1KOFA

Crystal structure of gluconate kinase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
171
structure length
171
Chain Sequence
b'TTNHDHHIYVLMGVSGSGKSAVASEVAHQLHAAFLDGDFLHPRRNIEKMASGEPLNDDDRKPWLQALNDAAFAMQRTNKVSLIVCSALKKHYRDLLREGNPNLSFIYLKGDFDVIESRLKARKGHFFKTQMLVTQFETLQEPGADETDVLVVDIDQPLEGVVASTIEVIKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gluconate kinase
publication title Conformational changes during the catalytic cycle of gluconate kinase as revealed by X-ray crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 59
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.7.1.12: Gluconokinase.
pdb deposition date 2001-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kofA00
5K8TA 2KB0A 1II8B 4M53A 2OESA 1G1MA 3F5FA 2N46A 5L3SA 3SR0A 5JRZA 2PX0A 2O8FA 1GNQA 1HT2E 5FBRB 2ZJ5A 1H8ED 3AF2A 2QPAA 3K9NA 2PEYA 2B8TA 4EFLA 3L43A 2W2XA 5DH9A 1Z0DA 2ZJYA 3IPXA 1E9EA 1W5SA 3BD9A 1U2RA 3NEYA 5AJXA 1JPJA 1M34E 3NIBA 1G5PA 4P4TA 4YC7A 4W9MC 2QAGB 3CNNA 5HR5A 5L3RA 1W4CA 4TMZA 3QXXA 2O0JA 4AY2A 1Z8FA 3CWZA 3BH7A 1TL7C 1SVOA 2FF7A 4TN1A 4EPWA 3QQ5A 1U9IC 4C0LA 2GTPA 2HCJB 4OQFA 3A1VA 3B2EA 4JMPA 2X77A 4OJKA 4TTQA 3RS0A 2VPPA 3VKWA 4A4DA 3ZVNA 1KDOA 3RS2A 4HAZA 3TH5A 1XEXB 3B1ZA 2QU8A 3IILA 3HPRA 4AG6A 2V7QA 2QTVB 1KNXA 2FSGA 1LS1A 5JEDA 3RRNA 1YHNA 4B6EA 1G8FA 3PUYA 1E2LA 5A5GA 2ZR7A 3SOPA 3GJ4A 5DN6A 4KLNA 1VCMA 2EW1A 1E2MA 2BCJQ 3U3JA 3KJEA 3U2QA 4Y0VA 1U94A 3DMNA 121PA 3FYHA 4DLTA 3MJRA 1J8MF 2Y8EA 2O8DA 5JJLA 4BFSA 2J41A 3AVQA 2V8OA 2BBOA 4F7WA 5CK5A 1W49A 1R8SA 3GLFA 5FFMA 1IXZA 2IWHA 5DI3A 1GNPA 1FFHA 4DCTA 1A5TA 4L9WA 2GRJA 1KY2A 1W2HA 3GJXC 1JPNA 2OXRA 1Z0KA 1VCNA 2A2ZA 1UADA 2VP9A 4NKRA 5BXQC 1E4YA 4BFTA 4B71A 4P3YA 3K53A 2JJ1D 1XJQA 4JBWA 1KI8A 3MUFA 5L3VA 2J7PA 3QPUA 4TL6A 2FWRA 1LTQA 1M7GA 2WKRA 4TMXA 4EDHA 4ERNA 2W2VA 1E0AA 3QEOA 1M8PA 4X8HA 2P3SA 3UG7A 3LVQE 2IYXA 4HLCA 4LV5B 4CDGA 2F43B 1XB2A 5J4YA 2C9OA 3AF3A 4LBWA 2KI5A 4P4SB 3JVUA 1Z3IX 2HJVA 1XXHE 2ZVPX 4TYQA 3KFXA 1KY3A 2OSBA 4IOJA 2HUPA 5E7IA 5KDOA 2RCNA 5G41A 1DTSA 1UPTA 2GKSA 2QMOA 4I1VA 4JVSB 4Q48A 4Q7JB 3N5CA 4PC2A 1XF9A 1M2OB 1E79D 1GRRA 2NQ2C 4UNQA 3WRXC 4US2R 2GCOA 3WMEA 3V00A 3DL0A 3U7GA 4BRUA 5EE1A 2HLDA 1RYHA 4O2LA 4HUQB 3QF4A 4TYNA 4JVLA 1IOZA 3W5IA 2QE7A 3OFND 3KKNA 1EK0A 3L8ZA 2OUKA 2YNMA 1YZTA 4UJ3A 1Q1QA 4Q9JA 1O87A 4G5QA 4HI0E 4B3GA 4IVRA 1I2DA 2GHIA 1R0XA 2ZRFA 2XITA 5FPSA 2JGNA 1G7SA 5G40A 1UEIA 2ZYVX 4EJSB 3C16C 3AVXA 2ZI7A 4TSFA 3Q3JB 3NDBB 3CW2A 1MABB 1VIYA 1IJFA 1E2EA 1BMFD 2J45A 2KBFA 2ZREA 3DHWC 3Q72A 4PX9A 1NNEA 1Q3HA 2JEOA 4GP6A 1VIAA 4QKQA 2P65A 4L4UA 5P21A 2VSXA 1QBKC 5LDDC 1NN1A 2BVNA 2MSCB 1MV5A 5FPHA 4HSEA 3A36A 3WYFA 1QG4A 2I1VB 3EIHA 4ILEA 3FHTA 4AIIA 3TQCA 4KO8A 4FMDF 3Q8XB 1Q1BA 3FHCB 1J70A 2JDIA 2QSZA 3CX8A 5J40A 1CJKC 1YR6A 3IIKA 4JZKA 1VG9B 2JASA 2GEUA 1WB9A 1CKEA 4HB3A 2GILA 3GFOA 1T3HA 1JQJC 3SFVA 1Z6XA 3WHLA 3RVBA 1E2FA 1OXTA 2CL0X 3SJBA 4CEHB 4HLDA 1AGPA 2BKEA 2C98A 1IXSB 2PJZA 5KOYA 3QKRB 2CJWA 4ZDKA 2WWIA 1YZKA 1YE8A 3U7HB 1T6NA 2BJVA 3OAAD 4B3FX 1FNMA 2Q0HA 4M2LA 2C2HA 4PANA 1HE8B 3SU8A 1W4RA 2OFWA 3H86A 5DIFA 3MRSA 2JA1A 5EXXA 3LAWA 1IQPA 1VTKA 3CM0A 3BH0A 2RHDA 4RCYA 1QHYA 4TMWA 1WBBA 3KQKA 3UPUA 2KJQA 3ZYCA 3U7FB 2JAQA 2OCYC 2D7CA 3FFBA 3QIAA 4PQYA 3FKSA 3H0KA 1YQTA 3ASYA 1KJYA 1RFLA 3L0SA 4V0KA 4RY2A 3CB4A 4ZKEA 2WWFA 4KLZA 4V03A 1X3SA 2A3RA 3G82C 5TDHA 3B5JA 5IT5A 1W36C 2NO9A 3HWSA 5HCIA 3KXIA 4LDJA 1JJ7A 5DLQC 4YDSA 2YYZA 2VYFA 3O47A 4MKHA 1T9HA 4ON9A 5BN5A 5F9FA 2P6RA 1G5TA 1OE0A 3MFYA 3O8BA 1XWIA 1Q0UA 3A37A 5B30A 1E99A 1FUUA 2AK3A 4JSYA 2O0KA 4F38A 5F98A 2IX3A 4QFMA 2PL3A 1GL9B 2GXUA 4G5SA 4LBVA 4Q02A 4Q66C 3VR6A 1XDBA 5EZ6B 2WJJA 2NZJA 1G21E 4LJAA 2XAUA 1NMZA 1EFRA 1JAHA 1E1QA 3TAUA 1X8KA 4TMVA 4DCUA 4L9SA 3GJ0A 4KSCA 5DYGA 2A5DA 2XZLA 3IEVA 1NKTA 4X8OA 5TMPA 4RD1A 1XZPA 2F1JA 3HYRA 5TVKA 4JIMA 2A5YB 1QZXA 3UMSA 621PA 2BHRA 1VG8A 4QGAA 3FTQA 2WKPA 2ZE6A 4B44A 2ZQ5A 1ZM4A 1N5LA 3QNUA 5FTJA 1NIJA 4DLXA 2GWHA 1SVIA 3K0FB 1JECA 2EYQA 3QVUA 5EXTA 2R6DA 4XVUA 2WIAA 3K9LA 2VF8A 1NSFA 4JYBA 3NG1A 5BW8A 4DHEA 3SFZA 3QEJA 1SZPA 4PO8A 1KGDA 3OHMA 3WNBA 1G3QA 1HUQA 2RGEA 3BJIC 4HDQB 4Q4JA 4DJTA 1BYIA 1AKEA 2IWRA 2WTUA 3PVSA 5E7JA 1T0JB 5D3MA 4JYCA 4IXNA 1E2QA 2D2FA 4NZYA 3DMDA 4KBGA 4Q1EA 4D4LA 3ICEA 1GKIA 2P5SA 3I4LA 1II8A 2QMUA 4BFZA 1S1CA 5CITA 3HYTA 1ZC4A 3T5GA 1W4BA 2DFTA 3VFDA 1TU3A 2CEAA 1GITA 1LY1A 4RFSB 4A8JB 3OEHA 2ODNA 1JR3E 3VR2A 4IHQA 3GLGE 4Z8YA 3AVUA 4PHTA 5B2ZA 1G3RA 3OIUA 3ZVLA 2V1UA 1VCIA 5JLJA 2QORA 4QBIA 1Q1ZA 1KTVA 5L3SB 2FE4A 2ZYWX 3DM5A 1NVWQ 1GWNA 3RAPR 2O8FB 2E9SA 2HF8A 4I1OA 2RGDA 4DUGD 4JSTA 3UXMA 2QP3A 2QAGA 1FUKA 4OQNA 4Z51A 5H70A 3KJGA 1KDTA 4C0KA 4TL7A 1QVRA 2R65A 5TB5A 3EZ9A 1N2CE 1CJTC 2HCBA 4ZI2A 4ZO4A 1W2GA 1BYUA 3LQQA 1RRGA 1A82A 2BBWA 1VG1A 3SN6A 2YOFA 5IK2D 2QGZA 4PAOA 3MWLA 4PC3A 1GM5A 1E9SA 4XSHA 4E03A 1N0VC 2GESA 4Q1BA 2GBLC 4W5JA 5EP1A 3PITA 2BM0A 3SEAA 1U8YA 1TUEA 4BQSA 1NBMD 4TQUS 3X1ZA 3VKHA 3K9GA 2V55B 2HJGA 3HU2A 3ZQ6A 5BN4A 3ZDQA 2Z4RA 2H18A 1SKQA 2YKGA 3CPEA 1XRJA 1LW7A 2C78A 4OHXA 2NOAA 5HZKA 1G4UR 4IDOA 5EP2A 4ZKDA 3K70C 1E2GA 4DVGA 3U4QA 1DADA 2JJ2D 4JBXA 2XZOA 3X2SA 1P2UA 3M0EA 2V54A 5FTNA 3BGWA 3R20A 1HQYE 1DPFA 1KDRA 4AWXA 3E5HA 4BEBA 2JLUA 4BLQA 4DLUA 4C2UA 4R7ZA 2O8DB 4FI3C 1E2NA 1YZQA 1P4SA 4Q4HA 2OFXA 4BASA 1AK2A 2WVJA 5J5CA 3EPJA 4ACBA 3T1VA 1BKDR 2BDTA 1G19A 3LX5A 5JWHA 4C3ZA 5CDFE 3GLFB 2F55A 4KVGA 1FMJA 5DI3B 5AUPB 4TMKA 3I8XA 3VX4A 4BE7B 1W4AA 1OXUA 4OHWA 4QJ3A 5BYKA 1ZU4A 1P2VA 1YZLA 2CNWA 4M22A 4IKEA 4Z1MA 3WMFA 1E2JA 3A1WA 3ZQJA 4URZR 2A30A 2ZU0C 2X8AA 1EX7A 2BMDA 2QP4A 2C8VA 3GPLA 1CTQA 1YR7A 3X1DA 2AWNA 4OBEA 4Q9LA 1FP7A 1D8TA 1FTNA 1HEIA 4P4SA 1A7JA 3KZ1E 1MRNA 3CRW1 2AFIE 2EU8A 3A8TA 2G3YA 2QTFA 1U0HC 1JNYA 4PPGA 4EIWA 1ZYUA 4GP7A 1SXJA 1Z07A 4CVNA 2IHBA 2GXAA 1FW6A 4I4LA 2WICA 2CHVA 2IUUA 4IXMA 2AWOA 4HYYA 3LFUA 1R4AA 1UKYA 1R5OA 1NN3A 3EASA 4EAQA 1BH2A 1E3MA 1E4VA 3QPVA 1WDTA 3RRZA 2BMJA 4KVAA 4HUQA 3UK6A 2C03A 8OHMA 1B0UA 2AHOA 2R8RA 3RS3A 4BFVA 4MRSA 3ADDA 1OIWA 3E2IA 821PA 1KMHB 1PLLA 1Z63A 3AVTA 2RKOA 4NYMQ 2GCOB 4C0JA 3GLIE 4HDCA 3ZVRA 2HYIC 4KHZA 5JS7A 2W0MA 3OEED 1KSJA 4P4UA 5DHFA 2OCPA 2J46A 3A1TA 2ZRDA 2XJ9A 3T06B 4EJSA 5JJKA 3UG6A 1II0A 4YONB 1ZP6A 4IEIA 2CLSA 3W34A 1AS2A 3QOFA 1YKSA 1Z6GA 3CF2A 2ZROA 1OH7A 2DFKB 2CL7X 4MKIA 1OIXA 5KSYA 1NN5A 4RCZA 5TY0A 1XCMA 5LPNA 2WAXA 1W0KA 3LW7A 4M8NE 3T34A 3B1XA 1UKVY 1DELA 4YMUA 5J4KA 2EFHB 1F5NA 4ZCMA 5KNBA 1AGRA 4IOKA 2OLJA 1KO1A 1EFTA 4M4SA 2YHSA 5DE3A 3VNUA 2EQBA 3KTAA 1CJUC 4WZBE 4FINA 1BO6A 4CEIB 2JJ8A 1PV4A 5FUWA 1U0LA 3E70C 2QAGC 3MLEA 3FOZA 3CONA 4AKGA 4WA7A 4B2IA 4FMBB 4PHHA 1FQJA 4S35A 2QMEA 3EZFA 3K0AB 3TW4A 4CEHA 1P9WA 2QRZA 3GJ5A 5HTKA 1DG1G 4OI4A 4YQFA 4LSGA 2CK3A 1CU1A 3P20A 2D74A 2O8EB 5KPJA 1TEXA 1S8FA 4NPHA 3BRWD 4PSKA 5H1YA 5FPTA 1KZGB 1XD8A 4D4JA 1UFQA 2WHXA 4RJLA 2WJVA 2XTNA 2IS2A 2QAJA 1KKLA 2PH1A 2WWYA 4C0BA 2ZVQX 1E9FA 1N25A 2CCKA 2P6NA 1UBGA 1DAIA 2XNDA 4AK9A 3MWKA 4FWIB 4F91B 1D5CA 3M4YA 3VX3A 1F2TA 2CVFA 4H1VA 2GVZC 1VDZA 2BV3A 1E32A 4B6FA 2PCLA 3LNCA 3ND9A 2FOLA 2QT0A 1A1VA 3VNVA 4OK6A 1NRJB 2WKQA 3SJZA 5DGXA 2ZE7A 4CW7A 3IDQA 3ECCA 4F93B 3AQ4A 5FI1B 3A4NA 221PA 2FDCA 3VR4A 3UIEA 2QI9C 1K5DA 4US1R 4HAYA 4A0FA 1Z29A 4JVNA 4X8MA 3WMGA 4BLSA 3HR8A 2KWIA 4LYAA 2Q9AA 3AKEA 3BB3A 2Z4SA 2PZFA 4XJXA 4KU4A 2AXPA 1KIMA 1OJLA 1YZGA 2P2LA 4LYJA 4KYUA 4QGFA 4U5XA 1TEVA 5EXPA 1JAIA 5GVRA 1WP9A 4JL6A 4NL4H 1QHXA 4OI2A 2CE7A 1P2SA 2AKYA 2ZE8A 3DOFA 2FFHA 3LLUA 3L82B 4QHTA 1G7RA 1NJGA 4JL8A 4NYIQ 1A2KC 2F1IA 2DPXA 3CF0A 3GLHE 2J1LA 3SJAA 1SXJC 5EZ5A 1U81A 2NO7A 1I4DD 4Y0AA 2E1RA 2CCGA 1NG1A 5JCPA 4O25A 3K0FA 4EKDA 2W00A 4MITA 4BFWA 2Q21A 3GMTA 4LOAA 3W6OA 1CR2A 3GFPA 3BS4A 2UKDA 3WNCA 1UAAA 4TLEA 5EUQB 2GA8A 1TX4B 3EC2A 4PQRA 2AL7A 2OILA 3L0OA 3TGPA 4TTPA 1NKSA 4QNMA 4GI7A 4DLZA 1OW3B 3NHBA 4PZLA 3R9XA 4WOPA 5KUTA 1NVVQ 2VRWA 4BFUA 2ZU6A 1XMIA 4TZ6A 1QHSA 1N6LA 4B35A 3PEUA 4OL0A 2FA9A 4F92B 4US0R 3ZD7A 2V7QD 3CRVA 4LJ8A 1T91A 4Q4JB 3T1OA 5M04A 3G0HA 4EJSC 4LC1A 2YWFA 2CDNA 1JQLB 1GKUB 3C5CA 3RSOA 5KDLA 5DN6D 4JLMA 2D3WA 5DO9A 5D3MB 2H17A 3LXXA 1Z47A 3EZ2A 4TLDA 2A5FA 3I72A 2ZRNA 3AGQA 1GG2A 4C30A 4GZLA 3TVTA 4KFUA 4MUAA 4OJQA 5EXSA 2HDNB 1GL7A 4KAXA 4PXAA 1TU4A 1XXHA 3SQXA 4TYPA 3DDCA 4IFEA 4DDUA 4EPVA 4NYMR 3A1SA 2QEQA 4D25A 1M74A 2HV8A 1W0JA 2ZRMA 4N0DA 3AVVA 4A1FA 1SKYE 1G3IA 1W36D 1L7VC 3NXSA 2ECKA 2DY1A 4N0EA 3WYGA 1JBKA 1AS0A 3SJCA 4G3XA 4ZCLA 1ZM2A 1JR6A 2CCJA 1U8ZA 5HKKA 1S4QA 1XJCA 2IYYA 4M1WA 2QL6A 2V6IA 3N2EA 4WXRA 3B78A 5JHGB 1WRBA 1FL9A 2VHQA 4NYJQ 2C99A 2J7PD 1E0KA 3K09A 4N3NA 2YVUA 1XPRA 4R71A 3ZZTA 4RKFA 5IRCD 2BBTA 3RRMA 4U02A 4HZUB 3B9PA 1C1YA 3WBJA 1D2NA 4G1UC 3VHXA 3VMFA 4QBFA 1W46A 1W5TA 1IN8A 2Q9CA 4XTRA 4C4PA 3PIRA 1GAJA 1T0HB 2N1BA 1Z0FA 2B7BA 4ZDIA 2ZS8A 1E9DA 1JEEA 2GK7A 2OFOA 3LY5A 5LB4A 1G16A 4DSOA 1MR3F 4A36A 2IXEA 4D81A 2XZPA 1NVXQ 4RZ2A 1VPLA 3FMOB 4QHSA 4WZ6A 4B75A 3O8RA 3O8DA 1EG7A 2DCUA 2ZTSA 1U8AA 4TWZA 3F0TA 3U4QB 3RYTC 3B60A 4ARZB 3Q7QA 3B7GA 2D4HA 2HLDD 4B34A 1LNZA 1OKKA 2C5LA 2ANCA 2IEYA 2P67A 1MH1A 2QE7D 2HXYA 4NE2A 3B13B 4AYTA 4DLWA 1E9AA 1DARA 3FMPB 1TF5A 2PZEA 2ZSDA 3KKQA 4YMSA 3D8BA 4Q4HB 4DLYA 3BIFA 1EWQA 3RRYA 1M7HA 2FX3A 2VP6A 3A58B 4CIDA 3U60B 3CRQA 4I81A 1X8JA 4TTRA 3TKLA 1TAGA 3QPWA 4TSFD 4IFBA 4I1UA 4PAQA 2F3RA 1P3JA 2BWJA 1ZD9A 4DLSA 4BLPA 1JXOA 2WV9A 4DCVA 1V43A 2R44A 1XPOA 5FBLB 4V0OA 5LB2A 1EFCA 2QZ4A 1J8YF 3I5YA 3I62A 2IYTA 2BBSA 4HZIA 4Q00A 1WQ1R 4GFDA 4JLOA 2QPOA 4BLRA 4RSGA 3ICQB 1UJ2A 1YJ5A 4DIEA 3QKSB 4GSYA 5EUMA 2XTMA 2B8WA 4M9XA 2F9LA 2D2EA 1RJ9A 3LX8A 2F9MA 4YLGA 2REBA 4JKIA 5FL3A 2JDID 2KSQA 1SXJB 3GFTA 2F3TA 4FW9A 4QM6A 5EE3A 2FMXA 1VKJA 2FSIA 2EFEB 4JJZA 1X6VA 1KMHA 2HYDA 3FDIA 1PJRA 5CK4A 2ZPTX 3T35A 1JJVA 1KI1A 3PUXA 2W83A 2XSZA 1OV4A 4UJ5A 4XSGA 4L16A 1DO0A 4NYIR 1ETUA 1G7TA 4G5GA 1OXXK 1KI4A 2ZUBA 3CBQA 4LK2A 1P2TA 4W7SA 2QG6A 4M9SA 4DXAA 4PTLA 2WJHA 4V0NA 5EP3A 2FEMA 2ZRLA 2JATA 5C18A 2IL1A 4NCIA 3TR5A 1XBTA 4D6PA 2FPKA 1TQ6A 3AP2A 3LV8A 4A8JC 3K70D 1Q21A 4DT1A 3L0PA 3QJYA 3FKSD 1IN4A 3W3ZB 2PBRA 3VU9A 1G41A 1NVVR 1KMQA 1TADA 5FR2A 3TSWA 1OH5A 4PPNA 3CPJB 3K1JA 3U44A 5C4GB 4CEIA 2XNSA 1PVOA 1AJEA 5JS8A 1Z6AA 3THYB 4V02A 2X19A 4E22A 5FOXA 4L15A 1RRFA 1YRBA 1NJFA 1AZSC 2IF2A 1R10A 5GJBA 1YR8A 3UMRA 4GMXA 2AKAB 2VEDA 1Z08A 3K0AA 1ZIPA 3KTAB 3NDPA 4QBHA 1XZQA 2HF9A 3QG1A 1E9BA 3ZH9B 4AC9A 4D0NA 1CRPA 2O8EA 1VECA 2R6CA 1G7CA 1RIFA 1HE1C 5HPYB 1S3SA 1OH8A 1DVRA 3C14C 3K09C 1G17A 1KI9A 2FFQA 1EFRD 2ZS7A 1E1QD 5JHHB 4AKIA 2ANBA 2WJGA 1CS4C 1TQ2A 3DZ8A 4I99A 4ESHA 3FE2A 3R9WA 1E94E 1XJ0A 1DAFA 2W6JA 2XTZA 3EW9A 5DISB 2HT1A 5FUXA 2QTHA 2ZITA 2ZSAA 3EARA 3TQFA 1Z5ZA 1Y63A 1LVGA 2XEXA 2OBNA 1CF4A 3VAAA 3EA5A 4LHXA 2NO6A 1JR3A 4BFXA 2CXXA 4AKHA 4IJMA 2X2EA 3IIMA 1ODFA 5GADl 2AX4A 4NYJR 3T5DA 3LVRE 5FPYA 2IYSA 2ZRJA 2OM2A 2ZIAA 3AH8A 5DYIA 3C8UA 3AKDA 1F2TB 2G77B 3EAQA 3REFA 1J2JA 2PX3A 1VYVA 5LBIA 2Q3FA 2RGXA 1AS3A 1DE0A 1Z06A 3B82A 2QA5A 3TUJC 3PEYA 1AQUA 5SZHB 2YC4C 5AJYA 4M1SA 2VP4A 1FQKA 2QM7A 2AK2A 2GJ9A 4A92A 1N5KA 3K0EA 4CGZA 5F2EA 5C4MA 4BLTA 2O52A 1IN7A 3FHOA 4Q7LA 2OCBA 2Z5FA 3H2YA 1AIPA 3E1SA 4KODA 2B21A 3QXSA 1R6BX 4HAXA 2ORVA 1G6OA 3BB1A 3ZZUA 3OEHD 3NBXX 2V1XA 5AUQA 3R7WB 5JWRA 4MKFA 2J0UB 3V9PA 4GL2A 3H1TA 1COWA 2FFBA 1S3GA 1OSNA 2JLXA 3NVAA 4MGYR 2Q6TA 4D26A 5FL7A 1S2MA 4XWKA 1ZBDA 2JCSA 2WOOA 3MGCA 1FNNA 1GL6A 1Z22A 3BORA 4IDPA 4LHWA 4CRWB 1GFIA 4MGKR 4UKDA 4PO1A 1ZCBA 2HXSA 2J5XA 3RS4A 4WAUA 4BZPA 2O8BB 1CR4A 2QUZA 1AN0A 2ZSEA 3FFAA 4RD2A 3KL4A 4ZPXA 1OHHA 2NGRA 3AB3A 4DIDA 4GT1A 1Z6TA 1G18A 1T3LA 1UBEA 2R2AA 2VSFA 3QE0A 3AGPA 4HB4A 3NH6A 4NCHA 2YOGA 4KCGA 3SC3A 1IAQA 3T12A 2A5GA 4QGHA 5CDFA 4KI0A 1NY5A 3WYAA 4JLPA 1XP8A 4DDTA 3BAFA 4BGDA 1WBDA 1KO7A 2JIZA 4J0QA 3REGA 4NU0A 4EPRA 3B85A 1BS1A 4R2IA 4D0LB 2WM9B 3GEIA 1FPMA 3LLMA 4FMCF 4AD8A 3ONWA 3CZQA 3MD0A 1GTVA 2P0EA 2WSSA 4N1AA 4ZDJA 4LX0A 2UVQA 4HLQB 5JECA 5B57C 5AJZA 1RPZA 3BE4A 1KJWA 4A6PA 3B1VA 3RNLA 4CZ2A 2ZRHA 4Q9KA 1N6PA 4Q7MB 4MRPA 2FSFA 4R9UC 4II7A 521PA 2RGNA 2GCPA 2PLRA 3SNHA 2ZAOA 1KK1A 4V0MA 4C7OA 5FOVA 1XXHB 1ZNYA 1KI6B 3NEJA 1E2HA 2H7VA 1QHIA 1SVSA 3BC1A 4JLJA 4C0AC 2EFCB 5FTLA 4XIGS 4LCBA 3RABA 4DLVA 1G6HA 2NMVA 3TUZC 4XWAA 1LF5A 4M1KA 4PAMA 2ZRGA 2CNWD 4C0HA 5KU1A 4TYYA 4Z1MD 2GVDC 5EP4A 3AKCA 1N3BA 4JS0A 2AD1A 1FOEB 2ONJA 1N6KA 2IS4A 2PCJA 4UNNA 4XVQA 3U6BA 5KNCA 4HZUA 2DBYA 3L2OB 5FTKA 3QG5A 2ZANA 3TSOA 4B3BA 3ZS9A 1NY6A 1AQYA 3KQHA 4Q1AA 3FGNA 4D0GA 4DKXA 3DM9B 4DDVA 4DWJA 2FGJA 1OB5A 2ZE5A 1GRQA 1E2DA 1MO6A 3M6AA 4B3DA 1SXJD 3EPHA 1FTSA 2VHUA 3P4YA 1KO5A 3AVPA 1ZU5A 5E7MA 3VHLB 2NZ8A 2DWPA 4MDFA 3A4MA 5JZVA 4TQAA 5KDDA 4TL8A 1P7CA 5JCZA 3I73A 2GF0A 1KYIA 1BIFA 4IVPA 3LWNA 4ARZA 4GBMA 4Q4LA 2WPDA 4RZXA 1IY2A 2ZI3A 4G01B 1R0YA 2WOJA 1Y3AA 4HAUA 4HAVA 1DG3A 3CPHA 3KUDA 4GPTA 3R9IA 3IO3A 2RAPA 4TQ9A 3MJHA 1NL3A 4MGIR 1N5IA 1ZW6A 2B92A 3AUXA 2PT7A 3Q5DA 4MYHA 1ZCAA 3ZS8A 3THWA 1W7AA 3BXZA 3QBTA 5FOWA 4IDNA 3CKLA 4M1OA 3QXCA 1Z2AA 1TF7A 5JFGA 2ZAMA 2NPFA 1TF2A 4K81B 4KITB 1NLFA 1KSGA 4ASUA 3S1AB 5HE9A 2QN6A 4OQLA 3DOEA 3SHWA 3OIVA 1KKMA 1W0KD 4O3MA 2OBLA 3MCAA 5L8VA 3QKSA 4UNSA 2ZRKA 2PJRA 4MRRA 1M7BA 2FNAA 2RGAA 1F6BA 6Q21A 1CBUA 3KUCA 4GNKA 2ZRAA 2XOKA 2NO1A 2ZI9A 4QL3A 4R98A 1KAGA 3EZ7A 1Q44A 1DEKA 4MYCA 4OQMA 2OAQ1 2WZQA 3T15A 3NBYC 4LV8B 5DSZA 1H8HD 2C04A 1RJ9B 3BK7A 4IOMA 4P0TA 1W48A 5FOSA 3GQBA 3MG9A 2V6JA 2WJIA 3RS5A 2BEKA 1E0JA 2CK3D 1YR9A 3PEVA 3SDZA 3KJIA 1XCGB 2IYVA 4PSAA 1UDWA 5F9HA 5FBVB 3DVLA 1CXZA 1J7KA 3DPUA 1TUIA 3CH4B 3UWOA 2VHTA 1SVMA 2G83A 4FMDB 4M21A 2XGJA 4RD6A 4K8OA 4BLOA 2XB4A 1HQCA 4M1TA 2NG1A 3THOA 1E1RA 1GIAA 1SVWA 2XNDD 1SVKA 4HEJA 3OE7A 1E6CA 3WNDA 4D4MA 1CULC 2QENA 1R8QA 4JBYA 2WJYA 2ZRIA 1EWRA 2GDJA 4O0MA 2RGNC 3W6NA 3EA0A 1ZC3A 3BB4A 4DEXA 5J47A 4DT1B 3THYA 3G5UA 3GJ6A 2ODBA 2R6GA 2WSMA 4H1UA 2ZJZA 3N2IA 3VU9B 5E3HA 4ZV4A 4LHZA 1IN5A 3IO5A 5AR1A 1XD9A 5ANRB 4BEJA 4Q1DA 4B43A 1NVUQ 3U44B 4URWR 3KKMA 3UANA 1PUIA 4A0HA 3ZVMA 2XJ4A 1MO5A 1P5ZB 4CT4B 1E9CA 1HT1E 1A2BA 1S9DA 1H8HA 2YOHA 1US8B 5BQ5A 4NHOA 4TYWA 4A15A 5D3QA 2O5VA 4KFTA 1LV7A 3AM1A 2QGNA 5C1BA 2NPIA 1XTQA 3LA6A 2ZI6A 1J90A 3VQTA 4QOSA 1KSFX 1V5WA 1N0UA 2IYZA 2IBMA 1AKYA 4OHVA 5G3YA 4X8LA 4JLDA 3ZZ0A 1OFHA 4DDWA 1IXRC 3EWSA 5FTMA 2FSHA 5JSZB 2IA5A 2AXNA 3H4MA 2G88A 1ESMA 4DC9A 3CWQA 1VCOA 1T5IA 5KHOC 1QF9A 1SHKA 4DCSA 2IHYA 1ZD8A 2FGKA 2VF7A 3BWDD 4FXPA 1TQDA 3NWJA 4LHVA 5J4VA 3ADBA 1QVAA 1GUAA 2IYWA 1SQ5A 3GLGB 2GK6A 3QVVA 2Z83A 4LYHA 2ZUCA 5SZJA 4TL9A 3KQNA 3RSLA 4FD2A 2OE2A 1QHNA 5K8UA 4FN5A 5L3QA 2J0QA 4FCWA 3OIYA 1LS6A 2EFGA 1P75A 2ZETA 1YU9A 3I8SA 4MGZR 5HCNA 3CNLA 4RD4A 4IDHA 1TQ4A 1UKZA 4A9AA 1F60A 1KI2A 5LD2B 3BFVA 1NBME 2ODEA 3MSXA 4DB2A 4JL5A 4IDQA 2YWEA 1DOAA 3A1UA 3B1WA 4B2PA 3RC3A 1NF3A 3PFIA 3R7WA 3TRFA 4FWTA 2J0UA 2QRNA 1W1WA 2PT5A 4ZDWA 2J0SA 3LXRA 4JKYA 2VHJA 5FBQB 2UZIR 1IY1A 1G3UA 1GKYA 1XD2A 1XCPA 1W0JD 3NBFA 5FBWB 3M1IA 1T8TA 4JT2A 1C9KA 3AKYA 4MYUA 5JRJA 2O8BA 4EPXA 4LZZA 4HAWA 2C96A 1II9A 4JJKA 5BWMA 1TNDA 4LUCA 5HKKD 1RYFA 3NBZC 2YC2C 5JJIA 2LWIA 1P73A 3SBEA 1KZ7B 1AA9A 3VKGA 3ZIAA 5DHAA 1T4GA 4NCJA 3ASZA 3CH5A 2GZHA 3PJRA 2IF0A 3TE6A 1OFIA 1LB1B 1ZRHA 4JLBA 5FOTA 1I2MA 2SHKA 3K0CA 5CLQA 4YMWA 4C0SA 2PEZA 2WBLC 2REXB 1LFDB 4OKSA 1VHLA 1Q20A 2X2FA 3AV0B 5DNYB 2ZRCA 3FVQA 3FMFA 4KFSA 1XMJA 3PEWA 3UATA 3SYKA 2J9RA 2MMCA 2DWOA 2JLRA 3FWYA 2L0XA 2VP2A 1R0WA 2V9PA 3KJHA 1U98A 4WXPA 3PXGA 1CJMA 3TK1A 2WWXA 4LV6A 5GJCA 3OIWA 4MQBA 3QF7A 5FOUA 5GVSA 5CM9C 4FIDA 1FMLA 3I3SR 3EX7C 3QSYA 2JLQA 1M1YE 3HP1A 5CB8A 1KOFA 4CT5A 4C9BA 1J99A 3EZ6A 1FX0B 3B6EA 4HATA 4QGGA 2QQEA 3WP0A 5HZHA 3MMPA 1QRAA 4LJYA 5EE9A 2J3EA 4AYWA 1KI6A 1U99A 3ZGXA 3FMIA 4NTZA 4POAA 3AVYA 4XVRA 3KXLA 4PC1A 1OKKD 4Q4AA 2CVHA 3PENA 4P32A 4A2QA 3TW8B 4XD7A 4C7OB 2W6IA 2WAYA 3WY9A 1XTRA 2P6UA 3ZJYA 4M9ZA 2NO0A 1LF0A 2BEJA 1KNQA 2ORIA 2VTKA 4LBYA 3BFXA 4NMMA 3WBKA 3DEFA 5E95A 1RRCA 3P4XA 3IKJA 2E87A 2JLVA 1CIPA 2UZ3A 4PR0A 4PO9A 2OEPA 4ZIRA 1JEDA 2X1VA 5IDVA 3LBIA 4K46A 3GLIB 2NIPA 1OYYA 4QBGB 4WIAA 4DLRA 3W90A 2W2TA 2C9CA 3JZMA 1YRAA 3PR1A 2I1QA 3AF4A 4AG5A 2OLKA 4TT3A 1ZM9A 3X1WA 3I92A 3LBNA 2G1KA 1NIPA 3RANA 4BZXA 4GDFA 4Z8XA 1NLYA 4YXWA 4BWYA 2Q3MA 4FCTA 1R2QA 4PSVA 1K6MA 3JZAA 2FEOA 1VG0B 1G8GA 4LYFA 1IBRA 1E98A 3IQXA 1R5BA 1WF3A 3AP3A 1SHZA 1Q57A 1VYTA 4W5WA 1G8HA 1E69A 2F1HA 3P26A 4QNRA 1IN6A 2JLSA 2ZXUA 1Q12A 2F7SA 3F3YA 2RGGA 2XSZD 4WW0A 1UBCA 1KK0A 3CO5A 4F4CA 3LRPA 4CF7A 2FV8A 4ZI3A 1QHHB 2D62A 2G0NA 1XEWX 5JMTA 2KE5A 4WVFA 4ACAA 1XU4A 4EQ6A 3H84A 2RGBA 3GJ8A 4AURA 3RC8A 2R6AA 3SS8A 4QJ5A 4QRHA 3I61A 1T8UA 3S1AA 4OI1A 3THWB 2ZRBA 3PUVA 4W5HA 2GF9A 4RD0A 4KBFA 4B47A 4BRWA 1H8EA 4LWZA 4ZCIA 3THXB 4LPKA 3AP1A 3GCGA 1IM2A 3A6PC 2ZI5A 2XXAB 3AEZA 4Q1CA 4MUBA 4OI0A 4RZUA 2DFNA 1P6XA 2G0TA 2WWGA 3SE0A 4LI0A 2FU5C 5IHPA 4Q7KA 2VBCA 5KSPA 2G9NA 3EG5A 2GJKA 2IXGA 5JBQA 3TR0A 2RH5A 3J81k 3LBHA 2BCGY 3B8HA 3K9HA 4KJZA 2DHRA 4Q21A 4BFYA 4WZAE 5TV2A 4MRNA 1Z83A 2CMKA 3B9QA 3U3OA 1OFUX 3D3QA 1OF1A 3NC1C 1ZM7A 1YZNA 421PA 5CLLA 3CIOA 5KSOA 4TZ0A 3K0CC 2H8KA 3CRRA 4JLVA 1NMXA 2Z43A 5F3WB 1R0ZA 2AD5A 5JEEA 2D06A 2W6JD 4TLBA 2QBYB 4BECA 4OHZA 4UXJA 1ZNXA 1OFTA 4YMVA 1TTTA 2RHMA 2OG2A 2N42A 1NLZA 1PUJA 2P5TB 1AZTA 1KHTA 4LBZA 2VP0A 1JALA 3Q5EA 1JR3D 3DKPA 3GEEA 1KI7A 1WXQA 3U61B 5EQTA 2IS1A 1UKEA 1X86B 2BJWA 2DFLA 4CEJB 3CR7A 3ZD6A 1KO8A 2YINC 1L8QA 5CYPA 4B33A 1ZINA 3SBDA 3VTKA 3GLHB 3X1XA 5C46F 1CRQA 4MH0R 4U7DA 5A4JA 3EPKA 3QY0A 1ELOA 2F1RA 1XTKA 1GOTA 3OZXA 2WMOB 3CR8A 5AJVB 3PQCA 4G5RA 1US8A 1RZ3A 1ANKA 5CYOA 2ORWA 2JJ1A 1DAKA 1Q1EA 4EUNA 3EIQA 1OLOA 3TJZA 1G291 2Z0MA 3KX2A 1OH6A 3T61A 1G20E 5B64A 4OYHA 3BERA 4LJ6A 1E2KA 4B3CA 1XNJA 2AN9A 3L0IB 4WBSA 3SQWA 5JWOA 1EFHA 3CLVA 3W8NA 4EPYA 1IJEA 3IHLA 2B7CA 3PV0A 2ZYUX 3WRYC 2ODWA 1COWD 2OV2A 5JSZA 1KJZA 5FL7D 3KDSE 2ZJOA 1MT0A 3DKVA 2XB2A 2BOVA 5FI0B 4OHYA 2D7DA 1D9XA 4Q9HA 3IGFA 4RZ3A 3GLFE 4LHYA 2OHFA 3IUYA 4I1SA 2DB3A 4C0QC 1E9RA 4O2RA 3GLGA 2QPTA 1E79A 3QXHA 5J4LA 3TBKA 4HUTA 2G1JA 3SYNA 4EFMA 1KO4A 3C7KA 1OHHD 1Q3TA 1S9HA 3D6TB 1F2UA 2ZRPA 2JLYA 1X1SA 3NTUA 1XFAA 4M0LA 1GZSA 2OBMA 2YZ2A 4GZMA 1N6IA 1SKYB 3OFNA 2GBLA 3TVDA 1NSTA 2R9VA 1GNRA 4KXFB 1JXMA 4XH9B 3V4RA 1R5NA 1T5LA 2QY9A 2J59A 4D4KA 1CEEA 2JIZD 5KYKA 2RGCA 4YDHB 5FPKA 3DO6A 5L3QB 4Z54A 3LW8A 3W3AA 4XWOA 4LY6A 4B2LA 3AUYA 1DAMA 2WSSD 1F48A 2ZEJA 3PCRB 1M6NA 2CLDX 4G0NA 2LCFA 1BMFA 1ZIOA 2GJSA 1UM8A 3CRMA 3SI7A 2ZR9A 4JVMA 3U3MA 3W9YA 1WE2A 3KQLA 4GOJA 1KDPA 3CUEF 2O8CA 1XX6A 1A4RA 3IIJA 2YV5A 4JT4A 1U0JA 4NP6A 1DAHA 2K5UA 3QXJA 2QQ0A 2J7KA 4E5UA 4B48A 1L4UA 3P32A 2IK8A 3P1JA 3UWKA 2VIIA 1XD2B 4Q18A 5BN3A 1UDXA 1TPZA 3ETLA 5H8WA 4NCKA 2PMDA 1XPUA 2VP5A 1B23P 2WWHA 2GEDA 2OCAA 4IW3B 5SZKB 3TIFA 2MSEB 2ONKA 1P60A 2GJ8A 1ZUNB 3VR3A 4BZQA 3WHKA 2R6FA 1VYUA 4LJ9A 3RS7A 1XMVA 4QM7A 4RFVA 4PC7A 2Z6VA 3AVOA 2GCNA 3OAAA 3LDAA 3IHWA 2ZJBA 3K0SA 2ZJ8A 3U5ZB 1Z0JA 4UNRA 1N5JA 1ZMXA 2FZLA 3L8YA 4MRVA 2HT6A 3C4JA 1L2TA 2C77A 3DZDA 1HYQA 5GJVC 1XTJA 1KSHA 4HLUA 5KPDA 1FX0A 3RWMB 3CZPA 3KQUA 4RD3A 3U7EB 3D31A 5CJ2A 2GAAA 4R2HA 1UF9A 3CNOA 2OO7A 2PMKA 1HY3A 1I4LD 2I4IA 4AKEA 2J87A 2WPDD 1GSIA 2ZSBA 3LH5A 3BH6A 2REOA 1R7RA 1OYWA 5AWFC 1N0WA 2CHQA 4U00A 1QG2A 2W0SA 2A7QA 2H16A 2EFDB 3EIEA 1E96A 1MKYA 1WA5A 2IXFA 4DB4A 2R62A 1PZNA 1HA3A 3WXMA 4BUJA 2IYQA 3JVVA 3I1FA 4Q4AB 2A78A 3Q85A 5TARA 2RB4A 2IC5A 4GOKA 4TLAA 1P61B 4JLKA 1HV8A 4LPSA 4E07A 4L8GA 4C2TA 2QNRA 2ERXA 1H65A 5EE0A 4NH0A 3GLIA 3GP8A 1DBSA 4ASUD 1WMSA 1G5RA 4ZIRB 3BFKA 3RLFA 1ZJ6A 1KK3A 1S96A 2ZI4A 4QHYA 1EXMA 2EWVA 2QM8A 3TLXA 3W5JA 5AJWA 2ZYTX 3HPQA 1GILA 3TUIC 2CL6X 4D80A 4CYMA 4F4JA 1U90A 3NHAA 2GAOA 1OB2A 3IPYA 2FPMA 3AF0A 1N6RA 2XOKD 1KK2A 2RMKA 3R8CA 2BC9A 1IHUA 1FP6A 1JB1A 1RE0A 1ZNZA 4A2PA 2LKDA 1NP6A 3MAAC 5TXGA 4MYTA 2ATXA 1F3OA 1CLUA 3GJ3A 3QKUA 1ZUHA 1XEXA 3I32A 5KTYA 3VR1A 1KI3A 4PHGA 3KB1A 2AFHE 2DR3A 4NONA 2CHGA 2CBZA 2DYKA 1QHHA 2IYUA 4DSUA 5AUNB 2OT3B 2H5EA 3D7MA 1VHTA 3Q9LA 4PFSA 1Q22A 5LD2C 2IEZA 4IEEA 4IVQA 4PHFA 1ZNWA 4EPTA 4KV9A 3C41J 1G4AE 2B6HA 5BYJA 3HU3A 1GRNA 4Q01A 2ZUDA 4H9GA 1BOFA 5KNDA 1E1RD 1HTWA 2QT1A 3AF1A 3PUWA 3ND8A 4UXIA 4EQ6B 3U6KA 1ZM3A 3V4FA 3OE7D 1S0UA 5G3ZA 3THXA 1UEJA 2I3BA 1D2MA 2J0VA 3QBVA 2A5JA 4B73A 5J4HA 4HB0A 2C9YA 2XXAA 2ZM5A 3GD7A 2DWQA 4TLCA 5AUOB 4PZZA 1CP2A 2QP9X 2AR7A 5GJWC 1WCV1 4MA4A 1W36B 4DUGA 2FN4A 2GEVA 2ERYA 3CX6A 2MSDB 4F4IA 3RHFA 1GDDA 1T3SA 3SHFA 1CJVC 4QJ4A 1G3MA 4A2WA 5K8IA 4UQOA 4PPFA 1G8YA 1X8LA 3U3RA 4RKEA 4URUR 1C4OA 2V4ZA 2CE2X 1ZUIA 2ZR0A 3GEHA 1G64A 1Z2CA 3NKVA 4DZZA 2F43A 3UMFA 5FH9A 5IK2A 1EESA 3OESA 2ZJAA 2TMKA 4QXAA 2ZJ2A 1GVNB 3SZRA 2EVWX 2QBYA 1G9XA 3PUZA 5FUVA 4A0RA 1NBMA 1QHGA 5CM8B 2GETA 4URVR 1I4TD 3TSZA 2JLWA 1P72A 1DAEA 5KSZA 1RRPA 1ZAKA 1W44A 2PZGA 2OAP1 3W8RA 4V0ME 4E09A 1NN0A 2ZSFA 4CEJA 1Z0IA 2IYRA 4HLUC 2JJ2A 4GRAA 3HR7A 2BM1A 1MOZA 4M1MA 3KXKA 4G5OA 4LRWA 3TAHA 3R8FA 1OXSC 4NDZA 4B76A 3GLHA 1OT3A 1SVLA 3KKOA 1EX6A 5UKDA 4YMTA 3Q7PA 4EFNA 3UKDA 4BPBA 1OPXA 4MDEA 4QC2A 2BMEA 1PLJA 4A0GA 1E2IA 4D82A 1Z6YA 3QF4B 4Q03A 1DAGA 3FPAA 2IT1A 1S1MA 5B58C 5EE5B 4Q1FA 4PZYA 3BOSA 1DO2A 2GZDA 1RVDA 5C2JB 3LD9A 1MABA 4ESVA 2GZAA 2VL7A 5EJEA 3WP1B 4A82A 4DBLC 2GNOA 2ASEA 1ONBA 5CJPA 3NC0C 4RVCA 1D2EA 1MRSA 2O0HA 1MO3A 3EC1A 4HB2A 4Q19A 1Z0AA 2OXCA 1ZD1A 4DEYA 5K8LA 3HU1A 4LJ7A 5G53C 1YVDA 1JI0A 2GXSA 2G6BA 1D6JA 4OK5A 3CF6R 5E4FA 1CR0A 3ZLJA 3FB4A 2JLZA 4M9QA 4AI6A 3EPLA 2HEIA 1E0SA 4B74A 1YZUA 1E2PA 1EGAA 4UXHA 1IONA 5DI9A 4XOIA 3PG5A 4MKGA 4Q9IA 2QSYA 4HDOB 1AM4D 1P9RA 4LGMA 3QKRA 2QROA 3O8CA 3KB2A 4DSNA 5CB6A 4PC6A 1NI3A 3ZIAD 5IF9A 4Q5IA 1U9IA 1UBFA 1N6HA 1HURA 3HJNA 1PLKA 2F6RA 2FFAA 2YWHA 5CIWA 3U3KA 1N6NA 3K8YA 3BBPA 2H57A 1F2UB 2W58A 4DSTA 1D9ZA 3GJ7A 2VA8A 2ZS9A 1CR1A 1P62B 3OEEA 4OK3A 4M1YA 3LO5A 5SZIA 2CJWB 3B1YA 4LC0A 4XTCS 4B32A 3OF5A 5FUYA 2BIFA 3AVWA 2IYLD 2FG5A 2YJTD 3KFVA 1GP2A 2PLFA 2VH5R 3MWJA 1P9NA 4DCNA 1G8PA 2VHCA 1K5GA 2VQSA 4L5BA 3ADKA 1SXJE 2VSOA 2V3CC 4PQFA 4AYXA 2YWGA 1XTSA 3K70B 5HE8A 5KO2A 1O3YA 4ABYA 1ZVQA 2BMFA 2MMGA 2LKCA 2A9KA 2NTYC 1XTIA 2O8CB 3NH9A 4B3XA 3SYLA 4ITRC 5AK0A 3F8TA 1EFUA 3QENA 2FJUA 1W47A 4XD7D 1SGWA 2GJAA 4NBSA 2W6ID 4QG7A 3T1QA 1ESNA 1XMSA 3I5XA 4FMCB 2EYUA 3QI2A 4LJ5A 2VO1A 1SULA 3TMKA 4NCNA 2QMHA 3W6PA 1NG9A 1N6OA 2C95A 4KYIB 2IUSA 3C15C 4KSBA 2Q3HA 2VLIA 2FPLA 3CX7A 4TMTA 3T1TA 3A4LA 3C5HA 4IRUB 3X1YA 3LQRA 4PPQA 3IBYA 5H68A 2IUTA 2Q9BA 1VMAA 3P27A 4OQXA 1DS6A 1RW4A 3VR5A 4IOLA 2OZEA 5FR1A 5A0FA 4KFRA 2EWWA 4TT3D 2H1LA 4DRZA 4JLAA 3IBGA 2KBEA 4GOXA 5JI3E 3IEUA 1XEWY 1FZQA 3ADCA 4LJ4A 3N70A 2XX3A 1QDEA 3RDPA 4URYR 4YXWD 1RC8A 4URXR 2WWWA 3IQWA 2GXQA 1OXVA 1KAOA 3RWOA 1TMKA 1HH4A 4P33A 4JLNA 3EXAA 4D2IA 5ELXA 2ATVA 1RKBA 4FCVA 4V0LA 3EWAA 2FH5B 3HDTA 2WIBA 2IS6A 1X1RA 1Z28A 4A6XA 721PA 5CIQA 4UNPA 1NMYA 3KKPA 2H92A 5JI2E 2IW3A 2FZ4A 2WMNB 1K8RA 1MO4A 4Q47A 3TNFA 1L4YA 3QUSA 2BKUA 3QKTA 2CLCX 3MWYW 1OIVA 3FKQA 4P31A 1IY0A 4RFSA 4A8JA 4S2EA 4GMDA 1XEFA
chains in the Genus database with same CATH superfamily
2KB0A 4N5LA 3WXBA 1Q6ZA 2AQ8A 3V4PB 2OESA 3TTUA 2CGEA 3USES 3RI3A 3SR0A 1SQSA 4UPVA 2R7AA 2WDPA 3U7RA 4XARA 5HBRA 5B53A 3VC1A 1OZHA 1HT2E 2D3TA 2O8FA 3AF2A 3IAFA 5AHOA 2QPAA 4DG9A 4B3RB 3B38A 4RGBA 3S0JA 1X2BA 2WSYB 3OCYA 3FOFC 3CRNA 3C6QA 1ZNQO 4QTXA 4W9NC 4NEGA 3VZPA 4E7OA 5BYAA 5DH9A 5JD4A 1Z0DA 3IPXA 2PX6A 1E9EA 3BD9A 4KQJA 1U2RA 5B3AA 3U13A 5HK8A 3GNTA 3NIBA 1G5PA 2QXUA 4JU9A 4ARAA 5LL6P 1U7OA 2V65A 8GPBA 1RCUA 5EEHA 2ID9A 5L3RA 3D7SA 2PANA 1W4CA 2C1EA 5DTJA 1JILA 4L8LA 3QXXA 1V26A 2IZOA 1V71A 1Z8FA 2C1XA 3OQBA 4ZQEA 1SVOA 3RWBA 2FF7A 1JVNA 3QQ5A 1U9IC 4DLLA 2HCJB 1DBWA 4OJKA 2WWVD 3VKWA 2X77A 4II2A 5LKRA 4AVYA 3L7YA 3RS2A 1NGSA 2GRAA 5FI5A 1XEXB 3B1ZA 4Z49A 4Q39A 2R68A 2NUTA 5BSFA 4WSOA 3H83A 3HPRA 3MJCA 1BVRA 4E14A 2ZUUA 2O3RA 2QTVB 3GP5A 2FSGA 1D8AA 3QPDA 4J16C 2VPWA 1Y37A 3OJCA 1YHNA 1G8FA 3PUYA 3IMFA 4HWRA 4WMLA 1B6SA 2I2BA 2NU8B 4BNMA 1S3IA 4MCHA 1P0QA 4BCBA 4KLNA 1VCMA 2VJNA 3U3JA 5J2TB 3DV2A 2Z6QA 3KJEA 3RBAA 1U94A 4R5MA 1G9TA 5CEFA 2I6FA 4RH3A 3UMCA 3P0HA 5B3JA 1M2HA 4MLCA 4YRTA 1FDIA 2B30A 2GZRA 2O8DA 1VBKA 4JQOA 5TE9A 4MAAA 1P7VA 2XVMA 3OIFA 4YRKA 3ZCUA 4BY9E 4BDSA 5GQSA 4IUYA 4H7KA 3L46A 4AX8A 2AE2A 1Z8DA 3WHPA 2YMMA 4KV7A 3GLFA 2IWHA 2H3HA 1Y8QA 3C6YA 2QV7A 1USGA 3NFYA 4ARBA 4KQIA 3ON5A 1YQXA 1EBFA 1JPNA 1PSDA 2HMSA 3LRTA 2FUG1 1Z0KA 1IWOA 2DSTA 4Z4QA 2VHYA 2ENUA 4ENWA 2BFEB 1AV7A 2WTMA 4GGMX 5BXQC 5K6TA 2SNIE 2FOXA 1ADYA 2I91A 3M83A 4N0PA 4YUVA 4HVCA 1XJQA 4JBWA 1FQOA 1JSZA 5LYYA 3SZ3A 2J7PA 3KJQA 2GQ0A 4GGOA 4TL6A 1T8YA 1AZLA 1M7GA 2FWRA 2YFQA 4BMOB 4ERNA 1EK1A 2WIGA 2HSZA 3GDHA 4N3CA 2HIAA 3UG7A 3P96A 3FOWA 4UHDA 3RYFB 1O95A 1M0WA 2HBRA 2ZQZA 3I04A 5JASA 2J3DA 4CDGA 1DJLA 3V4OA 5EJGA 1A4XA 4JB8A 1YE5A 3OZUA 3TZHA 2PE5A 1IZ9A 1FYVA 4KPFC 5BY2A 1XVIA 4RV5A 4TYQA 2M98A 1KVQA 1KY3A 4F6LA 1RXYA 3PQ3A 1O77A 4IOJA 1XRMA 2YWJA 5JZSA 2HUPA 4X63A 1KERA 2VBGA 1WJGA 4MUFA 2GKSA 2QMOA 2PH5A 3ZXSA 5HZMA 2C4WA 1QIHA 1RJDA 1ZH6A 2HK7A 3HY6A 2ZSJA 4YRDA 1E79D 3UHOA 1EWTA 4GKBA 4DWWA 5BR7A 1RWKA 1VL2A 3H4VA 5TPZA 3NIWA 4US2R 2GCOA 4HQLA 5CCXA 1QYCA 1AKNA 4DANA 2WAMA 1L7BA 2HA2A 4KE9A 2YMPA 4P7FA 3V00A 2YW9A 3U7GA 1EIWA 1AN9A 5AK3A 1V37A 3ABSB 3E7WA 1I2ZA 3QF4A 4HUQB 4D9FA 4DPLA 3AYXB 1IOZA 1XZGA 1YDHA 1YMQA 2B6NA 2QE7A 1YS6A 1EK0A 2WD7B 3AIKA 1Q7TA 2YV2A 3ETJA 2X7XA 4J1QA 2WHRA 5E6RA 1G66A 4UJ3A 3ZI4A 1Q1QA 4Q9JA 1K8ZB 3ZI7A 4L8YA 2ZYIA 1QYRA 3D9QX 3KYBA 4G5QA 4HI0E 4WADA 2E4XA 2Z8XA 1YS4A 1Y7PA 1OC2A 1W9HA 3CT6A 1BKSB 1WZCA 4HJRA 3EY4A 4XQEA 3O83A 2ZRFA 1V35A 1UWLA 1M33A 2ROQA 3D0KA 1S2DA 3FN4A 1M73E 1UEIA 4EJSB 1EFPA 1GZ4A 5GP1A 1TYEB 3CF4G 4DR6B 4ZXPA 3UWDA 3NDBB 1MABB 1VIYA 2HDOA 1E2EA 1BMFD 1E5QA 1NVFA 2J45A 3DHWC 3Q72A 4PX9A 4BTEA 1VIAA 4RM3A 3AW9A 2EC5A 2E1PA 2VSXA 3AJ9A 1ND6A 4U6SA 1BFDA 1QBKC 4GW3A 4Y6PA 5LDDC 1V9CA 2JIRA 1WKBA 1EBBA 1LBHA 2JLBA 1NUHA 2NXCA 4HSEA 2VWGA 4MRAA 4TQGA 4YFVA 3U1VA 3VBCA 3VUFA 4D3ZA 5LQKA 2G1PA 1TI7A 2Q7DA 1B76A 3M4ZA 3UGJA 1BE6A 3K2EA 1QFXA 4GX0A 3JALB 1KMNA 1PT6A 1FXWA 2P6MA 3OZRA 3T3HA 1R4NB 5BSWA 2QSZA 3IE0A 1XMQB 5J40A 3EQZA 16PKA 3IIKA 4JZKA 5E2IA 4GQIA 3HFSA 4AT1A 1D7AA 4B83A 5KB3A 1DX4A 3SS7X 5LP6B 1FIUA 1CKEA 4HB3A 3GFOA 2I03A 1T3HA 3SFVA 1UMBB 3WHLA 5AVRA 4ZD6A 1Y1QA 3BZBA 1IZYA 1E2FA 2AEEA 3UV7A 4Q05A 2CL0X 2NN3C 2P27A 1O7JA 3KYCB 2J6CA 1KVUA 5EOVA 2C98A 4C7OA 4QU8A 4YP1A 1ZXBA 2DQZA 3QKRB 4C20A 4FFLA 1QZUA 1VJ0A 1T0UA 3IFSA 3NJ8A 2P11A 3DHVA 5J59A 5T3YA 4BAZA 4M88A 3F8WA 1FNMA 4OA8A 2HCRA 4M2LA 1UANA 2X23A 5JD3A 5I9NA 1OI7A 1EIZA 1U7HA 3NLLA 1M75A 1QU2A 4L6IA 5DIFA 4QLBA 2V7BA 2VWQA 2JA1A 4L5CA 3ECAA 3K94A 1IQPA 3QUCA 1E7SA 1G2PA 4RCYA 1C8VB 4Q3KA 3KQKA 5EFOA 3GRYA 3UPUA 2PQ6A 4PRKA 2OCYC 4QGBA 1MJGM 2HIGA 3HB5X 3M33A 1LU9A 1ZMRA 1Z34A 3FFBA 4I4IA 1F8GA 1P74A 1T5HX 1UK9A 4R41A 3L7MA 3KSMA 5COBA 1Y1LA 4GX1A 4X20A 1ZZEA 1ISHA 3L0SA 1V2GA 1B3RA 3V48A 2WWFA 2Q28A 4CT5A 5CFOA 2EW8A 4KMMA 3VR4D 1O5OA 1VZ2A 5HK9A 3CY6A 3WIUA 4EABA 4FB4A 3B5JA 1R00A 5IT5A 1W36C 1G60A 4MWBA 4EI8A 5CAEB 5A4JA 5C1PA 5HCIA 4WK4B 1L7PA 1TC1A 3KXIA 2WG1A 4RQBA 4KREA 4CQMA 1CUXA 2VYFA 4E94A 3QNMA 3KWFA 3O47A 5CT4A 2ZVJA 2VTBA 3VKVA 2XYHA 2BFCB 3UTDA 3A31A 2HMTA 5JNRA 2P6RA 5ALRA 3O8BA 1XWIA 1Q0UA 1SCKA 1Z45A 3A37A 3FGOA 1E99A 4RWZA 4XZ3A 2AK3A 4JSYA 4UZSA 1J0DA 1Y8RA 4BKQA 3AUAA 3SBXA 2IX3A 3K6SB 2I5PO 1N34B 4AZSA 3JARB 1UK8A 1H2YA 2QX9A 5JJBA 3VR6A 3JAKA 2ARKA 1PAUA 1YVUA 3KVRA 2WJJA 4C4RA 2NZJA 1PQPA 1G21E 1NQ5A 2XAUA 1NMZA 3E8MA 4EEZA 1JU3A 1JAHA 3H2SA 1LH0A 1RS0A 1ZVJA 3V1NA 3TAUA 3ZJ4A 2C97A 3GJ0A 2XDQA 4L9SA 4FYVA 1JTVA 4DV5B 4N48A 4M0EA 2XZLA 3LI2A 4FJ1A 1VRCA 4TGLA 3PUJA 1PG2A 1YZ3A 3L8HA 1EQ2A 5TMPA 3KSAC 1FDVA 3HXKA 4RD1A 2VTEA 3HYRA 3JZFA 4M1EA 3T9EA 1R15A 2A5YB 4INOA 4PRZA 4BRSA 3ER6A 3Q3IA 5HS4A 1Y82A 2WKPA 4GLFA 4TV8A 2ZE6A 3JYLA 2OQVA 4B44A 2ZQ5A 3GA0A 4OHCA 3WQRA 2C8KA 1JG6A 1N5LA 2QTZA 4TTAA 4UAUA 3STHA 1U8EA 1TMYA 1TPYA 1D07A 1IHDA 1U31A 1YJXA 3K0FB 2EYQA 5KNDH 2YMLA 4B6QA 1VJTA 2X5OA 1U02A 4XVUA 4JX8A 1SPBS 3TRHA 4K9OA 1FDOA 1JH8A 2EKZA 5BW8A 3UHAA 4ILKA 2O2SA 4CLOB 4BE9A 1CETA 2IEDA 2JFGA 5EERA 3OHMA 4Z4EA 1G3QA 1HUQA 2AOUA 1ZN9A 2YNMC 1CY1A 1PTJA 4PBRA 3L1HA 1SD2A 2PFGA 4XPIA 1F2VA 1EDZA 3MOIA 4OIMA 1VL0A 1CV2A 1JJFA 2IY7A 3GUCA 4JYCA 4IXNA 4FJ2A 1E5XA 1KBZA 2BISA 4PTYA 6LDHA 2H29A 4Q1EA 2HI0A 4DLPA 3WK9A 3LSTA 1OXMA 1V6AA 4O59O 5EC8A 3ABQB 3I4LA 2XPCA 1UCFA 4RHXA 3JQFA 3R3WA 3BD8A 4NY1A 4OHPA 5DTRA 1IQRA 5CITA 1TQ8A 3PE4A 1I3MA 4WKBA 1I8TA 1ZD2P 4I6GA 5TGTA 3OT1A 1HYGA 1PDOA 4HNRA 1FFYA 3U9SA 1RJFA 4Z9YA 3THRA 5KZMB 4WE3A 1JDUA 4IHQA 1DC3A 2HJRA 2YXLA 4K6HA 5B2ZA 4LJLA 1ABBA 4R8VA 2R97A 1J9GA 1UXGA 2Q8NA 5IAGA 3ZVLA 1VCIA 4EX6A 1KTVA 1Z4LA 2IYPA 1ZUD1 2GRUA 4EY5A 2ZYWX 1XN4A 3RAPR 1NVWQ 3RS8A 3RFVA 4ZICA 2AR0A 3UUFA 4RTMA 1QH1A 4OQNA 3RF7A 4BV9A 4Z51A 4ICIA 4ZRMA 3RK0A 2XQFA 3HFGA 5GAJA 3CVXA 1U5AA 1XCJA 4TL7A 4KK3A 4CKXA 4EENA 3X2EA 2GTIA 5TB5A 5K4HA 3EZ9A 2AJTA 2QTTA 3LNTA 4EVQA 1LLCA 6AT1A 4HL6A 1JHAA 4PFQA 4RIEA 2BBWA 1V9LA 4AJEA 3E82A 1MPTA 3SN6A 2YOFA 4C3OB 4F2HA 2BZSA 4ZVTA 3BJRA 5C52B 1XZCA 4F6RA 1JA0A 2G28A 2VK4A 3CN9A 1DHRA 4Z9AA 2GBLC 4W5JA 5I4BA 2EGUA 5IZ4A 3PITA 1ZA2A 1L3BA 2BM0A 2WUEA 1TUEA 3HKEB 1CFJA 1Y34E 2QUAA 1JDZA 4TQUS 1UK7A 1Y89A 1L4HA 3K9GA 3TQRA 2V55B 3EXHB 4ZMRA 4B3TB 1WP4A 1YQGA 4WXHA 3NUZA 2OLEA 5J2TA 2YVLA 1F0YA 2BTOA 1SKQA 2H18A 2V5AA 3HEBA 3PQ5A 5CH8A 1QM5A 4OHXA 3V8BA 5I7FA 2NOAA 3K16A 1G4UR 1G20B 3Q9SA 4IDOA 3ZEIA 4IS2A 4NONA 3RKSA 2R3SA 1AHNA 3LPAA 3HNRA 4NV3A 3S5UA 4EZBA 3U4QA 3V55A 2EKPA 2EX1A 2G63A 3MLBA 3MYYA 4V3CA 3IOCA 3DGFC 4TV9A 1B3BA 2XBLA 1K08A 1PJQA 2AB0A 2P68A 3FUVA 1NW9B 2I4MA 3R20A 1DPFA 2JLUA 4ZMBA 5G4KA 1WNTA 1Q0QA 2QMYA 1H4TA 2Y0EA 4DLUA 1YK0A 4FI3C 4R7ZA 5AHWA 5GV8A 4R01A 1P4SA 2IU0A 4FNGA 4BASA 3F96A 4DA4A 1AK2A 1CUSA 3AJAA 2EJVA 2Q0SA 2Z3WA 1FMJA 4RE6A 4MXDA 3VX4A 4A03A 3HCAA 3MWDA 2I1LA 2QQGA 4MW2A 4PSUA 4QJ3A 3SF0A 5BYKA 4L07A 4CETA 1GZ6A 4RF2A 4M22A 2CNWA 3G2NA 1J22A 3I9MA 3WJ7A 3NT4A 4ZOCA 3O9MA 1AQLA 2GKOA 1W88B 2A30A 3K0HA 4Z99A 2OXEA 3QFFA 2BH2A 1EX7A 1D0SA 4BCCA 4YACA 1YR7A 1X7GA 2FMFA 3CXUA 4X71A 4NC9A 1Y8CA 3HCCA 4I5FA 1D8TA 2YJ4A 4OBEA 1GU7A 4Q9LA 4NBVA 5TT0A 4CI9A 5KAPA 1XAHA 1P4AA 3KHSA 4C1BA 2QTFA 1JNYA 1NUQA 1ZYUA 3BKWA 2ATEA 3M89A 4BVFA 2UAGA 2V7EA 3I9KA 4CVNA 2D5CA 1YTUA 5T8KA 1FW6A 4I4LA 3FKJA 2W42A 2V5VA 3DA8A 2IUUA 4ER3A 1HYEA 3LFUA 2VJPA 1UKYA 4HYYA 1BH2A 4UUNA 2D54A 4J0JA 4AM8A 4QTYA 1C30A 3BE8A 1TDJA 2G1UA 5TGDA 3MUOA 1A8QA 1CDOA 3BZWA 2QR2A 4HUQA 4G23A 4RK6A 3BMQB 2H7XA 2WV7A 5DRTA 2JF0A 4BFVA 3Q7EA 4CUZA 3ADDA 4IV8A 1ADJA 4DBLE 4JT9A 4JA2A 1Z63A 2O1SA 2RKOA 1IDN1 2D00A 3QMPA 1KYQA 4XFKA 1SQ6A 2P62A 3GLIE 4D96A 4KJXA 2HYIC 4PZPA 4P92A 4P4UA 2JCXA 2FWMX 2QN8A 3OX4A 1W6UA 4NBWA 3R23A 1M83A 4JGIA 3SXJA 5IPFA 7MDHA 1SXHA 2XYQA 3A1TA 3EQ7A 1H2ZA 2BUCA 2PR2A 2XJ9A 2YV3A 3T06B 4EJSA 1IZZA 2YDYA 1Q95A 2XI4A 3DDHA 3OP1A 5JQGF 1ZK3A 3A05A 4MYRA 4S1NA 1KE1A 4ZWNA 3RYHB 3UXHA 4IEIA 4N7MA 3INRA 3W34A 2XXJA 4G9GA 2A9RA 1OIXA 4ZQIA 5T4HA 3EXIB 3CLTD 2JKVA 1H0RA 3JATB 3A1FA 4XM2A 3AJDA 1FFEA 1QGUB 1JT9A 4E4YA 2WIKA 4PHCA 4ZHQB 3B1XA 4NOJA 4RIFA 3OQIB 1HO3A 1AGRA 5LZ5A 3FMGA 4JLUA 5H3LA 3RTDA 3ZCVA 2QLJA 4ZEMA 4FS3A 4BNWA 4CLRB 3D3WA 4QYTA 1H2WA 4DF3A 3VNUA 5DBOA 4NVRA 4CMAA 4CEIB 4U39A 1P3DA 5FUWA 1WMDA 1U0LA 3E70C 3VGPA 4B40A 4F9TA 5FLXA 2C2MA 5LP6A 3BTUA 5H0IA 4L5IA 2XIJA 3FOZA 4HDRB 5TEVA 4FMBB 4PHHA 1FQJA 3OCCA 4K9SA 4S35A 4E3ZA 4MP8A 1GFZA 3TW4A 4FHCA 4F3TA 1YBFA 2P9ZA 3V3KA 5EJ4A 5HQ3B 1BXRA 3BFPA 1JE0A 2IDZA 2HD4A 2PVCA 4OI4A 4DNFA 4YQFA 1JJAA 5KTMA 3P20A 2D74A 2WFZA 4MRMB 5BV1A 3JD2A 2QN9A 1DC8A 1LPSA 4KZPA 4NPHA 3W1VA 2G5TA 4EA8A 2OO3A 1XVAA 4OHUA 1NXOA 1OBFO 2W6CX 2DZDA 2ZBQA 5LMNB 4NBTA 3PLRA 5ALKA 4TSRA 4TWIA 3SXUA 4RJLA 2XTNA 2QAJA 2C5FA 1PCXA 2ASVA 4DR5B 1WZ2A 1NYLA 4MARA 4DSZA 1WVGA 5ALWA 1DAIA 2XNDA 1U6JA 3O92A 1QPGA 2QKYA 1FRQA 1D5CA 3GRUA 1J7JA 1EPUA 2DY0A 2JGFA 1YFJA 2H4HA 4BB6A 2CD9A 2GVZC 1EWKA 2TRSB 3SQOA 1E32A 1SIOA 1M2NA 4B6FA 2CXHA 2QT0A 4ALKA 3DE2X 1NRJB 4M37A 4XQ0A 2WKQA 3SJZA 3R3UA 4JJ7A 2QMQA 4R0NA 1PQ4A 5HQJA 4RJ2A 4BC1A 3C6MA 3C85A 4RAQA 4BNFA 5FDFA 4OGKA 2C9BA 3N28A 3R41A 5FI1B 1DQRA 221PA 2XNKA 1J0EA 5BNFA 2BFCA 1M66A 4H4DA 3BGIA 4KP7A 4Q3OA 2WA2A 3DUFA 3ES9A 1SC6A 3LQKA 4H7FA 3UIEA 3A9SA 4A0FA 1NQUA 1F8XA 3UC9A 1FDTA 1Z29A 4X8MA 2N47A 4RPIA 3TAXA 4JELA 2QLTA 3HR8A 3SDSA 3WMGA 5D86A 4U9HS 4AY6A 2KWIA 4ZODA 2FF5A 2OGSA 4HXYA 3BB3A 4ZANA 1JZSA 2Z4SA 3E2MA 3F2IA 2PZFA 4OIFA 4XJXA 1HDXA 3RT7A 2CMFA 1YZGA 4LOKA 4LYJA 4FPXA 4YUYA 4YIHA 1RXWA 5EXPA 1L1RA 2V98A 1QHXA 2IW1A 1G8MA 1UPBA 1X7DA 4OI2A 5IASA 4QUHA 1SU4A 2AFHB 2CE7A 1MXHA 3NBAA 5JR3A 3VSBA 2Q4BA 1P2SA 3DE5X 4DV3B 1EM6A 1JF8A 2CXOA 1U2ZA 3DOFA 3LLUA 4ENSA 1X87A 4QHTA 2H4YA 3IP6A 3OOYA 1T2EA 1NX9A 4F5YA 2YVKA 1RQXA 3OHSX 2J1LA 2H1RA 4PAGA 5D84A 3I6ZA 3OLWA 3X2FA 4TM7A 2BGNA 1KQFA 1GPYA 5HKOA 2E1RA 4RZQA 5JCPA 4KR7A 3U4IA 3K0FA 2FPRA 5CCBA 2Z95A 4MITA 5DXAA 4CMGA 3JPWA 1NV9A 1A96A 2RAFA 5ETJA 5PGMA 3W6OA 1CR2A 3BS4A 1IBLB 1LW6E 4DV6B 2GA8A 4PWZA 4BNZA 3JU3A 3LJKA 4D9KA 4CLOA 1QU3A 4MQ5A 1EVLA 1MC1A 3SEFA 4YRAA 2G4VA 1H2AS 2II6A 3WKEA 3W5AA 2BYTA 4WOPA 3R9XA 2FETA 4BFUA 3Q41A 4UVIA 3BCRA 2I3DA 3H4IA 1L7QA 2JIPA 4TZ6A 3FNGA 3PUHA 3WZLA 3PEUA 4OL0A 3AEUB 1E3EA 3OOJA 2FEAA 2EAUA 2B35A 3G9ZA 4PX2A 3V8QA 4K28A 3RBXA 4KFCA 1P1KA 1PW5A 1LJUA 4CCSA 3CRVA 4LJ8A 5IYZF 3T1OA 2FZKA 3IUSA 4JROA 2CDNA 1QNFA 3RSOA 5CX1B 4BQNA 4G2TA 5D3MB 4FMPA 2FPIA 4B9EA 3ZDBA 3EZ2A 2RGUA 2M6KA 2ZRNA 4C30A 1GG2A 1A4IA 4GZLA 4UBIA 2R8BA 4RHYA 4OJQA 4BNHA 4CDNA 2BTQB 2PXAA 4EI9A 1MOSA 3SQXA 1TU4A 3O4JA 4AWBA 3FPBA 1JQEA 1Y5RA 2BFWA 4EPVA 4FDVA 2QEQA 1T5OA 4OAOA 5BWOA 4N0DA 5EHQA 4KH1A 2DVMA 4UNIA 5F35A 3T3GA 2JGIA 1L7VC 1WZUA 3NXSA 4UFPA 4Z0HO 2DY1A 1C4KA 1FEZA 1E1YA 1X80B 1ISFA 1AS0A 1R18A 2QTMA 2ZWIA 3ZE1B 4RVFA 1PBTA 1J0AA 4GMHA 4J4BA 2GYVA 4FKBA 4B4VA 2OORC 1JR6A 1L7AA 2CCJA 1U8ZA 5HKKA 5CBKA 3PYXA 3JYQA 4EW1A 2EEZA 2C20A 2IYYA 3GLUA 3CSSA 4JBLA 2JANA 1KTIA 4WXRA 5JAZA 3L84A 2E6KA 4KMSA 1WRBA 4GPIB 4HAIA 4FYIA 1MBZA 3FXAA 4FYKA 4IQFA 5BSRA 1E0KA 4YFYA 3WK6A 1P5JA 1WCIB 2C83A 3WWZA 3BSFA 3FOCA 1XPRA 5IVKA 1MX5A 4R71A 1THZA 3PKJA 3HCPA 3HKEA 5IRCD 3AO0B 1W5BA 4HZUB 3B9PA 4YRJA 2J3QA 2YIVX 1LRJA 2QUHA 3VHXA 2E0IA 1WXGA 1U0NA 4JDUA 1YD7A 4X60A 1W46A 1W5TA 2DPMA 3WDLA 5DX8A 4P0PB 3G2JA 4YUZA 2VAXA 5I48A 3GJZA 1G20A 5JW6A 1W76A 1GAJA 2TMGA 1IZ7A 2ZS8A 2OFOA 3UK0A 1PJ8A 3AR6A 3HUUA 4DSOA 2QUBA 1MHTA 1F12A 5C4IA 3P45A 4B0OA 4QQNA 1QK4A 3NTLA 4FFBB 3R09A 4MV6A 5K0EA 2PLWA 4QHSA 4GLBA 2YS6A 4FEYA 1YKGA 2XWJI 2QY6A 3RBVA 3IE1A 3LK6A 1FYWA 2CDBA 1F8FA 2D4HA 2HLDD 2ZYAA 3I42A 3QVKA 2GZSA 2EBHX 3GR6A 4UE3S 2HXYA 3CLSD 4AYTA 5JZOA 1FY2A 1H4VB 2C7BA 3HP7A 4BJHB 2C0QA 2O4CA 1N2BA 3H8VA 2ZSDA 3L1UA 3ROZA 1Y4ZA 1DXHA 2QN2A 4Q4HB 4YRQA 2V74B 3PT9A 1EWQA 3RCBA 3FGZA 4KPYA 3RTEA 2FX3A 5JNUA 3UGQA 2PRYA 3SSAA 7YASA 1WW8A 2F3SA 1B1AA 2GA9A 2NVWA 4PZCA 4TTRA 3TKLA 2M6LA 1TAGA 1TECE 4P7JA 3V4VB 3RFCA 2IH2A 1TJPB 2G1AA 4PAQA 2HGZA 2F3RA 2P7IA 3QELA 2UVPA 3H99A 4CCWA 1P0MA 2WIDA 3IEIA 1UOOA 1H66A 1MD9A 1X8XA 3C3EA 2AC7A 4OU4A 4FBGA 4I9FA 2JNWA 5DM0A 4ZMSA 2IXDA 1DDOA 3HMKA 3SNKA 5F3DA 4F04A 1J8YF 3IBSA 4PRYA 1TE2A 2IYTA 4E13A 1NOKA 3CEAA 4YJ3B 4GFDA 4PG6A 1OC4A 4COOA 5H83A 4BQPA 1UJ2A 4DIEA 4OQDA 2I2XB 4GSYA 4F4FA 2VNAA 5BSTA 2F9MA 1OA1A 3GA5A 2JDID 4UM5A 5CA1F 2KSQA 2QZ9A 2F3TA 4QM6A 1Q5PA 2AJLI 5HVNA 1E8DA 2QRLA 1SIUA 1VKJA 4FYWA 1G6Q1 3GFRA 1YIOA 2J3MA 3C3CA 3PHBE 3FDIA 3T35A 2QNBA 2AN3A 3ZK9A 1CZKA 1Z4KA 2CNDA 3PR2B 3D7KA 3QWAA 1J39A 5J2UF 3DEYX 4XSGA 1DO0A 2NTEA 2VHWA 1L5GB 3TZQA 1C9NA 1ETUA 4WJZA 1SB9A 1VQ1A 3UJ8A 1OAOA 3GLSA 2FZ5A 3KBBA 4P82A 1P2TA 4FNOA 4W7SA 2QG6A 3HN6A 5EP3A 5FBZA 1CIVA 3I6IA 2FEMA 2ZRLA 1DHTA 2EBFX 3WOVA 3V6MA 1G0NA 1C4WA 2BFFB 2JATA 3PGXA 4MVJD 4ZAXA 1DBRA 4OXIA 1IY9A 4EYQA 9LDBA 3QTTA 1NR5A 3DZHA 4NCIA 3TR5A 2FWIA 3WYBA 3HBMA 5CXUA 4A8JC 1PSZA 4BNDA 2WHPA 1HT3A 3DO5A 2XMCA 5KWSA 4H1TA 2PUBA 3D54D 2MJLA 1N9ZA 2JH3A 4ZHQA 5FWNA 3L0PA 1YV9A 1V96A 3FKSD 3OQIA 4ZARA 3W3ZB 2EGHA 1XLWA 3FB1A 1PS0A 3CA8A 1IH8A 1ID1A 4CLRA 4EYOA 3RS0A 2RHCA 4OJNA 4CEIA 1PVOA 1TM2A 1X19A 1Z6AA 2WINI 3E0XA 1DAOA 3AZQA 5K09A 1RRFA 3BMOB 4HDRA 4HQNA 2FHSA 1NZDA 5ILOA 3NETA 3EOAI 1Q0ZA 1SRQA 2ES4A 4QYMA 2DLDA 2QTGA 1U9JA 1KS2A 2BZ0A 1Z08A 1V2HE 1ZHFA 1ZIPA 2VEDA 3GEPA 3NDPA 3QG1A 4KKXB 4BMCA 5HQ3A 4EMSA 3LLVA 4BMZA 1CRPA 4MRMA 2NU9B 4D8UA 1S3SA 2R47A 1PD1A 1XALA 4ZEVA 1KBOA 1VLQA 3RG2A 5MF6A 2Y92A 4ZAVA 2ZS7A 4TTIA 1E1QD 5B6PA 3OA0A 4K3UA 3ZTYA 3GYBA 4X1YA 1DAPA 2B1JA 3FSGA 3OQVA 4HQ0A 4BNLA 3FE2A 4ESHA 5LMZA 1KYXA 3H2BA 2V4MA 4WERA 2AMYA 4BP9A 1DAFA 2XTZA 3HDJA 5DNAA 4CMKA 1VDMA 2ZITA 3TL6A 1XDZA 4KQHA 2OXIA 1QGOA 4TUYF 2NT3A 3FCEA 2ODTX 4FFNA 2OBNA 4LKOA 4P4LA 3VAAA 4LHXA 3A11A 1IEVA 4JP5A 3KQMA 4LISA 1JHZA 2OG1A 4DQUA 5DBGA 1W0CA 3RG8A 4EA7A 3SZLA 2BFMA 1TCCA 2H85A 3U4DA 1P19A 4NYJR 2VOEA 4BNTA 4Z4IA 4HRYA 3V2IA 3MF4A 1QSGA 3GRCA 2EHJA 1JR4A 1QC5B 1FP2A 2ZRJA 5CDGA 1L1QA 1PT8A 3C8UA 2OCXA 4K40A 4IIBA 3OCWA 2HQRA 5M3BA 5BUQA 2PX3A 3AUFA 4JBNA 3W5DA 1FFWA 5K3CA 2RGXA 2CUNA 1SKBA 5A62A 2H11A 3B82A 2QA5A 3EUEA 4QE3A 2X7JA 4D98A 1AXRA 4I14A 4PS1A 4M1SA 4CG1A 2C29D 2DSNA 1TT5B 4I1RA 5KINB 1CUZA 2GJ9A 1XVLA 4MUGA 5HJEA 1OTHA 2AA3A 2RHLA 4Y2QA 4CGZA 4BLTA 1IN7A 2FLKA 4KO1S 5F1YA 3DAHA 4G0OA 1E5TA 2Z5FA 3ZYZA 5JIBA 1AIPA 2CHEA 3M34A 2IGBA 2DT8A 3ZE0B 5MN5A 1WKVA 3EDQA 3LC1O 3ELUA 1F4PA 3OEHD 3NBXX 3TTWA 3ZZUA 1WABA 5IFKA 3T0IA 2J0UB 1U2EA 4BEWA 3I05A 4ZALA 1UMCB 3A26A 3IXLA 1O95C 3WO1A 1Y7IA 2WB2A 1I5EA 1UWKA 2PX4A 3FFTA 5DNEA 1BQEA 4BAUA 1ARZA 3K4HA 1GFIA 1IBMB 2BE7A 3NHWA 3R9KA 3FTFA 2DERA 3OX1A 1UAYA 4XWTA 3RS4A 2QHXA 5C7LO 2O8BB 1CR4A 2QUZA 5SV2A 4RD2A 1SU8A 3AESA 3TWOA 5CEJA 2A9JA 3KL4A 1OHHA 2WT4A 3ZJ5A 1Y3IA 4LE1A 3NMUF 1CDEA 1Z6TA 1G18A 3K0BA 4OQYA 1BS9A 2FR1A 3NTXA 4NCHA 3ZNOA 5IULC 3DP9A 3Q8WA 3IP7A 4NOMA 4QGHA 5CDFA 4GNRA 1NY5A 2ISQA 4ZI7B 3DLTA 4DQVA 1DQZA 1XP8A 3NB0A 4R3UC 5CLGA 4G5FA 2WYIA 5JC8A 3RUDA 1GUDA 3BAFA 4NG5A 1TMOA 5IX8A 4BGDA 2J9XB 2VPQA 1KO7A 2JIZA 3KHTA 4J0QA 5CLFA 4NU0A 3B85A 3UB4A 3FHLA 1BS1A 1UZAA 3GG2A 2QVZX 2JBAA 5AW8A 1BHO1 2WM9B 4ZOLF 5CX1A 2OVBA 3W4KA 3FPGA 1XNHA 3FCCA 5E0KB 3LLMA 2GX6A 4BN0A 3DDWA 3H5OA 3LQ2A 3WV5A 3ZHRA 2FXVA 2XDYA 1JDTA 2XUAA 1ECCA 2ACKA 3COYA 2CF6A 4JI3B 1U7DA 1EJ6A 4GPD1 4EUKA 2JZNA 3RNLA 1V11B 2ZRHA 2RI0A 2DU8A 2FJPA 2PUVA 3WL6A 2ECFA 1TKRA 2C3OA 2JH8A 3F2VA 4U7GA 1RPTA 3TO5A 3WGGA 4PCAA 4K26A 3Q9NA 2WIJA 1YCDA 5KSWB 1XYGA 2HA0A 2PLRA 2CC2A 4TRMA 4WCFA 1IVYA 1XXHB 4HNGA 1Z0UA 1E60A 3HA3A 4PLCA 2XEDA 4K9PA 1E2HA 2H2GA 2R8XA 4BGEA 2O2HA 1P8AA 4ZP1A 2ZUEA 4DIOA 3PXUA 4JLJA 3U3ZA 3UH1A 1PR5A 1DC5A 1W87A 4LCBA 4QXPA 3ICVA 5B1IA 4DLVA 2ONZA 4J9VA 1LF5A 1USVA 3EEYA 1JLLA 4XDYA 3T5BA 1YRYE 4XRRA 3SZMA 3ZU4A 2J9FB 3WNVA 5D51S 2GVDC 2ZBEA 4EHHA 2ZB3A 1GY8A 1MP0A 3JWIA 3KEFA 2PCJA 4NH4A 4HZUA 2DBYA 3L2OB 2H5LA 4LNUB 3SM3A 2G8LA 2HOQA 2OCKA 1UFOA 2ZXEA 4G1EB 3QG5A 4B3BA 5JRDS 3PHLA 2J85A 3WLIA 2JGEA 2X3YA 1SUAA 3FGNA 4ZT5A 3ID6C 4D0GA 3DM9B 4DDVA 4DWJA 3HFJA 1NU6A 2FGJA 3MQ4A 4TT8A 5A4DA 1CZUA 1GRQA 3OOHA 4EG8A 4ZVRA 4DABA 4R05A 3X43A 4B3DA 1RRMA 3GEDA 4L4ZA 3IKMB 3J80A 4JOCA 2BD0A 1TCBA 5CB4B 3P4YA 1GQFA 1LQTA 3BEOA 2NZ8A 2DWPA 4FFBA 5JZVA 4M49A 3DUWA 2HRRA 1ULSA 2WT9A 4J90A 5GGYA 2HJSA 3B1FA 2LTAA 3CXRA 3NWOA 2ZW9A 5BMOA 4NBUA 1KYIA 3R2JA 4E5DA 1CG6A 1QIEA 3EK2A 5CM2Z 1U0OC 2GF2A 2XWBF 1L5OA 3M6WA 4Q4LA 4V2UA 5ERGB 1LC0A 3EBLA 4NJOA 4BHTA 1IY2A 3DJFA 4OHRA 3A2KA 1MC4A 4GC9A 1ACLA 1R0YA 4XGQA 5HJ7A 5BN1A 4G5HA 4L7VA 4HAVA 2B1RA 1P31A 1DG3A 3I09A 3CPHA 4GPTA 3ITNA 5AM4A 2CVQA 4TQ9A 5IAAA 3EGOA 4BWVA 3H1PA 3OCJA 4RNDB 2O2DA 5IBRA 1ZW6A 1O96A 2B92A 3R3XA 3S5JA 2PT7A 1H9BA 1RM5A 2BFPA 2DTXA 5BRJA 2G71A 4IDNA 4EA6A 2OGZA 4U0JA 2DHCA 1HG1A 2I65A 2A6PA 1R64A 3SE7A 1AVTA 2QX7A 3L7OA 3IC5A 1CW2B 3E7PA 3I01M 2PJUA 1QG0A 4KQGA 1L5NA 3S1AB 1YXMA 4AKTA 6PFKA 3B8EA 5EJ6A 4OX9B 1KKMA 3VDNB 4UMVA 3GFBA 4YAGA 2DUJA 5L8VA 4F45A 2AYYA 2QJFA 3BTOA 4ER5A 2IPAB 4QTTB 5KNBD 3VJMA 4L4XA 4GL2A 3LPCA 4MRRA 1QCZA 2FNAA 4LZNA 3AI3A 5AXBA 3W7BA 4CM8A 2ZRAA 5JQGA 2NO1A 3G9QA 2P8JA 3PYLA 1WVIA 2YXEA 1Q44A 3EZ7A 1DEKA 4MYCA 3FSJX 3L7CA 4RXTA 4MR8B 3UENA 1B7GO 1DT5A 1SZCA 2DT5A 4TM8A 1H8HD 1HL7A 2OFPA 3W06A 1HGXA 1RJ9B 1H2RS 4IOMA 3KPJA 1PR1A 3UT5B 2O2IA 3E4DA 4R1MA 1FTGA 1POWA 1XLUA 1ZIXA 2JEZA 2V45A 1OILA 1D1SA 3VZDA 4WKGA 3UC5A 5C8VA 1Z8HA 4YK7A 3KV1A 3AHDA 2CK3D 4FGUA 2IV3A 1YR9A 4HPWA 3SDZA 3VAYA 1DFGA 2QUIA 2WYUA 5H9VA 4Z2AA 3D02A 1SELA 4C88A 2XE8A 2PSJA 2OAEA 3DFKA 4G8CA 4HEHA 4PSAA 3ISVA 3N59A 1HEUA 5FBVB 4PGGA 5EJ8A 4FOOA 4L5AA 1P45A 1J7KA 1E64A 2YX1A 3UWOA 1NUAA 3HCWA 2HK6A 1Y1TA 3OZWA 1SVMA 2NX2A 3LY7A 3LGXA 3GUUA 2BR4A 2AH5A 2BFBA 4FMDB 1EZ4A 5IBQA 5ENZA 2GEJA