1KONA

Crystal structure of e.coli yebc
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
244
structure length
233
Chain Sequence
b'GHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLDANPRLRAAVDKALSNNMTRDTLNRAIARGANMETIIYEGYGPGGTAIMIECLSDNRNRTVAEVRHAFSKCGGNLGTDGSVAYLFSKKGVISFEKGDEDTIMEAALEAGAEDVVTYDDGAIDVYTAWEEMGKVRDALEAAGLKADSAEVSMIPSTKADMDAETAPKLMRLIDMLEDCDDVQEVYHNGEISDEVAATL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein yebC
publication title UNPUBLISHED
rcsb
source organism Escherichia coli
molecule tags Unknown function
total genus 63
structure length 233
sequence length 244
ec nomenclature
pdb deposition date 2001-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01709 Transcrip_reg Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1konA01
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1konA02
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1konA03
3HPGA 1WJEA 1K6YA 3HPHA 4F3QA 1LFPA 1WJDA 3F9KA 1MW7A 1WJFA 1WJBA 1KONA 1E0EA 1WJCA 1WJAA
chains in the Genus database with same CATH superfamily
1KVJA 3CUOA 1D1BA 1JLGB 1MH4A 5A8WA 3J80K 3HHHA 3IKVA 1EF4A 4U95A 3R6LB 4X62J 3J7ZI 3DLJA 2X6WA 2ZD1A 4DV1J 4BEHB 4XLFA 1BWEA 4X4VA 2KHMA 4XL9A 3ETOA 3KZZA 1F9EB 2Y0SN 3NKYA 4JI0F 3C46A 2DA2A 4MQVA 1NLKL 4NX9A 3I9ZA 2CW7A 2FX0A 1U47A 4JI8J 1RTIA 2RH3A 1O5JA 2XI2A 3VAFA 2MQ8A 4P2XA 3GU0A 3S1TA 1KBRA 5F8MA 2VKEA 4KFBB 1EKEA 3KK1B 3RAQA 4OWRB 1X7VA 5E2QA 1I5ZA 1G3TA 2ZH3A 1RAHB 2ZHOA 3K4NA 2F4VF 1TZ0A 3AJDA 1JLEB 1F9HA 4LG0B 1W0UA 2M34A 4P2FA 2Z5UA 5E41A 2ZXHA 5AE3A 4ECUA 2HHUA 1KD1T 2GW8A 4P6QA 1FERA 3NGRA 1ZGJA 1QNTA 2MC4A 4B3RF 1R00A 1JLCA 2DFHA 1X2MA 4NUBA 2XYGB 2Z2YB 4BYYA 4PCQA 4NCGB 5J2MB 5LMNJ 1WG4A 2DIUA 4M63A 2MQMA 3FCHA 4EK2A 2M2EA 2WBMA 1LK7A 3OSGA 2R8HA 3EGVA 3TJAA 2UV1A 4KIFA 4PYAA 4FYXB 2KHCA 4DBRA 5KFCA 4U7BA 8AT1B 4CNYA 4LK0F 3M2RB 5H9EK 3CLQA 2UXDJ 3JTGA 2ZJQQ 3I5UA 2V4JC 5DO2A 4PUOB 1V55H 3DRSA 1AFIA 1UMJA 1HQ2A 1DTTA 1ZA2B 2AW0A 2GO8A 4DV5J 3HT3A 4F3OA 3MR3A 3DYAB 1L3VA 3M6XA 3TMOA 5HQ8A 4WTOB 1Z6RA 2ME0A 2YPRA 3LAMA 2F4MB 4DV6J 3PHTA 4DQSA 4PQUB 4USHA 4IH5A 4B3OB 2HKEA 4C7QA 2KL4A 3Q5FA 3RPUA 1QAIA 3ECHA 3K5MA 2GMJA 5C7PA 1CF7A 2Y0SD 1RCXB 4ZVHA 2QYOA 2CUZA 3G8TA 1UCNA 4XAKA 1T0TV 3FC9A 1JMTA 2DTJA 2VKRA 4KBIA 3MM9B 5M5YJ 1GLNA 1G8XA 1YKWA 3A1YG 2YX1A 2PD1A 2MJNA 2GCFA 3TUZC 1WCMJ 2V6CA 1Y5IB 3ILLA 3V7CA 4ZPAA 2JZ5A 2VFRA 1NH8A 2VQFF 2PX9A 2AT1B 4EJUA 1GH8A 3PW5A 3H25A 3RBEA 2RGVA 2DNRA 2RB7A 1TTYA 4JX4A 1JJ4A 1U6GA 3LL7A 2XG8A 3MM7A 3AJ1A 2A5YB 2FNAA 2QF7A 3SQOP 2MLXA 5JHFA 4MK9A 4ZMMA 2H1KA 2KDZA 1WC3A 4LUBA 3I55S 2JSCA 2WA0A 1EETB 2DQLA 3OFGA 1OCRH 2R7QA 3HHLC 2DK8A 4NC7A 5K5RA 2H54B 3JRIA 3WE3A 2W9BB 3CT9A 5ICCA 4ZYAA 3WTVC 2GHWA 5C42B 4PWUA 3DFEA 4F7ZA 4AC0A 4K5RA 4DX8H 1MIJA 4C2UA 2V8GA 2VFTA 3OR1A 1G6NA 1SAXA 1ZQ3P 3A8EA 3AAWB 3OBIA 2VKHA 1GT0C 5KK1A 5BR8J 3QYEA 1NK0A 3PV8A 3AL0C 2D1HA 5EX0A 1Y0HA 2OJ3A 4E7SA 3DI6B 4LF5F 2B9YA 3G71S 2FJAB 3IL2A 4JI1F 5M5XJ 1V4RA 2YNIA 1VQKS 4O0IA 2VUMJ 5IC4B 2CNKB 1YI2I 5F64A 4MTEA 2H51B 2R7SA 4ELUA 3OMYA 4P74A 1R0AA 1VGYA 2HRUA 2RKHA 1RWOB 1P27B 4NLUA 4QIVA 3EGZA 3DRPB 3IR5B 4HF2A 3RQ4A 1Z1ZA 2Y3YA 4X4RA 4IHSA 4UY85 1JGSA 3VYTB 3I4NJ 3FHNA 3G4SS 2PT0A 2ZH8A 2Y0SA 4M9SA 2DTRA 1WJEA 4BQAA 1S10A 2XUBA 2JTVA 3K9TA 1AOYA 3CUQC 4LSNA 4W1UA 4JOUA 4NDLA 4KRWA 2QLBB 1HKTA 1D8ZA 4ABZA 3GTQJ 3HOVJ 3JSBA 4P1WA 5L38A 4HX8A 1ZRFA 2D1CA 3T41A 3OL4A 1O7FA 3ZR8X 2BXYA 1FFGB 2ZE2B 1D5YA 2DMTA 3WHCA 5K5OA 3PM1A 4BDYA 1WF0A 1T03B 2DA4A 3BGUA 1NK5A 2KDOA 2MBFA 2QL7B 2VB6A 2Y1LB 2AX0A 3L00A 4BHBA 4D3HA 1CQNA 3ZTOA 1N54B 3OR2A 1WHVA 1JUMA 4BACA 4UXNA 4RU9A 2LF8A 1JKPC 3TEGA 2XHKA 1HBMB 3TI0A 2NRAC 6FD1A 3C2PA 3ZZPA 4HNTA 2AJ1A 2HI3A 3J7AY 4XN3A 4RW4B 3HM5A 5MAOA 1ZAOA 3C15B 2MGQA 4ZVSB 4G3IA 1JT0A 4ZP6A 4ZYEA 3L9FA 3OSFA 4BXXJ 2GC8A 3B4DA 4P9FA 4LFAJ 1FDAA 1RLDA 1YJRA 3MEEB 2ROGA 1Q95G 4TQRA 5BMZA 4OIOF 1QU3A 2E5JA 2ISYA 2COMA 4L5IA 2KVIA 2KH9A 1H9GA 2YR2A 3MXHP 5KAFC 3GG0A 4CGZA 4ZDNA 1K9MT 4LF6F 3MTJA 1Z3XA 4DFJA 2AP6A 1UP1A 3GSDA 1LWCB 3DOLB 3P45B 2POKA 2QT7A 1S0NA 2BR0A 3RYRA 3X2QH 3DEUA 5CLSA 2VOOA 1TL1B 3ULHA 1NPKA 1REVA 1SVOA 4YMEA 2H94A 1CC7A 4JYAJ 4Y3CA 3BDDA 4KGKA 2CJBA 5CD4H 3DHXA 2ZJRQ 4CTAB 2JN6A 4WCEQ 3BN4A 2TCTA 1IN5A 4RUCA 1XDSA 1WNEA 2HOSA 4ZP7A 4DL2A 3NEUA 4MKBA 4JI6F 1GXLA 5A8RA 2CW0F 3CB4A 1R1VA 3CDIA 2ASJA 5JI6A 3PEHA 2ZBCA 1MWZA 1JKOC 3RKYA 4IXAA 2VUGA 1ZRCA 3LP0B 3SFZA 2IYGA 5BYRA 2ZB9A 1HQUB 1WRJA 3TGNA 4ENOA 1G1XA 1URNA 1T0FA 4E7IA 2X7IA 1MLAA 1O8BA 1ZA1B 4I6ZA 1MSWD 2M8GX 1P6TA 4KN4X 2DDAA 1Z2ZA 1ZAVA 2YNHA 1FY7A 3T5XA 2DR6A 1XBWA 3E3XA 3FCVA 4DS5A 4A8SA 3OYMA 5C25A 4I2QA 1BC6A 2X0LA 5B1BH 3KG0A 4YB1P 4F0HA 2DDBA 3IH2A 4XPEA 3HSGA 1UCRA 2ELJA 4M3GA 3TOAA 4F7VA 5CCMA 4LBPA 1B4SA 2P5KA 1SVLA 2RUSA 4ZVFA 1YZ7A 4NA3A 3M05A 3D1QA 3WTSC 3AQOA 1OFCX 3LFUA 1O6XA 1UVIA 3J81Y 8RUCA 3L7UA 4JV0A 5EF6A 5KG7A 1I51B 1OY8A 1RKJA 4XLPF 1WDDA 2OPQA 5EG0A 3GCWP 5KFYA 4PPZA 2B5JB 1WSUA 5DDGA 4ZITA 1LWFA 2CMPA 1X60A 4A6EA 5A2QK 2XEXA 2L9VA 2JPBA 4MK7A 3O3KA 2EINH 4GDFA 4YS2A 4AXJA 1UKUA 3HHEA 3HSZA 4RPFA 3CCVI 3LF0A 3EETA 5A2QU 1RBLA 4LSLB 2CQCA 3KLEB 4B9VA 2VJ5A 2EI5A 2MD0A 4X65J 3BYPA 4IG0A 4IOAQ 2A69F 5E8IA 4L9JA 1N0UA 4C3IJ 1VQYA 5IP6A 4FZVA 2GOMA 1HBUB 3OL6A 2X85A 2AYEA 1X4OA 1F3FA 3JSYA 4G1PA 1FRMA 4RAGA 1U5TA 2XY7A 4A3BJ 4YIIA 1K47A 2BDPA 2DNNA 1FEHA 2OO4A 1PUEE 4D3GA 5I3PA 3NWTA 3GLLA 1WHWA 3PJXA 5LHHA 1NK3P 1KYWA 4C97A 4N7TA 1JLGA 3H9GA 2NCKL 1H9TA 3TNVA 2WV0A 4OI1A 3HSDA 1VQ4I 2E1RA 4PQAA 4XIDA 3BPVA 3D6HB 4BEHA 1FWLA 3RRGA 3DTIA 2DT6A 2JH3A 2GAGC 4USVA 3RW7A 4TY9A 5J1RA 4U8VA 5F04A 3PCOB 4X66J 2QRRA 4NE9C 4TXSA 3T1YJ 4DPYA 1JIHA 1USTA 1KGSA 2MSSA 3RKWA 2FEZA 4E6KG 2IBOA 1TT0A 2Y9YA 4HBLA 4HX7A 4XDDA 3KK1A 3FGVA 3BTJA 4FDFA 1HD0A 4M6VA 5DM6F 1Q78A 2ZNYA 3LA3A 3E1SA 2FJVA 3W60A 5AJ3F 2K85A 1JLEA 4LG0A 1FDNA 3QGGA 4RDUA 2ZCWA 2ZBKA 1IN7A 4KIBA 1NHUA 3G2XA 1MH3A 1EKSA 2VDIA 1YHQS 3F8BA 2DIVA 1J75A 4CWBA 3BSCA 3T6BA 1RHJB 4AVZA 1I1SA 4NCGA 1YJ9I 5I42B 5IS2A 1WJAA 4I0BA 1SXLA 1UETA 2B0LA 3THVA 2IA2A 4DW6A 2E1CA 3GJTB 2FJEB 3RB0A 4QW8A 3J7Z5 4CCMA 2XF5A 2WVBA 4QWDA 3P5JA 2UXBJ 1W2BR 2W2QP 1R5ID 5J2NA 4OFZA 4OZ3A 1P4WA 1X58A 2ZXJA 3DOMA 3CO7C 1UHWA 2Z99A 1FJLA 3SFIA 1IKWA 3G3ZA 2IVYA 3M2RA 3ZMVA 2HEOA 4P73A 1JJ8C 4Q5SF 4IR9A 5KG3A 1N5TA 1RT1B 1FYLA 3BZCA 3Q23A 4DS4A 1EKRA 1Z3YA 1RWNB 1S9EB 3DYAA 4Y0FA 1RTJB 3MCMA 2DLLA 2FPHX 2HGMA 4PQUA 3T9NA 2H8RA 2BA9A 3ZQHA 2KFZA 1IV6A 2YS9A 4LK1F 5KFEA 1S7OA 2IHR1 3QU3A 5KFZA 1RYSA 1KONA 3ABTA 2XCAA 1QSLA 1C0TA 3ESWB 4PG6A 1VQMI 4DSEA 3MM9A 3R60A 4J9OA 1WPKA 4UHTA 3RB3A 3ZZTA 2JX2A 2ZUGA 3CCJI 4YN3B 1AT1B 3EUNA 1RHKB 3CCUI 3Q8PB 3IRXB 4OHWA 2YU3A 1SH0A 3BR9A 1FNOA 3CMAS 2O1PA 5DV5A 1KS2A 2QKLB 3VHQA 2MQOA 2C3UA 4F50A 3E01B 5M5WJ 2GBYA 2EG2A 3HOUJ 1WZ2A 4URQU 3TO9A 2M30A 2MKIA 2KIFA 2HQ3A 2DT5A 5C2CA 3LNQA 4OV1A 2XZWA 2HVRA 2BY1A 2STTA 2JEIA 4RUAA 4TVAB 2M9KA 4GVBA 3D28A 1EETA 5KFKA 4M71A 1B8IB 1MMLA 3S8SA 1G3SA 2KRBA 4A3FJ 3R1HA 1OCPA 1U1OA 2LQ8A 2Z2SB 1ZYQA 1ZH5A 2RQ4A 1R58A 2W9BA 4K4XA 3CCQI 5KOXA 2VG6A 1SUQB 2XM3A 1QLNA 3MCNA 1IXCA 3PRDA 5DETA 2XIGA 5C42A 1ZKGA 1G4CA 3ONQA 1U6FA 2XLJA 3GSIA 2M4GA 2K9LA 2B4PA 4CLLA 3GBGA 1H6KX 3O2PE 4QOTA 3KXDA 1BBYA 2A68F 4Y4RA 3OTBA 3ROUA 3KHLA 2HQDA 3BO3A 2M7BA 3A01B 3OJSA 1WWXA 2GHPA 1QAXA 3O1LA 4AE5A 3N79A 4RW6B 4YIRX 5DRKA 1O0PA 2DD8S 2VDHA 2WY8Q 2BHYA 2CQXA 1U0JA 3BTIA 3DI6A 3QJPA 1MU2A 5HMYA 3JS9A 1SVDA 1TFWA 2HHTA 2YKMB 4DN0A 1U1MA 4A3JJ 2A6OA 1SQGA 4YB7A 4PJLA 2ASLA 3GW2A 2I1RA 5E18F 4TY8B 1SV5A 1G59A 1G6BA 3JRCA 4WFBQ 3QZ8A 4ALZA 1WC1A 2WB1N 2BOLA 3R2DJ 3THTA 1NTCA 4ZCLA 4FASD 4IJAA 3UCUP 3DOKB 1IQZA 2GIVA 4NASA 3QPSA 2P0WA 2MY7A 2V7FA 4MFEA 2C6YA 1WH5A 4KISA 3KJQB 3HSJA 1HNVA 4IHVA 4I6YA 3PFIA 1ACIA 2BOAA 2ZOFA 1BR2A 4I09A 5D6EA 1ZTTA 5GADJ 2QL9B 1IAWA 2HYJA 3VR1A 2AGPA 4B47A 2DNQA 1ZTWA 1KTVA 3R7BB 1FBUA 2KVQE 2WAQN 1ELOA 4KPYA 3LA2A 5LEKA 4HDUA 2X6XA 3CDWA 3NS7B 4I6AA 2NUHA 1WORA 2PI4A 5D0GA 4LFCF 2ASDA 3PIPQ 3PIOQ 2EFGA 1B72B 3KETA 2XAUA 1SC7A 5F9LA 1QPMA 1Q86T 1Y6IA 2MZTA 2KFNA 1WG1A 5M2UA 2N7YA 3T1HF 1JB0C 2JSPA 4YB5A 3OTOF 1B0TA 3QQAA 3D66A 3DLGB 4CCLA 3N97A 2KI2A 1CGPA 3CF5Q 3K58A 1VTNC 1Y4ZB 2ISZA 4K2JA 4DGWB 3BCAA 3SSQA 3VWSA 4FYDA 3K4MA 2NXNB 3C15A 2UVWA 2KMUA 1F1ZA 1YJUA 3A3OB 2HHHF 5HL7Q 2ZSHB 2BKPA 5B0AA 3DDNA 2O3FA 4YG2F 2XQCA 3MEEA 2V6AA 1OCOH 4LBIA 1MWQA 1FWPA 3UDVA 1UJ5A 3BJYA 1S6QA 4FF2A 3MMCA 1RA6A 4F4KA 9ANTA 2VPWB 3G6YA 3MDFA 3FQLA 2IAJB 3HJVA 3GLJA 2L9WA 1MMDA 3WZ0A 1F3VA 1UFMA 1QE1B 3S2WA 1MMSA 2DXEA 2KT5A 1NSKL 2P7CB 2F65A 5CD4A 1OCZH 3G8SA 1YQHA 3HO1A 1NJWA 1R6RA 3VODA 2IJNA 4ILMA 3BR6A 3U1KA 1RT3B 4Q7AA 2CQ3A 2VASA 1IBCB 4RL1A 4KA4A 3HDSA 2DN0A 4JQFA 4ZHRA 3NL0A 4OYAA 2Q6CA 3M7GA 4KV8B 2BEOA 4KY3A 2XBPA 3JSRA 3W7BA 2JA6J 2PFFB 3NP5A 3TO7A 2R8KA 1QBJA 2R4GA 5EHHA 4BU2A 3JREA 1B4AA 3BPXA 2BW3A 4IVNA 3N4WA 1R5HA 2XHCA 1UJ8A 4KITB 1W5TA 1JUSA 1TQPA 4GGGA 3TW6A 1S49A 3C2HA 3LSTA 2O7OA 1TL4A 5IT9K 1HFEL 4LFBJ 5FLMJ 1T9VA 2LU1A 2CQPA 3FKJA 3T8TA 3JW4A 4XMYA 2IGKA 4K2EA 1RR8C 5IT9U 1HBXG 3H2UB 2L02A 4RGRA 3TUPA 2H3EB 2RD5C 3VGTA 1N33F 1Z91A 3GIIA 3GTKJ 2PLYA 1OQ3A 5EZGA 3C6TA 5LSOA 2RQCA 2YQ3A 4BQQA 2QCOA 2J0QD 4NBQA 2LXFA 3I82A 1I94F 3H42A 3GFHA 2JSXA 1FJGJ 2KYZA 3N6NA 1YRNA 3EICA 4DSFA 2AQFA 2LP0A 2AMCB 3TVYA 5K20B 1OQYA 2WZ1A 2XS7A 1U1PA 4BXUA 4CLKA 3ILIA 2EFOA 3QLHB 1G2EA 2PI5A 1WEXA 2IGOA 1JLBA 4RA2A 4HPQA 3IFEA 4LSLA 2FDNA 2J5AA 4OYPA 1PO6A 3AB4B 5H9FJ 3K70C 2BANB 2ZJ2A 3NCQA 4WP9A 1TMJA 4HG2A 2KB2A 1M5OC 1YRTA 1BIBA 3OV7A 4KIAA 3QMQA 4II3A 4CO0A 3M8SA 3NAIA 2HVIA 4TV7A 1VYAA 4UQTA 2OTLS 3AODA 3D54A 3ABKH 2PIIA 5JVGQ 2JOQA 2FQ3A 4G12A 1NSPA 4YFUA 3J81K 1IN0A 1UJ4A 2OUGA 2WWYA 4C2MA 1FKAF 4RX6A 4FKYA 3GV8B 3M6VA 2F9DA 2BZ2A 3QT6A 2NVUB 1MWYA 4L73A 5D8KB 1XC9A 1QAJA 3HDDA 3U02A 5EDNA 2B51A 3BR5A 2QQ9A 4ZPCA 4EU0A 4EGLA 2GIFA 4YR2A 1LFBA 1TR0A 3A3NB 1YRUA 2C2ZB 4Q47A 1YITS 3I56S 2CPHA 4DV7J 2M45A 1IR1A 4DR1F 4PG8A 4RS8A 3M8FA 3DRRA 1EP4B 1JI8A 1T02A 2KT0A 2OZUA 3JTNA 2OQRA 2R2UA 1FJEB 2B7CB 3MWMA 2WY7Q 2CJ9A 2B9EA 2A18A 5HP1B 1DTQB 2KIMA 1GX5A 1T9YA 2XULA 3V6HA 1FT8A 2R7UA 2MKKA 4M5DB 1WOPA 4C3MA 1AA7A 3PO2J 5F8GA 3L7WA 4Q0BA 2PMZN 2ILZA 1GMWD 5I42A 3NNAA 3FZVA 4CSWA 2D45A 1WKKA 3H8YA 2DA3A 3JSPA 5ETLA 1ETQA 2OZ6A 2ZJQF 1DP3A 5EEAA 2R7DA 1X4PA 3BBCA 1MZBA 4DL3A 3K2ZA 4DR4F 5EX3A 4X64J 5DCMB 2L7FP 3EMTA 2O03A 3QPLA 1J5EF 2YX4A 3G86A 4DYRA 1H3DA 3GCXP 1WHUA 1V9OA 3NOGA 3R2CJ 2Q66A 2Z0GA 3BM7A 3PQJA 1K1QA 2XNQA 1TL3A 1RT1A 3LAPA 1OY9A 2HQNA 2PBIA 1QY7A 2XS2A 4QR0A 1HNXJ 2FB0A 4XR6A 1HYSB 2NYHA 5B0BA 1S7AA 2XGEA 3HCXA 4Q2LA 1KZHA 4QIEA 2B9XA 2ZFWA 2XGPA 4B9MA 4OYXA 4EVIA 1MN7A 3RZDJ 1QZEA 5C4XJ 1E3HA 2DGVA 2K9SA 1XNRF 4KMFA 3DCFA 4ZZDA 5GMEA 5JVHQ 3HVWA 3FXLA 3U21A 3QYYA 4WE1A 5CZXA 2XAGA 1I3QJ 4IR1A 1XMKA 4ZJZA 4FYYB 3QAHA 4B17A 2ROPA 2UXCJ 1V5GA 4A3GJ 2BE5F 2OELA 3IRXA 3TP2A 4TU7A 4EUVA 3F22A 2D7SA 2ZM6J 3PTWA 5T7LB 3WE2A 1FD8A 2MTLA 2DEIA 3E01A 4XNFA 3J7AN 3CJ8A 1X0PA 5LBQA 3S16J 2BBEA 3B6BA 3CMYA 4NRTA 3IWZA 1M1EB 2WVFA 3H2LA 1VFJA 1YW7A 1WJBA 1D5VA 2NZCA 1ZM9A 3NXZA 5AONA 3QGIA 6AT1B 3B4MA 1S1XB 2WV1A 1WGXA 4ZCIA 4V2FA 1J09A 4ETXA 2G9WA 2H1YA 1FRIA 2JHEA 3W5XA 3W3SA 4CZCA 3IHUA 1UFWA 3FCWA 4WXHA 4ED5A 4V19K 1Y10A 3ZQIA 1YS6A 4LT6A 1H2TZ 3BGOP 2YPZA 1S12A 1GMWA 2EKNA 1DLOA 4MTDA 1X4AA 5HN0A 1GVDA 2Y48A 2MZSA 3CC7I 1MD0A 4OMZA 4RAFA 5LLQA 1N78A 1VQ6I 4QJVA 3HJEA 4AU7A 3FUYA 3GV7B 1XPXA 5E33A 1S1VB 1BMQB 4RW6A 3ASNH 1S3JA 2UV8A 4C8OA 2UUCF 1DHMA 3H5UA 1EB0A 3K0JA 2B3TB 4I7FB 4MJKA 5MLCV 3U1MA 4LLLA 2CVEA 4BWJA 5J2PB 2V9WA 2YKMA 3GIRA 1TKTB 1QVTA 3ZTPA 3QZ7A 4XONA 4DSIA 1P1LA 3Q22A 2Y31A 2K27A 2IVFB 4RNOA 3O8GA 2F48A 3KEQA 1Z67A 2K86A 4OX9F 2XMTA 3TAMA 2ECBA 3UWTA 1ZHFA 2CADA 4G1QB 1W0TA 5CABA 3F0NA 2MKCA 3E51A 4UV8A 1NPPA 4LREA 2DA1A 3UNGC 3FFIB 4W98A 1N4LA 3FQKA 3M7VA 2YNFB 2RKIA 2MQNA 5HJYA 4YELA 1EQ0A 3TOQA 4B3SJ 4DU8A 3CO6C 3DGPB 3HOYJ 3I9V9 3CDUA 3DMJB 4L74A 4PXCA 2LP4A 3SBMA 4I98B 1SJ4P 2L08A 1Y5LB 3D6MB 5GPCA 2NAZA 3EPZA 2EIJH 4CQ1A 5M2RA 1ROFA 3ISNC 3MMYB 4ES1A 4JI7J 1VMBA 1JXSA 2LC2A 1NKCA 2C3YA 1E6VB 3VGVA 2OEJA 2LQBA 5CYJA 4OYIA 3NWSA 1YW9A 3D0GE 1X0FA 1VJQA 3AD8C 3PYFA 4J9SA 1I5OB 1LB2A 1JHHA 2V8VA 1U8WA 2CNLB 1RHRB 4H4MA 3RAMA 4YOEA 2PFBA 2VPXB 3QWPA 3SFGA 3VEPA 2VBZA 3ZQGA 3MCZA 4LRAA 4RW9B 3L7PA 2KRFA 2CUFA 3J81j 3KDNA 2RN7A 2M8DB 2NXNA 1Q79A 2RQPA 4A4JA 2P6TA 5J1UA 2EFWA 5FD6A 4ZS6A 4ED1A 2RQQA 3W3CA 2WAFA 2CZ4A 1K6YA 4Y00A 3QWLA 4J90A 1UEUA 2JFDA 2P81A 4QWBA 3DLHA 4XSZF 1IJEB 4ZPBA 4RW7B 4ZK7M 5JJBA 4A3MJ 4V2GA 2ZJRF 4NLVA 2QSFA 1KU9A 3IBFB 3QJJA 2GAUA 1TQMA 3HTUA 3LSPA 5LJ3Y 3V42A 1QE1A 5KHDA 3ZC4A 4MQ9F 4DOZA 2RNJA 4QPQA 4UUWA 1UVNA 1RAJA 2YWKA 1R71A 3LANA 4P9SA 1Q8KA 4U88A 1S9HA 1RT3A 2VPLA 3CTRA 3V5RA 4K0KF 1WEYA 3H40A 4NA2A 4DR6F 4ZCMA 4QZVB 4PYDA 2MH9A 2X1DA 5ICFA 2XYPB 2NOJB 2JVGA 1RTDB 4YUDA 1VQ8S 3C6UB 3HRMA 2YKNA 4R5PA 4DV0F 1N5SA 3SYTA 2KIQA 1JJ2R 4AL7A 5IZHA 5DGBA 2DCLA 3CULA 3SDGA 5K7HA 1BQNB 2VU5A 4TKTA 2V9KA 1XCVA 5CVUA 5DUKA 4A3LJ 3PW2A 4FE4A 2PFDA 2DO0A 3PXGa 1QGPA 3LSMA 1HMVA 1QPIA 2ACJA 1GMUA 1WOOA 1DRZA 3PZPA 2DNGA 5CVVA 4DV2F 2L5QA 3IS9B 4JB8B 1RKTA 4KGMA 1VBZA 3OVBA 2WONA 2F4OB 3I31A 1T05A 2QQBA 3SQNA 4M5HA 1S6PB 2HNDB 3MOJB 4L75A 4DQ2A 4N9HA 1FRJA 3OYBA 1PC4A 3CJKA 1WWHA 2V8HA 1USSA 4CO3A 1XG1A 2K9QA 4JI4J 1S29A 4LR7A 5F6FA 4A8MP 4QIWD 1Q4RA 4DPWA 3SFUA 5E3OA 1UWBA 1I27A 5L9NA 4DV4F 2GA2A 3BCBA 3RSNA 3OYEA 2HVEA 2XWXA 1NHVA 3NGKA 5KFUA 4ANDA 1UHMA 3I9V2 2VICA 1SFKA 3J7AO 1N34J 1PAUB 4DWIA 3TL4X 2CQ2A 2MKHA 4ZZLA 5F0WA 3VPRA 4IRIA 3FEYB 4P2MA 1X4BA 1Z4UA 4XTTA 4IOAF 1FDDA 3HOTA 4FKXA 3QU6A 4PZJA 4XLAA 5KT6A 1WJ5A 3J7YJ 3ENQA 2CUEA 2B4VA 2L4MA 2QLZA 5JFRA 1M1HA 2H6CA 2QLWA 5K8PA 2IAIA 2R93J 4PABA 4R8UB 2VFSA 3S1RJ 2XNRA 2M1BA 4OYBA 3C3LA 1V3ZA 1W7WA 4N47A 4RUHA 1DBDA 2XGDA 2KZMA 1DURA 1FC3A 2LNBA 3W2VA 4DSKA 5JVTA 5B0CA 5B0GA 2XPVA 2RQMA 1IG7A 2LLKA 3JAMZ 1MDMB 3CJRB 2V2KA 2ZHAA 2GIRA 2UU9J 1YX2A 3HBLA 2WHOA 4CCOA 2L48A 5FDLA 3GE9A 1NG6A 2CPXA 3IAS9 2NNYA 4Z6YA 3RR7A 3CJ3A 4M5JA 1YJ7A 3TRGA 1R8CA 3HG9A 4G8XA 4C0HA 3I0TA 3QYFA 3D7SB 2HZCA 3R5DA 3S15J 5HODA 4KR0B 1KDNA 2ZC4A 4CP5A 1O3SA 1FKOB 1DAXA 4QPXA 5DG9A 3Q2TC 2ZHBA 1YIJI 2OSQA 1V3FA 3E6CC 2DGQA 2V2VA 1XMQF 4DXLA 5EWEA 1M0SA 3S2HJ 1EP4A 5D3GA 4RAYA 1Q5VA 2GS8A 3T5KA 4B3MF 1XSDA 1AZSA 2D3UA 2OJED 4Y13A 4Q48A 3JRFA 4PJ0C 4USUA 2VBWA 5HP1A 3HTSB 1DTQA 4DFMA 2MG4A 1YW8A 3BR0A 4BKXA 4UY8T 1ULRA 1YWXA 1B0PA 1NH3A 1B99A 3RUBL 3ZTRA 1FXLA 1ON2A 1G3YA 4DX6A 1LPQA 3L2CA 3H36A 4L0ZB 1T94A 2DO4A 5I3QA 1UPPA 2XZTB 3G1MA 4PZVA 1YRXA 1BL0A 5IM0B 1T9WA 2HNZB 1WI3A 1N36J 5DCMA 5BPIA 1VFCA 3G71I 3H3UA 3EPGA 4AQYF 3GUDA 3CJQA 3C19A 2QIFA 4YQWA 1NK6A 4N8NA 1JNRB 2EBIA 2HQCA 5D4PA 5BYSA 3FDSA 5CCLA 5GTIC 4M8LA 4ED7A 4O5VA 2A0FB 4H4KC 4WYLA 3KYCB 4ES3A 4QLCU 3COAC 4KC5A 1HKSA 4OI4A 3ICLA 4MIMA 1FDBA 2NUUG 1HYSA 2BJ1A 3OUYA 2BY0A 3HVRA 1ZG3A 5DDQC 5JUMA 2E7WA 1VDHA 1C0UB 3CJNA 2KG0A 4OZJA 2JWNA 3JRAA 2M8HA 3BZQA 4RM3A 5LD2C 1IKXB 1TP4A 1RWVB 2Q1ZB 4U7UD 5IY5H 1C0WA 3FSIA 1J9IA 3LFKA 1T3NA 2LK2A 4C6AA 1NBEB 4NYOA 1R6VA 4ED0A 2JLFA 3D6FB 3M9NB 1HW1A 1F5TA 3MPWA 3TP0A 1OS5A 2PC6A 2QV6A 4KICA 3FNNA 3QSYB 2K9NA 1FLIA 2HYIB 3CC4I 1S57A 2E5LF 2ME6A 2ILYA 3P49B 4EBEA 2V8DA 2G13A 2H1LA 2DW4A 3K4BA 5F3ZA 4I2PA 5B08A 4FETA 1FD2A 2APOA 3RPQA 4IRGA 4Y15A 3WGGA 5L1IA 3PNIA 4WP8A 2N8GA 2G2YA 4NXMF 3I5CA 2AU0A 2IXSA 4L3NA 1AUSL 2AYGA 1IRZA 2KRHA 1BUXA 2VV5A 5D77A 2EEYA 1P9YA 4LF9J 1FBSA 1VI7A 1Y8QB 1IRFA 2WK4A 5M2PA 2V1UA 3RRKA 1FWKA 1HCRA 2B0GA 3IAS2 2XSJA 1K4TA 4HR2A 4I6WA 2KZZA 5EWFA 2VJJA 2GQCA 1OLTA 2E2JJ 3FHZA 2JA5J 5KFHA 4IOCQ 4CICA 3KEOA 4P10A 1NB7A 4LRBA 4CLFA 1FE0A 2X9DA 2HURA 1LXNA 3A13A 2LR8A 3H5AA 3JCUC 3MAQA 4XSXF 4H0EA 2J7UA 4F8RA 4WTYA 3QO9B 3HIFA 4JV1A 1IGNA 4IRHA 2VPYB 3SDEB 2ZBQA 2GMHA 1XX5A 2ECCA 1N5QA 3SJMA 3BR8A 2CWEA 1C1CB 1RT5B 1KRPA 3OL3A 4BXFA 2I0XA 1SC4B 1BJZA 1TK8A 1JKQC 3CGIA 2PQ8A 1A35A 5DQHA 1FP1D 4OHZA 1TKTA 2GVZB 3T5LA 4IG3B 9ATCB 4ZVEA 3D0IE 4KHPJ 2WTEA 2EXUA 4BDPA 4AIDA 1RHQB 3HC7A 1VISA 3H5YA 1SC1B 3CJ0A 1MG7A 2ZKUA 5HS8A 2QA4S 5F1RA 2VJVA 2UUBF 2YVSA 2F3JA 2EA4A 4G1QA 2VKZG 4PRFA 2KJBA 3SCIE 2L7ZA 2GOXB 4OZ5A 1J59A 3RAXA 1K4SA 3K2AA 3FFIA 4U67Q 1IF1A 1D3WA 4ZJOA 2DY1A 3I4MJ 3ENWA 2YNFA 1N52B 2YWWA 3VSLA 4F4ZA 5FGMA 3KLVA 1WTBA 5HVGA 5DD8A 2A3JA 3DGPA 2IM2A 3DMJA 4IFVA 3PIPF 2JEGA 3PIOF 1IKVA 2XC9A 4B3TF 1R8HA 4DPUA 4EM2A 2EIKH 4LF8F 2BQRA 3MM8B 3IM9A 1UVKA 3EGWB 3UN3A 4UVCA 3FXJA 3QIDA 2IGMA 4PFPA 2B6AB 1JE8A 4FBTA 4HLBA 4LBHA 5H9FK 4QYZK 3CF5F 1VQ7I 2HDCA 3TQNA 3WTYC 2RAEA 4DHVA 1N5YB 2BJ8A 2FGCA 1RISA 4IQJA 2FMLA 3H1CA 2WSFC 4LFUA 4YDXA 4IQ4A 3KJFB 3FBIB 4B8XA 5F9NA 1Y5NB 3IUOA 2WOMA 4CYDA 3R0AA 3RB4A 4KT6A 1X19A 5IP7J 1OISA 1B7YB 1T2KA 2MSTA 1VBKA 1PJ6A 1FFSB 2IMOA 3ZZUA 4I7HA 2A2DA 3CQZJ 2ZJPQ 3R5AA 2W1OA 5EGOB 2E5HA 1MMGA 5BPDA 2B63J 2ERRA 4AIJA 4ITSA 3A4CA 4KUMA 4BE0A 3SZ2A 1LJ9A 2ZZTA 3CDBA 1JLAB 4XIUA 1KP6A 4JI0J 2P9EA 3OSNA 1N48A 3HFZB 4BBRJ 3M32B 5A6PA 5AXLA 4QBUA 2XMAA 2HFSA 5FB2A 3GJSB 3LP2A 2IPQX 4Y6IA 3ML6A 3C1DA 2J7WA 2Q3PA 1UPMB 3E6MA 1VHIA 2FF4A 2MLKA 3JSOA 2M0CA 2IGNA 1QUPA 1EA3A 2IJFA 3MM6A 5LFAA 2FLNA 2J6UA 3WC2A 2F4VJ 3B02A 3Q8QB 4EJVA 2DFEA 3AT1B 1NSQA 4QYRA 3G73A 1R31A 4RNFA 1IBKF 2Y1IA 4ECTA 4EBCA 1AKHB 4USIA 3EJMA 3V8KA 4C48A 3QNWB 1GVJA 1Q8BA 1RUSA 2JC1A 4B3RJ 1RTDA 2AYBA 1OYIA 2E34A 3FDYA 3C6UA 3W9IA 4EM0B 1ETVA 4KTQA 2LECA 2HWVA 1JTXA 3IH3A 4RBTA 4MGRA 1MMAA 1BQNA 4NI2B 2PJRB 1PIEA 4DX5A 3IC1A 2FBKA 2E1MB 1LV5A 4A5MA 4OI3A 2HVZA 4C8KA 1V6HA 4GVLA 4OHXA 4OLPA 2IM1A 1SI9A 1MJ9A 5FLVA 1JX4A 1CVJA 2HVDA 4K4WA 1RWMB 1MROB 4XM3A 1CS4B 1RAFB 4TNOA 1VI0A 1M1KT 1D0YA 1O51A 1S6PA 4G7ZF 2EBEA 3TOBA 2HNDA 5AIPA 1UVMA 3JQJA 2Y9HA 1WSVA 3ABLH 1ZM4A 3CJTA 2DEJA 1WFXA 3FVYA 1S1UB 2OPPB 5I3UB 1DGRM 2CO5A 4UVAA 4DR2F 4R79A 1V3SA 1HBOB 1PCAA 3K5OA 1VHFA 4TQSA 4OAYA 1N5VA 1VC6A 1PAEX 4HRIA 3FKIJ 2I8EA 1X5TA 1RABB 3GTOJ 5ETQA 2CJYB 3ULQB 4IHYA 3E5XA 3EGNA 2V2ZA 2AF6A 3ISZA 3K6GA 4HF0A 3W8PA 3IR7B 1QZYA 3M1CA 4O3QA 5D8HB 2DGXA 3DKYA 3I4PA 2A3SA 4HHHA 4CYUB 3GXOA 2VQFJ 1VQOS 5J40A 3QRPA 1FPQA 1OYWA 5IPAA 2OHDA 2QSFX 1VBYA 3GZ5A 1KQKA 4F02A 3MTKA 3ZP5A 3ABMH 4A8QA 1U09A 3H5RA 3D4JA 2R8JA 5FLXK 4L3KA 2QSWA 3FXRA 5JVGF 2HVSA 5H6RA 4LMZA 3PW4A 4DUZF 3M2VB 2YH0A 2MYSA 5K7ZA 4I76A 1QUVA 5A8KA 2GXBA 2IIHA 3C8YA 3KUEA 3KDOA 5J4YA 5FLXU 3JAMY 4M72A 1PG5B 4BE1A 3L4BC 3WHBA 3ZCOA 1NNDA 1QM9A 3CJRA 2FHKA 2J0XA 4QSHA 3MR5A 4LF1A 2HFVA 5T41A 4ZYGA 3EZOA 4XLHA 1NK7A 4PR6A 3RG6A 2PA8D 1FX7A 2HAFA 3DTKA 3CMAI 1LQ1A 1OSDA 2M5WA 1RWWB 3IRQA 2RHSB 2IC3B 2L0KA 2O0YA 2VPRA 4Y2IA 4A46A 1GNKA 2VE8A 3ITHB 3M2UA 2GAHC 3WX8A 2KQRA 5HNHA 1R4MB 4HEA9 2Y8WA 4D7MA 5EYRA 1HNIB 3NCPA 2WVEA 5BJRA 5JMNA 2VN2A 3MECB 2UXXA 1FKOA 2XB5A 1BM9A 2BM1A 2ID6A 2MSYA 3JRHA 4LF5J 3D5RC 1U0HB 2DRBA 4JI1J 2MKJA 2RF2A 1VZ0A 1C1BB 3DEEA 2HHSA 1EQMA 4ICLB 5LL6d 3KLFB 2LA6A 1MW7A 2RS8A 3CDLA 5CYQB 1JJ6C 1W1WE 2J9EA 4M95A 2KP6A 3HK2A 5DCFA 4LQ9A 4JV5F 1SKUB 1ETKA 1VQ9I 1P6RA 1J2XA 3SZPA 3US5A 1XTZA 3IO1A 1LNQA 2C22A 5GP9A 1R8BA 1SD6A 3R27A 1UB9A 1A6QA 1R27B 4L9NA 5K1YA 1RT6B 4DG1B 4F0KA 3UPFA 3AAFA 4LB5A 3W1YC 2XRLA 1TUGB 1S6OA 4MH8A 5LRRA 4FXWA 4RKUC 3IKTA 2OA4A 4D5CA 3LWFA 1YS7A 2BABA 1D8KA 3TDZC 1IN6A 2V50A 3KJVB 3Q8SB 2W4DA 1I3OB 4J19A 1VC0A 3OLAA 2R5YB 2VG7B 5HMZA 3NMAA 3IRWP 1W36C 1R8PA 2Q79A 5HROB 4TU9A 2X1AA 2HQIA 2IY5B 4Y2MA 1PVEA 4CLZA 4CUGA 1VIOA 5DS7A 1TWCJ 1U25A 4F4WA 3K89A 4M6YA 1Z1DA 4CO1A 4TYBA 3KIOA 2CSOA 2ZMEA 2L9DA 2GX8A 4P71A 2ZBPA 2KKOA 1SC6A 2V34A 3HFKA 4MEXF 2IW5A 3PNTA 5KOWA 3S2DJ 3G8QA 2FHMA 3TZYA 3ECOA 2I5JB 1CPZA 3VGSA 2G0CA 2EV0A 3WU0A 4C11B 2IBDA 4F3MA 3BQZA 3LSGA 2R7VA 4WZQA 2L3MA 2CJQA 3QT7A 2RSQA 1NU4A 4L72B 1HI1A 2YXLA 5GAEI 3P9IA 4UOHA 1IO2A 4Z2YA 3EDQB 4B4CA 1RRJA 2Q0OA 4A69C 3OL9A 3F8NA 2GVDA 4LF6J 1B64A 4I01A 5B3SH 2UZKA 1SJ1A 4NNJA 2KO1A 2NQPA 1MJBA 2CRGA 2FVQA 4DZ6A 2B4UA 1UL3A 1U1RA 2M9HA 3KMQA 1X2NA 4ESJA 3F8FA 3GTYX 3GX4X 1QTMA 3AKZA 1TW2A 3ZMTA 4LVOP 4U0WA 2EFVA 3PX4A 4Q5VA 4A3KJ 1ORKA 3NAUA 3V6KA 4WU2A 2H8WA 4JI6J 2DRAA 3MEXA 4HEA2 2ZDPA 2N7CA 4F55A 2VKVA 2AHQA 2FGOA 5DLFA 2YUSA 3FRZA 1SKSA 5C3EJ 3HHLD 1VRTA 1BQXA 1M5VC 2P2CB 4NPOA 3WTWC 4IQMA 3QIPA 3D0HE 5KFDA 1FP2A 2KTQA 3T3FA 3UQSA 3SDEA 3E5QA 3HGYA 1YI2S 4RWWA 3R5JB 3KG1A 2IBKA 1T9XA 3D2WA 2K8GA 2XAJA 3MEGA 4OIQF 3HL2A 2ZZNA 2COBA 1GV2A 3TDUC 3KUHA 2VKDA 3QT8A 1TVRB 1X1CA 3C7JA 2EV6A 1OKRA 2V4QA 1K1SA 1SFXA 5KNLA 1HI8A 3BQ0A 2QA1A 3U1DA 2LA4A 4CYCB 3R1LA 1HNWF 4FTHA 3EM1A 2EG1A 4LF4F 3S14J 3FXQA 1IXRC 3CCTA 2X3DA 5DDRC 2FLOA 2L41A 4LJZF 4OOIA 2H48B 4CCNA 5AXMA 4WXCA 4M5GA 5HSPA 3ZQCA 4HDVA 2I6WA 3GB0A 1PYOB 4OU0A 1BW5A 3EUAA 1RU1A 1IM4A 1FTCA 4JI2F 3UD3P 1FJ7A 4X4QA 5L8RC 3CNQP 2IVMA 2CXEA 2QG9B 4FP9A 3KUGA 2EVZA 2YSRA 2XY5A 5GAGU 4Y65A 1RWXB 3DXSX 4BGDA 1SPBP 1HQEA 3MAAA 1KQ8A 1NJZA 3M30B 3L2QA 5LEJA 1FTZA 2Y9ZA 3MD1A 1LFWA 1AFJA 4YEJA 1NJYA 1BW6A 2E19A 1K8AT 2B9SA 3UE2A 2ZH1A 2ZH5A 2KHDA 2OSRA 3F56A 2JVHA 3EXCX 3TUIC 3SZTA 4HNVA 1YDLA 2DT7B 3GTGJ 1NK8A 1PUFB 3PG9A 1TT5B 5F0UA 3FXOA 1RJJA 1VQSA 1RYRA 1W7PD 2O8KA 4MK8A 5FO5A 1VS3A 3DM2A 3GFXA 2FA5A 1H74A 1HW5A 4QCLA 4PJNA 1APLC 3C14B 5EGOA 4V19X 1JLQB 1AHDP 2QMUB 5F08A 3M8WA 4CLSA 3RDIA 4UUXA 1MNMC 1LXJA 1LOUA 2IMWP 3HHLA 4R0EA 4QWEA 2DH8A 1FEXA 3HM9A 3M9MB 2IS2A 2E1AA 3VGUA 2ZXIA 2CKWA 3HOZJ 2BYCA 4IO1A 3VF0B 3KK3B 2ZITA 2W8LA 1U6BA 1NG7A 3DDIA 2H65B 3G1OA 2HK3A 5L3FA 1RT4B 3TR5A 1CJUA 1HA8A 1L3SA 2QX0A 3HYIA 2HIQA 3R5GA 3KLHA 3AA9A 1R0CB 5DZ7A 2ZWPA 2MQPA 2RC4A 3IWXA 3I0RB 1SL0A 5AJ3J 5RUBA 2VA3A 3TARA 2WTFA 2GJFA 3HSEA 3I3LA 3W63A 4KPCA 3MAHA 5HOOA 4Q45A 1AKHA 1G2HA 5CJ9A 4S05A 4PDKA 3D5LA 4NEZA 1TQIA 4Z2XA 1M5SA 2YWHA 2X1FA 4HQEA 3JTPA 3UD4P 4HACA 2XVCA 4WFYA 2DFIA 4NLQA 5CVRA 3I5BA 2OCEA 1YJNI 2BGCA 5C2GA 1M5KC 2AJFE 1N0VC 2DY9A 1VRUB 5BS6A 3PHEA 4J9RA 2HZAA 3CD6S 3IP0A 2J8SA 2R7OA 3QAUA 4KO0B 3TEDA 2MKSA 2C3MA 1UZCA 1CLFA 5DYMA 3WG9A 3CUQA 2DPDA 2VC1A 3BWGA 3P7NA 4PGHA 3J80U 2OH2A 4DJBA 2KT2A 4QWAA 4BAYA 1S1UA 4MKVA 3SSRA 5L1KA 1LVAA 3N4MA 5I3UA 4AYBN 2PEBA 3HJFA 1S0VA 2EZIA 2JA2A 3ZO7A 5GAEU 1V5EA 5FKNA 2X3GA 5HMXA 3V4IB 1NDKA 1CJKB 5HLTA 2M7AA 3TO8A 1ETOA 3K0LA 4AWXB 2MHEA 5KTQA 1QA6A 3Q0VA 2E5GA 4K5SA 2HS5A 3KLIA 5IQQA 3RW6A 1XN9A 3VFZA 3S01A 1W7PA 2EWHA 1A9NB 3KP7A 2CUJA 4EO8A 3BZ6A 3Q9VA 3KMSA 4NLWA 2FIUA 1LW2A 4PG4A 2COLA 3GWCA 1RB0A 3CCVS 1AWCA 1Q8LA 2E66A 3W9JA 2VLAA 2BZTA 3E0JB 4I64A 2BVLA 4CYUA 1R49A 1ZAWA 4USMA 2XO6A 5C4JJ 1YZ6A 2HZDA 2DPUA 4A3CJ 4KKOB 3TEHB 3IWNC 1YLXA 5D5UB 1W25A 2HFNA 4CZZA 2OI2A 3Q83A 4TN2A 5F8JA 3FBEA 2ZC3A 3LP1B 1TNTA 2HNYB 4F04B 2DRDA 2FD5A 1AUDA 1NMEB 2J9DE 4LD5A 2EC0A 2G1HA 3M8QA 2UWMA 3TX0A 2HQRA 1HXDA 3NARA 4EMSA 5KG4A 1VQ4S 2QJ3A 2BHZA 2JRSA 3N0VA 2BE9B 1UTAA 2KJWA 4ESFA 2HBQB 1A36A 4HVZA 2Q2EB 1DPRA 4ZA1A 3W66A 1WJFA 2K02A 3F0CA 2PMUA 5LHGA 2FVSA 4KGXB 2JLGA 2DGOA 2Z58B 2L3DA 3RBZA 1RWKB 1A31A 2V8PA 3IC7A 2VZ9A 3BJ6A 3BBFA 4JBAA 1VCTA 2HBRB 5JLWA 3GMGA 1QO0D 4J9QA 1VQNI 1HNIA 3EX7B 3F8CA 3MECA 3I71A 3BH7B 4DV3J 1JTYA 1UAAA 1O7LA 1H73A 2LQJA 5GTHC 2G4BA 3EZUA 1C1BA 2ZEJA 1NXIA 4ICLA 2X6OA 5ICGA 2NZ4A 2R9LA 1JKHB 1YJ9S 2NSBA 2KIUA 1KFDA 3TQEA 3HFVA 2VFUA 5GAHI 5IT3A 2MZQA 3SIPB 4CCJA 3F44A 2Z56B 2AZ3A 3LPYA 2DFFA 4JI3F 1Z21A 2OTJI 3B8HA 4ECQA 2R2TA 1X4HA 2R7TA 3D1NI 1SL1A 1D1UA 2Z2LA 3CF2A 4ZVTB 2BQ3A 3HPOA 2HHQA 2H4YB 3MPVA 3GIMA 2HHWA 1IJWC 2XKOA 3O2IA 3FM5A 1DU6A 4OYMA 2FRHA 1X4DA 5IC6B 5E1XA 1B9MA 5E1ZB 4FVCA 3HRTA 3GQCA 3OFFA 1S79A 1D9DA 3K4JA 1UZDA 2CU7A 1XQIA 2DO7A 2R92J 4DSLA 1E0EA 2JUGA 1FOYA 4ZIVA 2V9PA 5DG7A 3SDBA 3OSPA 3DXJF 3JQKA 2LRDA 4ZP8A 3PO5A 5KFLA 3KOAA 4D5FA 3GYHX 2IYIA 4C8NA 2JK3A 3CLOA 5LSLA 1RHUB 2VG7A 4LFCJ 4AVPA 3VYUB 2QFJA 2YTCA 4KH1B 2AV5A 2FZKB 3WTXC 2E60A 3MUVP 3G82B 4OV6A 1VQMS 4O3NA 1H8AC 4IDKB 2BE2B 3ELHA 3T1HJ 4WXWA 2CJKA 1HBNA 4DZDA 2VT2A 1SVMA 4ZJLA 3OTOJ 3DRYA 2XZDB 4IEJA 3CCJS 2YNGB 1REGX 3TYTA 1OYDA 3CCUS 4CO8A 3JYTA 3GFIA 1K78B 3LALA 4EGYA 1XMXA 3DP7A 1Z77A 1S72I 1WC5A 3GIJA 1RSCA 4HV6A 2XLKA 1T33A 1BA5A 4Y7NJ 2I5JA 1I6XA 4F4AA 3VAGA 2HHHJ 2DT9A 3GG1A 2WW8A 4ILRA 5B0FA 2W25A 2E1MC 1I3AA 2R7FA 3N5BA 3VAIA 4M5NA 3D3BJ 2LEBA 3NQOA 1QQIA 1B59A 4WFZA 4HLYA 3A3PB 3T1BA 1VQ5I 4AYBA 1X4FA 3ETMA 1R4NB 1RUNA 2NXJA 3TAQA 3BY6A 4E7LA 4IL6C 5ILSA 4IOCF 2CH0A 1H72C 3PM9A 1Q1KA 4OMFG 3CCQS 2AQ4A 5CQEA 4EJOA 2WVDA 4FF3A 3K10A 2VIXA 1YBTA 3R97A 3KK2A 2F5GA 5IP9J 1ZLKA 2XS5A 3VZHA 1OMIA 2DR9A 1H7XA 2MMYA 4C0OC 2J0SD 1BQMA 3MM5B 2MYFA 3A2KA 3BQYA 2QBYB 2M52A 4EV0A 1N8RT 2R4FA 3RTVA 2CQBA 1MKMA 2CQ7A 1JKRC 1XR7A 2W01A 3MURP 4GXOA 5CYMB 3CCSI 4K4SA 1Y39A 3CO0P 1TL7B 2OKQA 1TKZB 1TL5A 2M2BA 2ELHA 1IXKA 1BXNA 1FF2A 1KLNA 4RW8A 2HRTA 2VPZB 3ZXSA 3DPLC 2IJLA 1XN7A 2AX1A 4HNUA 3POTB 2OD6A 3VYSB 1TVRA 3MKZA 3MEDB 2DBBA 1TBXA 2F4IA 3PRBA 3CCEI 2DGUA 3NOCA 2HHXA 1EJ9A 2PO4A 6PAXA 5IT0A 1O4XA 2FJ1A 2D41A 4ZPDA 4IRDA 1R0BG 4AUXA 5IV3A 1N33J 4OJ3A 1V54H 1YG2A 5ETOA 1P4AA 5HDGA 3M4OJ 2NS1B 3DLEB 5J8FA 4FPRA 3OYIA 2E1NA 4O44B 4DR3F 2YWGA 3B73A 1I94J 1KQSR 4DYCA 1FTTA 3P8BB 5ED4A 1HA1A 4MKAA 1FRLA 1I39A 1FRKA 1J5OA 4EO6A 3AD9C 2NR0A 3JRGA 3M9OB 2N82B 2OIHA 2K7LA 1FOKA 4E7KA 3ZNJ1 5J47A 4XKWA 4P7VA 3I59B 2LDUA 1S1WB 4C3LA 2VA2A 5JLXA 3GV5B 4II2A 1DUXC 1F43A 5KG1A 3EWGA 3QWUA 2B8QA 3GJQB 4G94A 3ZMSA 1EZZB 3T5HA 4UUSA 3J80Y 4P96A 1U9OA 1WSRA 1KNZA 3EUKL 3MZHA 4DLEA 3HOXJ 5C5JA 3Q0WA 4BQNA 5FFZA 2ZJPF 5KT7A 1PUFA 5E17F 3C2BA 2KRRA 1KYZA 4ZDLA 4PXDA 4KYWA 1UEKA 3VAMA 4FE7A 1ICEB 1N56A 4W4MA 5K9FA 4HSTA 1Y7PA 5E3CA 1QHHD 2JL9A 4HOBA 2AZ1A 1RC9A 2UVRA 2RDIA 1RKWA 1FKPA 2Z9OA 4FPIA 2RS2A 2GGPB 5J2QA 3CMEI 5FFXA 2ZWOA 2CQKA 5GAHU 3Q8RB 4IH7A 2WAEA 1SB6A 5ITHA 1K61A 1NM2A 2ZO4A 4QW9A 2RDJA 1HR0F 3LW5C 2KISA 1ZM2A 1OR7A 1U26A 1XMOF 3PL8A 3PSFA 3HZEA 4BS9A 4XRSA 1TKDA 5IXUA 3FXUA 3AHPA 1S5ZA 5HLFA 4FT8A 1KQ0A 1S99A 5IOLA 2H5EA 5A8WB 3MR7A 4KH0B 3QP6A 2IRUA 4X4UA 2I8DA 4DR1J 3HUGB 4WYWA 5DEQA 3IBCB 2KXFA 5KFMA 1WELA 2LU2A 1E3PA 1XERA 2QMWA 5KG6A 1GXUA 4DMZA 2MLGA 4AXIA 5ETPA 3T9ZA 2E35A 1RTIB 5L39A 3BSNA 4Z37A 2DHSA 1S77D 1XIQA 3QBCA 2ZOMA 3GFZA 2QQ8A 3DTEA 1I50J 4DUYF 4C8YA 2BJEA 4XOTA 4ZPWR 2GZWA 1RIOH 4FN5A 3SXLA 1YE9A 4U0YA 1JXEA 2AWZA 3MMAA 1UHSA 1RT2A 3LMMA 3NAHA 4XK8C 2CPDA 3JQMA 1FI4A 1A6LA 4DR4J 1VRUA 1YFHA 1JGGA 1MBHA 2V4RA 4YY3F 2LKPA 5KFAA 3C16B 1J5EJ 3OVSA 1LUJB 4NRUA 1PDNC 4U9RA 1IUFA 2OC6A 1JLCB 1SJ3P 2V26A 4H4OB 4AL5A 3HZJA 5CKTA 1YLFA 2J6TA 4QR1A 3OYDA 1JLFB 4AM3A 2C1EB 2DHAA 3IWFA 2LEPA 1DGWY 2E2HJ 1XB4A 5D0HA 3V4IA 1VK3A 1B70B 4P5OA 2VBYA 2NYXA 1XNRJ 4KFBA 5J1EB 3K1PA 5DLGA 1T08B 1S5LC 1GMVA 2BBYA 1X5PA 4X6AJ 4FISA 1DTTB 4O3MA 3M9AA 4K7QA 4EJWA 3EYIA 2D3OR 2MQLA 2PDAA 2LF7A 4L9TA 3LWMA 3M8RA 2FC9A 4GRIA 4MT1A 2ESNA 2Z16A 2QE5A 4LIWA 1RQ0A 3UW1A 1U3EM 2Q43A 1XEZA 1K73T 2HIYA 2XRNA 1SQFA 2HRYA 2QENA 3A03A 4XBFA 5J2MA 1LE8B 4KKOA 1CF7B 2VHGA 4AIHA 3CPWR 1D0XA 3OL8A 2IA6A 3BC8A 3H35A 3RZAA 3EPIA 4IYQA 4DCOB 3CCMI 2LFVA 3NEKA 4PWDB 4MKYA 4Q43A 4OI0A 3K8WA 1GUUA 5IWAF 2A61A 2OP5A 2KFDA 3FM3A 2FHJD 2YWEA 4KFCA 3X1LB 4Z7CA 3R6GB 3DBRB 4X4PA 2V9VA 2R7WA 2D1VA 4XO0A 3HI9A 4PUOA 3K70D 3CCRI 4F93B 5LRSA 2CQQA 3R8YA 3I54A 2J9CA 4DPOA 3MM7B 4L6V3 3L2UA 3LQVA 2IM0A 2CDRB 2DHHA 4N77A 3I87A 4B3OA 1SD5A 2W84A 4RBUA 2B7EA 2CFOA 1BN5A 1YGYA 1NDLA 1F1BB 1ZR4A 3FBBA 1KQFB 3S3NA 2XASA 4UY8I 4A5NA 3FK4A 5K8MA 3R5CA 2JNJA 1HNZF 1DU0A 2HU9A 2KM8C 3G6XA 2UUCJ 2MFZA 3I4HX 4C2MJ 3OV8A 4LF7F 4LB6B 5HQLA 5FJ8J 1XNQF 3PKMA 4M3DA 4O3SA 4XLNF 2PN6A 3W8GA 4BJ6C 3Q8VA 3LSJA 3LWLA 3VALA 1BHNA 4C3JJ 1RHMB 3OR1B 3FZBA 4P7TA 1HWKA 3UN5A 4OX9J 2A1BA 4F36A 3CW2C 2CQIA 2BYVE 1IBMF 2OF7A 3MF5A 1J7KA 2EA2A 2DCUB 2FVRA 1DFDA 4NQWB 2H5JB 1VF9A 4GYIA 3OQ2A 3H0DA 2DA6A 3V6JA 4BJ5C 4LR8A 2HR3A 4AD9A 3FXMA 3EDRB 3CC2I 2CJXB 4GKJF 3PFEA 2B9WA 4Q8FA 1R0AB 1OR7C 3RTRA 4JUZA 3GFJA 1P92A 3PNVA 1RPWA 1X5SA 1FOWA 2CFXA 4CO4A 4LGWA 4Q4ZF 1WKMA 1LFPA 2O61A 1VLYA 1ZREA 1PGZA 4BHCA 2QEXI 3PR4A 3GTPJ 3QYBA 2QA4I 2NS8A 1FYMA 3OYNA 4LSNB 1TKXB 4DR5F 4A0YA 1D8YA 3LSHA 1ULYA 4KYZA 2A07F 4IDKA 2BE2A 1UW4A 1MSFC 2JA8J 2FHJA 2YWFA 2HQGA 1STZA 4IPAA 4RLQA 2LQ5A 3AG2H 3HKZN 5H1SV 3PX0A 3UO0A 3NS6A 3SCLE 2JRTA 1WF2A 3BSAA 1VK8A 4ANCA 2Y75A 2D9OA 2FTRA 4FBUA 5L3EA 2XSFA 2R5ZB 3FX3A 1NRKA 4HHUA 1W5SA 4BLGA 3BO4A 1SIWB 3DRPA 1I6JA 3OXFA 5EJCA 1GV5A 2E1PA 1U8SA 1SD4A 4KIGA 4UUTA 4OYOA 3CEDA 4J37A 3M8YA 2D9PA 4CDGA 3NGTA 1SMTA 2DR5A 4M6XA 1FXRA 1HDDC 1VRQC 3WHIA 1SANA 3OYJA 4CLWA 2BV6A 5DUIA 4N0BA 3IN5A 4LLNA 2VT3A 3G96A 3AJ2A 4F4XA 3KKFA 3KP4A 5D5WB 4W97A 1U8RA 3PKYA 4XKVA 2ZE2A 4NLDA 2BV3A 3KTQA 2XCPA 2DXIA 2ALZA 4B9LA 1U2FA 2CPEA 3QQCD 1T03A 3ET6B 4K0KJ 3LTOA 1R43A 3IH4A 1JT6A 4KHRA 3I53A 4DR6J 1KHVA 5FKLA 3MM5A 4CLYA 2VJUA 4DUTA 1VQ6S 4C3KA 2KJVA 1VQPI 1H88C 4P52A 2CV2A 2E9ZA 1TQLA 2HNHA 3NRBA 2G0EA 2DVIA 5CYMA 1ETWA 2W4PA 5IT9Z 4DV0J 4XRFA 4BE2A 1UFLA 4X4TA 3PX6A 1REVB 1TKZA 5EN1A 1Z05A 3TP3A 1XWLA 2HW3A 1M5PC 5KFPA 1HBMA 2LMIA 1CJTB 1UZHA 4ZIWA 4DLGA 4GKKF 3A8JA 4RW4A 2UP1A 4ED2A 2EFPA 2LY1A 2NOGA 2OBPA 2ZOGA 4FF1A 4DV2J 3O8HA 4XICA 2VQEF 1POGA 3GFLA 2CIMA 1ZM3A 5A8RB 4M5LA 3TVZA 3GF2A 4JBCA 1GAOA 3JR9A 3PFOA 2XGQA 1R23A 3NS5A 2ZH7A 3QJLA 1GX6A 3IV5A 4BY1J 4OYZA 3R5BA 1U1KA 5A2QY 3SV4A 2HQAA 5J6XA 3DU5A 5HS9A 4IF4A 2CNOB 4DV4J 3MZYA 3AB2B 1FMWA 4FS1A 2WB1D 3F21A 1LWCA 3BLYA 3DOLA 4N56A 3DLEA 1OO0B 1DP7P 4O44A 1CULB 2FZCB 2YNHB 4WU3A 4AUKA 1TL1A 1UVLA 2D2WA 2CQ1A 1REPC 3H5SA 2DAOA 1NEEA 3I64A 2CPFA 3PNYA 2GQQA 1L0OC 4CTAA 5LGUA 5KFNA 2CZVC 5A76A 1HIYA 3TQ1A 4LOCA 3D5MA 4NZ6A 4BQOA 4RU2A 2VOPA 1VQLI 4KGZB 5CAAA 3HHGA 1R22A 5DG8A 4JV2A 1S1WA 1FRXA 2HZTA 1RTHB 1HHSA 2E2IJ 1RDRA 2WAQD 2B7BB 1FYKA 2DNHA 3LP0A 3IGNA 4ITVA 3CIZA 3CCYA 3NNHA 1HQUA 1Z0XA 5DQGA 2OPQB 3LGNA 5EG0B 1CQMA 4OINF 1IM6A 1S9FA 2V94A 1RAEB 4ID8A 4ESBA 1LWFB 4KGVB 4ER8A 1S6LA 2MJUA 4JI5F 2VQHA 4F92B 2FMYA 1F4KA 4ECSA 3BP8A 4G1IA 3VQTA 1P7IA 3VQSA 4ANJA 4KNYA 2BRLA 4RB0A 2HVQA 1LDKB 4WF2A 4HW0A 5KFGA 2ZUAA 5DM7F 2F8EX 1KVIA 3KP5A 4IG0B 2GGPA 5CVJA 1RBAA 4UF4A 3TX8A 2R2RA 3CUNA 4G6VB 3KE2A 3CJSA 3MQ0A 3BG9A 2LSOA 4AFFA 3RJPA 5B09A 2P9CA 2DJNA 3ERED 4X84A 2QGUA 1Y00A 1KLMB 4K50A 1IUYA 1KFSA 3FMRA 1NB2A 1F9NA 1ZOTA 4OZLA 1H2UX 4L5EA 1NPRA 5KT2A 4A8FA 3T19A 5L3GA 1BD6A 4BY7J 2K5CA 2I9SA 1XMQJ 3H20A 3QFWA 4B9NA 3S17J 2B5JA 4PSXA 3KNGA 3HUGA 5BNGA 4G6TB 1RCOB 1R89A 3HKZA 4WCGA 2QQAA 3CCLI 3THPA 1OY6A 1PC5A 4B3MJ 3WIVA 4QPOA 4L18B 5D6GA 4USJC 4IHXA 4RLEA 2DNLA 3CDAA 4C3HJ 2RHQB 1ZETA 1BLUA 1P8GA 3KLEA 2FYXA 2ZKTA 4B9TA 2LBFB 2JWTA 3RGIA 2VJ4A 2WB1A 4B43A 4OJHA 3ILJA 5CVIA 3MCOA 3BG7A 1HBUA 2MY8A 2DJWA 1X1PA 2C3OA 3BPSP 3GR0A 4O23A 2AJ4A 3QPHA 1HSJA 3GMEA 5BQTA 4J9UE 1QVFR 3VDXA 4GO7X 4N5SA 3L9ZA 3SI8A 1PJ5A 4DF8A 3KX2A 1BC7C 4E7HA 1YJWI 4IX7A 1SEUA 4ASNA 4AQYJ 3V7RA 1P7JA 3C16A 3VCDA 4DR7F 4UZCA 4M5KA 3CD0A 2P8TA 4A2UA 2X1GA 5ILUA 4O4GB 2DHXA 4H4OA 2W2MP 2CS3A 2WAQA 1KSPA 3OHAA 4XRSG 3OHBA 1JLFA 4NL5A 3J81U 3HOWJ 1WHYA 2R7ZJ 1MNEA 4PKDB 1X9MA 5L3DA 4USTA 4XPCA 2LG4A 3N28A 2V0NA 2AD9A 2FLPA 4IHTA 1IC8A 2JRMA 2AGQA 5J2NB 2JT1A 2VIHA 3BB5A 1RADB 3DOMB 3P96A 1D8JA 2CQHA 3REOA 2VL1A 1YVFA 2VFVA 1IKWB 3D1OA 5J1EA 1P2FA 1P4XA 2E36A 2UUZA 2VQGA 2XF7A 4XN0A 4FQGA 1L5UA 4OI6A 4OHYA 3SHFA 2JQ7A 2OD5A 2YY3A 4BC9A 4WXOA 3OYLA 2L01A 3TAPA 3WQPA 2Z1DA 1OPZA 4CO5A 3VAHA 4WKYA 4RMNA 4RAZA 1J27A 1B1BA 2TRTA 2XTJP 4X2BA 1V5VA 2E5LJ 2F4FA 3MR2A 1S4EA 2Z2MA 1MBFA 1LE8A 3UDLA 2BXZA 2EQRA 3KPHA 3G6EI 3N5FA 4LQ3A 2HHPA 2JLEA 1T98A 2ZBRA 1C0TB 1NAQA 5B0DA 3MFKA 3KLGB 4NXMJ 3AH6A 3G9CA 1FFWB 5AXKA 5KFOA 3TJ8A 4I68A 4PWDA 3SZGA 3SCKE 1MN9A 2FVPA 4ZCKA 4EI2A 2HZVA 4OIPF 2EFQA 1FBQA 3H0GJ 1ODDA 2NXCA 4XLCA 1Y56A 1BOBA 5HJXA 5LMUF 3EYYA 2VF3A 1SJQA 1VLOA 3HRUA 5D0RA 3OIOA 2W2PP 2KZGA 2QTWA 5KFVA 1U1NA 3P3DA 1PBUA 1S9EA 1SL2A 4MFBB 1RTJA 2CPZA 4GCVA 2VG5B 3PY8A 2RDPA 2RJZA 3U1NA 1EAYC 4K4VA 2YX7A 4IKAA 2D5VA 4GMKA 1YIJS 2KXHA 4GVBB 2X1EA 3R7SB 3RCOA 1OQ6A 1M1GA 2L2OA 3NWGA 3ABUA 2VG6B 3R3TA 3H4DA 3FSXA 2NPIA 4UB8C 1YG0A 1D3YA 3K1MA 3ZQ7A 4IOBA 2JJ7A 1IQTA 1GTEA 1LDJA 3S32A 1UW9A 4M3EA 3EQLF 3KLNA 3CE8A 2J0WA 2RMLA 4K4ZA 4I02A 5IYBJ 2XC7A 3UCGA 1ITPA 3DWLE 4BJTA 2E44A 2UUBJ 4CH1A 2ROEA 4OMYA 4JX5A 2CPJA 1BIAA 4NQWA 1Z2LA 3IR6B 5HDKA 4CO2A 2K4JA 2STWA 4YRVA 1MU2B 2PMZD 1NCLA 5ADZA 5H20A 5KAKA 1D0EA 1Q82T 2Z8QA 1U0SA 2XF6A 5KFTA 1S7IA 1B8IA 2V5HG 3KYDB 2GIZA 1RETA 2A5WA 2E5IA 4ZVUB 4B3TJ 3BKTA 4P75A 4LF8J 2W7PA 1TNSA 1SV5B 2YBVA 3GYXB 1D09B 1HARA 1SUQA 1U48A 3K4CA 2AJ0A 2EIMH 1MNDA 4GYGA 4E8UA 4CLUA 3BQ2A 3T6JA 3F23A 3P4UB 3KJNB 4ATNA 3NGUA 2DYRH 2DJIA 3IBWA 4PXBA 5CHCB 2OMOA 2AJQA 1JHFA 3GEZA 2QO3A 3AOAA 1TKXA 1HNVB 2A2CA 3A01A 1Z9CA 1A7GE 4DBQA 1SJFA 3BKUA 5DQIA 2YKQA 3E3VA 4ID5B 4UVBA 4K4UA 3BR1A 5KFXA 5F0HA 3ADAC 4A93J 2G9OA 2IEKA 3FBCA 3CC4S 2K3FA 1B9NA 3GONA 1U78A 4N41A 4E2FB 1TFYA 2W00A 2NXEA 3H9QA 2R5ZA 5IFMA 3L95X 4MO7A 3VVTA 2MLZA 1DJ0A 1WACA 1NHAA 4B3XA 3ZN0A 3RB6A 4TY8A 4ETSA 3F9KA 3KEYA 2VD3A 4U0VA 4J9VA 2CW8A 1F6TA 4S0MA 4EBDA 5DS9A 1Q5YA 7AT1B 3O8WA 1X9WA 1M90T 2DITA 1RE1B 2M8EA 3DBLB 3LOCA 1NH7A 4CDIA 3V4MA 2ZNZA 4BUPA 3DOKA 1PP8F 5KFQA 2UUAF 3MVPA 1A5JA 1RR7A 1B3TA 4DL7A 3M6UA 3A8KA 4B9UA 4DN9A 3M8JA 4G7HF 1EJ7L 2LLZA 3R6SA 1FT9A 3KWMA 2QGFB 1XDUA 2U1AA 2V63A 1R8AA 4RNNA 1S6QB 3MMCB 2K7KA 1L3KA 4X4OA 1IBKJ 3ET6A 2HWHA 3IGVA 2BQUA 2W57A 2BJ7A 2V1XA 5KG2A 1N32F 2A6TA 3BGFA 4E7JA 4J9NA 1B72A 5IT9Y 2XWYA 2R42A 3GFYA 3CVKA 4DZPA 3NCRA 3PEJA 1R3NA 3TWZA 1B6AA 2PMZA 2K3PA 4LRFA 2UXNA 4Q2MA 1BI2A 1PYSB 4EGZA 1FK9B 3R0JA 3DLGA 2G1DA 3BBBA 1YBUA 3ERMA 3IAM9 2CVIA 2RNEA 1CJTA 2EWNA 3HXLA 1NDPA 2FBIA 4DFPA 2WADA 3FBFA 5JXSA 5GADI 1TWGJ 1XGNA 4ZDOA 1FJCA 2GXAA 5THWA 2FD2A 4ZHRB 2C2DA 2D3ZA 3TW7A 3N05A 2HS0A 5KFWA 2ZFUA 3UR0A 3OY9A 1ITYA 3O5TB 2W2OP 4S0HB 4V19J 3QOPA 5SUHA 4Y2CA 5HS7A 1X1AA 1HWLA 4X4NA 1K79A 4CHUA 2RU9A 3TA0A 2LH9A 4YHHF 2BW3B 3JB9k 2KPMA 1IJFB 2O8XA 3WU1B 2XMUA 3HXMA 2IAJA 1FCAA 3R9LA 1ZELA 2J5PA 2DNKA 4DR2J 3IG1B 2W7NA 5KFSA 2HLTA 4H54A 2AJ2A 4ENKA 1NO8A 2IA1A 4H4KA 3GTLJ 5HVQC 1CULA 2Y0BB 2NVQJ 2DODA 4DFKA 1Y1VJ 1U6ZA 5EWGA 1JJHA 4NXNF 4C30A 3CD6I 4NA1A 4LIVA 4JX6A 2V67A 4ZN3A 4ILLA 2HFOA 5L3BA 4HLXA 4NLTA 1VQ7S 5LGNA 4EMDA 3F72A 2MEWA 1VNDA 2ZZMA 2K9MA 2EC2A 3Q3SA 2HDWA 4RB1A 3MPYA 1WDTA 4M5IA 1XGOA 4HF1A 2HBYB 4G65A 2RQKA 5EDWA 3QFHA 4QWQA 2RNGA 4KV8A 1OIAA 3C6TB 4HI1A 1RTHA 4P2SA 7FD1A 1X1BA 2XAFA 1J2VA 1MBGA 2JEFA 2R8IA 1DPUA 2GA7A 3M8PB 5CXTA 3KLOA 4IHWA 1YRNB 4DUZJ 3DF8A 3S1MJ 2QUFA 1SH2A 3OR1C 3S3MA 3OJUA 5A0YB 4EFAC 2DA7A 2CJAA 3P9KA 2DOEA 2H9ZA 2J76E 2HLUA 5D15A 4TLQA 3NGDA 4Y2KA 2Y1JA 4EATA 3TKYA 1IBLF 2LFBA 1JLBB 2XAHA 2QM3A 5GVQA 1GQEA 4N4OB 3HSRA 4EEFG 4JK1X 5HLHA 4CNZA 2KG1A 4WKRA 1K0TA 4DSJA 4CT8A 1ZPVA 2DGWA 4LIRA 5L1LA 2K3KA 1Q0NA 4NZ0A 3JRDA 4URGA 2OQGA 1IR2A 1KLMA 1H38A 2XDVA 4KMUX 5F0FA 2O9LA 2L9RA 1CEZA 3Q9SA 3CZ6A 2M3DA 4PAAA 2KRCA 1SFEA 2ZKZA 3RI4A 2Y2ZA 3LO3A 5J1PA 2YKAA 1CC8A 2BW7A 3HEFA 5K5QA 3G6VA 3EYZA 4U7DA 3OYGA 1X1DA 3ZZZA 1NZAA 4GO1A 1H89C 4C9YA 3QLHA 3W61A 3HX9A 4CM0A 1WC4A 4JV5J 3HB9A 4ED4A 2LBFA 1VC5A 2BANA 2FQQB 4OL8A 3WU2C 1R1UA 3IAM2 2VQLA 2DISA 3HVTB 4EYHB 2RVJA 3L7OA 3KYLA 3DRRB 2JZYA 3D9BA 1T9TA 2OEKA 1FMVA 3OR2C 3OOUA 1XR6A 4DQIA 2H4WB 3RR8A 1W5CC 1S7EA 2NXUA 3S6EA 5KVRA 5F8LA 4QR2A 4ECRA 1Q1HA 2M7SA 3KHRA 2GHVC 1ETYA 1U1QA 4KDPA 3GFMA 3FMWA 2E1OA 4Q0BB 2DR7A 1WHXA 4NCAA 4O4GA 1SBRA 5ETMA 2AXLA 4BBYA 5FROA 1VOMA 4NC8A 2C2MB 2XHWA 3DCAA 1RTZA 5HLIA 4UV9A 1U02A 1N6QB 1T7PA 1FTRA 3IMQJ 5E20A 3FEXB 3M8ZA 1IN8A 3HVAA 1JXLA 4LIUA 4YFXF 4RB2C 3N6MA 1WOSA 1GHCA 1QDUB 3I55I 4X62F 3MAJA 4DV1F 5KCMA 4B44A 3CXCR 1TL3B 1QTNB 3Q0AA 4KE5A 4F0MA 3SXYA 4NWBA 2AGOA 3ZQFA 2DQRA 3TZWA 3W9HA 2HFUA 4JI8F 2G2ZA 8ATCB 3BDPA 3F8MA 4M5DA 4NLRA 4OYWA 3ZMUA 4NLGA 3BG3A 4C2TA 3B6AA 3EUHA 1F2HA 1Z7LA 2MB0B 4WE1B 3GYNA 1XS9A 2R2SA 3CD5A 3KLGA 2OU2A 5E3RA 1SIZA 2M88A 5C24B 2W1BA 4L76A 5ETNA 2QC3A 3DLKB 1XK8A 1T39A 1UFKA 2BVZA 3SQGB 5GADU 1VQKI 3TANA 2IM3A 1T0FC 2DOAA 2FJBB 3OYAA 4OX6A 3DU6A 2V1DA 2Y8YA 1ZZNA 5LMNF 4BH9A 1OCTC 1ON1A 1BOAA 3HKWA 1KVKA 2QA2A 1TK0A 1N25A 2Y30A 3KHHA 3ILOA 1TWFJ 1OYEA 4MFBA 2DR8A 2VG5A 4F3QA 1L3UA 3G4SI 2GLOA 4OX8A 3DKXA 2JJ4D 4GFBA 4KJZA 1SFOJ 3QPIA 3N9UC 1WEZA 3A02A 2R3SA 2QSHX 1YOVB 2UXDF 1BGXT 1ERDA 2CG4A 2YKOA 3X3UA 1U8BA 2PE8A 1KU2A 3GZ7A 4RM2A 2OUMA 3CD7A 2PSZA 3ZRGA 5HK4A 1QD1A 4DV5F 4W92B 3BG5A 1S1TB 4Z7YA 1HHTP 2BEFA 4NLSA 4IO9Q 4DV6F 2DGSA 1VQ9S 1ZZFA 1DLOB 5KFFA 1EX8A 2AEJA 2F8HA 2PEHA 2DYSH 5T7LA 4ECWA 1RAGB 1ZGWA 1LWXA 1HNWJ 2JPCA 4LF4J 1V3RA 1KHWA 3ZGKA 3A8IA 2XMJA 4LMYA 1DQAA 4DV3F 2A05A 2HFHA 5A6WA 1MGTA 2JMWA 2W24A 2HAIA 4XK4A 4JI2J 4WIQA 3K4LA 2LXUA 2QKMB 3PVXA 4URSA 4U87A 1S1XA 1F9FA 3IXQA 4F91B 1XSVA 1U5TC 3TAMB 3D3CJ 1B0VA 3UDCA 3CESA 4XOPA 1W4MA 1ZG5A 4CRJA 3HOSA 2XMKA 2DMNA 1YSJA 4NB5A 3GJRB 3SYZA 3GP9A 3BJAA 1Y0UA 3C2GA 4YFKF 4TLRA 2ADCA 5EUHA 1X9SA 2RKIB 2HBZB 2AQEA 2QN6B 1PJ7A 4A0XA 4JYKA 4OIXA 1WJCA 3LA7A 1S1VA 2M3AA 4WK3A 3OIQA 3HGGA 4DDFA 4ZVOB 5B0EA 4HV5A 1QJHA 3RQIA 1WC6A 3AFHA 2FHOB 4F2SA 5F8HA 3MI7X 4ID5A 2ZSIB 4HI2A 4I7FA 1S4FA 1BWVA 2J7KA 1MBKA 5J2PA 1W36D 3WTTC 3ZTSA 2C2RA 3PJRA 2CRLA 2EPFA 4MYTA 3UN2A 4Y3OA 4ZTJA 2HTJA 4C8LA 3MWBA 2MPUA 1H0MA 2YPYA 2ACMA 2F1FA 3E6DA 2X48A 5D8LB 3W64A 3KP3A 4C8ZA 3H9JA 3A0BC 3M8EA 2ZDOA 5F0CA 5BR8F 1BI3A 5FIIA 3CJ2A 4AD6A 3M1VB 3L2VA 3ZPLA 2B4OA 4ZP9A 2OPSB 5HNFA 3JTHA 1Y3JA 1OCCH 4H4MB 3HPGA 2ZVIA 1BR1A 2N3OA 1SJRA 1LQ9A 4G7OF 4PSWA 2BKOA 3W6VA 1IUJA 5G0RB 4G6QA 2Z4PA 4XQFA 3PO4A 4WK1A 1K7AA 2AHOB 3MD2A 2BKNA 1GXPA 1X4CA 4UOFA 2E9TA 1SQEA 3MMJA 1JNZB 5GMDA 3CIMA 2JFKA 1JWWA 5H2FC 4L9VA 2UUTA 4EEYA 1KU7A 2VXZA 4ECZA 3BTLA 1K44A 4ECXA 4K8RA 4DU7A 1U9NA 4I0WA 4KHMA 1KQ9A 5C44J 1BY9A 2XY6A 2UV8G 4A6DA 3KZYA 4CLTA 1E6VA 2BJDA 4F52A 2K06A 2OFGX 2XAQA 2HPIA 1R5GA 2FU4A 3FKBA 4ELTA 2QZ8A 1OJ4A 4HTIA 2W9CB 3S8PA 4C9DA 4M94A 5E3MA 3I58A 1IN4A 4ZYHA 4A3EJ 2VQCA 2BUNA 1R7JA 1TMMA 4GRSA 1FK9A 1X8DA 1C2PA 4MHGA 4K2XA 4RW9A 2V2QA 1S8NA 3EUHC 2PI0A 1WKJA 2EH3A 4BCAA 3PW7A 2HTSA 4IZZA 3I96A 1MSEC 1QSYA 3IWLA 5D5VB 3DKDA 2B56A 4KJIA 2YKNB 3K59A 4R5PB 3R4KA 1K6OA 5LM7E 2LKXA 2F63A 2MGZB 4A8YA 3QGHA 2W48A 2ZH6A 1FESA 2GQ2A 4RW7A 1NK2P 5KAIC 4WFNQ 1E17A 1RESA 1HMVB 3IG1A 5B1AH 3BDEA 4LF2A 3E5UA 3V6DB 1PYVA 1ACMB 1KC8T 2WONB 4X4SA 1T05B 1CG2A 1T8EA 3WDOA 4LFAF 3TVKA 1TW3A 2IS1A 1TWAJ 1T8IA 2RVCA 2RAQA 4O3RA 3BPDA 4ELVA 3S1NJ 3CJKB 5FLXZ 1ENHA 2XROA 2DA5A 5KFJA 3DN9A 3SSSA 4QU6A 2M70A 2V68A 1UWBB 1U2WA 4IKFA 1I6HJ 2P4WA 3LSKA 4A12A 4W90B 5EEGA 3N6LA 4QQBA 4K59A 1HPZB 1WI9A 3RKXA 2KL8A 3M8PA 3J7ZT 1EIYB 4Y2AA 2I5UA 1O3QA 4JYAF 3F6OA 4U7CA 1XD7A 1FX4A 1OSCA 4DIQA 1VIXA 3FXKA 1QRYA 1NHKL 5A0YA 1X5OA 2AYMA 2J6SA 3VYRB 3IS9A 3M3YJ 2DTZA 1IXSB 1KQGB 2Q8KA 4FNHA 4WWSA 4DL6A 3OD2A 1V5FA 4ENJA 1H0HB 2AEFA 1P9QC 2ALYB 5L9XA 1YHQI 4OJGA 1ONVA 1FVQA 3UCZP 4QYZJ 1JUPA 3EVOA 1Q16B 3CCZA 2GNKA 5FD1A 2NVXJ 2K3IA 3UD5A 3KP2A 2JEJA 2F5FA 5D4OA 1DQUA 3W2VB 5E3LA 1X4EA 4C4WA 1IZ1A 2N4DA 2IS4A 3UNYA 4HA8A 1Z6TA 1GXTA 2ASYA 1WJ9A 2LVWA 1HQCA 2FZGB 1SMYF 3OYCA 3U1LA 2L7KA 2ZVSA 2IRYA 3OTEA 3PFYA 4RWXA 4QIFA 1YYVA 5FDLB 2HQFA 4LG3A 2VODA 3D67A 5E3QA 2O01C 1BJAA 3FK6A 4IRKA 3TUJC 4Y28C 2UVVA 3DV8A 4BS2A 3D5SC 3FK7A 1R1TA 5ILVA 1QAYA 4NMXA 2CWXA 1NZ8A 1E3OC 1Y8RB 5KFIA 4DF4A 4S04A 4OIRF 2ELKA 3DLLQ 3DHWC 4U8YA 3B54A 4R8UA 1YJNS 4JI3J 3BT9A 2DMQA 4QIGA 3WX4A 5ETSA 4UUVA 2MH2A 4HT5A 3HVTA 1SAUA 1TC3C 4A8XA 2XMVA 3KHGA 1WVRA 2W2NP 1A6IA 5D3GB 1O57A 2XPUA 1WKLA 3B82A 5JHUA 4CLPA 1AZSB 1PILA 5GAGI 2GZOA 1ZGAA 3T0YA 1MDMA 1Y11A 3KNAA 1IVZA 5HMWA 3MD3A 2DU9A 3V81B 2AEMA 4KSEB 3K8VA 2GM4A 1OWXA 1SH3A 4BWMA 3BSOA 9RUBA 4X65F 1WUUA 3J7YI 3T5JA 4O3PA 4OI2A 2NVYJ 2VC0A 2LXIA 5HI7A 3K5NA 1E6YB 2WRMA 4RGXA 2DNOA 2G7HA 2CAJA 1N6QA 2DNPA 4A3IJ 2E71A 5K8OA 2EILH 4LVNP 2YU9J 2MZ1A 2B8PA 2F40A 1FO1A 2UVUA 3AQPA 1NJIT 3GR1A 3CJQB 5K8NA 1AW0A 3I0SB 3W65A 5CPRB 5M3FJ 3WGHA 1TU0B 2CGPA 1LFUP 2A6HF 4G9YA 4FVMA 4BL0B 2Z2ZA 1CSJA 1KOHA 3I6PA 3OLBA 1RI7A 1YX3A 1D9FA 2QA4G 2C42A 2L4AA 2BACA 3OUYB 3QATA 4ZPTR 2HQ5A 2L9NA 4MNUA 4X66F 1RAIB 3T1YF 3WC0A 3ZMDA 2LD5A 3W2AA 1H98A 3E2EA 3WTUC 3KG4A 4GC7A 4CH7A 2HG4A 3DGVA 1IDYA 4B08A 1IV8A 5AXNA 4HKQA 1AXQA 4M9ZA 3H0PA 1G3WA 2MQQA 3CSKA 4RLFA 3K5PA 2CYYA 4MAKA 1T38A 3I5AA 4JP0A 2LREA 4M3BA 4ED6A 5C24A 1DQ9A 5FKOA 5IM0A 2LVSA 2HNZA 3DLKA 1WD6A 3OWTA 2HVHA 3SQGA 1QZZA 3CJ5A 2KZVA 5IYCJ 4LITA 1H7WA 2ACYA 3MUTP 4I2PB 2ZC2A 2DXFA 4HL9A 2CPIA 4F25A 2CDQA 2FUG9 1NDCA 3O3LA 1F5BA 1TK5A 1NKBA 3H92A 3DDKA 4HQMA 1VQNS 1HHQA 4F2RA 2M0MA 1S9GB 5HBMB 1C0UA 2UXBF 2QLXA 2LKSA 4WPAA 1EH6A 5BYQA 2WB4A 1X31C 3MEKA 3FSYA 3CDHA 2IRFG 1IKXA 1DZ5A 1AROP 1RWUA 1TAUA 2CJJA 4OJ1A 2XSJB 3QSIA 1F5CA 3UKGA 4PG5A 2M0GB 2XGXA 4C8MA 1UA0A 1S48A 1HSTA 1PJRA 4P72A 3QT5A 1S1TA 3EZ5A 4MTPA 3H98A 4NZ7A 4X0GA 4YEAA 3EE3A 5LT5A 2OTJS 3SEOA 5D4SA 1XGMA 4IH6A 1U49A 4QU7A 1URRA 2DYAA 2HXOA 1U7LA 2V6EA 2TDXA 1KOOA 4ZPVR 2QLFB 3J7A1 3NNCA 1BE4A 3CJ4A 2L7MP 1UJ6A 3SCJE 5D4RA 2HYFA 2XPWA 1BR4A 3E6BA 2JC0A 4DR3J 1MMNA 2CZ9A 4E0DA 4ZDPA 1EH7A 1AB8A 1B7FA 1U2RA 4KN7X 5ERIA 4M5MA 1T95A 1O3RA 4J7CA 1Q53A 2OAZA 3DRXA 1PYTA