYA 4XWAA 1VIYA 2PZEA 1G7TA 5TV2A 2C99A 2H5EA 4G5GA 2XX3A 4PC3A 3LV8A 1KK1A 2LWIA 4G5QA 4NYJR 2GETA 1RYHA 5J47A 1F2TA 1RW4A 2GEDA 3RYTC 2O8DA 1BS1A 4Q7JB 1XEXB 2HJVA 2J7PD 4JLBA 2NMVA 5G3ZA 2ORVA 1YRAA 1RRPA 2C9CA 3L43A 3QJYA 3AVXA 1H65A 1ZUHA 4B43A 5AJWA 1X8LA 1KMHA 1XPRA 2VIIA 5JRZA 2R6AA 4IOLA 1AQYA 4PQRA 4F91B 2REOA 3KKOA 4RD1A 4FMBB 5TB5A 2FPMA 3HU2A 1SVIA 4HZUA 1DAGA 1IOZA 4C7OB 1KI9A 1KOFA 3K9LA 3EC2A 4DIEA 3GJ8A 4NMMA 1CR0A 1OV4A 4PXAA 2OUKA 2ZAOA 3LQRA 1X3SA 3RRMA 1KSGA 1HEIA 5EP3A 5K8UA 1VCOA 2ZRIA 2VP0A 3W5IA 4Q4AB 2O0HA 3QE0A 2Z4RA 4B35A 1WXQA 1T91A 4DCTA 4WAUA 3DOEA 2WWFA 3PITA 1AJEA 4LJ8A 1Q1BA 4MGZR 4URWR 1PV4A 3GJXC 4G1UC 4Q7LA 1CKEA 5FOSA 3AF0A 3E1SA 3QXJA 1KI4A 1TUEA 1WDTA 4DVGA 1XDBA 2J59A 1CR2A 1XXHE 5HKKD 3R20A 4OJKA 1NY6A 3EPKA 3GEEA 1YQTA 3UPUA 1RRCA 3T15A 5KOYA 3SS8A 1LV7A 1U0HC 4X8MA 1XXHA 3QQ5A 4P3YA 1O3YA 4N0DA 3PUZA 1P7CA 2IF2A 1KHTA 2EU8A 2V6JA 3D8BA 1E2KA 1XEXA 3V4FA 3VKWA 1E2JA 4QKQA 4F92B 3AVTA 2ATXA 4D80A 2QPTA 2FF7A 2IYZA 2WICA 3AVOA 2C2HA 2FV8A 3OF5A 4JLPA 3JVVA 1KO4A 1E94E 4MYCA 3A36A 3A4LA 3MD0A 2NOAA 4UXIA 1VCMA 2OBNA 2VL7A 4KITB 1T9HA 1KY3A 2ZE7A 4WZBE 2MSEB 3QENA 3SQXA 1DG1G 5A0FA 1EG7A 1KAGA 2ZUCA 1M74A 4XTCS 4IDNA 4DEXA 1Q22A 4R71A 2QT1A 3I4LA 2FSHA 4C7OA 1IY1A 1DG3A 1I2MA 1CEEA 2O0JA 4GPTA 3TVDA 1FQKA 2FEMA 4DCVA 4DLRA 4OK6A 5GJCA 4DCNA 2ZANA 2QSZA 3IQXA 3AVPA 5FUWA 1LTQA 4BECA 2HEIA 4ZDIA 4OK3A 2BM0A 2QMHA 3QUSA 1P9RA 2BVNA 4MUBA 3WY9A 1XB2A 4IEEA 2PLRA 3O47A 5B2ZA 2OXRA 2JLRA 4X8HA 1E9AA 4NL4H 2VHJA 1ESNA 5DSZA 5AUQA 1Z2CA 4Q9JA 3RS0A 4L15A 4RVCA 5CDFA 1XCPA 5FI1B 1W0JD 1N6RA 3U7FB 1NRJB 1G6HA 4RSGA 1QHHA 4B47A 5FOTA 1OYYA 1QG2A 1L4UA 2QU8A 2ODBA 3PUWA 3TJZA 2JIZD 3SNHA 2H1LA 2XEXA 4AWXA 5LDDC 2F7SA 4PANA 1NLFA 4GMXA 4ON9A 2YJTD 5B58C 2Q6TA 1CRQA 4WZ6A 1Z83A 1W36B 3BRWD 4DIDA 2AKYA 2QA5A 4M8NE 1SXJC 1S1MA 2XTMA 3IIJA 3AKYA 3CRRA 4DSTA 2QAGB 4JBXA 5BXQC 3ND8A 1RC8A 4ESHA 2ZS7A 1N6IA 1XF9A 1SGWA 1ZCBA 2WWWA 3R8CA 1T0JB 4PAMA 3HU1A 5IF9A 1TAGA 2C78A 4M53A 4PPNA 2LKDA 5EXPA 2ZEJA 4HB0A 4O25A 2CCKA 2JJ2D 3K9NA 3WP1B 3HYRA 4LBYA 3U44B 1W5SA 2CHQA 4UNQA 2DFTA 4JKIA 4Q19A 1HTWA 2BMJA 2OAP1 5FI0B 2D7CA 2QRZA 2FFAA 3PV0A 4LYFA 5EXTA 4C0SA 1XTJA 2ZRPA 1G7SA 1P3JA 1Z22A 3GEHA 2G1KA 4Q1EA 1E79D 4MRVA 2JDIA 4JJKA 2Z0MA 3ONWA 4NYIQ 2E87A 4Q1FA 2W0SA 3NH6A 4DZZA 2PT7A 1NN0A 4M1KA 2KB0A 1COWD 1Z0FA 2GDJA 1YZUA 1NG9A 1W7AA 1YJ5A 1JXOA 2B8TA 2GJ8A 4TYQA 5FPHA 1U94A 1Z5ZA 3AP3A 1IN8A 4IVQA 2FOLA 2CE7A 3GJ5A 1KI1A 2P6UA 1QRAA 1JEDA 4A4DA 3VFDA 4B3XA 4B48A 2B7CA 4CDGA 4HLUA 5FPKA 1OIXA 4JSTA 1P9WA 1Z06A 2HYDA 2P0EA 5FUVA 2D74A 1E1QD 1R0ZA 3T5GA 3DMDA 3IO5A 2ZI4A 2YWEA 2QTHA 3I5XA 4HYYA 2ZRHA 1G18A 4LHYA 2DR3A 1VYUA 4QFMA 3SEAA 2PX3A 2VBCA 5CB8A 1B23P 1J8YF 3T12A 1HA3A 1U2RA 1OH8A 3DPUA 4LBVA 1NF3A 1T8TA 3TKLA 2PL3A 1OFTA 2CBZA 1G5RA 5E7MA 2WMNB 5JJKA 3LBHA 4KLNA 1NN3A 3MLEA 4EFMA 3IGFA 5EUQB 4IW3B 1QHGA 3G82C 3MUFA 3U44A 1P73A 1J8MF 1T8UA 4D4LA 4YXWA 4A1FA 4B73A 3SJAA 2QP9X 4DLXA 3B78A 4QOSA 5TXGA 4AKIA 2IYTA 2QT0A 1NVUQ 4FWTA 1R10A 1NL3A 3K0EA 2RGGA 4OQFA 3U7GA 4B6FA 2XTNA 1W5TA 1VG1A 4WXPA 4EKDA 2QNRA 2PMKA 4PZLA 4YDHB 5AK0A 4FW9A 3BD9A 2WIBA 4TMTA 4LPKA 3SQWA 4NZYA 3EPHA 1GM5A 1T3LA 2AHOA 1EXMA 4JLMA 2WOOA 1OH6A 1Z07A 4Z51A 1FQJA 3KFVA 3GLGB 5DI3A 3SJZA 5DN6D 3ZIAA 4W5JA 4L4UA 3TR5A 2YWFA 2DY1A 3ZVMA 3ADCA 3AVVA 1P61B 3OIUA 4Q4JB 1EX7A 2IYVA 3MWLA 1R0YA 1YR8A 3L0PA 4NCNA 1YZQA 2IA5A 4W7SA 5DHAA 4XH9B 1CR4A 2XB4A 3TR0A 1XEFA 4OHWA 1S4QA 2P5SA 1TF2A 4FMCB 3RNLA 4GL2A 4LJ6A 4ILEA 2WPDA 2X8AA 1KK0A 1NBME 2IX3A 3K0SA 1GKYA 4KO8A 1DADA 2GKSA 1G8GA 1S1CA 3QKUA 2FE4A 1E98A 1QHNA 1P2UA 2WJYA 2NO9A 2BBWA 1AZTA 1DAMA 1DO0A 5C46F 1D9XA 3LXXA 1UBGA 1YR6A 3OAAD 4Q9HA 4YMWA 4DBLC 2WJHA 3QNUA 2WAYA 4W9MC 1SKQA 1SULA 3RS5A 4OK5A 2GXUA 4UNPA 2VHUA 3VX4A 4QJ4A 2R6DA 2XITA 5TDHA 4DT1B 4D4MA 2JLZA 1ZM9A 2F6RA 2XZOA 3LXRA 3PG5A 2QE7A 2ZM5A 2BCJQ 3NBFA 5GJWC 3MWYW 4HLUC 4NU0A 3TLXA 3K09A 1KI3A 1W36C 3WNCA 3D6TB 1H8EA 3W8RA 3TW4A 3KKMA 3AEZA 1IN6A 1OHHA 3EWSA 3UATA 2VF7A 2QTFA 3R7WA 3V00A 4HSEA 2QAGC 4F4JA 4OHVA 2OBMA 4HDQB 2RGXA 3PVSA 3A1UA 4QNMA 4DLYA 3DVLA 1KDOA 3AP1A 3IIMA 521PA 2AFIE 3B85A 3GLGA 1VHLA 1C4OA 5CJ2A 4G5OA 1Z47A 1XTSA 2O8BB 4ZCMA 1ZU4A 4Q4JA 1BYIA 3EPJA 3ADKA 2V7QA 4NCHA 4F4IA 3W6OA 1CIPA 1CP2A 4KLZA 1W44A 4BEBA 1XMJA 1L4YA 3TW8B 2I1VB 3TSOA 3NHBA 2ZI6A 1ZINA 3CH5A 4G0NA 4JLDA 3GFTA 4AKEA 1Q21A 3B6EA 5FTNA 1YZTA 1U8AA 1KKLA 2H17A 2IL1A 2KWIA 5HCNA 2JJ8A 3I8XA 4NHOA 5EE5B 4NCKA 5FTMA 1Z0AA 2MMGA 1YZGA 3TQFA 4BZXA 2VP6A 4B74A 5BN3A 2HLDA 4DT1A 2RCNA 1HURA 3OIWA 2QSYA 5AUOB 3LDAA 2J0SA 1LY1A 1IN7A 1NMXA 4Y0VA 4JSYA 2GCPA 3X1ZA 3P26A 4TYWA 1T4GA 2ZRJA 3H4MA 5ELXA 3KZ1E 3ZGXA 1GRNA 4F4CA 4CIDA 3QKRB 3I1FA 1UKVY 2CK3D 3K9HA 3A1SA 3LNCA 3HU3A 4XD7A 1ZYUA 2CVHA 1NSTA 1X8KA 3CNNA 2YWGA 2QPOA 1GDDA 3THXB 3WBJA 1GNPA 4BRUA 3LD9A 2X77A 4TL6A 2QMUA 1JPNA 4KFTA 2WIAA 1E32A 2F43B 2CHVA 2OILA 2VEDA 4FWIB 1UKZA 2AL7A 1F5NA 2BIFA 2R65A 3GP8A 4WZAE 2IS1A 2G3YA 2VLIA 1XJ0A 1ZIOA 5FL3A 2QQEA 1GILA 4YMSA 4CW7A 2C03A 2PZGA 2ZRNA 4K8OA 4JLOA 2D06A 5FOXA 4ZI3A 3FHTA 2F3TA 1RJ9B 3QEOA 4L9WA 3KKQA 1MRSA 1XTRA 2E1RA 3LBIA 2IF0A 4ACAA 4BEJA 4BUJA 1SVOA 1R8QA 3NDPA 2IUUA 4URYR 4B3CA 5DIFA 1OF1A 1N6NA 3WYGA 1G3IA 1AS0A 5EJEA 5J4VA 2AD5A 2FN4A 4CF7A 5A4JA 2NO0A 1U99A 2QUZA 1QHSA 4A0RA 1S96A 3W6NA 4XVQA 3S1AB 3WHLA 1JR3E 3K8YA 4OL0A 4C30A 1TADA 1VDZA 2DWPA 2GF0A 3K0CA 4QNRA 4A15A 2ODWA 3OFNA 4TLBA 3BFXA 5JCZA 4A8JB 1GVNB 1CTQA 1KSHA 1RVDA 1M1YE 1WA5A 1YHNA 4PZZA 2J0UA 1S3SA 3X1XA 2CEAA 3ZS8A 2C77A 4WA7A 5KSZA 1XNJA 4BFVA 4PPFA 1ZAKA 2AXPA 2ZYUX 4WW0A 2G9NA 3ZS9A 4I4LA 3THXA 1XPOA 1DTSA 2WMOB 4Q1BA 4XOIA 4F7WA 2F43A 3RWOA 5JWOA 1S9HA 4C0KA 4LCBA 4TZ6A 4BLPA 3OIYA 3UMSA 4I1VA 1RIFA 3EAQA 3UMRA 1JECA 1NJGA 2YC2C 4LJ9A 3PR1A 1JALA 4D2IA 3EZ6A 1AN0A 1E9DA 3CX7A 1KDTA 4IHQA 3KFXA 2HCJB 1OB5A 5B64A 3K53A 1ZM7A 4BFXA 3NIBA 1RJ9A 1E2LA 4LZZA 1IQPA 2QM8A 3BERA 4MGIR 4HLQB 5JLJA 3A1TA 1Q12A 1KNXA 4CEJB 1N6HA 1GWNA 3KKNA 2F9MA 1N6OA 4EFNA 2YC4C 3MWKA 4DDVA 2NTYC 2G88A 3UG7A 2ANBA 5KYKA 1TF5A 3GCGA 2QBYB 1G291 4URZR 4JVSB 2GVDC 2GTPA 3QBVA 1Q3HA 1Y63A 1ZVQA 1Q20A 4XWKA 2IXFA 1IJFA 2IXGA 2WHXA 2IYQA 1SKYE 4M0LA 3AUYA 3TSZA 1Q57A 4DLSA 3S1AA 3X1DA 121PA 4KVAA 4FMCF 1OIVA 2ZI3A 3A4NA 3Q7PA 1JI0A 3L0SA 3W34A 1FP6A 3P4YA 4HUTA 4A0FA 2HT6A 4QBFA 2G0TA 3BB3A 3JZAA 4IFBA 5L3QB 1E1RD 2QTVB 4QL3A 2XSZD 1ELOA 4B2PA 2A7QA 4PPQA 1HYQA 5GADl 2EWWA 1NMZA 2W83A 3KJGA 2JJ1A 1Z63A 4HLCA 1GL6A 3KJEA 3ZVRA 4E5UA 1FNNA 1MR3F 4RCZA 1KMQA 1V43A 1FUUA 3UWKA 1BMFD 1WRBA 3TUIC 2RGNA 3AUXA 3AF4A 4I1UA 3IUYA 4TT3A 3DKVA 5BN4A 4GRAA 4CYMA 4EFLA 3RS2A 3VNVA 4IDPA 2FWRA 1AGRA 2KE5A 3CONA 3VR4A 4FD2A 1SVMA 1M2OB 1P62B 2VA8A 3WMEA 4W5WA 3BXZA 2VP4A 3DO6A 1O87A 1G3RA 4A9AA 2JLWA 2GXAA 1FPMA 2ORWA 1JEEA 4CEJA 4FCTA 3P32A 4XJXA 3NWJA 2ZVPX 4M9XA 4FI3C 4B44A 4LY6A 2FZLA 4I99A 2H92A 3ZJYA 3B1XA 2QBYA 3U6BA 3T1VA 3FKSA 2A30A 4BLOA 1GNQA 4M1WA 3EIEA 5KSPA 3SBEA 3PUYA 3VAAA 2LCFA 2WSSD 3AF2A 4LX0A 3AQ4A 1Z6TA 3U3JA 2DB3A 5KNCA 4A36A 5JI2E 4P0TA 4C0JA 2NO1A 4AG6A 1IM2A 2WOJA 2UKDA 3L8YA 4TYPA 2FGKA 2AWNA 1GAJA 4GFDA 3SR0A 4TQ9A 3OEHA 3PUVA 1E9SA 1UEJA 3RRZA 4URUR 4JLJA 1NY5A 1H8HA 2BV3A 4LV6A 4HB4A 1D2NA 1CF4A 1LS1A 1E0SA 4Q48A 4Z8XA 3N70A 3CRQA 3MGCA 3NKVA 2AXNA 1EX6A 3L8ZA 4B3BA 3RAPR 3U3KA 4UNRA 3TK1A 1XU4A 4HAWA 3KQLA 2EVWX 4EPVA 4P32A 4UQOA 2QMEA 3FMOB 3I8SA 2RHMA 1KI8A 5GJVC 2EFDB 3RC8A 4Q9LA 1NBMD 2BWJA 1OT3A 1TF7A 1X1SA 3OEEA 2BMEA 2V4ZA 3H1TA 3ETLA 4QHTA 4LHZA 1IBRA 2Q9AA 3IPYA 3U3MA 3T5DA 5SZHB 1R6BX 5JWRA 2JLVA 2ATVA 4A8JC 1V5WA 4NCIA 4Q5IA 4TTPA 1OXUA 1KI6A 2QEQA 4RZ3A 5J4LA 1W49A 1C9KA 3Q7QA 1QF9A 3SI7A 1ZBDA 4PPGA 1JJ7A 4DLVA 3RRYA 3HPRA 1Z6XA 2KI5A 2A9KA 1SXJE 2IYLD 2N46A 5JHGB 1OLOA 4Q03A 3MWJA 4LHVA 4D0GA 1E4VA 2JGNA 2ORIA 3PFIA 1SXJA 3CX6A 2ZUDA 3K9GA 1OFIA 2IYYA 2ZU0C 2RGNC 4LWZA 5IK2A 4Q4HB 2IWHA 2BHRA 2FH5B 2WKQA 4LRWA 3W9YA 3EX7C 1OFUX 4ASUD 4PO9A 1U9IA 2WZQA 3VKGA 1R2QA 4A0HA 1LNZA 2O8EA 5EP2A 5SZKB
chains in the Genus database with same CATH superfamily
5CW2A 3M9LA 4HDRA 1J21A 2FZKA 4U02A 3R6LA 4YJ2A 1IHDA 4WEOA 2J46A 2IS6A 1DT3A 3D6JA 1PQPA 1AUXA 2EL7A 2IQ5A 3AFOA 1U0GA 4L16A 5J2TA 1NVVQ 3QLJA 4PWZA 3IUBA 1RI3A 3F1LA 3LOPA 1QSGA 4KMOA 1B76A 1KA9H 2ZUSA 3FIUA 3N3BC 4FINA 4ZQEA 5I9BA 4GZMA 5ULLA 5MFPA 3S27A 4CG2A 2HJGA 4D9BA 3LUCA 4JT4A 2X7HA 3CR8A 3ZCQA 3TINA 4FDUA 3N74A 4YPVA 1F7VA 3BJRA 3H2YA 4P7JA 1E6WA 1RYFA 1ADBA 2H0RA 1OH7A 1T0UA 2QQGA 4LZOA 1P0PA 1TJ5A 2RHOA 4C3ZA 4EG1A 1EUZA 1J1IA 3EIQA 3HS3A 4HMQA 3AW9A 4MITA 5EIWA 2HWYA 5F7XA 2XUJA 4ABYA 4DA9A 2IRWA 2V6MA 3MWEA 3PSHA 3D1LA 3GROA 1L5GB 5A4MS 3L4SO 3O9MA 5BNWA 3Q8KA 2AN9A 3L0OA 1A2OA 3ELUA 3E5HA 1TTTA 3T5TA 1JIVA 1MA3A 1C3OB 3EUEA 2A78A 4RCYA 3L0DA 1YS9A 4A0GA 1LPAB 3TRDA 2HXGA 4AJ4A 1X70A 1M2WA 2AJ8A 3S70A 3SFVA 4DDTA 1UK7A 4N3BA 1J0AA 1ZD8A 1IN5A 3THYB 2GF9A 3DBVO 3FUWA 1TC2A 3TZQA 4BCBA 4DUGA 4MB0A 5JTTA 3C98A 4Q4AA 4G1BA 3IDZA 3AYXB 2YMPA 4J0HA 3DXFA 2UU9B 3C7AA 3R9XA 3W5HA 5IWAB 4YRBA 5CNIA 3AFHA 3T7CA 3LO5A 2WT9A 3GMTA 2M9MA 1EBUA 2BSQA 1DAEA 1TKRA 5KHAA 4L2IA 1OCEA 3MINA 4MV6A 5JBIA 4TV8F 1HMPA 2PT9A 3LM8A 2XLBA 3OQIA 1V8DA 1XD2B 1WF3A 4B84A 3ONFA 3UVEA 5K2OA 3IB3A 3IL2A 2FHSA 2OZKA 4RD0A 5LUAA 4NYJQ 4RY8A 4A5SA 1U0BB 3CH4B 3D6AA 4OMCA 1VL5A 3EZ9A 1N5MA 3LT4A 4NRDA 2GGSA 2EQBA 5ALLA 3ZPXA 1ZJ5A 4UVEA 1JFVA 3BDVA 3OT1B 5E1DA 2HPHA 4ZT5A 2O19A 2AF3C 4HS4A 2ILVA 3HLYA 4LOJA 4PLHA 4S0ZA 1AM4D 5IDVA 2H1HA 2FX5A 1ZW6A 2OYSA 5LKRA 3N2KB 2M98A 5FFMA 2LR0A 5H1YA 1YACA 1L7BA 1ZSNA 4ZOAA 4ZI5A 3UH1A 3M4YA 4MQMA 4RPHA 1GIAA 2B7LA 1JR3D 4LZWA 1BOFA 3VNSA 5KKAA 4JIGA 5AI0A 3H18A 1T6NA 4EVSA 5KQLA 2NPFA 1NRIA 3GJ0A 1JEOA 2R5WA 2PRJA 3PNQA 3K72B 4XD2A 2HLPA 3UJPA 1CUJA 1RMQA 5AUNB 2ZS8A 1EFRA 3BFVA 2UYHA 3NOVA 2HHCA 2PX2A 4C3OB 2C4WA 2G36A 3KDAA 5LN1A 1ZN7A 4BDSA 3QEKA 5FF9A 2WJPA 1ENPA 5JDCA 2SICE 3Q10A 5CLFA 2O2HA 4H0FA 2HDHA 5KYWA 2WIGA 3ZK8A 2QV0A 3MELA 1QHEA 4RXUA 5M29A 2IHTA 3RADC 3M6WA 4IIHA 4Q6BA 5FBLB 4C14A 1W47A 1VKRA 2FZWA 1E8DA 3SDZA 2D3WA 1ORHA 2ZULA 4LGMA 3WIVA 4I50A 1FUKA 1DE0A 3IAAA 3PHBE 4R41A 5BPFA 1D2MA 4UEJA 1DAIA 1CNFA 1P4SA 1ZCJA 2E89A 4PLVA 5L45A 5HK9A 4PHTA 2BGMA 4DM3A 5ALKA 1XN1A 1CS0A 2DFKB 1AUOA 1YVEI 1ZG3A 1NP3A 2VPXA 5EJ9A 2H59A 1Q1ZA 3CF4G 3NAGA 3KJQA 3VPBA 2Z6VA 2C8JA 1BMQA 4HAUA 4JKOA 3CRVA 4N82A 2W43A 3GNQA 3LWZA 4NOLA 4JQSA 1Z7EA 5DHUA 4G0YA 1SVLA 4JP8A 3NHWA 3RFCA 2O0MA 2E4XA 3O93A 3PFGA 1BO6A 1DHRA 2NUPB 4R9UC 2WTUA 4RW0A 3FYUC 4A7PA 2VDUE 3A6EA 4QGFA 4D8WA 4H17A 5LIRA 5DV9A 4YJ2F 4R16A 2F67A 3QVJA 5EJMA 2XPCA 3PQCA 4MQUA 5GV7A 4MV0A 1VMAA 3QY9A 1BEUB 4FPXA 3FWHA 1Q6ZA 3KVOA 4LHWA 5AYVA 4X91A 5JT1A 5K99A 3UAYA 3M1YA 1C4KA 3VOAA 4RLFA 3BGDA 2ZSKA 4YIKA 1JSXA 2C9BA 1IXKA 5J2TF 3C3AA 1V3UA 3EH2A 4EP1A 3CUWA 2R5FA 2QAGA 3RVBA 5DLDA 2WE8A 4J7AA 2OEPA 1QAQA 3AVYA 3BCRA 3UT5A 2QZ4A 1DRUA 4R2XA 4D9KA 1IZYA 1JWBB 1NF9A 3D2BA 4J1TA 4YUVA 4D9GA 5A5FA 3NOQA 4FBLA 5BYKA 2WAXA 3GJ3A 1FP4A 3TSWA 2GZAA 1AIPA 1XLTC 3AR8A 3USCS 1QF6A 2PFKA 4EQ6B 4XQGA 2R86A 1DAHA 1VKJA 3EOBI 3ZZ1A 4ZIRB 2I1WA 1E2FA 1E60A 4EB6B 4DSOA 1FXSA 1YQQA 3I6ZA 4G37A 3EXIB 3I9NA 1VFNA 4BGDA 5JY6A 3R5FA 3THSA 3CLRD 4R83A 5ADWA 3QLVC 2H1VA 3EF0A 1T6ZA 5D3ZA 5E2BA 3T61A 4K46A 4AFNA 4YV2A 5EJGA 1VI5A 5H7XA 4YMTA 4CGZA 4RADA 5I9TA 3DO5A 4WKNA 1E3MA 3GK3A 4CM5A 3E9NA 1FMTA 4PLGA 1KVQA 5IUNC 4I08A 4UAUA 1LC3A 3A27A 3AERB 4MKXA 1E3JA 4BX9A 3GLFB 2BMAA 2ZJ2A 2XD9A 2C8KA 4WDRA 2OL4A 2VWQA 3LC2O 3N2IA 1II8B 1A77A 1RYDA 2C1ZA 5I47A 2QN6A 3K70C 4KN9S 2UXBB 4GW3A 4DRXB 5JD6A 3PCRB 1A8QA 2GAIA 4P9NA 1L5QA 2E3JA 1JJIA 4MMYB 2RGDA 4RD6A 4WOJA 4AU1A 2W6ID 4QBIA 5D86A 1N7JA 4GWGA 5EG5A 3RVKA 4C4OA 5LMCA 4BKRA 3HGQA 4RFLA 4ENQA 2V6BA 4B32A 4NESA 2J30A 2HJWA 4B3DA 5K0TA 4P4SA 4JI3B 3T7SA 4DV2B 3I34X 1ODIA 4DCUA 1ZAYA 2OV6A 4CM6A 2O54A 4K0RA 1MEJA 2JGDA 3TG2A 2EF0A 3P9CA 4DKJA 4YDRA 2FWPA 1B2LA 5ANRB 2WKSA 4RVUA 3NC0C 4YLYA 1M6NA 1DQYA 1NJ8A 4HB3A 4GOOD 1PN3A 3RABA 4BEVA 8ADHA 5KNBA 3R3XA 2O3QA 1E66A 4ZQCB 1V8OA 1J97A 3MTDA 3C7TA 3PUXA 4JEUA 3LK7A 2LKCA 3LOQA 4GQBA 1OWLA 5SZJA 2VXYA 3EUAA 3LZDA 3UT6A 2YCBA 4EJ2A 1NI3A 4ML3A 2E18A 4MLZA 4B3MB 3SYKA 2AGVA 4XJTA 4BMVA 4F4HA 2E4WA 4N01A 1NUAA 2VTKA 3LFUA 3FPCA 1VLZA 3QFSA 2OKCA 4OPMA 2OXTA 2ZXUA 3NORA 3NALA 3DKKA 3RWMB 4B6OA 2IS4A 3U6KA 4EKIA 4FZVA 1N2HA 1CZHA 1C3EA 2IYRA 2C2KA 2WABA 1P2SA 2Q4DA 3CUKA 3CWCA 1X19A 1RKVA 4ZQHA 3QW4B 4OMFG 2IZ0A 2X2OA 4HH0A 4ALKA 3BD7A 4JJ7A 1I1HA 4GU5A 1GP2A 1KIFA 3MMPA 1QLHA 4RKWA 4UEWA 2OGWA 1LBQA 4P4TA 4ED9A 2H7YA 4YWJA 1VE1A 3L77A 2PV0A 2G4CA 4AMGA 5BMVA 1UP4A 1SHJA 1VKNA 5CX1B 4YJHB 4Q3EA 4B2LA 3GCWA 2F48A 2A5LA 4EJMA 2XKBA 5K0BA 2J85A 2P2GA 2QVXX 3RFFA 1I13A 1L6IA 2CZGA 4I50F 5SZIA 2J41A 2ZITA 3CLTD 3DB1A 3DL4A 5JR3A 1AMNA 3JQFC 4XAQA 1U1CA 5KTRA 3E58A 1NI5A 4RVOA 2NT4A 2XE6A 1WW8A 2JCGA 1TI7A 4KQFA 2QUAA 1EDOA 4RAQA 3GB9A 5DMHA 3R76A 2QTAA 4ITVA 4DA8A 4E13A 1NNI1 1CJBA 1GGMA 4XM2A 4D8XA 2VBIA 4HI0E 4JR0A 2Q5HA 2JKZA 3O4JA 3EGEA 5CURA 5JSZB 2XGJA 1LSJA 2R2AA 2EATA 4G63A 1IL0A 1LDGA 1H2FA 4LG1A 2CYCA 4M60A 2E48A 2OCGA 2WWIA 4E5DA 4TKZA 3COSA 1PL8A 4MV9A 3HADA 1SBZA 4HYQA 2H5JA 1ZI8A 3ROKA 1UWVA 3IAFA 4EKEA 2UUBB 1RLOA 1U6JA 3NT2A 1T1GA 2NZJA 2BH9A 5TQ0B 1J06A 3S55A 3TSYA 3R7LA 3U48A 1DVRA 4J76A 2KLHA 4O0LA 1CQXA 1YFJA 1II0A 3NW9A 3EPRA 4AMUA 5LNK1 2ZZKA 2BL4A 2OFOA 1OPRA 1S8OA 4KGZA 4RK1A 3TL3A 1C1YA 1W2WB 1EEHA 2OCDA 1FF9A 2X5OA 3AU8A 4HTFB 3RYIA 3SC3A 5BN5A 3H65A 3ILYA 4S24A 3WMXA 3LPAA 1Q0LA 1PS8A 2H2HA 2ZXFA 4FU0A 1Y6QA 1K3UB 3QITA 1PWZA 4Y2HA 3DC2A 5ALIA 1NNEA 4KYUA 4Q7KA 3GT4A 1I3LA 4R68A 4BMCA 4BTLA 4BPBA 4R0MA 1V9SA 5HWSA 4DADA 4B4WA 1TEZA 2BGIA 4H1TA 1HQCA 1EUCA 3NASA 4C2TA 3W8DA 1VKOA 3P9YA 2JRLA 2DKNA 1PZGA 1NIPA 2R8EA 4QELA 1K7SN 4EZEA 3H6KA 1NMYA 5FWXA 2X42A 2CLEB 3LCJA 4CGYA 3EA5A 1RQNA 2WM8A 2Z8YA 1DELA 3V2UA 4IJQA 4X7RA 4XIFA 2KYRA 4CM4B 5FHRA 3A26A 4CIAA 3Q8MA 1XZMA 1QYRA 3K5IA 3S7TA 1I9GA 1RKXA 4JP3A 3UMYA 1AMOA 5H59A 5D85A 2HREA 1X7YB 3SDBA 1CG6A 3JQ7A 1EHCA 1WOYA 3PU6A 1BQ3A 2D1QA 3EMDA 1I24A 3LBYA 1G3MA 3A6FA 1WE2A 3FGPA 4CTMA 3B8EA 5ECDA 2BDEA 1COZA 3HJNA 2VKTA 4J1QA 3ST7A 4DMMA 1B6TA 2G6BA 3AV3A 4PYOA 1WMDA 1R0CA 1RIIA 5CA1B 1XZQA 2FR8A 3NC1C 4L7QA 4R2HA 2H7VA 4MGKR 4PVDA 1B8PA 3G0IA 4E1VA 4B09A 3Q9SA 2HMTA 3X1YA 4AAYA 4ZJPA 2NU7A 1XKLA 3ZY5A 4E5SA 1ZO8A 4C08A 3OT4A 3UANA 3R09A 5DBHX 1BGWA 2D62A 4ZWNA 3ZUGA 4FJ0A 1G20A 4IIUA 4LE1A 2OXCA 4QVGA 5BW6B 5BNTA 1Z4LA 1IUPA 1DXOA 3KQHA 2J67A 3MCWA 3HUFA 5EIBC 4GMHA 1J90A 3MJ4A 1KO8A 3HKDA 3V33A 1JFFB 4OFXA 4BDTA 3ICQB 4MUGA 1QJ4A 3CT6A 3AEXA 4NE7A 4OQNA 1YZFA 4BYGA 3SZGA 1UFKA 1N9KA 1V5GA 2FWIA 2OFPA 2ZYIA 3WJAA 3BMCB 4BOYA 4QXQA 5CH3A 1Q1EA 4L85A 5JJIA 4RWZA 4EK9A 1HNXB 4RF5A 3QKRA 4G0PA 1PSDA 1KEPA 2C8LA 4PR0A 3SJBA 2GWRA 4LXQA 2X9GA 1QB7A 1P0IA 3KUKA 5CAEA 1A8IA 1VJRA 4LJAA 3KEFA 1NNUA 3RKSA 1IZ9A 4QIHA 5A05A 3C16C 2Y1EA 5DU2A 2EAUA 3SX2A 1U2GA 2WVGA 3HN2A 3JQ8A 5F76A 2HGZA 3EYAA 3HJUA 1FDVA 5FADA 3HWSA 1TO6A 1QFMA 2WFLA 3PC3A 2AR9A 3KFLA 4J4HA 1HV8A 4NZZA 2HHJA 5LA6F 1Y1KE 2BRUC 2PS9A 4Q01A 4BHTA 4INOA 1XZAA 3AV0B 3AR6A 1JJBA 3FDXA 3GLHA 4ZVSA 5KCZA 3PJRA 4MKFA 5DYIA 3U4AA 2DULA 3H99A 1VPTA 3U7JA 1DMSA 3C15C 4BNTA 1U7UA 4U00A 3LWNA 3EVEA 4I3HA 4Y6QA 2X40A 3VI4B 5HQTA 1GL3A 4H3HB 5FTLA 3UB2A 5JD4A 3BEDA 1Z68A 2GN6A 4IWYA 4MQ4A 5EIAA 4C0HA 1YRBA 2Z08A 2ZRAA 4GQIA 3TPFA 5K20A 1LLQA 3MK31 4HGOA 1MENA 4LV5B 5BV1A 2IW1A 3DLTA 5EEHA 1TQHA 4MJXA 5FBHA 4HRYA 2EZ4A 2ZAMA 2OUIA 5E4FA 1XAHA 3LPNA 5E3HA 4F3YA 3ET5A 2W9XA 3TB6A 2ZJAA 1GZUA 4ERXA 1Z0DA 1XC7A 4CEIA 3CG0A 4JL6A 4OHBA 1QHXA 2WDPA 5YASA 1ZHFA 2H4ZA 4GC9A 4GP6A 3VJRA 2BJWA 2VHEA 4NDNE 3WKBA 3HZRA 3MLAA 2VDWA 4J6FA 1V9CA 1BQEA 2PUGA 1FNBA 3HY6A 4GHWA 2DPMA 5ITZA 2F9LA 4Y7CA 4KE9A 2AX3A 2I67A 3FNEA 1HC7A 3D4PA 1TYDE 3RBVA 3PQEA 3HNOA 1NP6A 1L2TA 3MMZA 2I6QA 4B81A 4M9CA 4BN5A 5CLLA 1F48A 2VHYA 4NV0A 4ZJZA 3WKCA 3QSYA 4FMPA 1UEIA 2RAVA 1TPYA 1DEXA 1TUIA 2ZSHA 5DX0A 1E1QA 1WBDA 5TSDA 1WM1A 4WXEA 4KO4S 1XQXA 1GYRA 4AKTA 1AHIA 3DZ8A 1ULSA 2FJPA 5L3ZA 5MGBA 3L5OA 1C29B 2IY8A 2YOGA 3O95A 3HXMA 5DGDA 4TMZA 1GTVA 1XRRA 2GK3A 3NTQA 4CQLB 5JCPA 1TJ4A 1YE3A 2MOKA 3LC1O 4RDCA 3X1WA 3ODPA 5IAAA 4XR4A 4C1NA 3DKPA 5M04A 1EWTA 1Q3TA 1N7HA 2ZR0A 3AR3A 3UPTA 1DAFA 3TQCA 1O6GA 2QLTA 3DUFA 3NUGA 3OMLA 4GZ6A 5IN5A 4YIHA 1CIVA 1SQ5A 4AQDA 3WBBA 4CMIB 5B36A 2GM5A 3I6MA 3O5AA 3FDZB 3T3OA 1JG7A 4RFVA 5DLQC 3ZLUA 1SQFA 1KJWA 3PKIA 4ZA2A 2FSSA 1RSZA 1P4RA 3V7WA 3KVRA 3HDHA 2C7QA 2R00C 4D44A 2GPNA 4HJRA 5IHPA 3TVYA 4TSRA 2DSTA 1VLHA 4L4SA 1FNCA 4MZDA 4Q00A 4EAAA 5F9HA 2YXNA 1R9MA 1PL7A 3DEAA 3JALA 3LVRE 2VQDA 4G6ZA 1IHYA 4QDXA 1M2KA 3MBKA 4QXAA 3TO5A 3OEWA 3ILXA 3W8NA 1MXHA 2ZRCA 4ZDKA 2V7XA 4AX8A 5CDUA 3OOEA 3VDRA 1FUIA 1A9OA 4N40A 4QFBA 2POQX 1KSFX 5CHYA 3ZZNA 4C6TB 4UTRA 4C0BA 2GK7A 2YFKA 3K9FC 1KFBB 5D1NA 5C8DA 4BMXA 1NN5A 2YIMA 1DC4A 3D8TA 1AV7A 4PC2A 5GONA 3E05A 2VF8A 4OP1A 1YI8A 3DOJA 4YC7A 1V45E 1QYDA 1V1RA 3L49A 4N3NA 4RENA 3UUFA 3CNQS 2JB9A 1GDTA 3QU5A 7REQB 1FCJA 3KDSE 3GELA 3DCJA 4MSUA 5TNXA 5EI5A 1T24A 3RHFA 2VDMB 5KPDA 4BNFA 4LTMA 2WB4A 1NNLA 3BBLA 3BXGA 4JLKA 4BRZA 5A3JA 1Z0SA 3EGOA 4RGVA 5CDSA 2WHQA 5ICMA 1GSOA 3DVQX 5BV7A 3VNRA 4RTNA 2C5EA 4YPOA 4RCVA 4R1NA 2G4VA 2J5XA 3KU1A 4PLPA 2FUNB 5B30A 5E1OA 4L0DA 2PAFA 3BTVA 2ZSAA 621PA 3EXAA 3HUDA 4GLFA 4IIXA 2ZI9A 4UAJA 3DBHA 1TJPB 2VR1A 3TJRA 1XMSA 4U7DA 5KTTA 1TA9A 4NEQA 5EPOA 1CD5A 2I8CA 4ZT2A 1NT4A 2DJ5A 3CRMA 3V4OA 5JMTA 4EY8A 3VA7A 2F8SA 3CLVA 4P5PA 3DO8A 1DGQA 3V3TA 2RGBA 2ZKIA 2G25A 5BSTA 4IH4A 2OO5A 1JQBA 1JFRA 1DDGA 1QORA 2YUIA 3R0QA 2SECE 4EHJA 2BFWA 3A1VA 3Q0TA 2D2IA 4DCPA 1OXVA 2K7FA 3KKPA 3NO4A 3ER9A 4HLDA 3DBIA 3FYCA 2AOUB 2B98A 1TTPB 3C6BA 2RH8A 1MAAA 1R9NA 4OQXA 3CZPA 1GNVA 1HNZB 3MTQA 2Q4OA 1M2HA 3QVGB 1J0XO 2QMOA 2ISCA 1PV1A 3PKJA 5TY0A 3OZIA 4S1NA 1G6OA 1NPTO 1OHHD 2O06A 2BEVB 1ZEMA 3NXSA 3HNPA 5CVUA 3Q8LA 4RZ2A 4NFYA 2QL5A 2VNHA 1JU9A 4OBBA 4EPRA 4CG1A 3O0TA 4MQEB 3DDSA 4BQSA 1UBOS 5LB2A 4RHUA 4ZK2A 4ARVA 3AKZA 5T7BA 3SE0A 2H4JA 3O74A 4E08A 2JRCA 4B34A 3SS7X 3KTOA 4QPDA 5JXJA 3ZVNA 3WI7A 4KQIA 4MRMA 5LP6C 3E53A 3SZRA 5GM1A 5JXHA 1OAAA 1RCUA 2XCUA 1CFJA 3NQ41 5EPUA 1VIVA 2GSDA 4X1YB 4ARUA 2CFSA 3BGIA 1ZOIA 2HK6A 1KE1A 1R3DA 2I4MA 3D3WB 1YD7A 4DABA 1J1ZA 2A1IA 4LC9A 3QEMA 1D1TA 2B8NA 1JHXA 2QTZA 4CTNA 3NPAA 4YP7A 2IV3A 3RSSA 3O2JA 1MMFB 4LKRA 4MPPA 1BCSB 3TE6A 2ZOSA 3TGPA 1PLKA 1U7XA 3NATA 1TM1E 2O1WA 2HXYA 4IX9A 4M21A 4WCFB 4FFDA 4U3JA 3VYRB 2ZIXA 6GPBA 2A9JA 4NBRA 1HYHA 4LF4B 1JAHA 1HE5A 2PS0A 4RJLA 3SOZA 1JTVA 3LX8A 4KRXA 3BMOA 5JNTA 2Z43A 4RH1A 3VR5H 1O7JA 1PBTA 1J09A 1TU4A 2C0CA 1TUGA 2CUZA 3E2MA 4HWPA 4ZRDA 2HLDD 3NYRA 4RV9A 6Q21A 1XCBA 4F4UA 4NU8X 2YY5A 4II2A 3Q2KA 1XRNA 5ALGA 3SC6A 2EJWA 3IAM1 4HGNA 5K4AA 2PSFA 3FYUA 5BV2P 4WTOA 4X7BA 4KMSA 1QH8A 4V02A 1AOXA 1M10A 2VYQA 2Z3ZA 4GT1A 2Z95A 1U9ZA 4FYIA 5CVJA 5EKUA 2JVJA 2XJ9A 4KGXA 4DR5B 4OHRA 1C1HA 1XPJA 3WR5A 2JD1A 1KS2A 4FJ2A 4UZSA 1PZXA 2ZIGA 2MINB 3OPNA 3D59A 1WUHS 3BX1A 4E1BA 2I62A 4KW7A 1C1XA 2IKSA 4RK0A 3JYPA 4GYKA 2JGKA 2D0IA 2V7EA 3OLVA 3P5SA 3UEOA 4BJ6A 1IBLB 2CXOA 2P9ZA 2QYTA 4MP6A 3WK7A 4RC9A 1CQIB 1RWNA 1QTQA 3KHKA 5B7QA 2JCSA 1RHUA 4JFAA 3FNBA 3KB2A 2VP2A 1C7JA 5F1OA 4LF9B 1HSZA 2CXNA 4QYXA 1XLTA 2PD3A 4OA8A 5C8YA 5DTIA 5C7LO 4OM7A 2POCA 3QUTA 3TQTA 4DGQA 5GONF 1O4VA 3HP4A 4HWOA 4OQPA 4BPRA 2R62A 4HWSA 5BSRA 2JLQA 5DO9A 3WRXC 2QPLA 3T5BA 4KPYA 5AVRA 4M8SA 2FEOA 3R8FA 2QD5A 3QKSA 3WWPA 1JSRA 4BZQA 4IRUB 1F17A 2I6XA 2XZTA 1M2GA 1ECGA 4YWHA 2YXBA 4DDKA 1J9ZA 2V1XA 2XYGA 2ZKLA 1EU1A 1FNMA 3TB4A 3N05A 1UDBA 1XN4A 2QTCA 4GNRA 3GLIA 5T4FA 1Y7HA 2A9OA 3CXRA 3GBVA 1OBFO 4MA0A 4YLGA 4BNZA 1SOWA 4B7CA 3OX3A 1R00A 1OC4A 5E9AA 4EW2A 2W2LD 1T2UA 4EYKA 4XWOA 2BGTA 2JEZA 1FPQA 2VUHB 2IOFK 2P5TB 3INRA 3KX2A 4IF6A 4PR3A 2PX6A 3OFND 4TL7A 5JZBA 4TTAA 4YLEA 3BOSA 4ALMA 1E0DA 4EH1A 1I94B 3JARA 1W6UA 2QTMA 4ZOBA 1GO2A 1G8KA 3ZZMA 5JZMA 3P9QA 5ESWA 5FYQA 4D81A 2PXHA 1JZQA 4S1VA 2C9ZA 2O3JA 3AK4A 3K0HA 3QBDA 4BNKA 1Z8HA 3O8QB 4Q1DA 5CT9A 3W2IA 1KP9A 5C5EA 3R0XA 2HEGA 3FHOA 4BZPA 5KX5F 1TQ2A 1Z8FA 1MB0A 2XOXA 2QHXA 4PQGA 1SRRA 4R3WA 4ZOQI 4WESA 4EB0A 1OB5A 5AW6A 3PTAA 2VNSA 2GZHA 4X1IA 4Q05A 1IJEA 1N3BA 2OCAA 4WFIA 1G41A 1FDOA 4BQRA 3BL8A 3WRVA 4YJ3A 1P2VA 2I8LA 1K89A 1NR5A 1YJAA 2BJVA 2I2CA 1F2UB 4YP0A 3CBGA 1F4LA 3L7OA 2P75A 1QCZA 4Q24A 5HIJA 5I9IA 4BQPA 3KOWA 3ECCA 1B26A 3OQ1A 1L5MA 3O8BA 4LY9A 1GR1A 4WKGA 3SSNA 4H1UA 3FCCA 3I76A 2VHQA 5HHTA 2ZJBA 2Q3FA 3HACA 5BV0A 1ABBA 4P38A 2F59A 3IB6A 5CB4A 2C1EA 2NSDA 1Z5PA 1YA6A 4UD2A 2RBGA 1JGTA 1ZK4A 2SHKA 4KUHA 4FIDA 2J3KA 4FC7A 4HO1X 2PG3A 3M5CA 3UAOA 4QXMA 2P69A 3F8SA 4AY2A 2A0UA 3RHSA 2D0DA 4M1SA 1YXMA 3KU4A 3RSOA 4WVFA 1L6RA 3O1HB 3QYPA 4Y2VA 4F93B 3V8EA 2JG3A 5I45A 4ZN6A 2SCUB 3IE2A 5H8WA 1G55A 4XFJA 3RVPA 3HBLA 5IXSA 2G83A 1A95A 2ZRLA 1AB5A 1E3TA 1PDOA 1U0NA 2EG5A 3AY6A 2WLTA 3M5DA 1M7BA 2GILA 1XBTA 1Z4MA 2NZ8A 2WJVA 4CXMA 2IOQA 4DA0A 4XX0B 1J2UA 2XKAA 1MQAA 1DRVA 3Q5GA 5FPQA 3B89A 3CT4A 1W88A 4WPGA 2ZM6B 4RIHA 1GADO 1NLYA 1D1PA 3JWPA 2C3PA 2WNSA 4PQYA 4Y2PA 4LTNA 1ZHOA 3I09A 3VYTB 1FDWA 1I8TA 4WY8A 1YT5A 1SY7A 4G4SP 2IVFA 2BM8A 3HGTA 3HVIA 1ABEA 3C7KA 1GA4A 4MW7A 4QDOA 1WQ3A 4B9EA 2OTCA 1TMYA 1ZNQO 2UZ3A 2W4QA 4LE2A 3KSZO 4PZUA 4RFSA 3FPGA 5FPYA 3C48A 1Q0ZA 1HDGO 4BV2A 1SC6A 2FMHA 3RLFA 3AGQA 1BMFA 2Q0HA 4LRTB 1CJVC 2QLLA 2J3IA 1W30A 5DHFA 3SYRA 5SV2A 1LW6E 3MAAC 4EVIA 2K87A 3LW7A 2WM3A 3OKFA 2OO3A 3DHNA 3CRW1 2R1UA 3HDVA 3IEVA 3MN1A 2CWWA 1BHJA 5AKGA 4D3YA 4MI3A 1OX4A 2GARA 2D7DA 3VR4D 2FXIA 2WC1A 3LQQA 3R75A 2DLNA 2ZQZA 3LF1A 1SB9A 5ICSA 5BPHA 1Y3FE 3C8MA 4PC1A 1TECE 4EM6A 1K6EA 4P84A 2DWCA 4GKAA 3CIFA 1YONA 3H6GA 3AI3A 2OBBA 2X41A 1XKXA 2MU1A 2H18A 2G5TA 1TPZA 3MXTA 4TTQA 1KGSA 2RAPA 3HYLA 3JVDA 3LUDA 4WI1A 1MB2A 5G0UA 3GYGA 4A27A 5LQDA 3VAYA 3DW3X 4W1RA 1ZUIA 5C8YF 3RGWS 2YR0A 3T06B 1R0LA 3JASA 2ZPTX 3DQPA 4TLMB 2QKYA 1F8YA 2VTDA 3CWZA 3C3WA 3MSCA 5P8WA 1N57A 3I1JA 4COOA 5A3VA 3F9IA 4K9LA 5K1ZA 4OAOA 3I92A 4D79A 3R7WB 2PSDA 3R3HA 2BOVA 2B4QA 4AT1A 4W6ZA 4ARZA 1HE3A 5FYDA 4J8PA 1JIUA 1C3VA 3OETA 3OH8A 4BVJA 1J9GA 4Z9BA 5IDWA 1RLIA 3GARA 4BIIA 2AT1A 4UMVA 4PGHA 5LYJA 1BG6A 1P17A 2BBTA 1T5HX 2GTHA 1XZGA 2G8NA 1IHOA 2H31A 4K9KA 4OJQA 4H0CA 4DJTA 1M6VB 2AJLI 2UDPA 3F97A 3QMMA 4X71A 2XKJE 3RF6A 3RHZA 3KPJA 3SAJA 3WQSB 1G7CA 4J3FA 4LWOA 2GLXA 2LUOA 3GF4A 2G08A 2GA8A 3SD7A 4LDZA 2YVLA 4B75A 3A9RA 4Z7OB 3DUWA 2IPXA 1P60A 1FXWF 1TK9A 2XNCA 4E5YA 5IT4A 4DF3A 3NHAA 3ZE9A 2CZQA 2ZUFA 4QRDA 3OZTA 3AEKB 4LVNA 2XYQA 1QPBA 3GAMA 4HX9A 3CF2A 5PGMA 3FJOA 4H7JA 3Q40A 1CZUA 5AMXA 2OP0A 5BYAA 1X1AA 4R2KA 3RSLA 3HDTA 2IIPA 2IPNA 2ZWAA 3WWEA 4DJEC 3KZNA 3DOFA 3WIUA 3GIWA 2PUAA 4J94A 1LV8A 1SBNE 5AW5A 4YAIA 3X1KA 3A6PC 3M3PA 4NV3A 4H7EA 4D98A 1S0UA 1B93A 1U7DA 1PGQA 2BGNA 3G89A 4HDOB 3GL9A 1SH7A 4GGMX 4CLEA 4E6PA 1P80A 3AUFA 1UDWA 4LYAA 1T3SA 4FS8A 1QZUA 3G2PA 5EP1A 4XPIA 1J25A 5CB4F 3RU9A 4HBZA 2O5EA 4HQNA 4LUCA 5KU1A 4HN9A 1XCMA 5HNKA 2YX1A 1DEOA 4O08A 4YR7A 1ZR2A 4TUYF 2QUHA 4C7XA 4CFZA 5ADUS 3L7CA 3KHSA 2B82A 4HG2A 3ZU6A 2WQ7A 1Y9EA 3C1AA 3H3FA 3ND5A 1GRQA 1T3ZA 2AHRA 2PLNA 2WINI 3NUQA 4I1OA 1XQWA 1V2HE 4K05A 4PO1A 2BRUA 3D0KA 5DBGA 3VC1A 2K7ZA 1ZNZA 2RJNA 2QROA 4UHJA 4S05A 1YTUA 3AUAA 4NXNB 4TMVA 2FEXA 1K8XB 4GX2A 1DOAA 1DG9A 2XOEA 1G5TA 3D4NA 2HHLA 4ND6A 1RAFA 4W4TA 4YRDA 5FD8A 5LLDA 2ET6A 1IHUA 4F1JA 2J9XB 1RBYA 5HE9A 4N76A 3SLRA 3CIOA 3F5SA 3O1LA 5IULC 1OBCA 2C4HA 3PYMA 4ZTBA 1QFZA 3CW8X 4M8KA 4FOOA 5LJIA 2YYSA 3AX6A 4C5BA 2XOKA 3R5HA 4EDHA 3WYFA 1KVUA 3UMCA 1NFFA 3MNFA 4MR9B 3NHJA 1BE1A 1GDHA 1N9GB 4C22A 5AHRA 1PSZA 3E2PA 3OWHA 4BN0A 1QJCA 3F5DA 1I1NA 4K6KA 4DUPA 3AIMA 3TD6A 1Y8QB 2VI5A 5BWMA 4AP5A 2ZIFA 4GXNA 3SHQA 4AURA 4MVJF 4R5MA 1ZJZA 3DNPA 2OHJA 3FDFA 4CNQA 1Y8AA 3EC1A 4QLAA 3K8QA 4Q3AA 1OAOC 4MULA 1QNLA 3SP1A 2EW8A 1VZ3A 2NACA 2RHJA 1CY2A 3PHHA 4NG4A 3THWB 2P11A 2PBZA 1YKGA 3UAVA 4AY5A 4BS9A 1K7FB 5FJJA 1H2XA 1QP0A 3I6YA 4GGPA 1YR7A 3FB4A 3PICA 5K0JA 4IZ6A 5LIPA 3D6MA 2Q3JA 1CU1A 3CVYA 4WOBA 5KYUA 5BSGA 3JAMA 3DR5A 1KQPA 4L0QA 4TZ0A 5DSTA 4I1RA 1F0YA 1K0FA 1BXRA 1QP8A 2B4AA 1CQZA 4U6QA 4Y2GA 4D8TA 4YXFA 1YQDA 3PDIA 3MRTA 5AW9A 1GAWA 1IBCA 3MPUA 1XCJA 3PX2A 2JBAA 2P0YA 3A6JA 1WBBA 2EWMA 1KR2A 2GBLC 4CKWB 4BO3A 1UBNA 4JITA 3DD1A 3F5MA 2ZSBA 4YAUA 1VYHA 3DE5X 1G0NA 4L4ZA 4OJMX 4FOPA 5HIMA 2XNDA 3DTVD 3HRIA 4LVOA 3F5FA 4RXMA 2AJCA 4HDAA 5KYVA 1NF8A 1JEAA 2P78A 1JDUA 3GEBA 4JWTA 4YJ2B 1JPUA 2QNIA 5ALDA 4EOGA 1CERA 1T0HB 1W4AA 1Q3KA 2RH5A 2GUWA 3OKCA 5CPFA 2BFCA 5IMBA 2DC1A 4PG6A 3VHQA 3DCIA 3AFIA 4P5DA 1RJFA 1UC4B 2B78A 1RXCA 2P2NA 2W7TA 1PV2A 2MTBA 3K0AB 4MYTA 3UWPA 1EP1B 3W3AD 2C9DA 4YBZA 2CMFA 3W5CA 4LECA 2ECKA 3FFTA 1UP6A 3OC6A 1PZEA 2XUGA 1OBOA 3DPIA 3C6XA 4LC0A 5BYBA 5CLQA 3K70D 4LI3X 1CUCA 1YJXA 1BIFA 1MQ8B 3OCWA 3Q4GA 4RKFA 4TXHA 4AZ0A 4BWVA 4FB5A 3K32A 1Y5NA 4NJEA 2IBMA 5KJFA 1MRNA 2C7BA 4D26A 1PKEA 2XMCA 2QOEA 1X7ZA 1MLDA 1KXZA 4JIMA 4LSZA 1M6HA 2NUAA 3A2LA 3GLHE 4N5DA 5AXBA 1NMSA 1XVVA 4KV7A 1NBOA 3EQ6A 2F1JA 2X14A 3PTZA 5ARCA 3FTFA 1MH1A 5DCLA 1LDNA 3AF5A 4RETA 2X2PA 4LKOA 2DPXA 1GYQA 5I4IA 4IMIB 5EMNA 5B57C 5JQGA 1DRWA 4PG8A 1W1IA 1VHTA 3GFFA 1ZRHA 3A1FA 2P3QA 3COYA 2Z6AA 4D3FA 3ABOB 3Q3JB 5KDLA 3HZZA 3ZCRA 3WSTA 2WU0A 3HCEA 4KPFC 1JXQA 2IIVA 3VGPA 5JSHA 1C7FA 2EKLA 2BCEA 2DBYA 4YTEA 1ML3A 1Q92A 2YICA 5LQNA 5ALFA 4TSFD 1MP0A 4HQKA 4B46A 1U98A 2EHJA 4BYMA 5AM2A 1FDSA 2RH9B 3D8UA 1LTKA 3V4VB 4F4DA 4HKTA 4UE2A 2HV8A 1CY4A 2PN1A 3OE7A 4OP3A 4GKVA 1ZWKA 5F3DA 3U13A 3VZBA 1LUAA 4HN4B 3SCZA 4G1EB 5EKDA 4ZYVA 1ZJYA 2QRUA 3CSDA 5JH7F 3NM4A 5JS7A 1H2ZA 1T34A 3QU7A 3QLEA 4C89A 2PAAA 4E3WA 1DO2A 1TE2A 1FFEA 4LQCA 2Q4RA 3ADBA 2W2XA 1V7PC 4QG7A 1ZZEA 3HL4A 1J8QA 1W581 4KWCA 1EVYA 2P6OA 4JY7A 4UATA 4CETA 4LHXA 2A0FA 4HNUA 1DBQA 4YDQA 4QUHA 3FSJX 2EBWA 5SY6A 4OLFA 5TJ9A 1M2VA 1P5JA 3EZFA 1XVAA 4G89A 3ZDEA 4H