1KOFA

Crystal structure of gluconate kinase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
171
structure length
171
Chain Sequence
TTNHDHHIYVLMGVSGSGKSAVASEVAHQLHAAFLDGDFLHPRRNIEKMASGEPLNDDDRKPWLQALNDAAFAMQRTNKVSLIVCSALKKHYRDLLREGNPNLSFIYLKGDFDVIESRLKARKGHFFKTQMLVTQFETLQEPGADETDVLVVDIDQPLEGVVASTIEVIKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gluconate kinase
publication title Conformational changes during the catalytic cycle of gluconate kinase as revealed by X-ray crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 59
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.7.1.12: Gluconokinase.
pdb deposition date 2001-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kofA00
4MYTA 2VP0A 1R7RA 5BN4A 4Q7LA 1OYYA 1E1RD 1WQ1R 1VCIA 5BN5A 1G8PA 4JSTA 4XD7A 4KV9A 4D0LB 2WMOB 3ZD7A 2OO7A 2QPAA 1TQ4A 5DI3B 1DARA 3GLHB 3CX6A 1O3YA 3ICEA 3QEJA 3SEAA 2GK6A 4R98A 1GG2A 3GJ3A 2ZTSA 3LA6A 4TL8A 5HE8A 1XCMA 1CR1A 2P5SA 4ERNA 5L3SA 2YC2C 1JR6A 1OYWA 3R9WA 3DOFA 3TR5A 2OUKA 2NO1A 2DYKA 3C5HA 3RC3A 1YR8A 2ODNA 3FE2A 1G8FA 4BPBA 1CJVC 1YZGA 4DDTA 3R8FA 3EPJA 1TPZA 4LJ8A 3TBKA 4NHOA 5FBLB 1MO5A 3PVSA 4P3YA 4DZZA 2CE2X 2F1JA 3CF6R 2RGXA 3REFA 1OFHA 3U3JA 5L3SB 2CL7X 2QENA 5HKKA 1G3IA 2QBYA 3FHTA 2GVZC 4MQBA 3W5JA 4AYWA 1R0YA 1G8HA 1UDWA 5KTYA 4MRPA 2W2TA 4D26A 3T1VA 4URUR 3MG9A 2FE4A 2LKCA 5JRZA 1ZD1A 4KITB 3GJ8A 3SN6A 4DDVA 1COWA 2VP2A 2E87A 1ZD9A 1IHUA 1F5NA 2GBLC 2QSYA 3BC1A 2NPFA 5C18A 5CIWA 2GA8A 4LYJA 1EX6A 1OB5A 2GEVA 2QBYB 2Y8EA 4TLBA 3CRW1 2DFTA 2J3EA 1YR9A 5C4MA 2GF0A 3OIVA 4G5QA 5J4LA 1ZBDA 5J4HA 1S4QA 1C4OA 1CR2A 2W00A 3VKGA 1FOEB 1R5OA 1W4CA 2QAGC 3U4QA 4G3XA 3P20A 1KGDA 4LBZA 4FXPA 4FCWA 3LVRE 1EGAA 2J59A 4WAUA 4PO9A 1ZYUA 1Z0IA 1P2SA 2C9YA 2ZRDA 2V7QD 3A4NA 4LHYA 4WVFA 5TMPA 1S9DA 1JECA 3TUIC 1RYHA 1J70A 4HB3A 4DCUA 2XAUA 3PUVA 3GEEA 2LKDA 5JJIA 1P2UA 4A4DA 4DCNA 4U7DA 1Z3IX 2ZSFA 2FOLA 3U4QB 2D3WA 4FINA 1KK1A 5EE9A 2V8OA 4JLDA 2G0NA 5FPYA 2PJRA 2GAOA 4JLNA 4OI1A 4HLUC 5EZ6B 1P9NA 1Z06A 2FSIA 3SC3A 1DAMA 3EPLA 4IFBA 4DLXA 1A7JA 1GAJA 1S2MA 2IS4A 1XEXA 2ZRIA 1JAIA 2OLJA 4EPTA 2J0VA 4M9QA 4TWZA 3G0HA 2AFHE 1CTQA 4Z8YA 1HT2E 3ZVRA 1XTKA 1XJCA 1GSIA 3NEYA 5AJYA 2NZ8A 1X8KA 2J7PA 1IONA 2DFLA 3HDTA 4HDCA 1T6NA 2NO9A 3QE0A 4I1OA 4DLRA 3GQBA 3CH5A 1I2MA 5CITA 3TR0A 4P4UA 3MSXA 3W3AA 4MDFA 1XEXB 1FW6A 5KHOC 2G6BA 5DN6D 4Z1MA 4C0BA 4KU4A 2BM0A 1AS3A 3WP1B 3NBYC 2F9LA 2HEIA 4I99A 1KDPA 1DAIA 4TLCA 2FF7A 1OLOA 3MRSA 4H9GA 3WXMA 3U7FB 5JLJA 1E2DA 1N5IA 1FPMA 4FN5A 3C15C 5EQTA 1U9IC 2R6DA 4DC9A 3SJBA 4XJXA 1KAGA 2H92A 1SXJC 5D3MA 3DM9B 2WTUA 1RRGA 4JT4A 4BGDA 1BYIA 2QPTA 2BMJA 1P2TA 2EFDB 4KODA 3JZMA 4CW7A 4ABYA 2IYZA 4UJ5A 2Q3FA 2JLZA 4OI2A 2O8CA 3KKMA 1QHNA 3K09A 3ZS9A 3SQXA 5FBVB 4RD1A 1S96A 3RNLA 3F3YA 1SVMA 2WSSA 3U7EB 1KI1A 1JEDA 1ZP6A 5D3MB 1G21E 1XTIA 2EYQA 2G9NA 3IDQA 1W4BA 4Q4LA 1D5CA 1VYTA 2WAYA 3MWJA 2OZEA 3SHWA 4KYIB 3QXXA 1FNMA 1KZGB 4UXHA 1P3JA 3O8BA 2QL6A 4G5OA 2O8CB 1UKVY 4HUTA 3D3QA 1FZQA 2JLXA 3OFNA 2HF9A 3LBIA 2CNWA 4WXRA 1CJMA 3NIBA 3SYNA 5AWFC 3T15A 3MWYW 3BAFA 4M1YA 2QU8A 2QORA 4BUJA 3D7MA 1AZTA 2AWNA 2IT1A 2NO6A 1II8A 1R8QA 2FFHA 3PENA 1CJKC 4KVGA 1X86B 4HAVA 2QI9C 3K9NA 2R6CA 2BMFA 3A8TA 3QXCA 1SVKA 4I1SA 821PA 2IWHA 5HCIA 2ZSAA 3KXLA 1VCOA 3P27A 1MO4A 1GILA 3D6TB 5TARA 1EWRA 2YOFA 3P26A 2NIPA 5CK4A 1II8B 4D4KA 3FMOB 4C30A 3NVAA 5JI2E 2QMHA 4I4LA 3RDPA 2IS1A 1KK2A 5JS7A 3CF2A 5E4FA 1PUIA 2ZVPX 4DLUA 4UNPA 3THOA 3LY5A 2G88A 1N5LA 3EZFA 2WMNB 2ONJA 1FQKA 4MKIA 4EPWA 3H1TA 3JVVA 4BLRA 5GJBA 4FMDB 4Z8XA 3K0CC 4TSFD 1XMJA 2ZJBA 1OIWA 4Q4HA 2DHRA 2ODEA 4POAA 4K8OA 3RWOA 5B57C 2GJAA 3I92A 3FMFA 2NPIA 3A1SA 2OEPA 1TTTA 3RANA 1VIYA 1P9WA 1TAGA 4MRSA 1Z8FA 1MOZA 2AK2A 2CMKA 3KFVA 3O8CA 1D2NA 4E09A 2ZE8A 1T8TA 4Q4HB 1R10A 1DVRA 4EDHA 2PT5A 2PCLA 1J90A 4BFVA 3E70C 1N6PA 4HYYA 2FPMA 5DE3A 1J8YF 1X8JA 5DIFA 1G3QA 2P6NA 2J45A 3QVVA 1OF1A 5FBRB 3R8CA 4PC3A 4B3FX 4Q7MB 3WMEA 4A1FA 2AD5A 1W48A 4XVUA 2IYSA 1E2LA 4PZYA 3IGFA 1KNQA 1UEJA 3KTAA 1G5PA 5EXSA 1N6HA 4DB4A 1M7BA 2C03A 5L3QB 1XEWY 2WJYA 2BC9A 3U60B 1F3OA 1KI4A 3AP3A 2QPOA 4TZ6A 4PQFA 5AJXA 1KK0A 2Q3MA 3SBDA 4UNSA 2XSZD 5A4JA 3NDPA 3TSZA 2RH5A 1BO6A 3B60A 3UMSA 3ASZA 3BB3A 4ZI3A 3K1JA 5FL7A 2VSXA 2W6ID 6Q21A 1GKIA 2XXAA 1YZUA 2DCUA 4LSGA 4V0LA 4DDWA 2J0SA 2JLQA 2O8EA 3TUJC 4JBYA 2VIIA 3PEYA 4EIWA 3CX8A 3PQCA 2GDJA 3DOEA 5AK0A 2X8AA 4TL6A 4QBIA 1LS1A 2VHJA 1LFDB 2QTHA 3OESA 5CK5A 2IC5A 2IHBA 2QROA 3UWOA 4ZDKA 4XTRA 3R9XA 3X2SA 2VQSA 5CJ2A 2OLKA 1IY1A 721PA 4TMKA 2XXAB 1OPXA 1OKKA 2CHVA 1Z6TA 4ZDWA 1BKDR 1X1RA 3ZVMA 3K70B 2O8EB 2BCGY 2GCPA 1ZIPA 1N3BA 3B1WA 4DSNA 5FOUA 1T3LA 2QY9A 4LYFA 1CU1A 1IM2A 2VA8A 4A8JC 3RAPR 3UWKA 3KZ1E 2O0JA 4BLTA 2C96A 2JJ2A 2X1VA 2PX3A 3L0OA 1ZRHA 2Q6TA 4NCJA 5JECA 3EPKA 1Z63A 1JR3A 2A3RA 2ZJYA 3IQXA 2G3YA 3AVTA 4LI0A 1Y3AA 4XOIA 4A0RA 4DEYA 4D6PA 4DSUA 2QP9X 4WIAA 1JPJA 2RGEA 3I73A 1U2RA 2XTNA 4DWJA 1W2HA 3HPQA 1NVUQ 1W0KA 3VR5A 1XDBA 2FSHA 1KTVA 4A0HA 4KXFB 4FCTA 1GKYA 521PA 4Y0VA 4O2LA 4Q7JB 2EWWA 3RS2A 2O0HA 4Q1EA 2O8DA 2AWOA 1K8RA 1DAEA 2O8FA 3UG7A 1UKEA 3AVUA 4KVAA 2G83A 1J99A 4V02A 3ZZ0A 1YVDA 4X8LA 3SYKA 1MABA 1I2DA 1FUUA 2YOGA 2ZRJA 4N3NA 3C4JA 2QUZA 4EAQA 3ZH9B 1NJGA 1ZUIA 2EQBA 4M0LA 2PMKA 1TEXA 2VF8A 4IW3B 3QKRA 1P6XA 3C8UA 4PPNA 1YU9A 1N5JA 3CW2A 4Q1BA 1W1WA 5AUPB 2VP4A 4IDHA 2C2HA 5F98A 2O8FB 4DUGD 3X1WA 3OHMA 1EFRA 5CLLA 4JJKA 4KBFA 4M8NE 5EXXA 2WKQA 4US2R 3L0IB 3V4RA 4QJ4A 3UANA 1MABB 5C1BA 1NSTA 5KPJA 4QM6A 1A4RA 2HXYA 2XNDA 1YZKA 4C4PA 2WJHA 3A1TA 1CRPA 2KWIA 3TAHA 1G3MA 3IEUA 3QKRB 4RD3A 3SE0A 2PT7A 3DM5A 1P62B 4NP6A 1GL6A 1ZUNB 1NY6A 3T1OA 2ZR7A 1DO2A 2CVFA 4CIDA 1U8YA 2WPDD 1ZU4A 3FWYA 3EZ6A 3J81k 3OEHA 1IXRC 2K5UA 1VMAA 4IVRA 4DLWA 3Q5DA 3ND9A 1A2KC 1G7SA 5EE3A 4YMUA 1N6KA 4BFZA 3GJ5A 2ZJ5A 3LD9A 3TNFA 4L15A 4B3BA 2BIFA 1JR3E 3QXHA 1XPOA 4OK3A 2ZS7A 4HAWA 1MH1A 1OH5A 4PTLA 3K0AA 5DI9A 3DEFA 4LHZA 3Q3JB 4UXIA 1RPZA 3WBJA 4M1OA 1YRAA 1E32A 4M1KA 2GZAA 3VHXA 3W6OA 3WHKA 4BFWA 3I4LA 4ACBA 3MJRA 1F6BA 1GTVA 1TF5A 3PXGA 5JS8A 1Z2AA 2WOJA 2D7DA 1T5IA 2A5GA 3B1YA 3VHLB 4YMWA 1VPLA 2BEJA 2FPKA 1E0SA 1GNPA 3K0AB 2CLSA 4EPVA 4EPXA 1CS4C 1E2GA 5KYKA 1N5KA 3LQQA 1X3SA 1TU4A 5FPKA 2IWRA 3GMTA 4V0NA 4F38A 1OFIA 3AP2A 4DKXA 2WJVA 2JJ8A 4KFTA 2REXB 1NNEA 4XTCS 1Z47A 3LW7A 4OI4A 1N6NA 3GP8A 4IOJA 1WMSA 5KDOA 2B8TA 1CRQA 3NC1C 3V9PA 1PLJA 1ODFA 1T3HA 3VKWA 4TLEA 1X8LA 2FSFA 4CZ2A 1FP7A 1LY1A 1IAQA 2QRZA 1BMFD 2ONKA 3R20A 3FTQA 4N1AA 2IEZA 4FMCB 2HYDA 4B3GA 2OAQ1 4A6XA 2WJGA 2RGDA 4RKEA 2JCSA 2DWPA 3O8DA 4G0NA 2JLYA 2HLDA 1E2EA 1AA9A 4HB4A 4DDUA 4B32A 2ZU6A 1BIFA 1UDXA 3I1FA 1AK2A 4GOJA 4M4SA 4QHTA 5FPSA 4Q1CA 3UXMA 4DRZA 2GXSA 1TQ2A 3GJ6A 1M2OB 4BZQA 1FUKA 2FMXA 2ZPTX 1ZM4A 3FVQA 3GLGA 3AVYA 3TW8B 1FQJA 3WMGA 4B34A 3RLFA 4Q1DA 4WW0A 4Q9KA 5CJPA 1KO8A 1FNNA 2YHSA 1KNXA 2QSZA 3M0EA 3OEEA 1XPUA 3WRXC 2RCNA 1F48A 4U5XA 4OK5A 3ADKA 3KFXA 3ZVLA 1P75A 2ERXA 1OW3B 2Q0HA 3VR4A 3X1XA 4YMVA 2O0KA 3VFDA 4LCBA 3CWQA 3GLGB 1WBDA 1VTKA 1HV8A 1VIAA 5TY0A 3VR6A 1ZVQA 2W0SA 5L3VA 1AS0A 3BH7A 3KB1A 3MJHA 1NLYA 4FMBB 3U3KA 3CNNA 3U61B 2GVDC 2EFHB 3I32A 1SULA 5E3HA 2JJ1D 5FBQB 3P1JA 3IUYA 4IKEA 1U81A 4LPSA 3TLXA 2FWRA 2IUUA 1T3SA 2D06A 4PHTA 3RSLA 1E1QA 3SFVA 4XVQA 2QZ4A 3DMDA 1E4VA 4ESVA 4OHXA 1C9KA 1NBMD 1SXJA 1DG3A 1WE2A 1W46A 3E5HA 3CPEA 4PSAA 4NYJR 1EFHA 4NZYA 1UPTA 4FD2A 1YJ5A 1EXMA 4HLDA 4BFTA 2KJQA 4OYHA 2OFWA 5FI0B 2VF7A 4NYJQ 4NCNA 1Z22A 2WWXA 2ZI4A 3QKSA 4C0LA 1AS2A 2VBCA 2GEDA 1ELOA 1NRJB 1SXJB 5KSOA 4C2UA 1AQYA 2OG2A 1IXSB 2D7CA 1W36D 1NI3A 5HZKA 4PX9A 2C77A 2A78A 1WF3A 2J87A 4YXWD 2RGGA 3CRVA 1AN0A 2ZITA 1NL3A 4B44A 3RRYA 1GUAA 2JIZD 3QKSB 2WVJA 5CM9C 1OXXK 1DS6A 3QSYA 3TRFA 3GLGE 5AR1A 5HE9A 2V1UA 4B2LA 2WBLC 2ATVA 3I3SR 3VR1A 2CLDX 5HPYB 1LF0A 5DYGA 5J40A 4EFNA 3BH0A 2GNOA 4OL0A 1RRCA 3GEIA 3L82B 2R9VA 4DT1B 3NHAA 2CJWA 4TL7A 3TW4A 4ASUD 1QHGA 3NBXX 4L5BA 4TL9A 4FWTA 5EZ5A 2OBNA 3IBYA 4U02A 1DBSA 4HLQB 4W9MC 1QHSA 4URZR 1P72A 2HJGA 3UG6A 5FOTA 5JMTA 1QRAA 5G41A 2ZYTX 1TADA 1KSGA 2D62A 2RHMA 2WWFA 2A5JA 2WOOA 4FCVA 4IDQA 4NU0A 4YMSA 2CL6X 5JCPA 3AVXA 3BFXA 2CJWB 5SZKB 1Z29A 2IYTA 1CJUC 1G5TA 1OH6A 1SXJE 4PHGA 3GLHA 5EUQB 1NVVR 4AC9A 3BFVA 4MH0R 1HEIA 1N6RA 2R6GA 3KQNA 2REBA 4PSVA 3B1VA 1JALA 1XWIA 3SJZA 3QKTA 4BEJA 5LDDC 1HE1C 3Q5EA 4PZLA 3WNDA 1NVVQ 2GJ8A 2QMOA 2DBYA 1R0WA 1CR0A 2R44A 2V3CC 1W5TA 2IS6A 3VX3A 2WWIA 4RZ3A 2H17A 3OZXA 4OBEA 3KUCA 2BDTA 4V03A 5JJKA 3CB4A 1A1VA 2NZJA 3THXA 1KI2A 1DPFA 5L3RA 3T5DA 2I3BA 1DAFA 4B2IA 2QA5A 3N2IA 4KHZA 1SVOA 4DIEA 2AK3A 3TMKA 1RRFA 1KI8A 2VHUA 5GVSA 4HDQB 1KI9A 1IN6A 2GCOB 4MUBA 4NCHA 4RCZA 4AYTA 1PLKA 2QP3A 3AKDA 1GITA 2ZYUX 3RWMB 3NH6A 4L9WA 4ESHA 3THXB 4B6EA 1TNDA 1E3MA 3GEHA 4HZIA 1ZMXA 2YV5A 3BB1A 2ORWA 1KI7A 4QNMA 3K9HA 4YDSA 1GZSA 1E96A 1E79D 2F7SA 3OE7A 1N0UA 5IK2A 1VYVA 1KAOA 4DXAA 4TTQA 4IEIA 1WB9A 2NO0A 1S3SA 3WYFA 4XIGS 3NDBB 4UXJA 2NOAA 2WZQA 2FV8A 1NVWQ 2QGZA 1NMZA 2CK3A 1CJTC 3SJAA 2UKDA 1Q1QA 1KJWA 4BFXA 4B71A 5F9FA 2PEYA 3B82A 4KSCA 4PC7A 4NL4H 1DAKA 1XRJA 2A5YB 2GAAA 2OT3B 4RD0A 5HCNA 5LB2A 5P21A 1R0ZA 4GOXA 1OT3A 3GLHE 5H8WA 3LXXA 5FTLA 1KDTA 3LBHA 1CXZA 1SHKA 2WWHA 4AWXA 1UKZA 2F3RA 4MUAA 2PLFA 4TLDA 1QZXA 4L9SA 1H8HA 2GESA 1Z5ZA 1FMLA 2BM1A 1E9FA 1KY3A 4YQFA 3UIEA 4C0SA 3F5FA 2PL3A 3EX7C 4KAXA 3EPHA 3HYRA 1M1YE 2VP6A 3FPAA 1IOZA 3DL0A 4PR0A 1PJRA 4MGKR 1A5TA 4GFDA 1S8FA 4MYCA 4A8JB 5C2JB 1OXTA 2GXUA 4OHYA 4M22A 1CLUA 3FKQA 3KQKA 3T1TA 2HDNB 3MMPA 4ZIRA 4DCVA 5TVKA 1XBTA 2DR3A 1UFQA 2A5DA 3IEVA 4MGIR 3L0SA 5B64A 5IT5A 2P0EA 4HSEA 2ODWA 2YINC 4JIMA 4B74A 1E9EA 1JQLB 1JNYA 4M21A 3KJHA 3U2QA 1KMHA 4GP7A 4PO1A 4OQNA 1IQPA 1RJ9A 1RZ3A 1OHHD 4W7SA 1E9DA 2JDIA 4ZIRB 3PIRA 1ZJ6A 1KY2A 3K9LA 1QBKC 4HAXA 3HR7A 2FGKA 2D4HA 4BECA 1QVAA 1XTJA 4UQOA 2BBOA 1N2CE 4R2HA 4C7OA 3KUDA 4Y0AA 2IXFA 4W5WA 1OSNA 3T5GA 1KMHB 5BXQC 4XVRA 1RJ9B 1G18A 4S2EA 4QC2A 1R5NA 1W0JD 2IUTA 1IN5A 4M9SA 4JYCA 2ZRPA 1E2PA 1EX7A 1Q12A 1XP8A 4A0GA 1D6JA 1GP2A 2OSBA 2E1RA 3EARA 3RSOA 1QHYA 1E9AA 1Z0DA 4C7OB 2C9CA 4ZDJA 1EFTA 3A36A 2XZLA 3C16C 3PUZA 2HF8A 2FSGA 1EFRD 3THWA 3EC1A 1V5WA 2QEQA 1HT1E 3DZDA 1DOAA 3SR0A 5A5GA 3RS7A 3VX4A 4QHSA 2W6JA 3I8SA 5F2EA 1E69A 5BQ5A 2W2XA 5HR5A 3UPUA 4BZPA 4QFMA 4ZKDA 1WXQA 2CCGA 4A0FA 2VPPA 3KKQA 1GVNB 4BLOA 2ZI3A 1ZNXA 4CEJA 2OM2A 3F0TA 5FOSA 1IJEA 1KKLA 1KI3A 4Q4JA 1M34E 1VKJA 4Q9JA 5FTNA 1GDDA 5FI1B 3TIFA 1YRBA 1Q1EA 1ZM7A 1H65A 2FEMA 3MFYA 2ZRGA 3UATA 3ZIAA 3L8ZA 1M7GA 1OFUX 3HU2A 2LWIA 1OXUA 4LDJA 2UZIR 3SI7A 5D3QA 2YJTD 2PEZA 4NKRA 2OFXA 1GL7A 4CEHA 1H8ED 4AKHA 4CF7A 3P4XA 3FKSA 4CEJB 1U98A 1IY2A 1NG9A 2WSMA 2QT1A 5EUMA 4PPQA 4Q4JB 1AJEA 2HV8A 3GCGA 5G3YA 3LRPA 3X1ZA 1ZM9A 4ZI2A 3F8TA 3U3OA 2GXAA 1Q3HA 2P67A 2CVHA 1E2FA 1G41A 5FPTA 3W6PA 1KOFA 1XTSA 2O52A 3WHLA 3ZD6A 4CEHB 3T35A 4KSBA 5FR2A 1XB2A 1IXZA 1CF4A 4JL6A 5AJVB 1KSHA 1F2TA 2NTYC 2X2FA 3A1VA 4Q47A 1N0WA 4QGHA 4IFEA 2YZ2A 4H1UA 5KDLA 4PC1A 1VCMA 5JHGB 4IOKA 3CZPA 2V1XA 1Q21A 3E2IA 4IOLA 4IOMA 3NKVA 4URVR 1CEEA 1OJLA 4JL5A 3CBQA 1XJ0A 2I1QA 2C99A 5CYPA 2ZROA 3BBPA 4Q03A 1A2BA 1JBKA 3IILA 4PC2A 4US0R 4ZCMA 1E1RA 1UADA 2N46A 5SZHB 2KB0A 3CRMA 1XEWX 3WRYC 1XJQA 2ZAMA 1F2TB 1SGWA 2DY1A 5H1YA 1G20E 1G8YA 3BOSA 5TXGA 1MRSA 1R6BX 2HJVA 2YWEA 2Z43A 4WZAE 3SJCA 2MSCB 2V6JA 4OKSA 1F2UA 2BMEA 3U3RA 5L3QA 4LWZA 1G9XA 4B6FA 5JWOA 1WBBA 1Q1BA 2OAP1 1LV7A 3NBFA 4IDNA 5EJEA 1QF9A 4D25A 5G40A 1KO5A 1E2NA 1O87A 3D8BA 4UNNA 4Q9LA 2OV2A 3OAAD 1M8PA 3CZQA 1HQCA 3PFIA 4HI0E 2Z6VA 3ZQ6A 1E0KA 1F2UB 2W83A 1ZW6A 4EUNA 1E2JA 3ECCA 4M2LA 1FX0A 2GF9A 2F9MA 1IN4A 4HAZA 4LV5B 4OQLA 1XMVA 5TV2A 5JCZA 2KI5A 3W6NA 4TYNA 3DZ8A 2R6FA 2HCBA 4D80A 5IDVA 2FFAA 3LO5A 4JYBA 3AH8A 4KO8A 5IF9A 2ZSDA 5FBWB 2NGRA 3DO6A 4GPTA 1ZD8A 2WICA 1G3RA 3QG5A 3SYLA 3N5CA 2VEDA 1FX0B 5ANRB 2D2EA 4HZUA 4TYQA 2GWHA 1GRQA 3MCAA 2J46A 3LBNA 4A9AA 3FOZA 4L8GA 5CYOA 1U90A 1GRNA 2QQ0A 3ADCA 2YNMA 3BERA 4TMVA 2B7CA 4F93B 4NPHA 1YZTA 4BASA 3PITA 2DWQA 1M74A 5DO9A 5KOYA 1CP2A 4TQ9A 5DLQC 3FDIA 4HZUB 4U00A 1ZU5A 3QPWA 1K6MA 4D81A 2ZRKA 3RRNA 5JFGA 2V7QA 3QENA 4JLKA 4JVSB 3WNCA 5AJWA 1AIPA 4HEJA 3TQCA 3JVUA 2Z4SA 1VCNA 4M1MA 4LBYA 2Q3HA 4FW9A 1TL7C 3C5CA 1PUJA 4LV8B 2ZVQX 2GZHA 1HY3A 1HYQA 5B58C 4F92B 2Q21A 4FMDF 5BYJA 2GHIA 4XSGA 2ZYVX 1LTQA 4K46A 1XTRA 3GJ7A 3LQRA 3PEVA 3SZRA 4BLPA 1Q3TA 1JXOA 1Z28A 1VYUA 4O25A 3ZS8A 4E5UA 5KO2A 4EJSA 4M9ZA 1NKTA 2KBFA 1OFTA 3ZGXA 2QTFA 2OCPA 2DFKB 4B48A 4IVPA 1OV4A 2VYFA 3IBGA 4LOAA 3VNUA 4AKEA 2Z5FA 3K0SA 3AP1A 3CH4B 4MKGA 4C2TA 4MRVA 1J2JA 2IYQA 2QE7D 2XOKD 4RFVA 4ZCIA 2QG6A 1X6VA 3NWJA 1JB1A 1TU3A 2D74A 1QDEA 3MWLA 5DN6A 2ZRCA 4EJSB 1E99A 4G1UC 4Q1AA 3BFKA 3IKJA 1NN5A 2O5VA 3AV0B 4JT2A 2QRNA 1KSFX 4TMTA 1ZM3A 3U7HB 2ZUDA 4MITA 1Z0JA 2DPXA 3C41J 1SKYB 3KQUA 4II7A 1L2TA 2FGJA 4PHHA 4WZ6A 4LHWA 1E98A 2VRWA 1FTNA 2GILA 2WWYA 1UAAA 3CR7A 4G5SA 3BB4A 4LK2A 2RGBA 3QXSA 1DTSA 2EWVA 2J1LA 4UNRA 1Z6YA 3U7GA 1VG0B 1II0A 4N0EA 2KSQA 4WOPA 3EG5A 5EP2A 2VP9A 2R8RA 1G4AE 4GT1A 2IBMA 2VO1A 3W3ZB 1EWQA 3K8YA 1Z6GA 2MSEB 3BE4A 1VHTA 3Q85A 1MO3A 1RRPA 3NBZC 3SBEA 1KSJA 3NC0C 1Z0FA 4IEEA 4BQSA 4TMZA 3PG5A 5JBQA 2BBWA 2ZRBA 4FI3C 2BOVA 1G17A 4C9BA 4ARZA 1W36C 3NXSA 4XD7D 3ICQB 4B2PA 4ZKEA 4D2IA 2G0TA 3KQHA 4Q21A 1RIFA 3DPUA 1P61B 3THWB 1NIPA 4B35A 1MKYA 3EIHA 4NCKA 4TYYA 5JSZA 3QBVA 4PSKA 3WYAA 1YZNA 2OESA 3T06B 1OIVA 3W9YA 2ATXA 2ZR9A 2FJUA 4KFUA 3BK7A 3TAUA 1T8UA 3QEOA 2FPLA 1AGPA 3K09C 4Q18A 4ARZB 3HPRA 1UBFA 2GBLA 4AI6A 3JZAA 2ECKA 3QNUA 4LJYA 4MRNA 3T12A 3DMNA 1E94E 4GMXA 1OE0A 3B1XA 5KUTA 3W90A 1XTQA 4MYHA 3RS3A 2P2LA 3PEWA 5JSZB 1KDRA 4DB2A 2PH1A 3D31A 4PAOA 3PUWA 1LF5A 2R62A 2IYRA 5HKKD 3RHFA 2BKUA 2IYYA 4N0DA 1PV4A 5EP3A 3T61A 3WY9A 4DSOA 5K8TA 4G5GA 5IK2D 2QAGA 1MR3F 5G53C 5DH9A 4L4UA 4GBMA 3TVTA 1YZQA 3SFZA 4D0NA 1GFIA 2A30A 4RVCA 2F1RA 1YKSA 2IHYA 1COWD 2WHXA 5EP4A 1LS6A 1YQTA 4TSFA 5LPNA 3I61A 2ZE6A 4IHQA 3W34A 3DDCA 2AD1A 1W4RA 3OF5A 5J4YA 5GVRA 3AF4A 1WCV1 3BJIC 1SVSA 4TQAA 3CF0A 2QAGB 4NCIA 3LLMA 3VU9B 1G7RA 3U5ZB 2F3TA 4GSYA 1E9RA 2WWGA 3KB2A 2RB4A 4Q66C 1U8AA 5KDDA 1I4TD 4HLUA 4LY6A 1GIAA 1R2QA 2PZGA 2C5LA 2C9OA 3QUSA 4O3MA 4AY2A 4NYIR 4LJ4A 2J0QA 1P60A 1BS1A 2ANBA 4XWKA 3AGPA 3S1AA 1TUEA 4K81B 3AGQA 4RZXA 4TMXA 5GADl 2QMUA 2ZRHA 2KBEA 1NKSA 2PJZA 4NYIQ 4DVGA 2VLIA 3WBKA 5DSZA 2PZFA 1EESA 2G1KA 1XD9A 1QHHA 2YYZA 1U0JA 2J0UA 1NIJA 4I1UA 3T34A 4AK9A 4URXR 4CEIA 4PPGA 2ZRFA 4AG5A 1FFHA 3S1AB 2ZS8A 3FFAA 4E03A 4NBSA 3W8RA 1SVLA 2ZI5A 4Q4AA 3SU8A 1AM4D 2GETA 2SHKA 2WAXA 2O8BA 2XSZA 2YWGA 4C0JA 1U9IA 5FOWA 5AUNB 4C3ZA 1QHHB 2W6IA 3REGA 2J0UB 3CO5A 3RYTC 3QPVA 4HAUA 3H2YA 1S0UA 4CEIB 2J7PD 2F1IA 3KJIA 3CR8A 4Q00A 1G4UR 1R5BA 3AVQA 1VG9B 3TQFA 4Q4AB 5KSPA 1G19A 1KO4A 1MO6A 3AVWA 2O8BB 3UMRA 2IW3A 3PUXA 1YE8A 2GTPA 3L43A 4Z1MD 4JS0A 2RGNC 3EAQA 3KKNA 4IXMA 2YKGA 2AKAB 3ZYCA 3FMPB 2X77A 2Z0MA 2ZU0C 3K53A 3ETLA 1XZQA 4TT3A 1JEEA 4W5JA 2W2VA 4GRAA 3Q7PA 4BRWA 4QBGB 2B8WA 1KJYA 1P7CA 4ZDIA 2FFQA 4Q1FA 2H18A 1N6LA 1EFCA 1RVDA 4DT1A 3K70C 4B3XA 4V0KA 4ACAA 2JASA 2FX3A 1NP6A 3ZDQA 3QPUA 3ND8A 4P0TA 3QBTA 2IXGA 3LWNA 3B6EA 3M4YA 2EFGA 3GFOA 2IYWA 2WSSD 3VR3A 1RW4A 3PCRB 4C0QC 1G8GA 1EG7A 5E7IA 3THYA 3IHLA 4FMCF 2H5EA 4EFMA 3W5IA 4LBVA 2AXNA 5L8VA 1RYFA 4F4JA 3B5JA 3EZ9A 3NH9A 2ZI7A 2JEOA 3V4FA 1RC8A 1NSFA 1Z0AA 2IYUA 4ZPXA 1R4AA 1L8QA 2IF2A 2OCAA 3OFND 2CNWD 2JLUA 2P3SA 2PLRA 1E0AA 3GFPA 2UVQA 3SS8A 1MT0A 4TYPA 2AN9A 2HUPA 3THYB 3VKHA 121PA 3OIWA 3E1SA 3C14C 2RGAA 2HCJB 3IO3A 1N6OA 4RY2A 4A82A 3K0CA 2XTMA 1G1MA 4DUGA 2ZJAA 1QVRA 4TMWA 3PJRA 1T0HB 1IY0A 3H84A 5EP1A 1KI6A 1BYUA 3FB4A 3AVPA 5H68A 1F60A 1ZNZA 3LX8A 3ONWA 1JXMA 4P4TA 1G16A 4GZMA 1JJ7A 3B7GA 1NN0A 1L7VC 1W5SA 4QBFA 2ZS9A 5FR1A 2IYVA 5JJLA 2AHOA 4RJLA 2ZRLA 1DELA 5K8LA 3HYTA 2GJKA 2ZRNA 1G5RA 3EZ7A 2WPDA 2GCOA 1NF3A 2OFOA 2ZSBA 1KI6B 4PAMA 4LPKA 1E2QA 1AZSC 3NG1A 2QT0A 3AM1A 1XU4A 3GD7A 2B7BA 2ZSEA 3QJYA 3KQLA 4LJAA 4QGAA 2Q9CA 1LVGA 1T0JB 1YZLA 4JLVA 2FH5B 4WXPA 2IF0A 4YC7A 4DLVA 1NJFA 4URWR 2JATA 4KLZA 1W44A 5K8IA 2ZJZA 5FUYA 2A5FA 2ZE5A 4BLSA 1I4DD 1J8MF 4M1TA 2HT1A 3GJ0A 2BV3A 3GJ4A 3ZZUA 2OCYC 3QG1A 3HP1A 2OXRA 4HUQA 2CE7A 3R9IA 2NMVA 3I5XA 2VSFA 1FL9A 3BH6A 4P33A 4Q7KA 1XPRA 3BS4A 2MMCA 2VHQA 4ZV4A 3BGWA 3KDSE 4TZ0A 4ON9A 4RD6A 1Z08A 3PEUA 4BE7B 4NE2A 5G3ZA 3FHCB 4FIDA 3VR2A 2QM8A 1DE0A 1OB2A 3K0EA 3QKUA 5CDFA 5ELXA 3CLVA 2ZI6A 4HUQB 4DIDA 1II9A 2XTZA 3TSWA 1XD8A 2FZLA 4YONB 3U6KA 4KYUA 3CNOA 3IO5A 3K9GA 3LLUA 2HXSA 1ANKA 1RKBA 3KKOA 4CRWB 3EA0A 2IK8A 1Z0KA 5FL7D 1L4UA 4B73A 1KJZA 1BMFA 2G77B 4Z54A 4O0MA 4A8JA 2J9RA 1HURA 3PR1A 4F4IA 4KBGA 5H70A 3K70D 4QL3A 3EA5A 1NY5A 2AXPA 4GP6A 1NLFA 4LBWA 1N6IA 4M53A 4QBHA 5CB6A 2WM9B 4R7ZA 3A1UA 4Z51A 1TQ6A 1QG2A 1ESNA 3LV8A 5SZIA 2OCBA 4G5RA 4I1VA 3LVQE 3A4LA 1DG1G 2YC4C 4TTPA 3OIUA 3ZLJA 1OKKD 1S9HA 2QMEA 5LBIA 1YR6A 4OQMA 4X8HA 4PAQA 1UKYA 2W0MA 3BRWD 4J0QA 2GXQA 5SZJA 2ZRAA 1W49A 5KPDA 4A36A 4CVNA 1Q1ZA 5FOVA 1TX4B 2JJ2D 4GMDA 4LUCA 2WJJA 1TF2A 1JR3D 2C04A 3EXAA 4BFUA 4QKQA 2ODBA 1PLLA 1ZCAA 4JL8A 1N0VC 2ZJ8A 1B0UA 2PCJA 1YHNA 3B9QA 4E07A 3ADDA 1AKYA 1KIMA 3IPXA 4RCYA 3GFTA 1DAGA 2ZJOA 1MV5A 1T4GA 3B8HA 1W0KD 2MMGA 1T91A 5TDHA 3SOPA 4HB2A 3SHFA 3DHWC 2XNSA 4AYXA 4BWYA 1N25A 2JJ1A 3SDZA 4A15A 4JMPA 4JVNA 1E2KA 5AJZA 4JBWA 1UBGA 5J5CA 1Q22A 2AL7A 4IVQA 1XCGB 2QAJA 5HTKA 5CDFE 2EW1A 4LYAA 1NBMA 2H16A 4LRWA 1M7HA 2ZJ2A 3AKYA 2C98A 2P65A 1CBUA 2V6IA 3AUXA 4GI7A 4XWOA 5E95A 1ZIOA 2QGNA 4A2PA 2ZIAA 2JLWA 2IEYA 1S1MA 3BIFA 1Q44A 2A7QA 4NDZA 1GWNA 3QI2A 1BOFA 3SNHA 4D0GA 4GL2A 5KNCA 2IXEA 4XWAA 3TVDA 1Y63A 5DGXA 5J4KA 1B23P 2FG5A 1NMYA 4XH9B 4P4SA 1S3GA 3I62A 4LJ9A 2VH5R 4PXAA 2IYLD 2XNDD 2WV9A 1JQJC 1XCPA 4CGZA 1W47A 4LV6A 3PV0A 2JAQA 4YXWA 4HATA 3H86A 3TSOA 4Q01A 4OHVA 2H57A 4V0MA 2RHDA 5IHPA 1WRBA 2JIZA 1EK0A 1XMIA 4QRHA 1KZ7B 1T5LA 3ADBA 1J7KA 5A0FA 3SQWA 4QNRA 4QM7A 5EE0A 4P4SB 3OEHD 3TUZC 5GJCA 4MKHA 1W36B 1KMQA 3TE6A 2BBSA 3AVOA 4AD8A 2BJWA 1XX6A 3I8XA 2AFIE 2H1LA 3QXJA 4LJ7A 1P5ZB 3EW9A 3RS0A 1P73A 8OHMA 1GNQA 2R65A 3FMIA 4S35A 2EYUA 2ZETA 1FP6A 2FU5C 3BXZA 4ASUA 4DCTA 4EFLA 2ZUCA 3TKLA 4QGFA 4DBLC 1JPNA 2WWWA 3BORA 3IQWA 1DAHA 1WA5A 3G82C 5K8UA 4R2IA 2IUSA 4LX0A 4LYHA 4DJTA 2EU8A 4JKYA 3IHWA 4TLAA 1I4LD 2GRJA 2CLCX 2C78A 3CRRA 3MD0A 5EXPA 2CHGA 3GLIA 4B43A 3IIJA 1XMSA 2ERYA 5FTKA 3VNVA 3ZZTA 1U0LA 2IX3A 4A2WA 3AQ4A 1UBCA 1NBME 2H8KA 4NMMA 4Q48A 2V54A 4TQUS 5LD2C 2RGCA 1ZC4A 1ZM2A 3O47A 2V55B 2ANCA 3QF7A 2R6AA 2WJIA 3C7KA 1PVOA 1AKEA 4B3CA 4JLJA 1G7TA 5UKDA 1GKUB 1Q20A 5F3WB 4HDOB 3AF0A 1E0JA 1U8ZA 3MLEA 1QG4A 1E2MA 4NTZA 5M04A 2FDCA 2BMDA 5JZVA 3GLIB 2OBLA 1AQUA 3KXKA 4CDGA 4D82A 2J5XA 4MDEA 5BN3A 1XFAA 2Q9BA 1IBRA 1GOTA 5F9HA 1Z2CA 3CRQA 3DVLA 4B75A 4OQFA 4WA7A 3CM0A 3CIOA 2ZREA 5JRJA 1OH7A 1VECA 4L16A 4V0ME 2GKSA 3CUEF 1LW7A 4QOSA 4DEXA 4F91B 4JLOA 4LC1A 1D2EA 2KE5A 5CM8B 2HLDD 1OXVA 2YVUA 2WIAA 1W4AA 2NO7A 4MKFA 3Q9LA 5IRCD 4MGZR 2FZ4A 5JWRA 3RC8A 5JWHA 2Q9AA 1GL9B 3WYGA 3NHBA 1E9SA 1AGRA 1JJVA 1M6NA 2DWOA 2QM7A 2EFEB 4D4MA 3CWZA 1E79A 5KU1A 4H1VA 3Q72A 1DADA 3ASYA 5LB4A 4PPFA 1XF9A 5FUVA 2A9KA 3OEED 2XJ4A 2PBRA 1LB1B 2F1HA 4JKIA 1U94A 4P31A 2VTKA 4LC0A 4PC6A 4DLZA 4MGYR 3GLFA 1ZNWA 4OHWA 221PA 4CT5A 4WBSA 2RGNA 3GLIE 4I81A 3AF1A 2Z4RA 2QQEA 2IS2A 3LH5A 4BRUA 5EXTA 3U3MA 3K0FA 1E1QD 4JVLA 5CB8A 4LHXA 1UEIA 4PFSA 5DISB 3AKEA 3FYHA 1Q0UA 2XJ9A 5KNBA 2VL7A 4UJ3A 1SXJD 4M1SA 3GLFB 3KTAB 4O2RA 4JLAA 3AF2A 2F43A 3AF3A 4FWIB 1DEKA 5C46F 4NYMR 3B9PA 4KJZA 1K5GA 4QJ5A 2B21A 3L8YA 4EKDA 3K0FB 1HTWA 2AR7A 1S1CA 4KCGA 4NONA 3WNBA 3A6PC 4PHFA 1NVXQ 4NYMQ 4WZBE 3HU1A 4X8MA 4AIIA 1G6OA 1KO1A 4TT3D 5FUWA 1XNJA 2AKYA 3QY0A 4JVMA 1FTSA 4RD4A 2F43B 4AKIA 4A6PA 1NG1A 2VSOA 4B33A 1TQDA 4PQYA 4X8OA 1KO7A 4JSYA 4B47A 4IDPA 5FUXA 4LGMA 1ZNYA 1T9HA 2BVNA 4LHVA 4CYMA 2CXXA 4DCSA 3CPHA 1G3UA 2XX3A 5E7MA 5E7JA 3DKPA 3TGPA 5JEDA 4OHZA 1OHHA 1HUQA 2XZPA 3IIKA 4RFSA 2MSDB 2FN4A 4NH0A 5FPHA 3I5YA 2ZI9A 5TB5A 3MUFA 1G64A 4GDFA 1ONBA 2XEXA 2ZEJA 4P32A 3EIQA 4KFRA 5EE1A 4D4JA 4EQ6A 5BWMA 1W7AA 3CKLA 1KDOA 4W5HA 2DB3A 1HE8B 3TK1A 2BEKA 2C95A 1US8A 3HWSA 2Z83A 1SHZA 2JGNA 3R7WA 3GLFE 2IYXA 2ZAOA 5AUOB 4RFSB 2V9PA 3B78A 1KYIA 1W0JA 3L0PA 1NMXA 3KJGA 4Q9IA 2P5TB 2ZQ5A 4C0KA 1QHIA 3WMFA 4EQ6B 2I4IA 4UNQA 5AUQA 3P4YA 2QTVB 2FA9A 4ITRC 1OIXA 2O8DB 1US8B 3EC2A 1E4YA 1HH4A 3CX7A 3R7WB 4DLTA 4JZKA 2CHQA 3EWSA 1DO0A 4RZ2A 1IN7A 1UJ2A 1BH2A 1V43A 3EASA 3QQ5A 3UK6A 4OJQA 621PA 2WKPA 3MWKA 3Q8XB 2BBTA 4R71A 3CNLA 5CLQA 4BLQA 2GEUA 1SVWA 1K5DA 3IPYA 4Q9HA 3RRMA 2D2FA 3B2EA 3X1YA 4EPRA 2JLRA 1E6CA 3MAAC 1D2MA 3A37A 3U44A 5FFMA 3UKDA 2RKOA 1SVIA 2N42A 4URYR 3A1WA 1G291 5DYIA 2REOA 3LDAA 2PMDA 4AG6A 1VDZA 3LFUA 1XXHA 1A82A 2IL1A 2J41A 4BFSA 3ZQJA 1H8EA 4YMTA 3RABA 1X1SA 3U44B 1GM5A 4QHYA 1U99A 2W58A 3ZJYA 1HA3A 2XB4A 3G5UA 4LJ5A 4US1R 1SKYE 2GK7A 1QHXA 1Z07A 2IA5A 1GNRA 4Q02A 1XXHB 4B3DA 4YDHB 3LAWA 2OILA 3OE7D 4ZO4A 1P2VA 2PX0A 4F4CA 2JLVA 3H0KA 3VU9A 2X2EA 2UZ3A 5CIQA 3V00A 3FGNA 2HT6A 3IIMA 4MA4A 4HLCA 4IJMA 1ZAKA 2WKRA 4JLPA 3B13B 1RE0A 3OIYA 4KFSA 2I1VB 2DFNA 2GJ9A 2VP5A 2ASEA 4BFYA 2CK3D 2CCKA 1JI0A 1ZUHA 3AB3A 4HB0A 3NTUA 4BEBA 4MRRA 3X1DA 4RZUA 3RVBA 2NQ2C 1G6HA 3GPLA 4KI0A 1E2HA 5KNDA 4AKGA 5JEEA 4PQRA 3NEJA 2CBZA 3WP0A 3M6AA 4IDOA 3LNCA 5GJWC 2ZRMA 3DKVA 5J47A 2HYIC 1IJFA 4JJZA 1P4SA 4B76A 4LZZA 1G7CA 3N2EA 3W8NA 4C0HA 3B85A 2XGJA 3BWDD 1H8HD 4D4LA 2OXCA 2F55A 3AEZA 2B6HA 4DLSA 4Q19A 1HQYE 4XSHA 5FH9A 4A2QA 4MYUA 4QG7A 2LCFA 1D9XA 2TMKA 5DNYB 1KKMA 1XZPA 2YWFA 3TJZA 2FEOA 2CL0X 5KSZA 3OAAA 2E9SA 3A4MA 3VTKA 2J7KA 4RSGA 3HU3A 1XXHE 3MGCA 2R2AA 2F6RA 3PUYA 2B92A 4EPYA 5J4VA 1CKEA 3KXIA 1P9RA 3O8RA 2H7VA 4ZCLA 4C0AC 2YOHA 3Q7QA 1CR4A 4LJ6A 1RFLA 4M9XA 4QJ3A 4HAYA 3FFBA 2BCJQ 2ZANA 5DHAA 4JBXA 1TMKA 4OQXA 2ZXUA 2ZYWX 1SQ5A 3QVUA 3RRZA 1R0XA 1MRNA 1IN8A 2CCJA 2CDNA 1Z6XA 4CT4B 4UKDA 1UF9A 3LW8A 2GZDA 4PZZA 2QP4A 1SZPA 1W2GA 2BJVA 2JDID 421PA 1D9ZA 4Q5IA 2XITA 1E9CA 1NN3A 1LNZA 3KJEA 1Z6AA 3QF4A 4GZLA 3UMFA 1TF7A 1R8SA 3A58B 2GJSA 5FTMA 2BWJA 1KK3A 3N70A 4BZXA 1SKQA 4PO8A 4IXNA 4DHEA 2C8VA 3BD9A 2VHTA 4YLGA 1YR7A 5HZHA 1FMJA 1NN1A 4DLYA 1OH8A 3LXRA 5JHHB 3HJNA 2OHFA 2V4ZA 2G1JA 3VQTA 3FHOA 1ZINA 3EIEA 4V0OA 2ZM5A 2ZR0A 3T1QA 3AUYA 3QF4B 3KL4A 2JLSA 2PZEA 2ORVA 4G01B 2ZUBA 2QN6A 3EZ2A 4TTRA 1C1YA 1GRRA 1PZNA 4AURA 1XEFA 2RMKA 1WDTA 2RAPA 5B2ZA 3AKCA 1NLZA 2ZE7A 2EVWX 3AVVA 4OJKA 4QGGA 2P6RA 5FTJA 3EWAA 5KSYA 2A2ZA 1OXSC 2W6JD 1E9BA 1WP9A 1U0HC 1ZC3A 4PANA 5DHFA 3VMFA 3CONA 1D8TA 2FNAA 2AX4A 2EFCB 1VHLA 5BW8A 4R9UC 2NG1A 2BHRA 4E22A 2GCNA 4OK6A 4OI0A 3LX5A 1CULC 5FOXA 2OBMA 2QNRA 3KKPA 3QIAA 1TEVA 4GOKA 3VAAA 4DSTA 1KHTA 3P32A 4A92A 3ZIAD 5FL3A 2P6UA 5BYKA 4ILEA 4TN1A 3KX2A 1E2IA 4QXAA 2JA1A 5EE5B 2QE7A 2VHCA 2XOKA 1UBEA 3I72A 4RKFA 2XB2A 3U6BA 3FKSD 3CPJB 1ZCBA 4F7WA 3HR8A 5B30A 4KLNA 1ETUA 2FFBA 2WIBA 2OE2A 2YWHA 1XD2A 3QOFA 3RS4A 1Z83A 1ESMA 2XZOA 1TUIA 4GNKA 4EJSC 1L4YA 4TYWA 3B1ZA 4JLBA 2L0XA 3TH5A 5LD2B 3GJXC 3M1IA 1JAHA 3L2OB 1Q57A 3ZVNA 2ORIA 3RS5A 4IRUB 5JI3E 1EFUA 2CEAA 4JLMA 1UM8A 2X19A 5DI3A 1CIPA 4M1WA 3H4MA 2N1BA 1XD2B 4RD2A 5GJVC 2BKEA 1VG8A 1VG1A 5C4GB
chains in the Genus database with same CATH superfamily
4MYTA 3SF8A 3VPSA 2Z3ZA 1PHPA 1ARZA 1G8PA 5CVDA 2IH2A 4KV9A 2QTWB 4D0LB 2RAFA 2WMOB 2LCIA 3FBWA 2XUIA 4TV8A 4B6PA 2EDAA 1DARA 2FWBA 3H0CA 3NKFA 4G26A 1PGOA 4IVNA 1Y9JA 1R3DA 3QA9A 2XGSA 3ICEA 1LJUA 3SEAA 2ZYHA 3NJ4A 1DL5A 2GK6A 4R98A 2J9FB 1JFFA 4LZJA 4MSUA 1NWCA 4DBLE 1XCMA 3T8YA 2P5SA 4WINA 3I9LA 1XJ5A 1ZO8A 4ERNA 3OKFA 2L19A 2NU6A 1P45A 3M1AA 3WDLA 4D44A 4GR9A 5BWCA 3R9WA 1UT8A 2C4NA 2WK1A 3S29A 3PC2A 3UW1A 1GEGA 1I7DA 1RP1A 2NO1A 3C5HA 2HHJA 4IQ0A 3EOAI 1PNVA 2B83A 3OJEA 3DEHA 5H4HA 1G8FA 4BPBA 1DUVG 1Z2NX 4KMOA 3OP1A 1X1EA 3LPMA 1CPYA 1ATZA 1IB0A 4GMFA 1DBIA 1A50B 1OFHA 1Q7RA 1V26A 4QJIA 3PF9A 1HDOA 4FNMA 1U0EA 2APJA 3NU1A 4KQIA 5BWOA 5HKKA 3O8QB 1E2BA 3FHTA 1DRKA 1M6YA 2ADMA 3AWIA 4RL4A 3W5JA 1A8IA 5JAPA 2ZBUA 4DQ0A 5AXDA 1MRZA 2X8WA 5DOVA 4DJEC 4YVFA 4D26A 3EVDA 4EMUA 2I3AA 5C81A 5JRZA 1QP0A 2BP7A 3CEMA 5DWQA 2G06A 4IF4A 3AXSA 2VP2A 2P75A 2GBLC 1RXEA 1EG2A 1MNQA 2GJ4A 5JZMA 4LYJA 1L7RA 1EX6A 2XGGA 2GEVA 3CFYA 3GA5A 4DLNA 1GN8A 5BSKA 4XB1A 4RK7A 2Q28A 4GC9A 3LYAA 2FWMX 3GVHA 1O0SA 2MYTA 3OEWA 3G2IA 2CJPA 3O8LA 1XVVA 2MSLA 3SBXA 2YN2A 3OIVA 3OQBA 3U44B 3JPWA 2FPGB 4QIHA 5CH3A 1XQVA 1CR2A 2Q2VA 1VRCA 2W00A 2XVYA 1FOEB 1R5OA 3PEEA 4MIKA 4RSMA 3BKXA 5IUNC 5JVDF 5JW6A 3P20A 3GRUA 3HLTA 4EECA 4AF7A 2UAGA 4IH1A 4OGFA 5LQUA 3LVRE 4C6HA 4NZNA 4YAWA 4QXMA 2YXDA 1Z0IA 4FGSA 2OQVA 3A4NA 1ISMA 3NASA 4WVFA 3HKCB 1JECA 3TUIC 1N2JA 1UFVA 1J70A 3J7TA 2I3GA 3ZGOA 3CJRA 2Z57A 4IDDA 3UJ6A 1EDZA 4ZEOA 3ZBPA 3GP5A 2FK7A 4KXYA 1W6RA 3H6KA 2OHVA 3ENNA 4B80A 3HV2A 3IP1A 4BDTA 4DCNA 1Z3IX 5JBIA 3QTLA 4GOMD 2D3WA 5DGTA 1QFMA 3WJAA 2I2DA 5CBPB 3U4QB 5DHTA 2V8OA 5M5BA 4KX5A 5ITZA 4X93A 4PNZA 4Y2QA 3FCCA 2PJRA 5JQGF 2GAOA 2V5UA 3GL9A 3HBAA 4JLNA 4OI1A 4CWAA 5JH7F 5REQB 4WY2A 1G21B 1L7BA 3L0YA 3R5KA 3CG4A 1ZK3A 3FTNA 2OLJA 3QIVA 2VJQA 2V7TA 2X41A 3PNMA 5IAKA 5JAUA 4IGIA 1HE2A 5AJYA 3MVEA 1Q17A 4EX6A 2A9VA 3BHNA 2XYRA 1USWA 4YROA 4LF6B 1T6NA 4BN5A 3B3QA 3E8MA 1IIRA 2QTZA 2JEZA 3I6ZA 4BV3A 3ZC3A 4IJ5A 2BDUA 3VZRA 1XMQB 5F35A 3FAZA 2MU1A 3I6IA 3RSGA 1LWNA 3FBTA 2Q2OA 3UH1A 2G6BA 5F2KA 5KOJB 1S8AA 4C0BA 1W88B 2C2WA 3WP1B 2R8YA 4RXMA 1WEKA 5CLHA 1A7KA 4CUZA 5B5SA 1E7RA 3E84A 3ZHCA 1OLOA 4URHA 1N5IA 3FHJA 4ZVTA 1FPMA 5T57A 2GA9A 4DC9A 4J94A 4JOBA 2WB4A 2R1VB 4MIOA 1KAGA 2H92A 2POQX 3FJOA 3GFVA 5EWLB 1SIBE 1SXJC 1T5DX 2AA3A 2UZ1A 2P9CA 1Y37A 1U7UA 1U6JA 3LXMA 3P9NA 1RRGA 3QELA 1JPUA 4PLVA 1P2TA 3C24A 4KODA 3JZMA 4CW7A 3H18A 3HYSA 4QFBA 4JGIA 1GNLA 4DV7B 2Q3FA 3COZA 1CERA 4DCGA 4RTPA 2JLZA 1NI5A 3D4LA 3ROQA 1J8FA 3S2GA 4AO6A 2O8CA 3DD1A 5F12A 5A3SA 2J3HA 5DNWA 3RVDA 3ZZNA 1W2WB 1QIIA 2ATCA 2HA3A 2WSSA 1GCOA 1JEDA 4QTUB 1EFAA 1PT9A 1ILWA 2WUWE 5J2TF 4Q4LA 4BNTA 3OHPA 2EC5A 1EVZA 3SHWA 2QNBA 4KYIB 5K51A 1WZ2A 3QXXA 1YBMA 3RVQA 5FEUA 1KZGB 4ZU1X 4OM7A 1MMFB 1TEZA 1LFAA 2QL6A 3T0FA 1USKA 3OJCA 4PAGA 2QRLA 5CEEA 3D3QA 3OFNA 2FRVA 2HF9A 3DDOA 3LBIA 2NU9A 3PD7A 3R40A 4IEFB 4RHYA 2P3OA 5BN3A 1NZJA 4XGQA 5FI3A 2QU8A 2XRFA 4BUJA 1Y9EA 3D7MA 4HNGA 2HRZA 3WRVA 2AWNA 2JIMA 2ID9A 1II8A 2YJZA 1FDIA 4UBOA 3NXKA 3PU6A 4KQXA 1A77A 3KYCA 5CA0A 4HAVA 1UQUA 9LDTA 1E3WA 4HSGA 3RBZA 3A8TA 5B6JA 1SVKA 2C2ZA 2XXBA 5K8VA 5JPCA 2J6CA 2J9XB 3RIMA 4DNXA 4GGOA 1FDOA 1GILA 4UFOA 4R3WA 3LG2A 1X15A 2NIPA 1VPEA 1X13A 3L8DA 2UXBB 1KAQA 3HUFA 4CMEA 3A7EA 3IBSA 3FMOB 4BGUA 1ABFA 4I4LA 3QVTA 3VR6H 1PUIA 5C1DA 3NT4A 3H8VA 4UEJA 4MVJF 3THOA 3PJFA 5EJ7A 1TJ4A 2P2CA 2QYHA 1OWNA 5FLXA 2WMNB 4DV3B 2ONJA 3PUJA 3I6YA 3S2SA 3R1IA 1FP4A 4B4DA 3A3PA 3IB3A 1JT9A 4FMDB 4Z8XA 3K0CC 5ARDA 3VZCA 4TSFD 3NTRA 5C1PA 1XMJA 2Y1GA 2YICA 2DHRA 3RWOA 4POAA 4K8OA 2BLNA 3NV9A 3LZDA 3TQIA 5I9MA 1TYDE 4OQEA 4ZV7A 4XAQA 4RKWA 1PSZA 1K9SA 3COSA 2BFMA 3VVCA 2PGXA 1USUA 1LI5A 1XLUA 4U6SA 3TSCA 1CQWA 4YJ3F 1TTTA 2A7XA 1P9WA 3RUEA 3LM8A 1MOZA 1NXPA 4LY0A 2I8LA 2I55A 3EJ6A 4YH1A 4A26A 4E09A 4LSWA 2JVJA 3F7OA 2J5KA 3VHRA 3X1JA 5B1DA 1LZKA 1V0JA 4BB5A 3R23A 1AU9A 1N33B 2VH1A 3DV9A 3E70C 2I87A 2H2DA 1T0PA 4D8VA 2QNIA 3AETA 3L1KA 3S28A 1U8CB 3NZEA 2MCFA 1ZUD1 1DRJA 3WE7A 5MGBA 3QVVA 1H2ZA 4FK8A 3OFVA 3R8CA 1K3FA 5CTJA 4CL3A 4PC3A 4B3FX 5IVHA 2FMUA 2FPUA 2IE8A 1JN0A 2RGYA 3VSDA 1E2LA 2VNAA 3WLRA 1V95A 5EXSA 1TFUA 3H4VA 1M7BA 1QC5A 2C03A 3EN0A 4W5OA 1XEWY 1YUBA 1IBSA 3RG2A 2Q6LA 4TZ6A 4PQFA 1YDEA 5AJXA 3UK7A 3U3DA 4KR3A 1YOVB 2DGDA 1N2IA 3NDPA 3TSZA 1U4NA 4EWLA 5DEIA 1JVBA 2ZIUB 4FTWA 3KKKA 4JR2A 4A16A 4DLBA 4BC0A 4R0VA 3PWSA 1UZNA 3LCRA 3AQIA 1L7OA 4LSGA 4V0LA 5G1OA 3U48A 1KS2A 1CF2O 3I9JA 5TGZA 3TJRA 2O8EA 1RJEA 4MQ5A 1JLRA 2YBDA 2GN1A 4AN4A 3CH6A 4YCNA 4BV8A 1O7JA 2GDJA 2WVGA 3PQCA 4PBSA 4AMZA 2AMVA 4JNKA 1O54A 4P08A 4RELA 4TL6A 3WGZA 4JXXA 3QLVC 4M6WA 4WJKB 1BXRA 3AM3A 1F51E 3R9XA 5CK5A 1WNFA 2EG9A 3AJRA 2CLHB 2LUOA 4OUDB 3VDMA 2BFCB 2VQSA 4X61A 3X2SA 3NHYA 2XXAB 1OKKA 3S1SA 2X8BA 5BVGA 1PNOA 4KAAA 2Z9CA 3TPZA 2Z6QA 3ZVMA 5HBGA 3PUHA 4IG4A 3ZHZA 4YYZA 1V4NA 2GCPA 1N3BA 3EOBI 3ONDA 5DP1A 1WG8A 4LZLA 1CU1A 1NJ1A 2QRPA 3F98A 4UC0A 3UWKA 3DKKA 1ZS9A 3KZ1E 2JJ2A 2X1VA 4NCJA 3L0OA 4WD3A 1YL6A 4FLEA 2ZJYA 3ROEA 1EJBA 2G3YA 3IP7A 2YV4A 4P4LA 5BSUA 3MAJA 4U39A 1D1QA 1BFUA 1P7PA 4P7GA 3WZMA 1XF1A 2GM3A 2QP9X 5JJ5A 2IH5A 1U2RA 1XG5A 2HLPA 1YCFA 2EKBA 4HWRA 3HPQA 4N3AA 4RMJA 5LM3A 1RABA 1X3LA 1XDBA 1SOUA 2NVOA 1M67A 4QJBA 1K97A 4W7HA 5GY7A 3O6VA 1VPTA 3K1TA 3SOZA 3GFBA 4O2LA 2PFSA 4Q7JB 3KJQA 3CT6A 3K35A 2IFTA 2XPCA 2O0HA 2CKDA 4Q1EA 2A92A 4ZAXA 2K7FA 3EZNA 3DFMA 4FBLA 3OE4A 3UG7A 1DAOA 1J97A 3ZHUA 3REQA 5IKMA 2RC5A 3LCMA 1J99A 5K9ZA 3DVAA 3QRWA 2I6QA 2HNBA 2QOEA 2AKEA 3EQ6A 3SYKA 4ZT7A 2QY6A 3MUNA 3H8SA 2YOGA 3CEHA 4N3NA 2F59A 3VYUB 4K28A 1HMYA 1QF7A 2WAMA 1KAMA 5EXDA 2VF8A 3IXLA 3V97A 3H2GA 3PXCX 1N8NA 3DBRA 4HS9A 5TF4A 4YRNA 1KQGA 4XWTA 1A5AB 2C2HA 1OI2A 1AKUA 3EIXA 2OV4A 5CLLA 1UM9B 1Z3CA 1T2VA 2DOKA 2I7XA 3N2YA 4H15A 2WKQA 3IH5A 4M8NE 4PS1A 4RH0A 2VATA 2W6MA 1MABB 4P53A 1NSTA 4FZJA 5KPJA 2HXYA 3H11A 2WJHA 3RVKA 2GEJA 3PE3A 3KZVA 4G09A 2KWIA 3N2GB 4RGQA 3PHLA 1ORTA 4JJEA 2GSDA 2Q1YA 3I04A 3SE0A 3A1CA 3WADA 4YT5A 1P62B 1EU1A 2FMFA 1NY6A 3KWFA 2VG8A 4HDSB 1DO2A 2CVFA 2O1XA 3IT0A 1MD9A 2JLCA 2WPDD 3DNPA 2XCSB 2FEKA 3I76A 3OEHA 1YRWA 1IXRC 4G86A 3IOBA 3VVBA 1AY0A 1RAFA 4CXMA 3HL4A 3QEAZ 3MA0A 4Q4DA 1U9ZA 2Q99A 4X24A 1GQRA 1H5UA 2VKQA 3CN9A 3HI6A 4ZZ2A 1T4CA 2EQ5A 4OFXA 3D8UA 3KQVA 2ZJ5A 4L72A 4ZOAA 3LD9A 3C3XA 4WXYB 1XVUA 1DO8A 1JR3E 1H5QA 1T6XA 2E21A 3O03A 2ZS7A 4NFHA 4RS4A 3TL3A 3VPXA 1CRLA 2GI4A 3L4JA 1OH5A 4PTLA 3J81A 1OTYA 3TPCA 5KKAA 3ON5A 1GPLA 2GO1A 4YO8A 2IZ6A 1ZOSA 3TNYA 2O2XA 5KYYA 2DPGA 1G5FA 1Q19A 3Q3JB 2XBMA 2ZIEA 3M3PA 4EHAA 1U7XA 3RVPA 3W6OA 3T1YB 3KQMA 1GV0A 3R3YA 2CDRA 2ZB8A 1KP9A 1GTVA 3PXGA 1ESDA 5ERXA 1MIOA 3LUFA 3E9QA 4QEDA 1T5IA 2VNIA 3NYQA 2M98A 1YFLA 3LDFA 4RQTA 1GNPA 1YHYA 4N3CA 4EELA 3TOZA 2FVXA 1BTOA 1CS4C 2DH5A 4RE6A 1E2GA 2VWHA 3AFMA 4PLZA 4N0QA 2ZIZA 3K4QA 1X3SA 3GLSA 3VR2D 2IWRA 3VHXB 1Y7LA 3N8NA 1YR2A 3AP2A 3OJOA 2WJVA 2Q5IA 3GARA 2REXB 3FY4A 5LA6A 3AY6A 4XTCS 1VM6A 1Z47A 2JHAA 4J0DA 4EM6A 5LL6P 1O6FA 2J0EA 5K0CA 3D64A 3G2HA 3EB9A 2G9ZA 4PNEA 4IOJA 1WMSA 3FZQA 5CGQB 4J9UE 4IJ6A 3HSSA 3NC1C 3UXEA 1MVNA 2GQ0A 2PL1A 5JC8A 1JPVA 1X8LA 1BGXT 1MTOA 2I66A 3JXEA 3L77A 4HNAB 2AFRA 2QB5A 2QRZA 3ZWCA 2I3ZA 3FTQA 1DC8A 1XNRB 5CFQA 3FDFA 3ZHVA 3G5AA 1LCIA 4G4IA 3BMQA 3IESA 3AEKA 3H5WA 3MEQA 5CW2A 5AKKA 3ZK7A 2XVAA 5AKHA 5EIAA 3QE2A 3INGA 1WL8A 3DVSX 3NYWA 3T5CA 4L7QA 2Z8ZA 5B3LA 4U2DA 1J2UA 4G0NA 4L3OA 2JLYA 3KE9A 1JKFA 2J3LA 2Q2WA 3ANLA 4R9SA 4RH3A 1LLDA 1WO8A 4P2GA 1N0IA 2WLSA 2CXQA 4QHTA 2WE8A 3L1UA 4JBIA 2BSXA 2NXEA 2FMXA 1Y1KE 2G5TA 2QU7A 3GLGA 3AVYA 4JENA 2WVHA 4N5DA 1D0IA 1RBQA 3AHEA 3PX3A 2QZ9A 4MVJD 1T8YA 2CD7A 2OHOA 5CDSA 5JRDS 3LKZA 3NW9A 3M0EA 4KK4A 5DGIA 3OEEA 4DLAA 1Q84A 3FOAA 2RCNA 1RD4A 2AE1A 2AUMA 5B36A 1QV9A 1Y9AA 3VYWA 3ZVLA 2LGJA 2P9YA 4RTNA 3OWHA 5HEKA 3X1XA 3OJLA 4O2BB 3LI2A 1RNLA 1O5IA 1QHEA 3CWQA 3DUFB 3QLUA 5CR9A 2BHNA 1HV8A 4IZHA 2HSEA 4P22A 3R6DA 5JYEA 1D04A 4XPZA 5DIZA 2W0SA 1AS0A 3H4TA 5DB4A 1DBVO 3JQBA 3HZRA 5C37A 4ZOBA 1WUIS 2JAXA 3U61B 2D2VA 2XBLA 1SULA 3I32A 3OTGA 5E3HA 4HN4B 4R68A 2JZNA 2L42A 2F17A 3IUYA 1U81A 4DYHA 4L85A 2FWRA 5EKDA 5AW8A 3PXXA 4UUAA 1PWZA 4XVQA 2D7JA 2FPWA 1SJ9A 3DMDA 1QUFA 3WLTA 5B55A 5DVZA 1E4VA 4K3UA 1U31A 2EW2A 4H16A 1C9KA 1FUYB 4HAIA 1JWBB 1WE2A 4KXVA 4MW7A 3HB0A 4Y6OA 1PR2A 3CPEA 1P2DA 2BMWA 4QZVA 3FOEC 2O2SA 1UPTA 4ZI5A 2XUFA 4E6PA 2VXCA 1TO1E 1TZBA 4R9VA 3ZCTA 1MQSA 3HJHA 4HLDA 2KJQA 2UUOA 1MU0A 3D6HA 4OYHA 2CMHA 1X77A 2QD3A 3F7TA 4NCNA 3V2GA 1URPA 4LTNA 1DQPA 4EGQA 5A4KA 4V1CB 4LY9A 4OX9Y 4MUIA 3AJ8A 1XVTA 3QKSA 4OJYA 1AS2A 3TOCA 1NYTA 3AF6A 2GEDA 4IUDS 1ELOA 2EZTA 3HZZA 3WBFA 1MC1A 1SXJB 1MBZA 5KSOA 1TKRA 2B4AA 4DV0B 4JI2B 2G63A 3OMWA 1NI3A 3EXHB 4H17A 4HFNA 4ZARA 3GT3A 3UUGA 2RFLA 1WF3A 1LDBA 4J91A 4OMDA 2C4UA 5EA2A 5IM5A 2PZMA 3CRVA 5MN4A 1AN0A 3HKBB 1NL3A 3PNSA 1LJ8A 3OZFA 4B44A 1X80B 1T25A 4XR4A 1BCRB 3O9ZA 1GUAA 4QPZA 5GV7A 2WVJA 1PCXA 3UFXB 1YJQA 2O0LA 1DS6A 2VUUA 4XLTA 3TRFA 4BKOA 3QSYA 4OLAA 3WO0A 4HPJB 1IZ7A 4YP9A 1NMQA 4PYIA 3WWZA 2WBLC 2ATVA 3I3SR 4XGIA 3VR1A 4DJ5X 4BTEA 4QA9A 2KLBA 3H7IA 2CV2A 5J40A 5T4HA 3BH0A 2EJWA 2GARA 1NUPA 5CLIA 1TQHA 1NBWB 3C87A 2QRUA 1SEVA 3Q3GE 3L82B 1RXWA 1NE2A 2J33A 2MSWA 4BMDA 3KWMA 2ID7A 3HA5A 4EGFA 1RAEA 3Q10A 5E8JA 1QANA 4QTTB 4FWTA 4ENSA 4UTRA 2ZPAA 2PUTA 5A71A 1HR0B 1CUGA 1RHJA 5LUAA 1QHSA 4URZR 4V2UA 3GB9A 4DR7B 3ZE7A 4XPIB 2ZYTX 1YXMA 3TEMA 2JAHA 4P3OA 2OPBA 3AJDA 2HDWA 2D62A 3LXUX 4G9EA 4ZYYA 2A5JA 2JFXA 4FCVA 4NU0A 5JCPA 3AVXA 3ZZ1A 2XR1A 3MFQA 1PQUA 1CS0B 4L6IA 4MO9A 3DLTA 4PHGA 3GLHA 5EUQB 5FWXA 1YJAA 3UCFA 5C8YB 5KJCA 5LU8A 1MAUA 3BFVA 4RPHA 3JVIA 1HEIA 1PJ8A 2REBA 3B1VA 4IIFA 3WKDA 3T3OA 3WA6A 4BEJA 3D8NA 3OZ7A 3WNDA 4HYQA 1CZKA 3HGTA 4YHHB 4I55F 2D8AA 1CR0A 4JT8A 1Z56C 3RARA 3LTNC 2AN4A 2PX4A 3GIDA 2WWIA 3GZNB 3S99A 1PHRA 4ZHSA 1SBNE 1ES9A 2CC2A 3HLKA 3G2LA 3KUCA 2YW2A 4LJKA 1P7WA 5JJKA 2ACVA 4GVLA 2ZP1A 3D6FA 4OXYA 1NF2A 2SICE 2NZJA 2UZ0A 3IKLA 5E4JA 3ZCUA 3KSUA 1ZOLA 5EJIA 4CG0A 3HVJA 1X9HA 3F90A 3T5DA 2I3BA 5E6SA 3VZBA 2QA5A 4B2IA 5KNBH 3TCKA 3H5AA 4M99A 1M5RA 1DCTA 2AK3A 1BX1A 3CE6A 3VH1A 1RRFA 1PW5A 4FOSA 5EHZA 5AESA 1GQ2A 3PDWA 5GIPE 1FQWA 5GVSA 5C5IA 4HDQB 3ABSB 5J1TB 2GCOB 4BN0A 1GXSB 1S5PA 2PRYA 3GGOA 4WK6A 2IHUA 5E0KB 5AW6A 4RCZA 3GLTA 4F96A 4ZGGA 1BD4A 4XD2A 1AX9A 5JFTA 1JEQA 1GITA 4Y67A 3NH6A 3HCWA 3Q6NA 4FKMA 4L9WA 4NV3A 1LPSA 4YEDA 5TJHA 3H1PA 5A4MS 4F4HA 4JH0A 1SIWA 7ABPA 3HXOA 4DR5B 1E3MA 1ZMXA 2MOKA 3F5QA 1KI7A 3RVMA 3DHYA 1H23A 3DZKA 4DCMA 5I9IA 3ZIDA 4W8GA 2F7SA 2TMDA 3ICCA 4YQYA 1T5SA 1YZHA 1L8AA 2NVBA 4F1WA 1KAOA 2EF1A 2JCGA 2K6GA 2SKEA 1I3NA 2SECE 1I7LA 3IKMB 3OCXA 1SCUB 3C4QA 3UTDA 2XQIA 1GTSA 4Q0MA 1U7PA 1S3SA 1S7CA 1QAMA 2IQIA 3GCWA 1Q0TA 4Z53A 3O5AA 1YIOA 1UXGA 1EAMA 1NMZA 1LZLA 2CK3A 1AUPA 2QGZA 3AHIA 3DE5X 4R01A 3SQMA 2UKDA 3H97A 2XKJE 4B71A 2ZUEA 1JSLA 3ACBA 1P4RA 2QD4A 4MB6A 4KSCA 4E70A 4PC7A 4NL4H 4OO3A 5I5GA 5CA1B 1TJNA 1CRZA 1PK8A 1P39A 5AVTA 1OT3A 4ZTUB 1LPOA 1TLLA 1I5RA 2B98A 1KDTA 1N2CB 4Y6LA 5TMEA 1SHKA 1DRWA 5IAOA 5IN4A 4JITA 2QN1A 1DIOB 1Z35A 4AWXA 4NMHA 1ZG3A 4RVOA 2E6KA 3OMLA 2CV0A 1M2KA 4UHKA 4TLDA 5EMMA 5F1OA 3RBVA 3O74A 1W9MA 2GESA 4H60A 4MUJA 1FMLA 4QDUA 3ZLBA 1T8SA 3GYBA 4YQFA 3R3ZA 2NNWB 4V1CI 3GUUA 1NFQA 1DKNA 3F5FA 4XDYA 4AY6A 3ZW7A 1QCZA 2PL3A 2PU7A 1NI4A 1M8JA 1WQ3A 4B1FA 1IBMB 3GCXA 3BAZA 3CA8A 2W2LD 3FPGA 3VV2A 3LE8A 2QLLA 3PDJA 3SSOA 3IMKA 5AI4A 1IOZA 1CQIA 2CWDA 2O7RA 1PJRA 3DL0A 1E3QA 4MYCA 1S8FA 4N7RA 4QULA 2WV7A 3IJEB 3TRDA 3UJCA 3AIOA 4AT1A 2GXUA 4EY3A 1VJGA 2ISQA 4M22A 4PN7A 2R60A 4U6NA 5BT9A 1CLUA 1JTVA 4EVQA 5AQEA 3ETEA 5CX4A 4ZIRA 5TVKA 1DC4A 1UPCA 1XBTA 2HZ7A 3PLNA 3GZTB 3SEZA 3ZWNA 4DMMA 2A5DA 1LUAA 1SEPA 3L0SA 2NU7B 3X1MA 5IT5A 1BW9B 2P0EA 3FETA 3PQ8A 4HSEA 4ZMRA 2ODWA 2YINC 1NOIA 4JQSA 2XT9A 5L9AA 2OCDA 3KJHA 1HLGA 5TQ2B 4GP7A 2H1HA 3ROZA 1R9NA 2AFVA 1RJ9A 1F9EA 1UMCB 1ODLA 1OHHD 3T3MB 2VDVE 3H9UA 2CNOA 1A71A 1Z7YA 3U0VA 4YJ2F 3BE5A 2EJBA 3NR2A 8MHTA 3ESRA 1FYWA 1XJWA 2OHIA 1B42A 4HAXA 4C29A 2FGKA 3I4CA 2D4HA 2P7IA 3ZWOA 3QBDA 1CRWG 5H3CA 4UQOA 3BICA 3R3SA 2OV3A 3JD1A 2IXFA 2G9UA 5EPEA 1EUYA 4H7IA 1HYHA 5IYZB 1KMHB 3HM9A 3T3EA 2NYUA 4EI9A 2RCYA 4TV8F 3UVEA 5JDIA 3FZNA 2IUTA 1RM4A 4W63A 3MWDA 5BOSA 1H4TA 1LI7A 2B34A 2D5BA 5EMKA 1B6RA 1WUHS 3B1JA 3EARA 3RSOA 3RC2A 4WBXC 4C7OB 2PXHA 1EFTA 1OFVA 3U16A 2XZLA 1Q7TA 3RVRA 2XMBA 2JJYA 1EFRD 3DZDA 1HT1E 2FQWA 1DOAA 2PT9A 1VSTA 2ZB7A 3DAYA 2VAWA 3WQSB 3EDYA 4EABA 4F56A 1I0LA 2AJTA 4NCAA 4QATA 3VX4A 3EDOA 1W85B 2W6JA 5DGDA 4JX8A 4ID9A 3F4LA 5DRTA 1ZBQA 4BZPA 4MUFA 4ZKDA 4GBED 3JQFA 4PRZA 1GU0A 3WK9A 1KE2A 5J23A 1CIVA 5C4IA 4CEJA 3GVXA 1PDOA 3T4PA 1EA7A 3DMRA 3TMYA 1IJEA 1YSCA 4CLXA 3MWEB 2VCHA 1KKLA 4Q4JA 4KR9A 1J2EA 4ZV9A 5FTNA 5FI1B 3KQYA 1YRBA 2P35A 3HKDA 3MJVA 3TIFA 3UY4A 1Q1EA 3MFYA 4MAMA 4F4UA 3ZIAA 4DRXA 2FG7C 1T36B 3L8ZA 1UJCA 4MQMA 1M7GA 5IJXA 5LXTB 2UZIR 3D3JA 4FT2A 4WGFA 4K9MA 2BI8A 1U2QA 2YJTD 2W6NA 3L7CA 4NKRA 5ARCA 1JSXA 2RB5A 4IMJB 1V7PC 3FKSA 1DTWA 3DLAA 4JROA 1IY2A 1YCDA 4GKBA 1XNQB 3DCNA 4Y2YA 2XB9A 3DEAA 5EUMA 1EZ4A 1TRKA 2HV8A 3QTBA 1B8PA 4KHPB 3BK2A 1XRPA 2WP8J 3FOBA 1H22A 2O5RA 1Q1AA 4MS1A 4FGUA 5DU2A 1LXCA 4I1YA 5AW9A 4ZI2A 2GUWA 3FSRA 1Q3HA 2Q4RA 4HGYA 1C29B 2P2SA 1JSZA 3OA0A 5FDFA 2H29A 5LQSA 2BTQA 3EVAA 5JALA 3IMCA 4ZWNA 8GPBA 3OCVA 1KOFA 1XTSA 1PR6A 2P0AA 4Q3DA 4U2FA 3WHLA 1FNSA 4DAEA 2C57A 4KSBA 1ZRNA 5A6SA 4QPDA 4YRAA 3E22B 1P1CA 1QR6A 3X3HA 3BIWA 1F2TA 2FY8A 2NTYC 1Q0PA 5KDLA 3GJYA 1N0WA 4NBUA 3TE6A 3VTAA 3ZV3A 5IEBA 3E5RA 3MQ4A 1WD7A 2V1XA 4CKYA 4BATA 1T2NA 1ZK0A 3E2IA 4IOLA 4URVR 2QRVA 1CEEA 1YQQA 1ID1A 3IOMA 2X13A 1J0XO 4PZ0A 2QR3A 3ZDEA 1KRWA 4IS3A 5KWVA 2VJMB 2QJFA 2IXAA 4U8HA 4US0R 2TRSB 2EIHA 3EF0A 5SZHB 1NATA 1F14A 4IUCS 2KB0A 2HSZA 2OK7A 2QLBA 1BG6A 4S2UA 1L5LA 3WRYC 1EIWA 1SGWA 2DY1A 4OQQA 1EIZA 1G20E 4M0CA 2WAAA 1E7WA 1ZN8A 1EBBA 3WRWA 3BMOB 1EXDA 1TLFA 2WTEA 3BDVA 4CETA 3GUZA 3CVWA 1D6MA 4XX0B 4EHNA 1RYNA 1D0SA 2GEKA 2MSCB 1LDGA 1QGUA 5CHEA 2OYRA 4ZJUA 3O4HA 2ZSJA 2QLFA 4BBAA 1K89A 4LWZA 1G9XA 5F1KA 1FFEA 3WBBA 5JADA 1Q2UA 5MN5A 3EZGA 2O2HA 3HVKA 3VBEA 3AUJB 1DQNA 1I1HA 5EJAA 2OAP1 1GQFA 1LV7A 4PCLA 5EJEA 5GP1A 2PK3A 3B9RA 1EFLA 3GXOA 1E2NA 3D8BA 4ICIA 3KR1A 4UNNA 1CD5A 4YFYA 1DKMA 3DLIA 5IZCA 4KPEC 2BLLA 3CZQA 1L3BA 3MJ4A 3OAAD 3PFIA 4HI0E 2Z6VA 4LRYA 1E3IA 2OWEA 2W83A 1E5LA 1ZW6A 3RIXA 1ORIA 1E2JA 1UDAA 1EQAA 5KC9A 1ZKMA 2UUBB 3USCS 2HJWA 1DZ3A 2BFBA 2GF9A 3MLAA 4ESOA 1QSGA 2F9MA 2A94A 3OG9A 4LV5B 4OQLA 3OU2A 1WKBA 3GG9A 3CBGA 4L75A 1FDWA 4N9WA 4QRIA 4UPDA 2G5CA 3W6NA 3QKIA 4TYNA 3QVGA 5DDIP 3OO0A 4JYBA 4KO8A 4HXFB 4QYXA 4TKUB 1WNTA 2B1RA 4CMKA 3HABA 4EYQA 2WICA 4RVSA 3BMCA 2GAFA 1AF7A 3RBAA 4R4JA 5KYWA 3I6QA 4NH4A 4CF6A 1B4DA 4OIMA 2IV7A 1P3DA 2CEKA 1P4GA 2YJ3A 1W5FA 2H4HA 1WPQA 5LOVA 3IIEA 5CYOA 1I1OA 4Y1RA 3RK1A 3WLIA 1Z4OA 2HK9A 3O2SB 5CAEA 1SCNE 2YNMA 3NKLA 4TMVA 3ZY2A 4BAGA 4F93B 1UP4A 3TRHA 3G6WA 5ALYA 5DYNA 2NVUB 2KX7A 1B3BA 1MAVA 1L7QA 2WYUA 1CP2A 1YNOA 4HWTA 3C70A 5IBRA 4U6QA 4LG1A 4U00A 1R27A 2R11A 1ZU5A 3G9ZA 5CCXA 2V5AA 2GTHA 2DM6A 5IDWA 4CM9A 3QENA 1V1JA 1RDFA 4GDMA 5AJWA 1EUDB 3IMFA 4P0QB 1L4LA 1ZSYA 3MBKA 1GL3A 2Z4SA 3DUWA 2TSYB 3ED1A 2UYHA 2X3UA 3HO6A 1TL7C 2OKGA 3C5CA 5CA0F 2ZVQX 2V0GA 4CTMA 2ZKLA 3DCJA 1AO3A 2R84A 3EGDB 1D0VA 5F21A 4MTCA 3W7VA 1PL6A 1B2LA 3G8BA 3RBXA 3TNJA 5EC8A 3ZDYB 3WGVA 2Q2QA 5BYJA 2FW9A 4XSGA 2Q0QA 2JFQA 4GSLA 1XTRA 3EIOA 3PEVA 4C7JA 2FK8A 3LSTA 3PDHA 1JXOA 4W6ZA 1Y8RB 3GRFA 4LOJA 1L8XA 1F8UA 3RROA 3AEUA 4IVPA 5IJAA 3QUQA 1S2LA 5GM2A 3BXPA 1CUJA 1K7FB 5ETJA 5JXIA 2AQKA 3FPJA 4KDFA 2ZM6B 2Z5FA 2WWRA 3LLCA 3O38A 1FVHA 2HIGA 4QECA 4C2TA 4MRVA 3FX2A 3N75A 2WTNA 1NW6A 2Z5LA 1WXDA 2CXTA 1W5AA 2D74A 1TU3A 3U7QA 3MWLA 4LRUA 3CRNA 4G5FA 1I24A 2IPLA 2ZRCA 3DH0A 3DEZA 4EJSB 2P68A 4G1UC 3QFCA 4BWFB 3X0DA 4OB6A 1QZ3A 5BMVB 1RMTA 1SHJA 5B2EA 3AV0B 1S2NA 2QRNA 4O8ZA 1VJDA 5BW6B 2ZUDA 3X1KA 4B8YA 1Z0JA 2DPXA 4IQ4A 3CCCA 1QX4A 4II7A 3OJXA 4V3BA 4EG5A 5BW5A 2FGJA 4GYYA 2C42A 4PHHA 1DMRA 3IMGA 4KKXB 3N5KA 4QUBA 1FTNA 1EFDN 2IX9A 2O2JA 3PGA1 4LK2A 1VJ5A 3L40A 3NV7A 3OBBA 4TWJA 1DTSA 4EAAA 3FWHA 1Z6YA 4MWCA 1MQ9A 4OU4A 3L7OA 2WUFA 4N0EA 3TW0A 1SRRA 3OP4A 1ZICA 4B4OA 1IBCA 4ZN6A 4GT1A 3KVVA 3O93A 3TO5A 2IYNA 2HDHA 4A6EA 2BGWA 5EHQA 4FFMA 3IT1A 5DSTA 1RQGA 3KJFA 2C1ZA 3SBEA 4MMZB 3TQRA 3V1YA 2JFGA 1AHPA 4IEEA 4LFBB 3PG5A 2O4UX 1CQJA 1XDZA 2GPNA 1NNI1 4OH1A 2O5EA 3GAZA 2BOVA 1G17A 4C9BA 4ARZA 2HX1A 4KBYA 1KJIA 1O97C 3CZMA 3NXSA 4E2WA 1U5AA 1CUDA 1JILA 4LMRA 1RHQA 4RAOA 2PS9A 3QNMA 1LKZA 4TMYA 4ZKEA 1KYVA 3N74A 4MX8A 4EVRA 1G38A 1P61B 3E3NA 3UA4A 4WY8A 5FRDA 3EIHA 3WGHA 1OD6A 7ADHA 4NOLA 3I2JA 4RV5A 5JSZA 2UYGA 3MJCA 3QBVA 3KQQA 4BBJA 4Z4QA 4KRYA 1YZNA 2JAOA 2OESA 3H5IA 1OIVA 3BBLA 3F96A 4XYLA 3HY3A 3ORRA 1GTG1 3PF8A 3PC8C 4ISBA 2ZR9A 4O4HB 4BVEA 2H2HA 3BK7A 4F4FA 3QEOA 3LC0A 1AGPA 4G1VA 2IHVA 4AI6A 1FYEA 3JZAA 3T94A 4BE9A 3TGLA 1AD2A 4MVJH 3T12A 2BEUA 4GF5A 1PJSA 2UUAB 2R86A 2VSQA 4CKBA 3O7MA 4MV5A 1OE0A 3WDKA 1Y0BA 4MYHA 1NVBA 2Q3LA 4O1IA 3RS3A 5JISA 3RYCB 4DB2A 4U7WA 3CUSA 2PH1A 1ECCA 4HY3A 3G1UA 5KCMA 3ICOA 5HKKD 2BKUA 2AJ8A 2IYYA 4K9RA 4ALKA 2JKZA 3D3EA 3WY9A 2R6HA 2HBRA 2FP4A 2JGRA 5IK2D 2QAGA 3T7DA 5LYJA 5G53C 2QX8A 1TD9A 3BF7A 4UBNA 2QD1A 5DH9A 1YA8A 1GFIA 1YKSA 2WP0A 4CL2A 1JDJA 2WHXA 4X5OA 4DDKA 3K1ZA 4YV2A 5EHXA 1UP7A 3GX1A 4ABTA 2D6FA 4GI3A 2A1TR 2ZE6A 4TLMB 5IJ9B 5GVRA 1SQGA 3AF4A 3BJIC 3PNBA 4Q3BA 1SVSA 3S44A 5B1YA 1AN9A 1WSDA 1IULA 5IAEA 4IIEA 4B6JA 4R1MA 3ITNA 1EE2A 1XKQA 4FNGA 4EB6B 3U5ZB 3LIIA 3W3AH 4CMEC 5MN6A 5K0BA 1MOSA 4CHTA 3IQIX 2HWYA 4HLUA 1KOJA 3ZXSA 4L4RA 5JATA 1PF7E 2PZGA 3NGXA 5ALEA 3VPFA 3LX6A 5CT8A 3N1UA 1HSZA 1UZAA 1A9XB 4RIIA 4DR2B 2QLJA 2VPZA 1MAWA 3PXEA 3AGQA 1O2DA 3EH1A 3QZUA 2G1UA 3ELDA