1KO4A

Crystal structure of gluconate kinase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
171
structure length
163
Chain Sequence
TTNHDHHIYVLMGVSGSGKSAVASEVAHQLHAAFLDGDFLHPRRNIEKMASGEPLNDDDRKPWLQALNDAAFAMQRTNKVSLIVCSALKKHYRDLLREGNPNLSFIYLKGDFDVIESRLKTQMLVTQFETLQEPGADETDVLVVDIDQPLEGVVASTIEVIKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes during the catalytic cycle of gluconate kinase as revealed by X-ray crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Gluconate kinase
total genus 58
structure length 163
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.7.1.12: Gluconokinase.
pdb deposition date 2001-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ko4A00
1C1YA 3B1XA 5A5GA 2GAAA 1KZGB 1OT3A 3A4LA 4NYMR 3PXGA 1NN3A 2F7SA 2QP3A 4TSFA 2GBLC 4YMUA 2OESA 1RYFA 3VR6A 1UADA 4KAXA 2AD1A 2ZR9A 4Q9LA 5KPJA 2JJ8A 1E4VA 3X1WA 1Z47A 4YONB 1MABB 1NVXQ 2F43B 3LXXA 2JGNA 5HPYB 5TMPA 3DVLA 2IF0A 4AYXA 3PUZA 2QI9C 2FU5C 1J8YF 2GCOB 5FTJA 3SHWA 121PA 1D6JA 4PX9A 3VX4A 1R7RA 2YHSA 3TQCA 4JL6A 4YMTA 2PX0A 1FL9A 1OXUA 1CR2A 1CKEA 2JASA 2FFAA 5CYOA 3FVQA 3C5HA 3Q3JB 1KDOA 4GT1A 3K70C 3BAFA 4TMXA 1A1VA 1PLJA 4AKHA 1U2RA 1OFIA 2ZRCA 1OIVA 1WRBA 3NXSA 4FWTA 4O2RA 4AY2A 1CBUA 1HUQA 3SJZA 2DFLA 4I99A 1R8QA 1JI0A 2WJGA 2AKAB 4HAYA 5JMTA 1BO6A 3AKYA 4KU4A 1M34E 4Y0VA 4UXHA 2OZEA 1OYYA 2CLCX 2HF8A 2PLFA 4JBYA 4TL9A 4PZLA 2REXB 3TNFA 4URUR 4DLSA 2VBCA 4HAXA 1YZNA 1LV7A 4PHGA 2PEZA 2RGXA 4ZKDA 4JLDA 1UFQA 1GNQA 3QKUA 2VP4A 3DKPA 1W2GA 4LYJA 3LQRA 2QA5A 2FFBA 3VAAA 4LV8B 4OI4A 2ZR0A 4B2PA 4KVAA 2FE4A 1MRSA 2B8TA 3I3SR 1KK3A 2EYQA 4NYIQ 2QQEA 3VHXA 4LHXA 4ZDIA 1OXSC 1X8LA 3VR2A 2FSHA 3AVOA 1XJ0A 3FYHA 3KQLA 2OSBA 3SJCA 5E3HA 1R0XA 2ZI4A 3P4XA 4Q4HA 2QPAA 4DLXA 3OFND 3GPLA 1U94A 1GRQA 1T3HA 2IWHA 2ZRIA 5TB5A 2YWGA 5JS8A 1GKYA 4FMDF 4B3DA 1KMHB 1XZQA 1GWNA 2RGEA 3QBVA 4JYCA 1W46A 5J4YA 3THYB 4QBGB 4XWAA 3TE6A 2GEUA 1SXJD 3DO6A 2OHFA 1BMFA 4PAOA 1II8A 4Q19A 4DDWA 2GTPA 4B6EA 3N70A 2WJYA 1R2QA 3KKNA 1RRPA 3L0SA 1JAHA 4X8MA 4OHWA 3AVWA 3A4NA 1TEXA 1KO4A 1WQ1R 3RHFA 2V9PA 3C5CA 4FMCB 1KMQA 5EE9A 3V00A 1ZUHA 1HYQA 1D2NA 1XTQA 3CX6A 4D0GA 1G6OA 2ZS8A 3NIBA 4BLTA 1HT1E 2YJTD 2DWOA 2WWGA 5GADl 1G5RA 1M1YE 4BFVA 4DLTA 1NY6A 4CEHA 2QORA 4C0BA 3DHWC 3GLIE 3F8TA 3EWAA 1KNQA 3EAQA 4N1AA 3ZQ6A 2GEDA 4TL6A 5LD2B 1QRAA 5HTKA 5KUTA 2HF9A 1HQCA 1G3QA 5JHHB 1T8TA 2ZSAA 5CB8A 5FOWA 2WJJA 1CLUA 1U0LA 1NLZA 2ZU6A 2JDIA 2ORIA 3LDAA 4BFXA 1DO0A 4GSYA 1E2LA 2R6DA 4IEEA 1TU4A 3LBIA 5SZKB 1GVNB 4PPNA 1E2MA 1HE1C 3SFZA 5BQ5A 2IYSA 4M22A 4DIDA 1KI1A 3RS2A 3OIUA 4GZLA 5C46F 2F43A 2ZJ2A 2J7PA 3QKTA 4LJ4A 5B58C 3U60B 1XEWY 2ZRPA 3OAAD 4PQYA 2ERXA 3O8RA 4UXJA 2CNWD 1ZUIA 4JJZA 4C2TA 2KE5A 1XX6A 4ACAA 4HSEA 4RZ2A 5E7JA 1RZ3A 1GG2A 4OQXA 2HYIC 4A82A 4C7OB 1XP8A 1XRJA 3QJYA 3K8YA 5KSPA 1D9ZA 1RW4A 4MRRA 2ONJA 2GCPA 2NIPA 1XD2A 3AVTA 3TLXA 1NG9A 1Z29A 1Z6AA 3NWJA 4QBFA 3UMFA 1YRAA 2CE2X 1AGRA 2FV8A 1UKYA 2DPXA 4NCIA 4RFVA 2V1XA 1XPOA 5JECA 4PHTA 4XH9B 2OLKA 1NVVQ 4NYJR 4ZIRB 4F7WA 1OHHD 2Z4SA 3QIAA 4A6XA 4KYUA 1DO2A 5L3VA 4GDFA 1F3OA 1MOZA 4FMCF 5FI0B 4B32A 1G291 3GLIA 1ZU4A 5DYIA 1TADA 5J4VA 3CNOA 1E32A 4BGDA 4U5XA 4LJ9A 5CYPA 2IYVA 4JSYA 2QP4A 4W7SA 5P21A 3FKSA 4ZKEA 1I4DD 3EZFA 2OAQ1 3TJZA 4QXAA 4RD0A 1Q57A 4AK9A 2OT3B 2YWEA 1E9BA 4DZZA 2WWXA 4NYMQ 1ZCBA 2R9VA 3AUYA 2IEYA 5G53C 1RRGA 4TT3A 4DT1B 1OFTA 3DPUA 3RC3A 1IXZA 3ONWA 4HB2A 3K0CA 3U61B 2G9NA 1X8JA 5DNYB 3TVDA 5DHAA 2NTYC 2O0KA 1XEXB 3RNLA 5EP2A 4PANA 1NF3A 4LBYA 5JHGB 2JLWA 2ZYUX 4C30A 2BEJA 1Z22A 3QEOA 1KSJA 4LX0A 2FPKA 3SQXA 3MWKA 1X8KA 1BYUA 4JJKA 3THWA 4FINA 4US0R 4TL8A 3D6TB 2FJUA 2HCJB 4LJ8A 2IYUA 1CS4C 1DG3A 1P4SA 2FN4A 1QHHB 2ZI5A 3B2EA 1W4CA 1SXJB 3FMFA 4V0NA 3C8UA 5FOUA 2C99A 4Q01A 3O8CA 3GLFA 3T1TA 2IXGA 4B35A 1WBBA 1OH8A 1T0JB 5FR1A 3AP2A 3CR7A 3SYNA 3DKVA 4AWXA 2IS2A 2GEVA 2Z5FA 3K0EA 3QVUA 4FN5A 3J81k 4KBGA 1NN5A 2I1VB 3HPRA 2WHXA 1WE2A 1Z3IX 2W58A 3TSZA 3K70D 2XTMA 2CK3A 3QPWA 1ESMA 1YZLA 4F4IA 4I81A 5HZHA 3QI2A 3NDBB 1CRPA 2V8OA 8OHMA 2P67A 3K0FA 4W5HA 3SBDA 2FFHA 2QTHA 1IM2A 1U8YA 1IHUA 1RFLA 4Y0AA 1P2VA 1E9SA 1IJFA 1G8HA 1G20E 1E2IA 3OIWA 4DCNA 2GCNA 3VKGA 1XMJA 2BJWA 1NN1A 1G19A 3A1SA 4V03A 1KSGA 3M6AA 4A36A 4S35A 3GLHA 3U2QA 2I1QA 3VR1A 1Z28A 2N1BA 2ZJOA 4A0FA 3ZVLA 5DLQC 4BFTA 4BPBA 1I4LD 3AP1A 2R44A 3LLUA 2YKGA 4WA7A 3FHTA 1DAMA 5C4MA 3VHLB 2GETA 3MD0A 2WSSD 1HT2E 2GDJA 3C7KA 1ZVQA 4RFSB 3N2EA 4TQAA 1G7RA 1NG1A 4PPFA 4Q9KA 2CL7X 2O8DB 3EG5A 4YDHB 2ODEA 3LVQE 2C78A 2QT1A 5JSZB 5KDDA 1KK2A 1NSTA 2J1LA 4PSVA 5AJYA 3T5GA 4GZMA 4A6PA 1Q22A 1PVOA 1EFTA 3PUXA 1SQ5A 2CHVA 4M1WA 1JJVA 3SYLA 1N25A 4LC1A 1US8A 1JR6A 2WSMA 3SJBA 4C0JA 4AURA 4B3GA 5TDHA 1MO6A 4Q66C 2IYQA 3OIVA 4NP6A 4FW9A 1E79D 3O47A 1VCOA 4PZYA 1E94E 2TMKA 2NOAA 5DI3A 2OO7A 1GRRA 2AD5A 5CDFA 1FMJA 4YQFA 3LBHA 5FPHA 3ASZA 4IOMA 4TYWA 1F2UB 4OL0A 1GZSA 3AF1A 1VIYA 3LD9A 4R98A 2LKCA 1KNXA 4EIWA 4R71A 1S8FA 2H8KA 4G5QA 5AK0A 3KQKA 4JKIA 2NO9A 4Z8YA 1U0JA 3ASYA 5GJWC 2ZSDA 4DVGA 3U3RA 4KODA 3R9WA 4ILEA 2Q9CA 5JRJA 2V3CC 1ZM7A 4B73A 4NDZA 4LYFA 1BKDR 3EIQA 4BZQA 2W0SA 4NCJA 2CLSA 1T3SA 3NEJA 2KBEA 4V0MA 3NEYA 4YXWA 5AUOB 1GL6A 2YOFA 3WRYC 3ZJYA 3GEHA 4HLUC 5L3QA 3FKSD 4TMVA 1FTNA 5AJWA 2P65A 1SVMA 4FIDA 2CVHA 3X1YA 1OH6A 3BORA 5JRZA 2AXNA 3F3YA 4LPSA 5BWMA 2IYXA 3QNUA 1KJYA 1G4UR 3QUSA 2QN6A 4B74A 4PSAA 4EJSA 4GL2A 5AJXA 4DIEA 3AF0A 1DAKA 3LRPA 2OBMA 1E9RA 1O87A 1FW6A 4IDNA 5K8IA 3CPHA 3G0HA 4O25A 3WNBA 4PPQA 4ZDKA 3CX8A 2UKDA 3NTUA 3TGPA 4JBXA 1E0SA 5J4HA 3TKLA 3NBXX 3PEVA 1FUKA 4KI0A 4M1YA 4TMWA 5A4JA 5KPDA 5F3WB 2Q3FA 1ZMXA 1ODFA 1IY0A 1YZQA 1TF2A 1YQTA 4JT4A 4G5GA 1NIJA 4WIAA 3NG1A 1G8YA 1EX6A 1YKSA 4A0HA 2ZRJA 2EFEB 5AR1A 2ZRAA 3RS5A 4L16A 1YHNA 2WOOA 3PUYA 3GJ0A 1T4GA 3SC3A 3VNUA 4UKDA 4F4JA 4A15A 2J7PD 3TSOA 2HLDA 4DLUA 3MRSA 2W83A 1F5NA 3FHOA 1E96A 2IS1A 3DM9B 1DAIA 221PA 1CJUC 4TTRA 1DAHA 1E2KA 2VSOA 4MGKR 4QG7A 3PIRA 2C5LA 3GD7A 1FZQA 3BWDD 2O52A 1W48A 4UNPA 2D4HA 1XDBA 2A9KA 3TR5A 3BK7A 2HUPA 2IK8A 4QJ3A 1UDXA 2XOKA 4C0QC 1JQLB 2WWWA 3QKRA 2JLSA 1XCMA 4UNSA 4KXFB 4YDSA 1PUJA 2LKDA 4KHZA 2PCLA 5CB6A 2A3RA 2QPOA 2NGRA 4HLCA 3UKDA 2QGZA 5KDOA 1E9EA 4HYYA 2D62A 2R6GA 721PA 1G4AE 1X6VA 4S2EA 1LS1A 4MYHA 3BJIC 5IDVA 2ZVQX 1U8AA 2N42A 2QTVB 3AF3A 4TLDA 2OXCA 5FPSA 3IUYA 1FUUA 3HDTA 3RWMB 3A6PC 2E9SA 3MSXA 1Q0UA 3CF2A 3K0CC 1JBKA 2HJGA 1NP6A 5DISB 1II8B 3SFVA 2FX3A 2DR3A 1VG1A 5AJZA 5F98A 4ARZA 1IXRC 4WXPA 1R5BA 3REGA 1VG8A 3MJHA 1JNYA 5DE3A 4EPVA 2X77A 4CGZA 3EW9A 3AEZA 1Q12A 1V43A 1LB1B 1VCIA 1T91A 4G5SA 4MQBA 1W36D 5FUWA 4LJ5A 2JIZA 4Q9IA 4QHYA 4DLRA 1OV4A 2K5UA 3MFYA 1C9KA 3S1AB 1DBSA 4C3ZA 1CJMA 1VPLA 5FOVA 4BEBA 4Z54A 1E2JA 4A8JA 2QE7A 3CRW1 4RD6A 4BQSA 4MRSA 3IEUA 1UBGA 4DJTA 4D2IA 1NVUQ 4LHYA 4D26A 1G3RA 1SKYB 1NBMA 3P32A 1QZXA 4D25A 4JLVA 2DBYA 2FZLA 3IKJA 3GJ5A 4URZR 3PG5A 4EQ6A 2RGDA 1E9DA 1XD8A 3AF2A 2IC5A 3T06B 3NC1C 1G3IA 1TAGA 3TSWA 1P75A 4HUTA 1S3GA 3AM1A 1EESA 1ELOA 2KSQA 3K1JA 5EUMA 4Z1MD 4CT4B 3WHLA 2P6NA 2WKPA 5CLQA 4H1UA 2FNAA 5G3ZA 1T8UA 1IN6A 3NVAA 3FFAA 4A8JC 1G8FA 4OQLA 1S9DA 2EVWX 1OF1A 1ZIPA 2OFWA 3L0OA 4EPYA 3B1VA 5EE0A 5KOYA 1W2HA 2QRNA 3SZRA 3U3OA 3K9LA 1M74A 2HV8A 2KB0A 4MGYR 3GFOA 1G7SA 2QMHA 3OE7A 3H86A 2PT5A 3RRNA 4URXR 1AK2A 3IPYA 2W6ID 3RAPR 5JZVA 1TNDA 3QE0A 2ZSBA 2CCKA 2GK7A 1HTWA 1JQJC 2PMDA 3BBPA 3ZS9A 3R8FA 5J40A 1NRJB 1XTIA 4HI0E 2ZIAA 4C4PA 1LTQA 3F5FA 4XD7A 3CZPA 4XJXA 5FTNA 3U6BA 2O0JA 3NHBA 2V54A 2ATVA 1OHHA 2OCBA 2DFKB 4M9XA 2XGJA 2J0UB 1DEKA 3T1QA 5J47A 4DUGA 1S4QA 1XEFA 3GLFE 1ZD1A 1RVDA 5KNCA 1XEWX 1XB2A 1US8B 2ASEA 2WAYA 3GLGE 2WAXA 1ZNWA 1L7VC 3IIJA 3LLMA 1W0KD 1XBTA 2OLJA 2ZJ5A 1W47A 1UM8A 1CR0A 2D3WA 2W00A 4P32A 1W36C 3CPEA 2RKOA 3M0EA 2BM1A 5HE9A 5DYGA 4DLVA 2PLRA 2ZRHA 1P9WA 2GJKA 4Q47A 1TUIA 5KO2A 1Q3TA 1FPMA 3MUFA 4WZBE 4N0EA 2ANCA 2Q21A 3B85A 3DZ8A 3OZXA 2YVUA 3AVUA 1VHLA 1R6BX 3WHKA 4Q4AA 1Q20A 3ZZ0A 4Q7MB 5HCIA 2DB3A 4PZZA 2GXQA 3RWOA 3U6KA 4FCWA 2JDID 2R6FA 2QPTA 1COWA 3E5HA 4A4DA 5JEDA 3QXJA 4TMZA 3QF4B 3TMKA 3I62A 4TTQA 4YMVA 4IVRA 5FFMA 2PJRA 3NKVA 2VSFA 4U02A 1F2TB 1H8HA 1YVDA 2GAOA 3A8TA 5JCPA 5IRCD 3X1ZA 2FGJA 4UNQA 4ITRC 4WBSA 1W5SA 2UZ3A 3QENA 4DDVA 3C41J 2O8CA 4XTCS 1II0A 2PX3A 3GJ3A 3WYAA 1Z8FA 3P26A 3AVXA 4M21A 4FMBB 1VKJA 2WBLC 3E70C 4JLPA 1MO4A 3RRZA 1KY3A 1DOAA 3ZD7A 3RSLA 3PVSA 1KDRA 4LGMA 4DHEA 5TARA 4WVFA 1KGDA 4PPGA 4EPXA 2FFQA 1HA3A 1FNMA 4EFMA 4M9QA 3HYRA 2GK6A 5ELXA 1KTVA 3LAWA 4TL7A 1JR3A 2ZUDA 2XAUA 1C4OA 521PA 4LPKA 2IXEA 3IPXA 4P4SB 3EIEA 3TRFA 4NCKA 1E1RD 3CNLA 3L0IB 4Z8XA 1KI9A 3OFNA 5B57C 4CYMA 2ZTSA 3GEEA 4QKQA 1KJWA 5ANRB 1ESNA 2PZFA 4FD2A 4A92A 3A1TA 3QXSA 4XD7D 4O3MA 1GSIA 1HH4A 2YWFA 1CULC 1NJFA 3NDPA 2J5XA 3KXLA 3R7WA 1NIPA 2F1HA 3UIEA 4BLPA 1J70A 6Q21A 3QVVA 1FFHA 4RCYA 5HZKA 2ZRNA 4Q7KA 4U00A 2J3EA 3KDSE 4PR0A 5GVRA 4MGIR 1EGAA 4A8JB 3B5JA 3Q7QA 1OFUX 5JS7A 3VR5A 3OESA 3BB4A 3UWOA 2NZ8A 3EC1A 2ONKA 5L3SB 2V7QD 1A2KC 3RABA 2RCNA 2OG2A 1V5WA 2ZM5A 2ZYTX 3AQ4A 1H65A 2AXPA 1E2EA 5BYJA 2V6IA 2VQSA 2XXAA 4DT1A 4B6FA 1QDEA 4HAUA 2NO7A 1KIMA 3GFPA 2C9OA 3ZVMA 2B6HA 4CEJB 3LVRE 4LWZA 1P73A 2ZI7A 4RJLA 3SDZA 3IQWA 4G5OA 1NBMD 2WVJA 4QRHA 5FUYA 2DYKA 3K53A 4D4JA 1AN0A 1L4UA 3ADKA 4LHVA 3ZS8A 4RZ3A 1P61B 1OW3B 1RPZA 3C15C 4H9GA 1DADA 3A1UA 3CLVA 3K70B 4PQFA 2BMDA 2G0NA 2GNOA 2GZHA 3PUVA 4U7DA 3BC1A 2FA9A 3WYFA 1JJ7A 2DY1A 2IYLD 1ZU5A 3L2OB 1DARA 5HR5A 3SJAA 3ZD6A 2BC9A 1SHZA 1S96A 1N5LA 1JEEA 4NZYA 2CJWB 4PSKA 1AS0A 3I32A 2EWWA 2GVDC 3TAHA 3G5UA 3U44A 1P72A 3BH7A 4HLQB 1ZJ6A 4RFSA 1OXTA 3Q9LA 2QM8A 3OHMA 4EFLA 1JALA 1JXMA 4TTPA 1VCNA 3D3QA 1UBCA 1S3SA 1XF9A 1Z5ZA 3EASA 5EP1A 4HLDA 5EE3A 1SKYE 5DH9A 5JWOA 2YOGA 1KI3A 4QL3A 1AZSC 3ADDA 4JLKA 3AH8A 3NH9A 1WMSA 2J41A 1QHIA 1OB2A 2IEZA 1SVOA 1SXJC 2IS6A 4NBSA 1XFAA 2OBNA 4US1R 1XTRA 3WBKA 1S1CA 1LFDB 4E5UA 1TQ4A 3CONA 1P2TA 4P4UA 3KQNA 3K9HA 4D6PA 4TZ0A 3I5YA 4PAMA 1ZNZA 1XJCA 2ZAOA 3AVPA 3KKMA 4UJ5A 4JLMA 1A5TA 3R8CA 3X1DA 5FOXA 1YE8A 3U3JA 3QXHA 5CJPA 2W0MA 3AUXA 3BE4A 3LFUA 4OI1A 5D3MB 1VHTA 5FL3A 4PAQA 3LBNA 2O8EB 2NQ2C 4IXMA 4A2WA 3TUZC 2X8AA 4WAUA 2VP0A 3PENA 2RH5A 3RRYA 2ZSEA 1KAGA 4B3XA 2GJ9A 4ESHA 1GM5A 4F91B 3KXKA 1ZCAA 4AI6A 4UJ3A 1FP7A 3K09C 2YYZA 1MR3F 2DFTA 4CF7A 2W6JD 1XEXA 2RGAA 2BOVA 1R0ZA 3TK1A 1TQDA 1XXHA 1GNRA 2DCUA 2OAP1 3EARA 4TT3D 5TY0A 1Q1BA 1U9IC 1E1RA 4TN1A 4B3FX 2IA5A 4Q4LA 2G88A 4LDJA 2ZRKA 2OV2A 3TBKA 5LPNA 3EIHA 1OLOA 1XCGB 1IOZA 2QMOA 1ZNXA 2ZETA 2NO0A 3I73A 3DEFA 1L2TA 4GP6A 4IDQA 1LY1A 2HCBA 4QJ5A 4TYQA 5BYKA 2P0EA 3CBQA 4GOJA 3JZMA 3EZ2A 4WOPA 4ZO4A 4KBFA 5EZ6B 1RRFA 1Z6XA 2J59A 2JCSA 1OIXA 3UMRA 4O2LA 3R9XA 3E1SA 4G3XA 1E4YA 1KHTA 2VRWA 3LW8A 4XSHA 5TV2A 3EPKA 1Z6YA 2IS4A 1G5PA 3FKQA 4M1MA 5CIWA 4HLUA 3RYTC 4LCBA 4XWKA 5KSYA 4ZCLA 1D9XA 3Q5EA 2X2EA 4AG6A 1IXSB 1YRBA 4X8OA 1H8HD 1B23P 1OE0A 3Q7PA 1Z08A 1N6PA 2FPMA 4HUQA 1F6BA 1OIWA 2D2EA 4EPRA 1UF9A 2ZSFA 2ERYA 1TQ2A 1VYUA 3B82A 2O8BB 4TMTA 4C9BA 4QBHA 2N46A 4Q4AB 1SVIA 3ND9A 1P9RA 1N6RA 4MUAA 1IBRA 3IO5A 3GP8A 1WDTA 3UXMA 2ZYVX 2YC2C 2HLDD 3T35A 2XTZA 5LB4A 3AB3A 4M9ZA 2BJVA 2VL7A 3K0AB 4CEIA 2GJSA 4AD8A 1RIFA 5BW8A 5L3RA 3NC0C 2ZI9A 3A1WA 4Q4JA 5HKKD 3WMFA 1HURA 1GOTA 2QBYB 4JVLA 1GP2A 5BN4A 1W0KA 3B1ZA 3B1YA 3A37A 2GZDA 1E2PA 1CXZA 3WY9A 4MYTA 1XPUA 3WMGA 2VF7A 3THYA 2GJAA 1KY2A 1U9IA 2BDTA 4M0LA 4ZDWA 4KSBA 5EXXA 1UEJA 5GJBA 3W6OA 4OHZA 2H57A 3KKPA 1QHXA 2H92A 4JIMA 4DUGD 1FX0B 4EAQA 3CB4A 3NBZC 1MABA 2Q9AA 4V0LA 1ZRHA 1W4RA 5C1BA 1ANKA 3LX5A 4GP7A 3R7WB 1LW7A 1OH7A 1D2EA 2AL7A 1NVWQ 3PCRB 2ZREA 4Q48A 5TVKA 2PCJA 4FCVA 4GOKA 3H0KA 1FOEB 2QAGC 2XSZA 3DMNA 3ZQJA 3HU3A 1T5IA 3LH5A 2W6IA 3KKOA 3W34A 2FGKA 2E87A 5H70A 3SE0A 1AQYA 1S9HA 2LWIA 4MRNA 2XZOA 421PA 1OXVA 3B9QA 3U7HB 1IQPA 3PUWA 3LX8A 1OXXK 3NBFA 2Y8EA 3T1VA 4YXWD 5H8WA 3WRXC 4B3BA 2I3BA 1K6MA 2GWHA 2CK3D 3KFVA 3NBYC 1OYWA 3U7EB 2WJIA 4TZ6A 3RLFA 1TPZA 4I4LA 1D5CA 2EQBA 4O0MA 5GVSA 4ERNA 5FTKA 1IONA 1AZTA 1IY2A 2HXYA 2IW3A 4Z1MA 2CE7A 1KSHA 2P5SA 1X1SA 3W9YA 1JR3E 4XVRA 1XJQA 5KSOA 4LSGA 4JVNA 1WB9A 3QSYA 1VYTA 1XCPA 1E6CA 4UNRA 1QVRA 2HJVA 2P6RA 1W0JD 4BLOA 1E79A 1S0UA 2BMFA 5FBQB 4C0HA 3PFIA 2QE7D 4MKFA 1Q1QA 2R6CA 3S1AA 1G7CA 5EJEA 5HCNA 3LNCA 3Q8XB 3BH6A 2CXXA 1TTTA 2ZJ8A 1XTJA 2RHDA 3MLEA 1KI6A 4OK3A 1K5GA 3WNCA 1IJEA 3GJXC 2A2ZA 1RJ9A 2J0QA 2KWIA 4ZIRA 1BIFA 2VA8A 5EP3A 3EPHA 3EX7C 2GJ8A 3TAUA 3TW4A 4G0NA 3SNHA 1W4BA 3RC8A 5JFGA 2QZ4A 2ZVPX 1IN8A 2VP5A 2Q6TA 1XD9A 3EWSA 4MA4A 3CRMA 2WSSA 1R0YA 2A5YB 2QENA 3IQXA 4HEJA 4NCNA 1P5ZB 5FPYA 4Q5IA 4LOAA 3HJNA 1M7HA 2EYUA 4PHHA 2Q0HA 3U5ZB 4WZAE 3EA5A 1E69A 2JLQA 1X1RA 4BECA 2D7DA 4DEXA 3BGWA 2XSZD 3JVUA 3I61A 3KQHA 4CW7A 1UPTA 1SGWA 2ZITA 3WMEA 1ZAKA 2BBOA 4FMDB 1VDZA 2V6JA 3LW7A 1KK0A 4PC7A 5JSZA 4E09A 4BFYA 3H2YA 3CNNA 4LJ7A 2R62A 2ZUCA 3H84A 2H16A 2WIAA 1EG7A 4LHZA 2JLZA 1J8MF 2QM7A 2DWQA 4N3NA 1E2FA 4K8OA 4D81A 4D4MA 3JVVA 1HE8B 4JS0A 4NHOA 3SBEA 3WXMA 2H5EA 3FPAA 3VR3A 4F38A 4MKHA 4DLZA 3FMOB 4DRZA 1YJ5A 5HKKA 4L9WA 4A1FA 2SHKA 3OIYA 5KTYA 4NE2A 1ZM3A 5EXPA 4MKGA 3BXZA 2Z4RA 3U44B 3UANA 1E9AA 4GBMA 4MKIA 4PTLA 4JLAA 1EFHA 4DC9A 1IAQA 1CF4A 4DDUA 2G1KA 1CR1A 3GLGA 2MSDB 2Z0MA 2QGNA 4TYNA 3EPJA 4IXNA 4AC9A 1Z06A 5FL7D 3ZH9B 2OFXA 3THOA 4DSOA 2VHJA 4OBEA 2V7QA 4JVMA 4RD4A 4DBLC 1DAGA 3KZ1E 3AVVA 2MMGA 4X8HA 1A82A 1G6HA 3M1IA 1UKVY 2XB4A 1H8EA 2FEOA 2UVQA 4IDPA 3EA0A 1QHHA 2OUKA 2AK2A 4BLSA 2WICA 2WWFA 5AUNB 3TW8B 3TH5A 1ZNYA 1FQKA 2F3RA 3LWNA 1TF7A 3TR0A 3BS4A 4B2IA 4RCZA 3ZZTA 4JBWA 1N2CE 3KTAB 4M1SA 2ZUBA 4NONA 2R6AA 1HQYE 4ZV4A 4BUJA 4LJYA 4URWR 5F9HA 1XWIA 1KI8A 2A5FA 4I1OA 3R9IA 2MSEB 1WF3A 1XZPA 3IIKA 5L3QB 4JLOA 2Z6VA 5CDFE 2GXUA 3I4LA 3SEAA 1EXMA 3GJ7A 4Z51A 2F1RA 4B2LA 2Z43A 5AUPB 4ACBA 4B44A 4IEIA 1YR8A 1GKIA 3AV0B 1NSFA 1CJTC 1XXHB 5K8LA 2WWYA 2F6RA 1N0UA 2JLRA 4ABYA 4L4UA 2OCYC 5CM8B 3WP0A 1KDPA 2WJHA 4JL8A 2W6JA 4EKDA 3FE2A 3HR8A 2CJWA 2ORWA 3C14C 2PZEA 1DS6A 1ZC4A 2CNWA 4OHXA 5DGXA 2CVFA 4IRUB 2WWIA 3W8NA 4A0GA 3EZ6A 1TEVA 1AA9A 1F60A 2CBZA 1G21E 2C98A 3SOPA 3ADBA 1LNZA 1KI4A 2O8BA 3BH0A 3B7GA 3KX2A 3SR0A 1TX4B 2A5GA 1IN5A 1JPNA 2VHUA 2VPPA 5CJ2A 4XVUA 2QU8A 2RMKA 4B71A 4HDQB 1VTKA 1FQJA 5J4KA 2GF9A 1II9A 3AKCA 3W6PA 4IOKA 4D80A 2G77B 1A4RA 1T6NA 4BFWA 3ZDQA 1U0HC 1BH2A 1Q3HA 3DDCA 2AR7A 2ZU0C 5AWFC 4Q18A 3H1TA 4C0AC 5FBVB 4ON9A 4PC3A 2L0XA 4Q4JB 4LBZA 2HYDA 1R5NA 2A5DA 2X1VA 3GQBA 3LQQA 4KFUA 1Z07A 2FEMA 2J0SA 2IYYA 3CX7A 2BBWA 1JECA 2WM9B 3FFBA 4EUNA 3AKEA 3G82C 5G3YA 2CHGA 1OSNA 1KI6B 2IUTA 2PJZA 2GRJA 1KSFX 2QROA 3QPUA 5C2JB 5JJIA 4B3CA 3THXA 5KU1A 5L3SA 2CCJA 2GKSA 1X86B 1GKUB 2OILA 3AF4A 4CDGA 3PEWA 1UAAA 4C2UA 3MMPA 3CRRA 1F2TA 2O5VA 1ZD9A 3AGPA 4M1OA 1NMZA 3L0PA 1GITA 3VU9A 3IEVA 4KCGA 4TLAA 1VYVA 2W2TA 2BWJA 3CPJB 2J0UA 1UJ2A 4MDFA 3MWJA 3CM0A 1MKYA 2GXSA 3OF5A 4OKSA 1WXQA 2BBSA 1NI3A 2VHCA 3HPQA 3IIMA 4BASA 5B64A 2P6UA 1YZGA 2BCJQ 4QGFA 1S1MA 4KFTA 1ZM4A 2AN9A 4TSFD 5KSZA 1O3YA 3U3MA 1LVGA 1Z0IA 5EXSA 3DL0A 2BBTA 4NKRA 1CEEA 2A30A 3ZIAD 2CL0X 2VP9A 3T34A 2XNDD 4DLYA 3KB1A 2OEPA 4JLNA 2JJ2D 1R4AA 3KUCA 2JJ2A 3OE7D 4JL5A 3UWKA 3K0SA 2XNDA 3TUIC 4XWOA 4YMWA 4K81B 1I2MA 2Q3MA 2QAGA 1QHNA 4AIIA 3GLGB 1DAEA 3QEJA 2FWRA 1Z63A 3W8RA 4D4KA 1AGPA 4NU0A 1IN7A 2XX3A 5KNDA 1ZUNB 5DSZA 4AG5A 1T0HB 2CL6X 3CWZA 5JEEA 2LCFA 4GNKA 1DPFA 2REBA 4P3YA 3UATA 2J9RA 1M8PA 4AYTA 5M04A 2XZLA 2VP6A 2C95A 2WIBA 2RGBA 3KJGA 4NCHA 4TLCA 1YU9A 3CR8A 2AX4A 3NHAA 1VG0B 5AUQA 1CRQA 3GJ6A 4QHSA 4RSGA 1G16A 3VFDA 4BRWA 2WKQA 3WP1B 4E03A 2IYRA 4LI0A 1JXOA 4P4SA 1GRNA 4DCTA 3AVYA 3PEYA 1IN4A 1FNNA 1XPRA 3PV0A 4IOLA 2ZE8A 2IX3A 2WWHA 2FOLA 4KSCA 1QG4A 4QGAA 1E2HA 1OJLA 2EWVA 1N6IA 5J4LA 1Z0DA 2AWOA 1D2MA 2R2AA 3LA6A 4V0ME 1M7BA 2QG6A 3MAAC 4DCSA 2VLIA 2XZPA 3D7MA 1NKSA 1VCMA 1MH1A 2EFDB 4PQRA 1N0VC 4KVGA 1HY3A 2AHOA 1ONBA 2JIZD 2O8DA 2XJ9A 1PLLA 2AFIE 2KBFA 3HYTA 3A36A 2O8CB 4W5JA 4DB4A 2GBLA 3ICEA 5L8VA 1G8GA 4BZPA 1UBEA 3FDIA 2WZQA 4GMDA 3VU9B 1G5TA 3IHLA 1GTVA 4BRUA 2ZJBA 3VKWA 5E7IA 1JR3D 2GILA 4LYHA 3KJHA 2F1IA 2E1RA 2IUUA 4XTRA 1N5JA 2PT7A 1OPXA 4R2HA 3SN6A 2C03A 1KO1A 3KFXA 3QG5A 4KO8A 4AKEA 4CEJA 4RY2A 4Q1AA 3QBTA 1SXJE 2BHRA 3VX3A 3KKQA 2W2VA 2MSCB 1J2JA 1G41A 1KKLA 2ODWA 3QXXA 2QNRA 3VQTA 5B30A 4L5BA 5DN6A 1QHSA 2F3TA 1QHYA 2C8VA 4XOIA 2QT0A 3LO5A 2ZR7A 4QOSA 1WBDA 1E9CA 2IXFA 2R65A 3FOZA 3O8BA 2XOKD 2WPDD 3L82B 4NTZA 4KITB 2HT1A 3FB4A 2FG5A 4XSGA 4ASUD 1VMAA 2A78A 2R8RA 4IHQA 3DOFA 1N3BA 1COWD 5EUQB 2A5JA 4PO9A 5SZJA 1NVVR 1KAOA 3IILA 4NYJQ 3GMTA 4M1KA 5J5CA 3EZ7A 4OI2A 5D3QA 2QEQA 2JLXA 4HDOB 1K8RA 3U4QA 2Q9BA 4H1VA 2NZJA 1MO3A 2PEYA 4B47A 1R5OA 1MRNA 5DHFA 1N5IA 2J46A 3CH4B 4NMMA 4MYCA 1CU1A 3T1OA 3BD9A 1UDWA 3ADCA 1RJ9B 3ZZUA 1E1QA 1G17A 4LY6A 1P7CA 4BEJA 4JYBA 5KNBA 4HZIA 1GL9B 2BMEA 4HDCA 4RD1A 3N5CA 1GDDA 2QAJA 3HR7A 4QGHA 4PFSA 5GJCA 1E2NA 3PQCA 3TUJC 5BN3A 2O8EA 2QP9X 5D3MA 1ZINA 2P2LA 4OQNA 4C0SA 1SXJA 2CLDX 3B1WA 4AKGA 3T61A 2ZANA 1ZM9A 2QSYA 4P31A 2H7VA 5EE1A 1Y3AA 5LDDC 3MG9A 4A9AA 3GJ4A 4US2R 2J7KA 1E98A 1Q1ZA 3ZYCA 2WOJA 4HAWA 1UKZA 3IBGA 5IK2A 1P3JA 2PBRA 4MITA 2XXAB 4ZCMA 4N0DA 4D0NA 4OQMA 3O8DA 1IY1A 1X3SA 3UK6A 2NMVA 2PMKA 3OEED 4QFMA 3QKSB 2YV5A 5CIQA 2JLYA 4I1UA 2DWPA 5LBIA 1KZ7B 5TXGA 2VH5R 5FH9A 3B9PA 4Q7LA 3RSOA 2PZGA 1M6NA 4G01B 3DZDA 1U98A 4QM7A 3AGQA 2X2FA 4M4SA 4PO8A 2B8WA 4LHWA 1AS3A 1HEIA 4I1VA 3ND8A 1G64A 3ECCA 4R9UC 3W3ZB 4F93B 1QF9A 4LV5B 3CO5A 4OYHA 1KK1A 3T5DA 1OKKD 1E2GA 3D31A 4PHFA 2OCPA 4KLZA 4QJ4A 3KXIA 5CITA 1DE0A 4DEYA 3SI7A 5EQTA 4QM6A 3B13B 4E22A 3P27A 1FX0A 1SVLA 4MUBA 3DM5A 2OE2A 4Q4HB 1AQUA 1XMVA 2ZS9A 3VKHA 3RS3A 3RVBA 2GVZC 5IT5A 3EC2A 2GXAA 1WA5A 4R7ZA 4PXAA 4CRWB 1NY5A 2G0TA 2B92A 1YZUA 4IDOA 4LZZA 1E0JA 3FTQA 4HUQB 1DELA 1Q1EA 1W44A 4JMPA 3C4JA 2NPFA 1AIPA 3Q85A 4V0OA 3ZVRA 4KLNA 4B48A 1EFUA 1XU4A 1XD2B 1S2MA 1AS2A 4XVQA 5JJKA 4B76A 4C7OA 2P3SA 2O0HA 4HB3A 4RD3A 3UG7A 1RE0A 2J87A 3BOSA 2QTFA 4AKIA 1CP2A 3I92A 4E07A 1P60A 1LS6A 2QUZA 4OJKA 5JCZA 3RS4A 1AKYA 3LY5A 1QBKC 2QL6A 2ZRFA 4MH0R 5CK5A 3CH5A 4LJAA 3WYGA 1SVKA 1FMLA 1NMXA 2EFCB 4G5RA 5JI2E 2CEAA 4EPTA 3FGNA 4D82A 1Z0AA 1ZD8A 2B21A 2IBMA 4OK6A 4HB4A 4PC1A 1KO7A 2W2XA 3X2SA 4FWIB 5JJLA 3VNVA 2XTNA 2BV3A 4B43A 2XJ4A 2G6BA 5EZ5A 3A58B 2RAPA 3C16C 4WXRA 4DKXA 4WZ6A 4XIGS 2AWNA 2WMOB 2ODNA 3REFA 4Q1EA 4M2LA 5EXTA 1KOFA 2YZ2A 3BB1A 4CIDA 2QQ0A 1Z0FA 3IO3A 3KJIA 1YR6A 3WBJA 2OFOA 821PA 3MJRA 2PL3A 3PR1A 3N2IA 4URYR 5KYKA 1XMSA 2P5TB 4KJZA 4X8LA 1G8PA 2D74A 1DAFA 5E7MA 1JB1A 2IT1A 1GAJA 5SZIA 3SS8A 4IVPA 4L8GA 5EE5B 2ZJYA 3A1VA 3CIOA 2QMEA 1W7AA 4Q1CA 4KYIB 3CW2A 4EDHA 1LF5A 3BB3A 1FTSA 2ORVA 2GZAA 2X19A 4IFBA 4OI0A 2RGNC 1MT0A 5BN5A 1AM4D 2EFHB 3CWQA 1VIAA 2AK3A 1J7KA 2CMKA 1GFIA 4W5WA 3CRVA 2NO1A 1P2UA 4NL4H 2F55A 3OEEA 3QKSA 1XNJA 3CF0A 1G18A 2YC4C 4OK5A 4D4LA 4ESVA 3PITA 4GPTA 3HU1A 4ZI2A 1EFRD 1YZTA 3KTAA 5IK2D 4YC7A 3FMIA 4IW3B 2DHRA 5IHPA 3T15A 1AJEA 1NLFA 1B0UA 3P20A 4TMKA 2FPLA 2BMJA 1RC8A 2QAGB 4URVR 2VTKA 4ARZB 1KI2A 3I5XA 1H8ED 5FI1B 2NO6A 4P4TA 5FUXA 3ZVNA 3BIFA 3TVTA 1RKBA 2B7CA 4EPWA 3ZGXA 1ZP6A 1W1WA 4ZDJA 2DFNA 3TIFA 3GLFB 1MV5A 1KJZA 4IFEA 4A0RA 4JVSB 5G41A 1KYIA 4B33A 2OM2A 2JJ1A 2JLVA 2QBYA 1DG1G 4I1SA 4IDHA 4TYPA 4TLEA 1E1QD 4AYWA 3CF6R 2ZYWX 1U99A 3K9GA 4Q1DA 1MO5A 4QNRA 4DSNA 2QMUA 2OBLA 2EW1A 3W3AA 2RGNA 2REOA 2D7CA 2G3YA 2IYTA 3WNDA 2AKYA 4QBIA 1RYHA 3U3KA 1F2UA 2ZPTX 3CZQA 2ZI6A 1TUEA 2VHTA 4MRPA 3LXRA 4RZXA 1ZBDA 4M53A 4BE7B 3KQUA 1SVSA 2H18A 1W5TA 2IWRA 2RB4A 3R20A 3UG6A 3KUDA 4M8NE 4BWYA 2KI5A 4DB2A 5H1YA 4MYUA 2VO1A 4W9MC 4R2IA 4POAA 1N6KA 1Y63A 4K46A 1N6LA 1OFHA 2YOHA 3MWYW 4HAVA 1E99A 4BLRA 4F4CA 4Q00A 2WKRA 3VMFA 4M1TA 2BIFA 1SKQA 1KO8A 3RRMA 1ZW6A 2ZE5A 3I72A 1PV4A 3K0AA 3CUEF 2JAQA 3EZ9A 3RS0A 5E95A 1QVAA 1N6OA 1ZC3A 5JWHA 1EFCA 5A0FA 1YR9A 2VEDA 2WJVA 3LV8A 2O8FB 1OH5A 3K0FB 1Z6TA 3D8BA 2ZXUA 1NMYA 4BLQA 2B7BA 2GA8A 3B78A 4V0KA 5KDLA 2H1LA 1N5KA 1TMKA 3W5IA 4DSTA 4MDEA 3BFVA 2ZE7A 1I2DA 2YINC 4OJQA 2XB2A 2D06A 1W4AA 3M4YA 2KJQA 1QHGA 2D2FA 2JJ1D 1BOFA 5FBWB 1GIAA 2HDNB 3V9PA 3HWSA 1W49A 4Q1FA 3P1JA 1E2QA 2J45A 4GFDA 4LBWA 4PO1A 2XNSA 5FBLB 3GEIA 2HXSA 1NN0A 2ZE6A 4C0KA 4WW0A 2VF8A 4CEIB 1VECA 2ZJZA 2QY9A 1JAIA 3GCGA 3DMDA 3P4YA 4RVCA 4LJ6A 4RD2A 3ICQB 2QSZA 4TQ9A 1PZNA 2C9CA 2VHQA 3IBYA 4QC2A 2C2HA 4EFNA 1T3LA 2ZEJA 2JA1A 1N6HA 2WTUA 1KO5A 1Z83A 2YNMA 3PEUA 1W0JA 5FPKA 3QKRB 1KDTA 4MRVA 4PC6A 1OB5A 1YR7A 2FZ4A 2BEKA 3Q5DA 4QGGA 3RS7A 1LF0A 1K5DA 3BERA 4CVNA 3SU8A 1E0KA 4DLWA 1VG9B 3EPLA 3EXAA 1KMHA 4GOXA 5B2ZA 1BMFD 2FMXA 4BFSA 4DWJA 1EWRA 1NNEA 2A7QA 1UEIA 1WCV1 2I4IA 3QG1A 3THWB 3AKDA 4UXIA 4A2PA 2C77A 3I1FA 5FOSA 2ZRGA 3GLHE 4Q03A 4V02A 3U7FB 3AVQA 3FHCB 4LBVA 4JSTA 5GJVC 3VTKA 1P6XA 2ZRDA 5KHOC 3GLIB 2FSGA 1XMIA 4DSUA 5F2EA 1BYIA 1D8TA 4DCVA 1P62B 4NPHA 5JBQA 1U81A 4JKYA 4P0TA 5DI3B 1CJVC 3L8YA 4KFRA 5FR2A 4RKFA 2ANBA 4JLBA 2HT6A 3BRWD 4G1UC 4TLBA 1ZYUA 2V4ZA 1PJRA 1CTQA 2PH1A 2RGCA 2IF2A 3KB2A 3QXCA 4FXPA 4JT2A 4YMSA 4GI7A 1E2DA 1UBFA 2H17A 2ZAMA 4LC0A 4LRWA 5CK4A 3ZIAA 3THXB 2OXRA 3IDQA 4BFUA 2EU8A 1RRCA 3E2IA 4Q1BA 5K8UA 2WMNB 5FOTA 4MGZR 1N6NA 2GHIA 2NG1A 4P33A 4TWZA 4D0LB 3SYKA 1L4YA 3GJ8A 1G7TA 4CZ2A 2FSFA 2IUSA 1J99A 4BFZA 3U4QB 3NH6A 1Z2AA 2VSXA 5G40A 1SVWA 1J90A 4KV9A 4TYYA 5CLLA 2G83A 2V55B 2BVNA 1G3UA 3W90A 1SULA 4IVQA 4EQ6B 4II7A 4QNMA 4OHVA 4Q9HA 3RANA 1FP6A 2JATA 4ZI3A 3MGCA 4B75A 4B34A 5FBRB 1JPJA 2XITA 3Q72A 4Q9JA 1XXHE 4F92B 1TL7C 3RDPA 1KI7A 1Q21A 3B60A 2GCOA 1YZKA 4JZKA 3QF4A 2CCGA 2ZRLA 1A2BA 4JLJA 1NJGA 3V4FA 2ZS7A 3V4RA 2O8FA 4Q7JB 5JI3E 1CIPA 1UKEA 3QF7A 2GESA 2J0VA 3B6EA 1NL3A 2YWHA 2Q3HA 1T5LA 4OHYA 4A2QA 1XTSA 1E9FA 1AKEA 2ODBA 1EWQA 2F9LA 4Q02A 1SZPA 5DI9A 4IJMA 4LUCA 4RKEA 4LV6A 2ZQ5A 1OKKA 2ATXA 2WV9A 1ETUA 1M7GA 2JLUA 4DDTA 3GLHB 2WPDA 4DXAA 2JEOA 5LB2A 3W6NA 5FPTA 3ETLA 3B8HA 2C9YA 1GNPA 1GUAA 1P9NA 1R10A 3QOFA 4HZUA 5C4GB 3MWLA 1G1MA 4LK2A 4DCUA 1W36B 3OEHA 3PJRA 3QY0A 3CRQA 3SQWA 1Z2CA 2ECKA 2GF0A 4ZCIA 1R0WA 3BFKA 4UNNA 1SHKA 1BS1A 2C96A 1DVRA 1G3MA 5EP4A 4C0LA 4OQFA 4CEHB 1F48A 1T9HA 2BKEA 1PUIA 3BFXA 3FMPB 1EK0A 1EX7A 3K9NA 3OAAA 3AP3A 4KFSA 4FI3C 4ZPXA 1WP9A 2EFGA 2FH5B 2MMCA 2BKUA 2XEXA 3DOEA 4HATA 2ZRBA 2VIIA 3CKLA 5LD2C 1PLKA 2VP2A 3L43A 4L9SA 2RHMA 1JEDA 2ZJAA 5UKDA 1HV8A 1GL7A 1XTKA 2QRZA 1KKMA 4NH0A 3T12A 3GFTA 4IOJA 5JWRA 4PC2A 2FSIA 3TQFA 5FTMA 3F0TA 4FCTA 4GMXA 1G9XA 1Z0JA 2G1JA 2V1UA 3KJEA 1Z0KA 2FF7A 5CM9C 1I4TD 1E0AA 2HEIA 3W5JA 1ZIOA 4J0QA 5HE8A 5E4FA 5FTLA 4NYIR 1NKTA 4CT5A 3UPUA 1P2SA 2F1JA 1EFRA 3I8SA 3SHFA 5AJVB 3L8ZA 1R8SA 1U8ZA 5DIFA 5FUVA 2C04A 5C18A 2OCAA 5BXQC 2VYFA 2NPIA 4TQUS 2BM0A 3VR4A 1CR4A 4LYAA 3FWYA 2UZIR 4QHTA 5DO9A 5F9FA 5K8TA 1U90A 1ZM2A 1M2OB 1GILA 2IHYA 4ASUA 4BZXA 2CDNA 1L8QA 4L15A 5JLJA 1Q44A 1TU3A 2Z83A 1NBME 4GRAA 4Q21A 5FL7A 2ZI3A 3KL4A 5IF9A 3IHWA 1NLYA 2IL1A 3IGFA 4EJSB 5SZHB 5DN6D 1CJKC 621PA 2IHBA 2RGGA 3ZLJA 3A4MA 2ZRMA 1TQ6A 3HP1A 1QG2A 1DTSA 3H4MA 4RZUA 2ZROA 4UQOA 3K09A 4M9SA 3X1XA 2IYZA 1E3MA 3QQ5A 3I8XA 2BCGY 4HZUB 3HU2A 1Z6GA 4EJSC 2F9MA 2CHQA 2AFHE 1A7JA 4HAZA 3OEHD 1N0WA 2IYWA 1TF5A 3QPVA 3JZAA 4HB0A 4YLGA 2FDCA 3UMSA 3U7GA 4IKEA 3MCAA 5H68A
chains in the Genus database with same CATH superfamily
3HACA 4ER3A 1VLLA 3TTSA 3B1XA 5A5GA 1R4NA 2DQ4A 4B0OA 3PXGA 1INLA 3CTMA 3DMRA 3HJGA 4OO3A 2QP3A 4DS3A 3GDGA 2A88A 3UXYA 2GBLC 4LVOA 3T52A 1R0BA 1JQDA 4K05A 4QUEA 3KOMA 2JFYA 1C4WA 1AGYA 3L6DA 4YJ3B 5AI4A 3T7RA 1KZ6A 3ESAA 3ONFA 4F5DA 3X1WA 3C3DA 1ZR2A 1MGOA 4F2WA 4YONB 5CLHA 2F43B 1CCWA 3LXXA 3DVLA 2BFCA 2O3RA 4X3PA 1NXTA 3CE6A 1TYEB 2WA2A 1OCEA 1RABA 5HRUA 1U7DA 4J3JA 1FXWA 3JQPA 2JFFA 2FU5C 3B70A 3JYPA 3WSWA 1MF7A 1NOJA 1WMFA 1T29A 5DYNA 3SHWA 3LQYA 4J29A 2GVNA 1NLUA 2P1ZA 5JSUA 5FX2A 2H85A 4JL6A 5EWMA 1FL9A 1WOYA 1CR2A 4WCDA 4RJIA 4DIBA 1KDOA 4K26A 3PNLA 4O4HF 4CMJA 4BNIA 4PHCA 5IMBA 4NBUA 5IDQA 4F3CA 3QBDA 1U2RA 3B1JA 2NW6A 2ZRCA 1WRBA 3NXSA 1E7MA 3HBAA 4IRXA 4WEOA 5A4KA 2HBYA 1CBUA 1NUQA 3SZ3A 1DQYA 4LYYA 2FW9A 5BQOA 1YFLA 3IXQA 4RTMA 2WJGA 4HAYA 5HK9A 1C9JA 1NUPA 1XOIA 4DNXA 1OYYA 1YDEA 2Q6LA 1YI1A 3DEJA 3NX4A 3L6RA 1FBNA 2VBCA 1PT5A 1UXOA 4DUZB 2E4YA 2PEZA 4HYTA 4B8YA 4HS9A 4L5AA 4I50F 4E5KA 5BNTA 5AW2A 3ZDAA 2L69A 3DKPA 3FZQA 1LBQA 4UM5A 4I5EA 2QA5A 3K5WA 2FFBA 3VAAA 3FPKA 4OI4A 2MT9A 3H6GA 3W77A 2ONZA 3GA5A 3KZCA 4B2PA 4KVAA 1XZBA 3G1UA 4ZMRA 1M6EX 2Z8ZA 3I3SR 4JXJA 4PIMA 5H82A 3VHXA 4LHXA 4ZDIA 1M1NB 5BPFA 1OXSC 2JA2A 4OHPA 4HAIA 4ALKA 5I9NA 1XJ0A 3NTRA 3SS9X 5CD1A 3K4HA 2OSBA 3UENA 2O2SA 2WJZB 5E3HA 4O4IF 1DINA 2XQVA 4RH1A 4MV7A 4M1EA 4DLXA 3U7HB 2ST1A 3ZX5A 2FN8A 4ZOLF 4YUAA 5KQSA 4EHNA 5FUQA 1D2GA 3SQDA 1LBTA 1Q6YA 5JS8A 1Z8NA 5K6TA 4CMIB 1O54A 2AMFA 1FDSA 1D0SA 3PQ3A 3LWZA 4BOYA 5JQGA 2RGEA 4PNHA 5DT2A 4BQRA 1GXSA 3QMWA 2TMYA 4PM4A 2PKWA 4AJ1A 4MIEA 3E3NA 2OHFA 1Z34A 1BMFA 2K87A 4XLLA 3LYUA 4Q19A 1WW3A 3RB8A 1BE8A 1ORRA 1BEEA 3GXOA 1GQYA 5IFLA 2PR2A 4B6EA 2DTXA 3BK1A 1MMFB 4NOJA 1F14A 2ZZKA 2J3KA 2RBKA 3AVWA 1GR1A 3NETA 1MIOA 2ABWA 3FR8A 3W3AH 4ENTA 4Q3DA 3ID6C 4KSYA 1SG9A 3RHFA 5AUOB 2FK8A 5LLSA 4FMCB 1M34A 4R51A 1KMQA 3MPOA 4ZCQA 3V00A 2AZDA 1U7XA 3BHMA 1D2NA 2ZS8A 4Q7QA 4BLTA 1HT1E 2YJTD 3UMVA 1JL3A 2WWGA 4FR2A 1G5RA 5ENVA 3K73O 4HH1A 4C0BA 3WLIA 2CF5A 4DMFA 3GLIE 1E8MA 3LIIA 1WZCA 4TL6A 2M6RA 3PDCA 5HTKA 3GT4A 4CLDA 1ECGA 3CEJA 3IT1A 1PJZA 3USES 1ZCJA 3OEWA 4HX9A 1F1BA 4ZVUA 5JHHB 5IUNC 3QE9Y 5CT4A 4NPAA 2XLCA 2NU7A 2ZU6A 4NPCA 1CHDA 2ORIA 3TBHA 4BFXA 1EFKA 5I3ZA 3ZI7A 4DYDA 3LBIA 1USVA 5BV7A 1L4HA 1HE1C 3GELA 3SKXA 3K0HA 1PS8A 4EITA 3M3DA 3TXAA 1WDMA 4GZLA 2D0PB 1P5RA 4KUEA 1Q5PA 1EBUA 4L3OA 4W99A 5C46F 4J16A 5ITZB 1YTUA 3QFRA 1NTRA 4FOPA 4IDFA 4LJ4A 4O2BA 1XEWY 2Q45A 3WRWA 1U0OC 4IJQA 3GHHA 5CNJA 1KPGA 2B1JA 1XG5A 1IZ8A 1ZUIA 1ZN9A 2QJRA 1GSHA 2GB4A 2KE5A 3B1KA 3HU5A 4JJZA 2WINI 3GJYA 4UBKA 3R5XA 5K3DA 3WGYA 5I7UA 1RZ3A 4G4JA 4OQXA 2W2KB 2RAUA 3C5EA 3IAS1 2XPCA 2JGMA 3ZGVA 3VO9A 2WHPB 5JU6A 1XP8A 3CUKA 1NXPA 1Y9AA 4WZZA 4TV9B 3C4QA 4IJWA 1L7XA 2G04A 2NVOA 3NWJA 4M6WB 3UMFA 4DCMA 3OFVA 4MQFB 1AGRA 4NCIA 1GKLA 1DXQA 1N7GA 4RFVA 4CTOA 4RVNA 5HF6A 5I9LA 1ODJA 1WLSA 2XV1A 3QTTA 5IKPA 2QL7A 2OLKA 4BWFB 1NVVQ 5K3EA 1IPFA 3FRHA 1YONA 3NDRA 1PFKA 1L7BA 1DKQA 1LLQA 1H1LA 2R8OA 2JAXA 4A6XA 1H2EA 5L3VA 4UFOA 2WVHA 4GDFA 2YJGA 4WNAB 5ALWA 5LP1A 4YCNA 1V16A 4GM4A 1TADA 1NI4A 3CNOA 4LJKA 1E32A 4BNKA 1Y4DE 2QZ9A 2Y1XA 1WAMA 2Q1SA 1KR2A 3U4GA 3U9SA 3L40A 5JUWA 1YS2X 3MS7A 3A1EA 3D5TA 4OIMA 1D7AA 5P21A 3WI7A 2VTBB 2Q4TA 5TQJA 1MU0A 2XGOA 3RFCA 2K2WA 2E7ZA 4ZKEA 1CV2A 2A6PA 3ZXUB 4OP1A 2C83A 1U3FA 4FFLA 1W4LA 4HC4A 1R1DA 3M33A 4HDSA 4N5IX 4OAOA 2I2XB 2OT3B 1MAAA 1TCCA 4JLUA 1GTSA 3KEQA 1OZFA 1SFRA 1VL8A 3KRTA 3LOQA 3RNOA 1VDMA 4DDHA 5JCOC 1YB2A 4WLOA 2NU9A 2IEYA 1RIIA 2WMYA 4TT3A 3D6NB 4KL8S 2I7VA 3DEZA 1BE6A 4LYJA 1WLYA 1VXOA 1A50B 3UJPA 1DC5A 1Y4ZA 3HXLA 2G9NA 5B6IA 5CD9A 1X8JA 3JU3A 2FQWA 4WI1A 2WM8A 1J8FA 1DEAA 4TV8B 1H42A 4F1KA 2I7TA 5KJCA 5JPIA 1F8FA 2V7UA 2YW2A 3O1JC 5JY6A 1G5IA 1KSJA 2G9ZA 3I9V6 1C29B 1BYUA 3HKDA 3ZWQA 2QUIA 4Z4FA 2R4QA 4FHZA 4US0R 1DKUA 3A6EA 4CWAA 4TL8A 2BGWA 4R9NA 4KK4A 1V3QE 1ATZA 1DG3A 4Y2YA 1GFWA 2Q2NA 3TEMA 3ZHVA 2O5RA 3AOEA 3CCBA 3ZJTA 1WMEA 3KHSA 1J7JA 1J1ZA 3MCZA 4Q01A 4XB2A 1CUBA 3NKLA 5B1DA 1AVTA 2IXGA 4OFZA 3OSUA 3HVHA 2G08A 5IJAA 4C6TB 1IBKB 1T0JB 5BSVA 1VP9A 2P8JA 3SYNA 2VZLA 4AWXA 2QHXA 2GEVA 4PLTA 3K0EA 4EJ6A 2JAPA 4GR9A 4KBGA 3MOGA 1VJRA 2JPDA 2WJ6A 4EATA 3NNDA 1GQ2A 1Z3IX 3T3DA 3Q40A 2FDRA 4CN8A 1EUCB 1OGIA 3NDBB 2I7CA 5HKOA 3BFJA 4I81A 5HZHA 4HNQA 3F9IA 3K0FA 4W5HA 3AR6A 1JSLA 4L27A 1IM2A 1UBOS 1IHUA 4Y0AA 2GHTA 4B3TB 1IJFA 4FQ8A 1G20E 1Y5MA 4E5YA 2DT5A 4RXTA 1OX4B 2OB2A 5I48A 5HOQA 1N2XA 2GPAA 3QUQA 1UMCA 4OMFG 1C3JA 3OCWA 2BJWA 1NN1A 5AOVA 3T7DA 5LU9A 1R4NB 4BKQA 4KIFA 2CDAA 3GLHA 3U2QA 3VKUA 3OJ0A 4A0FA 2VT7A 2R7KA 5DLQC 4BFTA 4BPBA 1I4LD 4N48A 2WFLA 2X15A 5B7QA 5ELLA 3K6JA 1U8CB 3FTCA 3G5LA 4H4DA 4CHTA 3LLUA 4DCJA 2HF2A 2BF7A 2AZTA 2ZUWA 1U2GC 5AK3A 4Z7JA 5L40A 1T9GR 3HWX1 2V58A 3OKFA 5C4MA 1ZD2P 1NDUA 3AK4A 4RA6A 2GETA 1HT2E 3ZR4B 4RY9A 1FP1D 4UREA 4PYOA 3N2EA 2AN4A 4TQAA 2O4CA 3WSTA 5IZCC 1KEPA 4CQJA 3KLBA 2C31A 1A9XB 1NG1A 3MTAA 3EZLA 1N8NA 3BA6A 1L5MA 3FIJA 2CL7X 4FGUA 4PPFA 1XLWA 4MVXA 3BUSA 1WQ3A 1HORA 2Q5QA 3WL6A 3MT7A 5ITVA 4TPKA 4Z4HA 3G2KA 2PGOA 4OFWA 1CUEA 2WHYA 2C4VA 4D8VA 5KDDA 4GX2A 2O7SA 4Y1FA 4GZMA 2FMHA 3D2BA 1ADCA 3OZTA 4MUMA 1EFTA 3OMXA 3PUXA 4ITVA 2QGFA 4UUNA 1JJVA 5T3YA 4R1LA 4ZRMA 5CA1B 3PEFA 4C0JA 1XUOA 3AXTA 4NU5A 4Q66C 3OIVA 4MWSA 4NP6A 4R1PA 3U0VA 3TW6A 1E79D 5CB4A 4PZYA 3OBIA 2TMKA 3WQRA 1V41E 2FP4A 3R41A 4RIIA 4MCHA 5KNBH 3LBHA 1CRZA 1TYZA 5FPHA 2AR9A 5LBUA 3SICE 5EHZA 3AEKB 2PIDA 2P9HA 3AF1A 2PR7A 2ZTVA 2BR4A 5B12A 3TZ6A 2JL1A 4EIWA 3MM4A 1CDEA 5JS1A 3RWBA 1QYWA 2UYGA 2NO9A 4Z8YA 3R7LA 3R7SA 2PSEA 4FQ7A 3C2QA 3ASYA 1O95D 2MINA 5GJWC 2ZSDA 2C9DA 3E84A 4KNVA 1N1EA 4B7CA 5AVQA 1RAEA 2OHGA 1XZEA 4PVCA 5JRJA 1JDTA 1BU8A 2D2IA 4P9NA 2R7MA 1EGMB 1AOXA 4QELA 4BZQA 5B7NA 5E2BA 2XUHA 1D2HA 1T3SA 3FOAA 4RESA 2H65A 3BREA 3BGIA 4RBNA 1GL6A 4V0MA 4QUGA 1NHWA 2H9YA 1UPAA 4V38A 4I50A 3WRYC 3ZJYA 4AF7A 1Y5RA 5A4FS 4PGFA 3HXTA 4LRUA 1KFKB 1YCGA 1V3TA 3OZFA 1FTNA 3RSHA 3H97A 1EXNA 3NPMA 3PICA 1XZLA 4UEQA 1KMCA 3F78A 1ZOOA 2CVHA 1N32B 3O4GA 4XGKA 3L6BA 1OH6A 1MX9A 5JC1A 2AXNA 3I30X 3G88A 2CDBA 3QNUA 1KJYA 5FDFA 1G4UR 4BYGA 1Q0SA 2WVGA 2EZ8A 2JAOA 1U2ZA 3KYCA 5AJXA 4D1YA 5EIAA 3BQ9A 2WABA 1U1FA 3CUUA 4JJIA 4EO9A 1TT7A 2G76A 4MQMA 4YMLA 1FU7A 3EUWA 1NF8A 1FW6A 3PKJA 4NNPA 4IDNA 3VGJA 1DQRA 3K9CA 4EG5A 2ID8A 4M3NA 4BGVA 1TYBE 3TXYA 1MX3A 3WNBA 1RHJA 4PPQA 2XHEA 3SJUA 4U2GA 4ZDKA 4JP1A 3CX8A 4I1RA 3VPDA 4FFDA 4M89A 2HW8A 4UBMA 3B53X 5ALXA 1Z2OX 2ZUUA 4K9SA 3IURA 2Q27A 3TKLA 1XLTC 5J4HA 1QO0D 2C7BA 2PMBA 2PLAA 5EMHA 5FWAA 5A4JA 3ZE1B 5KPDA 1I7LA 2Q3FA 1BA3A 5P8WA 4PYQA 1YZQA 4G5GA 1AK9A 1NIJA 2C3UA 4HQFA 3ZCVA 3HB0A 4GPZA 1PK7A 1SCQA 1EX6A 3ETEA 4HP8A 2O0LA 1GPWB 5EPUA 4XWWA 3TS1A 4KGVA 4M46A 4KIGA 2ZRAA 3ZUPA 4L16A 1HOXA 1YHNA 1VZ3A 2WOOA 2EWMA 2XWQA 3FZEA 2YBEA 3EGEA 2WMDA 5F21A 3R75A 4E2XA 1T1JA 3MA0A 2ZT7A 2Q1YA 3KOOA 1A9RA 4F4JA 4Q24A 4OU5A 3L8HA 4ZVRA 1EVYA 4UHFA 3RT1A 2ZGVA 1SAYA 3QEMA 4ICIA 3ZV5A 1UJNA 4JUDX 2WQ6A 3DUFB 2IS1A 1SCBA 1Y9DA 1BH6A 4F9TA 2ZBGA 2MYNA 1D4FA 3NRBA 2B1IA 2JVJA 1CJUC 4IHKA 1WO8A 1DAHA 2VSOA 4PS1A 1KYYA 4MGKR 4QG7A 4UHEA 3RCBA 2C00A 2OTCA 2IH5A 1PR1A 3OQNA 2QB5A 1ENOA 4UNPA 1XDBA 2A9KA 2J0EA 3CYFA 4PSDA 3TR5A 1GZ5A 5G02A 2VDKB 1UT5A 5DYTA 2LD4A 2XOKA 1JQLB 4MI6A 3Q7TA 1XCMA 2DBQA 4INPA 4L9RA 2LKDA 1VCHA 1T13A 1E9EA 4HYYA 4D45A 1GT6A 5AMXA 5E7QA 4DWVA 1M0EA 2CWDA 2HN9A 1G4AE 1X6VA 1Y8QA 3DLCA 3L1IA 3VPHA 3BJIC 3STVA 3ZV4A 4B5LA 3H3FA 1KZ9A 1OJ7A 2FF5A 4MI1A 1GYRA 2ZVQX 4MPPA 3ZE6A 1DQNA 4S1NA 1DX4A 3I37X 3IUYA 5LQRA 2N75A 2EERA 3BA1A 1ZXLA 4Y6OA 4COOA 1YBHA 3A1FA 3MSXA 1C14A 3R5KA 4N03A 1BCRA 5FWXA 3AYZB 1Q77A 2PGNA 3ILVA 3ZX4A 4N01A 4BIIA 1ZR4A 4Q9NA 1II8B 2FX3A 1VG1A 1ZDMA 5AJZA 3GB9A 4ARZA 1VG8A 3MJHA 2XI4A 1U0EA 3MJSA 1AT1A 1DMSA 2XA2A 1RPAA 3IDOA 1X1EA 5LMZA 1AKTA 2QNIA 1ZA2A 1VCIA 2XGMA 4G86A 4M98A 5FV7A 3SZLA 2Z6QA 2WD8A 1EMDA 4Q9IA 5LMCA 1DRVA 1OV4A 3TZCA 1NQVA 3KELA 2ILVA 4JOQA 5H80A 1JQAA 2XZDA 2HK8A 3S1AB 4RSRA 1E6EA 1T1SA 4FFRA 3V42A 4C3ZA 4E2WA 4L4YA 4YN3A 5JH7B 4RZHA 5K1ZA 3W2FA 1E2JA 5K0TA 2QK4A 1SUPA 4I3GA 3AF5A 2H2DA 2NZXA 3S1LA 5KKNB 3UMMA 2Q41A 5J1TB 2AFIA 2PRSA 4CHGA 1QU3A 4OQ4A 1NVUQ 4LHYA 1TKRA 4P3XA 1G3RA 2GN1A 1SKYB 1JWLA 4D26A 1FJGB 4K9OA 4NG4A 5JROA 2W6PA 3PG5A 3AF2A 1K08A 3EDMA 1G3IA 3I6BA 2QTRA 2QRMA 2X1MA 3TSWA 4GC9A 1TT5B 3E9QA 3Q5GA 4D44A 3IR5A 1ELOA 3K1JA 4HN2A 3T7AA 3E22B 4CT4B 3LQFA 1JHUA 5DVZA 2WKPA 3WHLA 5AKJA 5G3ZA 5KKAA 4MPJA 4YMHA 1IN6A 3NVAA 1SWWA 1BCSB 1POWA 4RLHA 4U2DA 1T2VA 4A8JC 4UBNA 3U17A 1NOIA 3ZYZA 4OUDB 1ZIPA 3IQDB 4W9NC 5LC1A 3T5PA 4GNRA 3U7QB 5WRFA 3CLSC 4MYSA 4BNHA 4UUAA 4EKNB 1X39A 3RJ5A 1MX1A 4FHEA 4LJLA 4RO0A 2J67A 2QTMA 2RBGA 3QQPA 4RXMA 3ANYB 3PGJA 1TXGA 1EA5A 1GA6A 1ZX1A 3VZCA 3ZW9A 1QIMA 2OY0A 4RSHA 1UZAA 3GO4A 3AG5A 2PZLA 3TLEA 2ZYSA 5KYYB 3C98A 3QBEA 5JD6A 3DF9A 3TLKA 3N0RA 3RRNA 3F9RA 2PT5A 2ZDQA 3H86A 1AK2A 2W6ID 4DBZA 2B9EA 4GG1A 3ZCSA 3HP7A 1TNDA 2DWCA 4CMIA 5C8YB 1FYVA 2HJSA 3CEHA 1T36A 3A6KA 1YMQA 3DAGA 1GZVA 5BYBA 5K45A 1SWVA 3DKRA 4D8UA 3P9ZA 4S1WA 3R8FA 5J40A 1E63A 1XTIA 2X9LA 4HI0E 4U0KA 1Z4KA 1E6UA 4XFJA 5AM5A 1Y9EA 3EW7A 5AM2A 3F5FA 5H0IA 3H16A 3OPQA 5BRNA 1YZVA 2LIVA 3U6BA 4RVSA 1CIVA 3NHBA 2JGDA 3BL6A 3D3NA 3UJHA 3EODA 1Q50A 5D01A 3FRJA 4YALA 3ZU5A 4QDTA 3GCDA 5AT1A 2GSDA 4CDRA 5JSHA 2J0UB 3VZQA 4A23A 1Q0ZA 1ZLXA 3I6IA 2XGJA 4E11A 5JSQA 3BX1A 1XEFA 3GLFE 3NYRA 4YFVA 1ZD1A 2WF5A 3R7DA 2C57A 1GCUA 1US8B 3HYCA 4IH9A 4Y9DA 1RLUA 1X7WB 4C06A 1JP7A 2WAXA 4C5AA 1JHRA 1KVSA 1QC5A 1W0KD 3E0QA 1DLJA 3GZJA 2A1TR 4D4IA 4C4AA 2PG3A 4CI9A 4F11A 2O4UX 2PL5A 4EM6A 5EPOA 3BGSA 3M0EA 4ZT3A 4M87A 3ER9A 2QG9A 2EJBA 3M3PA 4DLVA 1F4LA 2PSSA 4BVGA 2QTWB 1Y1QA 2XBMA 1PYOA 1FPMA 4F12A 1ZK1A 1C3OB 4EECA 1A9PA 2P69A 4PZ0A 2P9TA 5AJTA 3AVUA 3GVIA 3GAMA 1J1UA 3WHKA 3L5OA 4RXUA 5T4HA 3ZZ0A 2VDLB 3MFQA 4ZOQI 4H27A 4Q7MB 4DGQA 3CXRA 4PYKA 1DNPA 3OQOA 1YOVA 4EYQA 1KETA 2R6FA 3QGMA 1NZFA 3E5HA 4HF7A 1D1TA 2HNBA 4HMQA 2D5BA 4NJEB 4UEOA 1VFNA 4TMZA 3TFOA 3QF4B 3I62A 4TTQA 4YMVA 5KHLB 4RSMA 4IVRA 4U02A 2VSFA 4OYRA 1LJLA 1DHTA 1JR2A 2DSNA 3OX1A 4AMBA 2GAOA 1YBVA 4AMUA 5F35A 2FGJA 3AHJA 3CW9A 3EEBA 4UNQA 3X1ZA 2FOXA 3EYAA 1PT6A 1V5EA 4WBSA 4OBXA 1W5SA 5KJFA 1ESEA 4ZVOA 2RKBA 3C41J 2PL1A 4H0NA 1PD1A 3PNQA 1HLGA 3GJ3A 2PX3A 3JX9A 2K6GA 3N28A 3GJZA 1V25A 1P5HA 1EJ0A 1ZOPA 3B20A 3G0BA 4M7RA 4FMBB 2QD5A 3TD9A 3AVXA 3U48A 1UQRA 3QELB 2WBLC 3I01A 4LDRA 2W6CX 3DHYA 4UM7A 5K3FB 3H4IA 3TZLA 3GP3A 2VQEB 3GEPA 5KTRA 3WZMA 3PVSA 4YJ2F 1KDRA 1CUWA 3ZDYB 4DHEA 4ABTA 1LDGA 4WVFA 4PPGA 4JJ6A 3VJRA 2QNBA 3NHFA 1DC3A 1HA3A 4WLFA 5GOTA 3TOXA 4ALLA 2BP7B 3OMLA 3Q3CA 3RHZA 4HNGA 4EFMA 1UZNA 1WZNA 5AVTA 1KTVA 4UQPA 4X85A 4ZAVA 2G9QA 2XAUA 4KO3S 2P2ZA 2X0FA 3LX6A 1CQJA 1HYBA 3OT1B 3NQ41 4DR7B 1QONA 5BWLA 1Y5IA 4N6OA 4Z8XA 1WZIA 3MUNA 4Y6SA 4ANFA 4WCFB 3QVMA 3QXSA 1Z2DA 1XMQB 1Y1KE 1F8GA 3UEOA 2YWFA 1CULC 2I4TA 3JRNA 4G97A 5DGTA 2IVFA 3UVEA 3CWCA 4EUSA 3MTJA 1DUVG 7MHTA 2O48X 3U09A 3KXLA 2XZTA 1JXQA 3I04A 5EFOA 3R7WA 4OLHA 4BNDA 1UXIA 3DBIA 3V7UA 4MW0A 1FFHA 1YULA 3B6JA 4X1YA 5HZKA 2FXVA 4Q7KA 2NXJA 4U00A 3T99A 1J49A 1LNQA 3M81A 4JUAA 1V5FA 2VHEA 4NY1A 4B8WA 3D64A 4KX3A 2IVZA 4DIOA 3OESA 3TR6A 3MINB 4GGOA 3ZBPA 1C9NA 1XVTA 1ZZGA 3RAGA 5JAOA 2AEEA 4BKRA 3LCMA 2OV4A 1K66A 5LQMA 4UVDA 3IP8A 1FE8A 3RUPA 5B7PA 3RABA 1VQ1A 2RCNA 2OG2A 2V7EA 2XRYA 3FFWA 4KR0A 1O4WA 1ZUNA 2AXPA 2R7AA 1THZA 4IL5A 4IYJA 2VQSA 2RH4A 4DT1A 4PYMA 4MWCA 2FPXA 4PLYA 4TWRA 1A97A 5HKAA 4GI2A 2B6HA 3LVRE 1USGA 4LWZA 1P73A 3SWWA 1JIXA 1L8AA 2ZI7A 1Y3BE 1YDWA 2M2IA 2MIIA 4Y1RA 3IAM6 4Y2SA 4DRYA 1I3NA 3ZXSA 2C8JA 4Y6QA 2ACKA 4EGCB 1WZ2A 3MF4A 5DTMA 1LRJA 5JH7F 1AN0A 3KD3A 3UB2A 1CUGA 1XV5A 2WNIA 1RPZA 2ZDHA 1OLUB 5F51A 4LGCA 2DBRA 1CEYA 4OJNA 3ZHSA 4PQFA 1XZCA 2BMDA 2G0NA 4FQ5A 2DC1A 3Q1KA 2DPMA 2DY1A 2CZGA 2ZQZA 3EG9A 1ZVMA 3WBBA 3SHOA 4Y2UA 2FRDC 5HR5A 1VGRA 1DGQA 3ZD6A 2XXJA 1C41A 1NUTA 1I3MA 4KQHA 1RYNA 4E0BA 1C50A 1K8ZB 1RR6A 1S96A 2BUCA 3IAEA 4YAKA 1JEEA 3G49A 4OOEA 4PSKA 3DEIA 1HNZB 2YX1A 3I32A 3EEFA 2A0UA 4UEJA 3TAHA 4HLQB 1ZJ6A 1SB8A 3MCWA 3FPSA 1UCFA 5TGTA 7REQA 1OXBB 1Z0SA 1VMDA 3V4LA 3F6EX 4H3SA 2QM8A 2ZOSA 4U2EA 4G09A 1GN9A 3WYBA 4GXRA 3TI9A 2XEDA 1SN7A 1VCNA 3EVFA 4IXWA 1YIDA 4REOA 1YQEA 2Q62A 5K0NA 3RIMA 1S3SA 3AHIA 3S27A 3LBAA 3LYAA 3ZQ4A 5EP1A 4L72A 3GLKA 1NRWA 1NUSA 1XQXA 2WUGA 1RAIA 4D97A 3HGTA 1UMCB 4FBLA 2HM7A 2HWXA 5DBFA 4C04A 5JWOA 4RTJA 1V71A 4ER0A 9ATCA 4G0VA 3C3CA 4F9EA 3BXXA 1EK5A 3RT7A 4OHMA 5KOHB 2A57A 2XNCA 1OB2A 1TQ8A 2IEZA 4YRDA 4N7MA 4AN4A 4NBSA 5DHUA 8LDHA 2KM1A 5EWJA 5J9FA 5TQ0B 5LZ9A 1NM5C 1V37A 2CXPA 1K75A 4QQFA 4WOBA 4E5UA 2ETXA 4INJA 4P4UA 3SBXA 2ZBFA 1CDZA 2Q6VA 2ZAOA 3CR3C 3UV6A 3PF9A 3X1DA 4C20A 1L6IA 2GN8A 2W6MA 4GBED 1Z3CA 3U3JA 1JHOA 3UWMA 3IQIX 4OI1A 3EXIB 3PS9A 1UPXA 1W76A 5FL3A 3LBNA 3CLUD 3TUZC 2JB9A 3OHSX 2GCEA 2XDQA 3RVLA 1QGOA 4AO6A 4HHEA 3AUAA 3PLRA 2WHRA 2WM2A 1T2FA 1GM5A 3CF4A 1ZCAA 1E6LA 2VPYA 3C3JA 1IZ9A 4UJ3A 2JFBA 4ZA2A 4AI6A 2YYZA 4YRPA 2GT1A 4ZGGA 1MR3F 4X93A 3BXEA 9GPBA 1O97D 1RJFA 2I62A 1E8DA 2E4VA 3IPCA 5HMLA 1AF4A 2YIJA 3ZBTA 1L7NA 3KEMA 4H6XA 2YN2A 2QVXX 1R0ZA 4KQGA 4KQKA 4CG0A 1NBOA 1LKZA 3EDYA 3TK1A 1FXWF 2OVFA 1F2VA 2DCUA 5JJIA 1ZMOA 3GVXA 1U9IC 1E1RA 3PE3A 2LZ0A 3A2NA 3NZEA 4Q4LA 4QOJA 2G88A 2IODA 3LPLA 5IJ0B 3OCXA 3R5HA 4F3YA 4CLRB 4H7HA 2VPTA 2WHQA 4X45A 1AMOA 2E37A 3EOAI 4MO2A 1OLOA 5LBTA 5JO0A 3I73A 4BUCA 1MRZA 5ALFA 4KWTA 1AQJA 2IOFA 1UXJA 3RC7A 4QJ5A 2HCBA 5A3RA 1EVLA 1P0PA 5IZ4A 1RYZA 3EAGA 2GAIA 1D0VA 1GUDA 1C1DA 3JZMA 3R6DA 4GOJA 1NNUA 4ZO4A 4Y2TA 3ZWMA 4BCDA 1FP4A 4MUYA 4C6HA 4EH1A 5IF3A 3EMBA 3S2UA 2ECOA 3A0RB 3PVZA 4RELA 3AUUA 4FT4A 2P77A 1ZISA 4RQAA 1NXWA 4WPGA 3M6VA 5KOJA 3R9XA 4G3XA 3BIWA 5AOAA 4D9MA 1E4YA 1GYPA 5SV2A 2YY7A 4FHFA 4O02B 4X1KA 3EPKA 3WLNA 2V5AA 4HGYA 2IS4A 4AROA 1ZMTA 3OOHA 4HLUA 4A16A 4K9RA 2R84A 4LCBA 5CFMA 4WLVA 1OWOA 1RPJA 3NHPA 1A8QA 3Q5EA 4KQ1A 5TJ9A 1XVVA 4R69A 4XPIA 1YS1X 3R74A 2DLDA 1MD9A 1OE0A 3ZWKA 3C6ZA 5E3IA 4AUKA 3TYXA 2AMVA 3C1UA 1XA0A 2ZXUA 1JFSA 2D2EA 1SZDA 4MQFA 3T1NA 3FROA 2JW5A 4KREA 1DIOB 4PZ9A 4LTNA 2ERYA 1H5QA 1TQ2A 1XL1A 4KO1S 2O8BB 3M4ZA 4TV9A 1SCNE 4RM2A 1RCTE 2OAEA 4GZ3A 4C9BA 2OXFA 3HZRA 1RLIA 3QUBA 3IS3A 1SVIA 2BHTA 2R8EA 3KALA 1N6RA 3E18A 3LQKA 1WDTA 5EHNA 1IB6A 5AI8A 4P58A 3UXMA 4AZ3B 3T35A 4GYWA 3MB8A 2VHYA 1QFSA 4M9ZA 4RMJA 2FHPA 2VL7A 4E4TA 3K0AB 3IQHX 4WD3A 2GJSA 3H2ZA 2HRBA 3LT2A 3QELA 1LSSA 5ALQA 5HMMA 3LUCA 5L3RA 1EP2B 3NC0C 3OICA 1UQUA 5T8KC 3HTXA 2ZI9A 3O9MA 4TRMA 4OXKA 4M8SA 4JI6B 3RU3A 5HKKD 2DQYA 2H8GA 1GOTA 3M89A 4QAJA 1RYDA 2A9PA 2ZP1A 1AQNA 1FDOA 3ZI0A 1C1XB 4OJMX 4Q4DA 2I71A 4MYTA 1XPUA 1K88A 2DE0X 1TD9A 2JI7A 3G2IA 1P1HA 1PF7E 3CRZA 4KNYA 1M1ZA 3W6OA 4OHZA 2JLAA 4JIMA 3WGNA 2AFHA 3NBZC 4ZT4A 5JE8A 3SX0A 4V0LA 3SDBA 2IKSA 2C5AA 2ZSHA 4BLVA 1ZRHA 4G1FA 4RPCA 1ANKA 1M1XB 5ERGB 5F3DA 3ZTYA 1EHIA 4CFZA 4YLYA 5M2QA 2PUFA 3KUXA 2NU8B 3BWYA 3V3KA 2FUG1 4HJRA 3KOUA 5ALOA 3JYHA 4NU8X 1OH7A 5CDTA 3TEJA 2C5GA 3CURA 3FVRA 3K72B 1Z6QA 1G8KA 4FCVA 4FFPA 1N2IA 2CBXA 3H0KA 1V7QA 4DIFA 2XSZA 2VZ9A 1A4XA 1T5IA 4YY3B 4FC6A 4FJ0A 4KIWA 3V2IA 4J4TA 5DGDA 3ZN2A 2E87A 3CLRC 2O06A 4NS4A 5H70A 2CFCA 3K1YA 3GJTA 1AQYA 5EUCA 5J2TF 4ARUA 3L7MA 4MRNA 2I2AA 4B81A 4DG8A 4AP9A 3S6JA 1IN1A 1OXVA 2H29A 1X7DA 2IU3A 2HHJA 4OQDA 1GNVA 1ZHHA 2XMCA 3LE8A 3NBFA 3EXFA 2H5IA 3A3KA 5H8WA 2GEJA 2PUDA 2DCMA 3O1LA 2I3BA 2NTNA 3WRXC 4EB6B 4GHWA 4QECA 2XB6A 4EG3A 1QORA 2GWHA 4E15A 1QDLB 1ZXBA 3KFVA 3NBYC 3OF2A 2WJIA 3PXCX 3U7EB 3WLAA 1G2QA 3RLFA 4YRBA 3CZ4A 4TZ6A 2EQBA 4GMGA 3JYOA 4WY8A 5GVSA 3WK9A 1LUAA 1AZTA 1IY2A 2HXYA 1GKKA 1GPAA 4HZGA 2CE7A 3LUAA 4KI7A 1T8SA 2V7WA 2WLSA 2ODPA 4ZAXA 1G55A 3OPNA 4JVNA 5ERYA 2V0CA 3QSYA 1QYDA 1VYTA 4DC0A 4BTLA 5FUBA 3COZA 5FLEX 4DZTA 3B9RA 1WTCA 1OBVA 2QVGA 2QX9A 3CZAA 4BVJA 2Y0PA 4DV6B 1CY6A 3RJZA 3IX7A 2DU8A 3GLTA 5FBQB 2BKVA 1L7DA 3E7XA 3ENZA 2ZQYA 2HRQA 4OHCA 2IBTA 4GQAA 2HLNA 3WGVA 3MAJA 3COWA 2YXEA 5C4IA 3Q8XB 5GM1A 4OJTA 4CIBA 1XTJA 2I4LA 4JUBA 2HA7A 4R3UC 4W5RA 1K7FB 1OC2A 4C7VA 1OX5A 1Y7PA 2A2ZA 2IV3A 4FYYA 5AQEA 2WF9A 2J0QA 1ZXXA 4F3KA 1P9LA 2ID4A 2XUJA 3EISA 3KJNA 5EJIA 4HFJA 3EPHA 5EP3A 3WMXA 3EX7C 3UAZA 2GJ8A 3MJTA 2B20A 2UZAA 3Q15C 2BKAA 4G0NA 4YP5A 5BO5A 3TAUA 5AM3A 4RTQA 3RC8A 3LP8A 4BX8A 2ZVPX 3AI7A 4KRGA 1E6MA 2VP5A 2WYWA 3EWSA 2RHJA 3PLNA 5AESA 5AW4A 3CRMA 2B4RO 1R0YA 2QM3A 5EJMA 2GRAA 5K6RA 2A5YB 3HWRA 3HM9A 1XO1A 2BTQB 1XKTA 4G0MA 4JR2A 3P2EA 3AJ9A 1EDZA 3HJNA 3ETGA 3G6KA 4R81A 1M7HA 2M1XA 2QTAA 1Q84A 4RVGA 5BW6B 2XYGA 3WBFA 2HQ1A 2V98A 4H60A 4BFLA 5I7WA 1GGVA 3EA5A 5TNXA 3YASA 5KYVA 3A6HA 1MCZA 2CD9A 3CUSA 3I61A 3NDJA 4UDYX 3JZIA 1Q74A 1M72A 4R1NA 1UPTA 1IJBA 4CIXA 3ORFA 1ZAKA 1CLEA 1CEXA 1GGNA 3N0VA 4PC7A 1QJ4A 2X9VA 2GCIA 2J5QA 2O2JA 4MW5A 3H2YA 2Q5LA 2XUGA 4LJ7A 2ZUCA 4JGBA 2BGIA 4L57A 5LLDA 1YRYE 4LK3A 4UPEA 2D13A 3IE2A 4C4RA 3W1VA 4CKBB 4F8JA 6PFKA 4QT4A 1CYDA 3SOZA 4N3NA 1HNXB 4PLFA 5C1IA 1TRKA 3T5TA 2G1UA 5EJ6A 1XT6A 4JS0A 2PX2A 2PLNA 4JJ4A 3S55A 4FFVA 3JWPA 3GNTA 3BWXA 2XODA 3FIUA 2CD7A 4X3CA 3UYKA 3QHPA 4BX2A 1Q0PA 1WXXA 1N2ZA 2EARA 1WUIS 4L9WA 4ZOEA 2X41A 3BJZA 1YMUA 1B8NA 4NE2A 1T6ZA 1PBNA 5EXPA 5FIUA 4ZZ3A 2FPIB 1JLLB 2DPYA 2YQ5A 3BXZA 3DW1X 4UOQA 1ZITA 1KU0A 1RKUA 3WIEA 4TVBA 3U44B 3U4IA 1KP9A 3P9SA 4KUGA 4MKIA 1K2VN 1WR8A 3OCZA 3TTTA 3FBWA 4EOGA 1D4ZA 1OPRA 1VPVA 4E3ZA 4IG4A 2OXEA 1CR1A 2OFFA 3EPJA 4UC0A 1NZJA 1SPXA 1Y98A 4FM9A 4IXNA 1KFJB 2OFXA 1AY0A 3EFHA 3ABQB 4OBEA 2HWKA 4NBRA 4EW6A 4QXQA 5T64A 2P41A 3AETB 4DBLC 5CYFA 3TM4A 5GONF 2RHRA 9LDBA 3N58A 3H13A 5EJ4A 2QSJA 1H8EA 2Y1EA 4CF3A 4CL8A 3D43A 2YYAA 3EGOA 1QHHA 4RVUA 2F1OA 1G59A 1EUQA 5HFAA 1Y48E 4UOEA 1VBMA 1FQKA 2CV2A 3C0KA 1U28C 3PPYA 3L41A 2WF8A 5JO9A 3BS4A 4LDAA 5TS3A 1E3JA 3DDZX 1SCKA 1Z4OA 4HGQA 4QTYA 1IMJA 1SO8A 3KJQA 4M1SA