1KONA

Crystal structure of e.coli yebc
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
244
structure length
233
Chain Sequence
GHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLDANPRLRAAVDKALSNNMTRDTLNRAIARGANMETIIYEGYGPGGTAIMIECLSDNRNRTVAEVRHAFSKCGGNLGTDGSVAYLFSKKGVISFEKGDEDTIMEAALEAGAEDVVTYDDGAIDVYTAWEEMGKVRDALEAAGLKADSAEVSMIPSTKADMDAETAPKLMRLIDMLEDCDDVQEVYHNGEISDEVAATL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title UNPUBLISHED
rcsb
source organism Escherichia coli
molecule tags Unknown function
molecule keywords Protein yebC
total genus 63
structure length 233
sequence length 244
ec nomenclature
pdb deposition date 2001-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01709 Transcrip_reg Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1konA01
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1konA02
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1konA03
1WJCA 3HPHA 1WJBA 1MW7A 1WJDA 3F9KA 4F3QA 1K6YA 1LFPA 1WJEA 1WJAA 1E0EA 3HPGA 1WJFA 1KONA
chains in the Genus database with same CATH superfamily
4DV7F 1D3YA 5DGBA 3Q9VA 4F52A 4Y3OA 2DCEA 4Y6IA 4DF8A 2FRHA 4P75A 2O61A 3IV5A 4HW0A 3PZPA 4TY8A 5ICCA 3MF5A 1ZH5A 3PTWA 2IEKA 2MW8A 4RM3A 2CIMA 5HLGA 2WVBA 1O5JA 4GXOA 5LEKA 3MEXA 1X60A 2QM3A 3KFWX 3OYJA 3AY0A 1SXLA 2K9SA 3O8HA 2HHVA 2LOOA 2LLKA 5DM7F 2OPSA 3I4HX 5FFXA 2LQ5A 3S16J 2QCOA 1LWCA 2FTRA 2Q2EB 3QPSA 1S7IA 4NYOA 2HKXA 1B99A 4ZP7A 3WHIA 2NS7A 2W7OA 1NB2A 2Y1RI 1D8KA 3ZTQA 2LKSA 2PI5A 2DA6A 3IAM2 3FFIB 2DO0A 1RABB 4CLPA 2D2WA 1Y5LB 1D9AA 2OPTA 5FKMA 4B09A 5LM7E 2K9MA 3GZ6A 2OFGX 3KLIB 5FJ8J 4DCOB 1F5AA 3S32A 2MTLA 1RWKB 1DLOB 3D6HB 1T38A 5ICGA 1WFXA 4PXBA 4DG1A 2KFZA 2LYVA 3BJYA 1JTXA 5F1RA 5E3OA 3ZZPA 3JRCA 2CW0F 1MDMB 1HD1A 2XSFA 1DLOA 3O5TB 1CQTA 3WHCA 3QODA 3MTKA 3K4LA 4WJBA 4M6YA 5G0RA 1BA5A 1ERDA 1VNDA 4PFOA 2W4PA 2FC8A 4YRVA 4AC0A 1RWWB 4L9VA 2PMZD 4NL5A 5DCFA 2E1CA 2FEZA 4ZPDA 1R23A 4HACA 3T6JA 2YNIB 4ZVSB 1YX2A 5A2QZ 4MMOA 4L72B 2XBPA 1UA0A 5GAGI 4LR8A 4OYXA 3E0JB 2OELA 1S9HA 2L9NA 1SCJB 1MU2B 1Q8KA 2C3PA 3JRFA 2YKQA 4W98A 1PILA 4HX8A 2DGOA 2MD5A 4MQ9F 1RUSA 2PO4A 1BR1A 3MM5B 1XMKA 4OIRF 1SB6A 3VQTA 1CGPA 1FDBA 2LD5A 2KIQA 1MJAA 4XTTA 4IRIA 1PJRA 4XLPF 3BGRA 4CLUA 5ETOA 3C2PA 4XPCA 3VV2B 3C6TA 5GAEI 2BY3A 2V1XA 2J0XA 4DI6A 2WW8A 4RPFA 5GADJ 4CLSA 2BE7D 4DFPA 3V4IA 3S8SA 4JX5A 4ZIVA 2HURA 3F73A 1VQ9I 1U5TA 4QWAA 2KZZA 2B8QA 1SV5B 3NRVA 5K8NA 3M8FA 4GO1A 1R6YA 2IYIA 5EWFA 3HXLA 4ZJLA 3KHGA 3NCPA 3C3WA 1S5ZA 2FBHA 2R7ZJ 2B4PA 4S0HB 3P7NA 4CCLA 3UKGA 4XMYA 6PAXA 1WG4A 2I5UA 2OD4A 1PYSB 3OXLA 2X1GA 1WCMJ 2NS8A 2GAHC 4TLRA 2JEFA 2RS2A 1QTMA 2KISA 1IZ1A 3PHTA 2VONA 3F44A 1T56A 4QWEA 2XMTA 3WG7H 3MEKA 1NNDA 4YB7A 1HR0F 3DBRB 4LK0F 3CJQB 2CS3A 4BU2A 2E2HJ 1S59A 1WEZA 3LWLA 4I6YA 2ACJA 2IPOB 1XGSA 3T1BA 1K47A 2QA1A 3CJQA 3NQOA 2O8KA 2Y2ZA 4K2JA 4EVIA 3FXOA 5D4LA 2AWZA 2H6CA 4D7NA 1YFHA 2Z30B 4EO8A 2IA2A 3OS0A 4KH0B 3F56A 1X2MA 2UVVA 3QPTA 3BDPA 1A6QA 1J75A 5EWEA 1KHVA 2FVPA 4F25A 3DXBA 2WC2A 1OS5A 3N05A 2QO3A 3IWLA 5DDGA 3CCLS 2FPHX 2CV2A 5DCMA 2EFGA 2VPWB 2RVJA 2QIFA 4I6AA 3V7SA 2K1RA 3GTGJ 5CQEA 4A8QA 3HVWA 3PRBA 4CQ1A 1PYTA 2E1OA 1FJGJ 4IHXA 4UW2A 1RWNB 3T6BA 1HOMA 2IGMA 1SJQA 3M8EA 2HVDA 2BANB 1CPZA 1RT5B 2WVEA 1VI7A 3U9GA 4J9VA 5HLIA 1GMWD 2GWRA 1ZR4A 3R5AA 4X4VA 4C3IJ 3LFUA 2FJDB 3RRHA 1T0FC 3D0SA 5IYDJ 4OHZA 1Q8BA 4JBCA 3TOQA 1YS6A 2AJ0A 2EWHA 1FKPB 1ULRA 3FZ2A 4CLKA 3KLVA 1FPQA 5D5XB 4U88A 2CPXA 2EFPA 2CQHA 3VAGA 3BWGA 1TV6B 2IDEA 3HHLA 3ISND 1T8IA 1LWFA 4PEOA 3S93A 2VKZG 2B0LA 4TVAB 2R7WA 3OV8A 4OYBA 2E5IA 3C2BA 4LQ3A 2CQ0A 3MM6B 3OR1A 1X1PA 3M8YA 4L74A 4QIWN 1UJ5A 2BJDA 4G6DA 2DHHA 2ZE2A 3V6HA 3IWXA 2WVDA 1TL8A 2ZSHB 3DLLQ 1QHHD 4CYCB 3W3CA 3F72A 1NG7A 4ABZA 4P9SA 1KFDA 3JR9A 2MQ8A 2ZH7A 1SKSA 2YKAA 4OI3A 1VCTA 3RBXA 2DT6A 3CCMS 1YJNI 1T39A 2ZZMA 3UDCA 1HBNB 3GTOJ 1YI2S 3MFHA 2QEXS 1FC3A 2M3AA 5GAEU 1B72B 1NDPA 2KRCA 1L3SA 5GAHI 3D5RC 1QLNA 1BXNA 2LKZA 4ZP6A 1F1ZA 3DLAA 1IM4A 2FJEB 1H3DA 2YNFA 4DSKA 5B7WA 2DEIA 1VC0A 2IIHA 1ITYA 3QYEA 4KFCA 2DDBA 3PX0A 4K59A 4ZK7M 1XC5A 3GTJJ 5GP9A 1U2RA 1ZAXA 2NCKL 5BR8F 1KTVA 3BR0A 2FQ4A 1FRHA 3J7YJ 1QNTA 5D6EA 4B3MF 1UG0A 2HFVA 4YN3B 3RRKA 3U1MA 2GS8A 2YNFB 2O8XA 2FA5A 3MUTP 4G6TB 4IRCA 2E36A 1OJLA 4UVBA 3H9GA 2RIJA 4HX4A 2L2OA 4E98A 1MROB 1SEUA 3RKXA 1CQMA 2YUSA 4C8OA 2H1LA 1SC6A 4OYZA 1RDRA 2CFXA 4KGKA 1R22A 2ZH8A 3CC4S 1HPZB 2OCCH 5D8LB 3GWZA 4Q4ZF 3OUYA 3JQKA 1IM6A 3WQPA 1OY6A 1Y3JA 1VBXA 3SMZA 2LP4A 1SJ3P 1TL4A 3NS5A 4H4OB 4PJ0C 3S6EA 1OQ3A 2RB7A 2YPRA 2NVQJ 2XV4S 4BBSJ 3RB4A 2X1FA 4DV6J 4AWXB 2HHSA 1RTJB 3CCJI 3D67A 3KP2A 2EB7A 3ELKA 4K4UA 1V3FA 1UVJA 1FNNA 2RDIA 4NA3A 1N54B 4FPRA 2DA3A 1M1HA 1RE1B 3N5BA 2CUEA 1UFKA 1TR0A 1PDNC 5AE2A 4RWXA 2YWFA 1FTTA 1C0TA 4HOBA 3S1QJ 4WYWA 5LD2C 4HSRA 3BJ6A 2MKJA 4X62J 4KUMA 3PO3J 4N5SA 4BHCA 4MEXF 1WNEA 1Q53A 5IT4A 3V7CA 3LSKA 3OIPA 4WXWA 5K14A 2NVTJ 2L4AA 3GJQB 4Q43A 1APSA 3CDBA 3V2UC 3FSIA 2P8IA 1RU2A 1NLKL 3NCRA 3OLAA 4NCGA 3TMOA 4FT8A 2GLOA 3ZMVA 3VGSA 2FHKA 4RW9A 2QMUB 2W1OA 5A6WA 1XSDA 2LSOA 1HNVA 5H9FJ 4ALZA 4LK1F 2MEWA 5E5NA 2PMWA 5A0YB 1CF7B 2IA0A 4UUSA 4I99C 4JI6J 5DJBA 3GF2A 2IM3A 4Z7YA 4BY7J 1IKVA 4X4TA 1LUJB 2ZWOA 3C14A 1X4DA 3SDGA 2WSCC 4LLLA 3W5XA 2DXDA 3WTYC 2VG7A 4DJBA 4FYVB 4G3IA 5E79C 1MNMC 5KT2A 1JKPC 2WK4A 2F8EX 1HNVB 2PLYA 4NLRA 2W8KA 4BC7A 3LP0A 2HHTA 1Y56A 4M74A 3DQVC 2DIUA 1R1TA 1N25A 3DTKA 3AXMA 3D6FB 2UWMA 1WHXA 1XDSA 5A8KB 1KLMB 1NK7A 2V6CA 3ZTRA 2CJBA 4BBRJ 3TEGA 1UKUA 4Y2CA 3E6MA 4DQSA 3JRGA 3W2VB 5KFHA 3MEDA 3OD2A 2VOPA 3CIMA 3J7ZI 2ZBRA 2CPFA 2U1AA 4NLVA 1VQYA 3CLQA 1I27A 2YWGA 1E17A 3Q86A 2B9YA 4ZTFA 5J2NA 2M8EA 3MMCB 5H9EK 3S2DJ 5KK1A 3HTUA 1T02A 4P6QA 5DZ7A 3HHLB 4DR7F 2K9QA 3PW2A 1H0MA 3IGNA 5A0YA 5D3GA 1J5EF 3UDLA 1TUGB 4RW4A 2OPRA 2A6MA 1R1VA 4ZYHA 2ALYB 2PGCA 2N82B 1XC9A 4HTIA 4NLOA 4AXIA 1RKJA 1UZDA 1VI0A 1TKTB 3TAPA 2HSEB 3D9BA 2X1EA 1UJ4A 5CA5A 1HSJA 3PXGa 1OMIA 1KD1T 3U2RA 1B4AA 2W7NA 2MZ1A 2CDRB 5LHGA 4XR6A 2V2QA 4ZS6A 3SV4A 3J7A1 1SMTA 2COBA 3HZEA 1XNQJ 1ZM9A 3VAJA 2QLXA 1RLDA 4KIGA 3N28A 1ACMB 2ECBA 4DYRA 3MURP 3N6LA 2Y48A 1WQ2A 5L38A 3TZWA 2PI4A 3NARA 3MOZA 3GILA 1M90T 2MMYA 4ZLLA 3HFVA 3FK6A 3X3UA 1JK9B 4CCOA 2QSWA 2V9VA 5IOYA 3RYRA 3HFZB 2RUGA 2MY7A 2ACYA 3QT7A 4GRSA 2RDDA 4FYYB 1ZPWX 4PZVA 4M3FA 3CCRI 3C15A 1VQKS 2M4MA 4F3MA 4IKAA 4II3A 2CVEA 5ETVA 2VQCA 2A3SA 3B8HA 4BE2A 5B0DA 3QYFA 3IKVA 3JSMA 1H2UX 1U25A 3GR1A 2DXEA 1I50J 1HCRA 5A2QK 4NLYA 2WAQN 4YFUA 4AL7A 2FVSA 4CO3A 3OYMA 3CJTA 1HSTA 3S14J 1YITI 4KE5A 2L4MA 1TT0A 5JXSA 2O5DA 1MMLA 2YWKA 1R58A 1HL6A 3GCWP 2GX8A 1PG5B 3KEQA 4ZMMA 3CEDA 4RAFA 3MZ8A 3DRSB 1MW7A 2XSDC 1SD7A 3IAS9 2STTA 2CJJA 5IXUA 4HT5A 2F5GA 3C18A 5IQ6A 3KP3A 2R8KA 4IRDA 3FXKA 4USHA 5J1EA 3CF5F 4ZVOB 1JJ6C 2Y30A 3EVWA 5IOLA 4DZ6A 2FQQB 3P9CA 1JUSA 1EJ7L 2VJIA 1RACB 4LRCA 2RH3A 1YW7A 3EDRB 1UTAA 2NS0A 2EFWA 1PSDA 3DDNA 4OJ3A 1FCAA 3TOBA 1TMJA 2GQCA 4RW8B 4U0WA 1UG2A 4RW9B 3N9UC 1SFOJ 1RAGB 3B54A 3MCSA 4GVLA 2ZOFA 4DV5F 2IM1A 3ENVA 5GTHC 5FD5A 1S1WA 2I2YA 2PJRB 1MNEA 2VA2A 2CWEA 3V8JA 4FF4A 1RT4A 4OOIA 2KYXA 3ZZRA 1A35A 2DOEA 4NC7A 1HWJA 4J5OA 5J4YA 2DHXA 2AJ1A 4XK4A 1RHJB 2DTRA 4N8NA 1B72A 2OJED 4H0EA 3LW5C 5EG0A 3GLJA 5FLVA 2O7OA 4HTJA 1RBLA 4G7ZF 4NXMF 2WA0A 2CV0A 4B47A 1HW8A 4KN7X 3QGIA 2QUFA 3TQEA 2XYHB 1KYZA 4K4ZA 1Y11A 3HFKA 4GRIA 1S6QB 3TBIA 2I6WA 2IMWP 3PIPF 2OPRB 3CCQI 3TJAA 2P8TA 4X64J 2NYXA 4UF4A 2HWVA 3RKYA 4Y34A 3FHNA 4ZPBA 1IV8A 1RI7A 3GBGA 3I96A 1XB4A 1ZAWA 2HFOA 3TW7A 2HOTA 1G3YA 1XN7A 4QJVA 3FCVA 1U8SA 1XG1A 1XR5A 2OD5A 1USSA 3HGYA 4GO7X 5IV4A 2GXAA 1LB2A 2GMLA 2VJUA 3R0JA 1VLOA 3IG1B 3H2UB 4JX4A 2DR9A 4HBLA 1VHIA 1L0OC 2CO5A 2RRAA 4MIAA 3GSDA 2OMLA 2H3EB 3ZZZA 5K7HA 2LDYA 1T9TA 2OEMA 1ACIA 3BDEA 1PBUA 3HJVA 2IM0A 3A0BC 1CC7A 4JBAA 4OV6A 2ELJA 5KFJA 3T8TA 2LP0A 1MMAA 3KZZA 4C9DA 2PSZA 3DKYA 3JXOA 4CO1A 1ZTWA 4CZCA 2CQNA 2IBKA 4V19J 4S04A 4QWCA 3FKBA 2EILH 4A6EA 2GBYA 4QCLA 1FO1A 1UHSA 1R7JA 4OINF 2HPUA 3HI9A 2KMUA 3CCSI 1WDTA 2BE2A 3AQPA 3UR0A 3DLGA 3D3BJ 1VBYA 3GVAA 3MUMP 3AG3H 3CJRA 1IN4A 1P9YA 4CZZA 3I5UA 3SSRA 4M5KA 4BDYA 3VPRA 2I8DA 3ETOA 2QWWA 4MK8A 1XJWB 2F6CA 4HT7A 5E41A 4EGZA 3MM6A 3F6VA 2Y1JA 2YQ3A 1SVMA 3WTUC 5ETQA 5ETKA 3A8JA 1UFWA 3UVJB 2A69F 4K4VA 1OPIA 1ZTRA 4YIRX 1HNIB 1TFWA 2I5JB 4JI6F 4NXNJ 1FOWA 3GYNA 1IJWC 1TKZA 2J9CA 1IR1A 2LECA 1GHCA 2ZJ2A 2R5YB 4RNHA 3EDQB 5EN1A 1B59A 3H4DA 2M30A 4MKAA 2ALZA 3R5CA 3MECA 1BC8C 4YEAA 2QFIA 2A6EF 4OLOA 5F8HA 2RF2B 1D1AA 1FZPB 1JLCA 4B3XA 1IKWA 4FHTA 1WHYA 2ZJRQ 4M9ZA 2Z9OA 4WK3A 1JNZB 2AEJA 2D3O1 1BY9A 1JLCB 3HG9A 1UEVA 1E6VA 1YJVA 4IKFA 4QPOA 3HIFA 5DG9A 1C4CA 2OAZA 1HWIA 4CTAB 1WOOA 4ZDOA 2O66A 2ZH6A 1GNKA 2ACMA 4YP3A 3F23A 2HNZB 4LIWA 4RW6A 1HHSA 2EW9A 1IBKJ 3WTXC 3M7GA 2HG4A 4QWBA 3LTOA 2VH7A 3ASOH 4LFBJ 1BIBA 1WF1A 4LSLB 3JYTB 3ZO7A 1O7LA 1MBEA 1G2EA 1YGYA 3QATA 5KHDA 5E3RA 3TL4X 1JLAA 4O5VA 2VV5A 1U78A 4QYRA 4B43A 2RS8A 2EI5A 5FD1A 4DR7J 3R5DA 4IO9F 2DNKA 1FFGB 1WHVA 2GVZA 1VQ6S 4XLNF 2I38A 2YKPA 3TP3A 3MCOA 2IGKA 3MR5A 1A36A 1FBUA 4J90A 4NRTA 3OL3A 3MAJA 3B73A 3VZIA 3GXOA 2YX1A 1IBKF 5H6RA 4KGVB 1UW9A 2EK6A 5F8IA 4ECZA 3KDOA 1F5TA 3BN7A 4LLNA 4DSIA 3I9ZA 1WJEA 4RAYA 4QWDA 1T3NA 1URNA 3T9NA 3OFHA 1M5OC 5FRMA 4IUFA 2Z3YA 3V4MA 1W7PA 1XNRJ 3GV5B 2HWTA 2W2OP 4KKOA 5KG2A 5HQLA 2HQ3A 3SZGA 1XERA 5KG3A 4RGXA 4BDPA 2AZ3A 4G7OF 2HK2A 4DMZA 4K4WA 4BJ6C 4DL0C 3GLLA 1NSAA 2KHDA 3QQAA 2LBFA 1VQ5S 2HVIA 1Z9CA 1D1UA 4DX6A 3MKYB 3AAWB 1QY7A 2CV1A 1C0UB 3IR7B 1VRUB 4CO2A 2HWIA 3T1HF 3TKYA 5LMUJ 4A8KA 3J81j 4PUOA 2R8JA 4ED1A 2I9SA 4XSXF 3A8IA 4B3OB 3K8WA 2GJ2A 3KLHB 1X9WA 1B0TA 3G6YA 4YFXF 4QZVB 1WHUA 4ENJA 5EX0A 2W9CB 4KRWA 2DD8S 2GW8A 4UUXA 4IDKB 5IC4B 4N4NB 1GMVA 4ES3A 3A4TA 2P5VA 3KG0A 3IUOA 2RKIA 4CLWA 1KA8A 3RAMA 1JXLA 2FLOA 2VQFJ 1WJAA 5DS9A 2CA9A 2RKIB 2EIMH 3CCTA 3GMEA 2JA8J 1Q0NA 3GSIA 2W82A 3F41A 1R27B 4RAGA 2R3SA 2F5EA 4X66F 1WGXA 2LFBA 2VZ9A 1EA3A 2ZO4A 4FF1A 1NK9A 3CDEA 5JR3A 3GFLA 1ZLJA 5IWAJ 5C24B 2Y9HA 1RB0A 2VG5B 4WP3A 3EPGA 1J5OA 4FX0A 5EGOA 3DXJF 4O3PA 2MXYA 3JW4A 2W00A 2KZGA 5F0FA 3RKQA 1RAOA 5A8KA 1YIOA 1Q8IA 1Q7LB 5LT5A 3J7AN 4F4KA 2HZCA 5HANA 2DGTA 2L41A 1XMQJ 3LSMA 3MXHP 5FDLB 4Y52J 1I94J 4CLLA 5A2QY 2WZ1A 1LQ1A 3ZFVA 1YDLA 2ZC4A 2XS2A 4UVCA 4OMZA 2CGPA 2XPWA 3FNNA 5F64A 3RJPA 1M5HA 4K4XA 5DLFA 1KBRA 4PGHA 3KZYA 1FX2A 2FE3A 2KM8B 3BROA 4F2RA 4RGRA 5K9FA 4ER8A 5KT6A 1FOYA 2AX0A 4KHRA 4KFBA 3RTVA 1SIZA 3ZQGA 4L5EA 1JLEB 2FJ1A 4YR0A 1FRMA 2XYPB 1V5VA 4O3QA 5HLFB 4HYEA 4PAAA 3KOAA 1LQ9A 2VL8A 2FGCA 3TP2A 4D3GA 2IS6A 2XKOA 2W2QP 2ISYA 3PDNA 3TNVA 3CP8A 2YWHA 2Z2YB 1NDCA 2BY1A 3OS2A 4FKYA 1JLAB 3KUHA 4PG5A 5HDKA 4I56A 4XM3A 2YQ0A 3BS9A 2AYBA 2VG7B 4ES1A 1YJUA 2GVZB 4A8MP 3ITHB 2WB1N 3Q24A 1DGRM 2DH9A 5DQHA 2E7XA 1LDDA 2JOQA 3EMTA 2AMCB 3IGVA 3L9FA 2Y1IA 2HBYB 3F8BA 3A1YG 3DRYA 4USUA 4BE1A 3HCXA 4IF4A 1DPRA 1IUJA 2XY5A 1RUNA 2MJUA 2O9LA 1YLFA 4D5FA 1B6AA 4LFCF 1KC8T 4TV7A 5D6FA 3TA1A 2W85A 2UUBJ 3PJRA 4N9IA 2CG8A 2Y0SN 4B3AA 5L1KA 3WE2A 3L2WA 1TKXB 4BS2A 2CWKA 1N5SA 5AT1B 1ZQ3P 5LOQA 4MYUA 4L9JA 1I6JA 2IRXA 4LIUA 3FXQA 2EKNA 2GIRA 2KJCA 4GVBA 1WHWA 4P2MA 4P2FA 3R97A 4FDFA 3Q9SA 3L2QA 2B4VA 1H2VZ 3PY8A 4I2QB 2GA7A 1PC4A 4XDCA 2ESHA 5KFQA 4OAYA 3RPUA 3OYIA 4F26A 5ITHA 1ELOA 1TT5B 2UVWA 5BJRA 1ETOA 1W4MA 2DW4A 3V6JA 3B6AA 3M4OJ 2FY8A 1NKBA 4YR3A 2OHDA 1QBJA 2KDOA 3QAHA 4CXFA 2QA2A 2DPIA 2XAQA 2J8SA 1S0OA 3FSXA 2DIVA 3AHPA 1D09B 3QIPA 5LXYA 3LMMA 4AM3A 2MY8A 4B3TF 3LFKA 4GKJJ 1NBEB 3BR2A 4NHJA 3PNTA 2EZIA 1S9GB 5J2MB 3G4SI 2VL1A 1DU0A 4L75A 2HK3A 2DR6A 4C2TA 3CCEI 4TNOA 5H6QA 1S4FA 3SDEB 1FRKA 4CM0A 5I3UB 2KXFA 3G2BA 5I42A 3BGOP 2VJ5A 3T5KA 1RT6A 1RT7A 4ED2A 2XY7A 2ZOGA 2DMUA 2VXDA 5B0EA 3NKYA 4U8VA 3AODA 5C7PA 1V9OA 2YKNA 2EG1A 3AG1H 4CLFA 4RB0A 3JRIA 3PEJA 1U26A 2PE8A 5GMKa 5FKLA 2GJFA 1S9EB 2B56A 3K5LA 1N88A 4MQVA 5E17F 2H1YA 1UHWA 2BM1A 1P1TA 4M95A 1NSQA 2BE9B 5GAHJ 2LQ8A 3PRDA 3TW6A 2M5WA 4Y33A 3ASNH 1X5OA 2GQ2A 2ZDPA 4DFKA 1HBMB 4HNVA 1WDDA 4PXEA 4YB1P 1Y0NA 5E3MA 4KHMA 4RLEA 5F8NA 4RU9A 1EJ9A 1IBMF 4DR6F 2MKCA 3HF5A 2Q1ZB 3R61A 5F3ZA 3CUQC 3HT0A 1M5KC 2C2MB 2HAFA 3LNQA 2L3MA 1QU3A 1K83J 3OIOA 2V6AA 3VQSA 1SJ4P 4L5IA 3A3PB 2LMDA 4YOEA 1K1SA 1RWPB 5CYQB 2L9VA 1QTNB 3BF4A 4KITB 3SZ2A 4CP5A 1N0UA 5DM7Q 4NA1A 2F8MA 3J81K 1DP7P 4DR2F 4ETSA 4YB6A 3FXUA 4AUKA 2XGPA 3VYTB 2ZE2B 3NLCA 1BN5A 4KPCA 1WF0A 1X1CA 5D0EA 1YSJA 5TISC 1IBMJ 1RTHB 3BN4A 4LBPA 3K5MA 2ESNA 3GP9A 2YNGA 2HGLA 2K7LA 3OW2R 3NAHA 4B9VA 2K06A 1QE1B 1HIYA 3G8SA 4M94A 2HOSA 5C2CA 3M1CA 2XRLA 3DGPB 1O57A 3QFHA 3JAMU 2C2OB 1TNSA 2ZBKA 3VSLA 1OIAA 4I7HA 5B0CA 5M3MJ 1LOUA 4KTQA 3I71A 1R0BG 2KJVA 1SD5A 4XL9A 3R7NB 2OLWA 4IG0A 4F3QA 1IDYA 4DL6A 2CRLA 4L0ZB 1VR6A 2VQFF 4P7TA 3HPGA 2R7FA 3W66A 2NNYA 2BKOA 2YNHB 3LO3A 4DUYJ 5ICEA 5DM6F 1C1BA 1TK8A 1K7AA 4X66J 4P9UA 4C30A 4ZCLA 3CUNA 3OFGA 1SKUB 1LWEB 1UWBA 3HOXJ 3LQVA 2VUMJ 1RT3A 2YKOA 5F04A 1GDTA 5H2FC 2KO1A 3M30B 4EZ9A 4IOBA 1GH8A 2YWWA 4DW6A 3FXLA 2L08A 4EGYA 4C8MA 1KGSA 3PG9A 2E35A 2X6YA 3GE9A 2DDAA 3W5ZA 8ATCB 4OIOF 2QLFB 3G4SS 1FYKA 1SC4B 3W2AA 1LKZA 3CDUA 1XCBA 4ZJQA 3B02A 1FMVA 1DTTA 1K61A 4FNIA 3FM3A 1KKHA 3EGZA 2J5AA 5E1XA 3V6DA 3HOVJ 2FD2A 4C8ZA 4ZDPA 1GMUA 1EF4A 5GPCA 4KYWA 3H3VK 4OI4A 2KXNB 3CC2S 1F1BB 1YK9A 2F5CA 2QYCA 1Z7LA 1R31A 5FLXU 3MKLA 1J0RA 4MTEA 4EATA 1BI3A 1XTAA 3I0RA 5ETPA 5LSOA 4NC6A 5AXNA 1T2KA 2OTLS 2IY5B 2HGMA 1FTRA 2G0IA 3MMBA 4CO8A 2CVIA 2YVSA 1UL3A 5M2RA 3I0RB 1HD0A 3QLHA 4C98A 2KU7A 3HRUA 5FROA 3DYAA 4C8KA 4A0ZA 4KDPA 1DTQB 2F1FA 3S3MA 5IT3A 3KUEA 2ASJA 4IR1A 4DR2J 1KVKA 1Y4ZB 1ZM4A 1MSEC 3ULHA 4OZ2A 2MLZA 1FX7A 4CH7A 2KKOA 4LFAJ 1T6SA 3NY0A 3J7AO 3J7Z5 3HHLD 1NHKL 1B7YB 2L9DA 3M4XA 2QV6A 3B4DA 2DGSA 1HMVB 1AFIA 3MEGB 5C4JJ 5HVHA 3OYAA 3W8GA 4X62F 4DNCA 4G94A 2K3IA 1BJZA 2YH0A 2NPIA 1I5ZA 3AQOA 3GFJA 3I0TA 2HU9A 2RNGA 1AHDP 1DY3A 1FWZA 3B6CA 4BJTA 2KRRA 2OSQA 1WC5A 1X4FA 4DLEA 2JPCA 2J7UA 2IDLA 3FMRA 2IA1A 4ED4A 5DD8A 4H54A 5C2GA 3R1HA 1N56A 5HVGA 2HQRA 2YKNB 3OPKA 2KL4A 3JREA 3QRRA 3BQZA 3C1DA 1I3AA 3LQRA 5G0RB 4AD9A 3SQNA 1JKOC 3OSPA 4MFEA 2VHGA 1QSLA 1N32F 1PJ6A 1RTIB 1UETA 3TX0A 2YTCA 1WI9A 5ERIA 4OZLA 3ABKH 1S12A 2FGOA 3HZJA 1EH7A 2KFYA 1M5SA 1RR7A 3R4KA 4CH1A 2AV5A 5E7OB 2OAUA 2DT7B 3BO2A 2ZH5A 1BOBA 2VG6A 5HI7A 4DYQA 4NLSA 1HF0A 1MBGA 4F67A 3DRRB 4RJVA 4DPWA 3CJ2A 1RQ0A 4G65A 1RETA 3HOTA 7FD1A 2XZWA 4GYIA 1QDUB 2J7WA 3I3LA 3QU6A 1GFWB 3QJPA 4KGZB 1T3OA 5KAIC 3MEEB 1OISA 3A01A 4GO5X 1DARA 4R5PA 2XTJP 1EIYB 3WG9A 2R42A 3MUVP 3UPFA 1Q82T 1OR7C 4FQGA 3BPXA 3HUGA 1LE8B 2K4JA 2JVRA 1IBLJ 4CNYA 2KFDA 2BQRA 4CI0B 2CDQA 1IGNA 1WSVA 4ZA1A 1LVAA 3IP4B 2P7CB 4ZVRB 5LJ5Y 1SKRA 1DPUA 2NUHA 1N8RT 1CEZA 4V19K 2CNOB 1ZLKA 3VALA 4EWTA 2R7VA 2AJQA 1S1VA 3IM8A 4DXLA 4YIIA 4M6XA 2ZSIB 4V2FA 1PCAA 2JA7J 1E2XA 1UCRA 3C6TB 4ZJOA 1Z1DA 4A3KJ 3HM5A 4IJAA 1TTYA 1TKDA 4PQUB 1NPPA 1LEAA 2XF6A 2MZRA 3KJVA 2G0JA 2DH7A 4LJZF 2RSQA 1RPWA 4NCBA 1IBLF 3N6NA 3GFZA 2HQIA 4DS5A 1JXVA 2GA2A 5IT9K 3GFMA 4DV1J 3BCBA 1PAUB 3RYPA 2B3TB 2B51A 3OHAA 4O44A 5K7ZA 5EZHA 2FC9A 2IJFA 4DR4F 2KKHA 5L1LA 4X65J 2QMXA 4HI2A 4KC5A 2PN6A 4DV7J 1K8AT 5EUHA 2LREA 3A8EA 2R5ZB 2R8HA 1H2TZ 2UUZA 3GFHA 2MABA 3K6GA 3BO3A 2DNZA 3ZQLA 4DDFA 2WVCA 1P27B 4WYLA 4LG0B 4J7CA 3KTQA 5A76A 3DNCA 1S1TA 1K79A 1S0MA 1Z1ZA 4F3OA 1QUVA 2HNDB 1RHQB 4DG1B 2LDIA 4XSZF 1S9GA 4F02A 3L2RA 3RYLA 3SFIA 1LFPA 3MPWA 3CLOA 1IUYA 1WC0A 3DCAA 2C6YA 4ECTA 1U1NA 2DO7A 3FFIA 2R7XA 3DI6B 3HVTA 3H20A 1N0VC 1MNDA 1BI0A 4WTOB 3AH6A 3FXRA 3IXQA 3QZ7A 4IHVA 5CH7B 4F2SA 4YY3F 5J8FA 3VVUA 4OJHA 2LF7A 2LY2A 2MQPA 2MKKA 3J80Z 3R1LA 3ECOA 5IP9J 1ZKGA 3PUFA 4UZCA 3ZNJ1 3LQQA 2YX7A 1HLWA 5F0WA 1U1LA 3CMQA 3MM7B 1QAIA 1PIEA 1R36A 3DLJA 2A61A 3TJ9A 4R0JA 2CNKB 3E01A 3QWPA 1IKXB 4EEYA 1E3HA 3D0GE 1FWPA 4DL3A 3ENWA 5HROB 2FNAA 1WEYA 2DA4A 3VAHA 1TQLA 3SFGA 4ESBA 2DJIA 1X4CA 2LEAA 3JTNA 3K10A 3G9CA 3NNCA 4HA8A 2VUGA 2QJ3A 1FE0A 1ZG3A 5EEAA 1RT4B 1S0NA 3S1RJ 2G2YA 4HQMA 1X4HA 5KFVA 4A2UA 5LGNA 2RT3A 1M5VC 1VK3A 5CZVA 2MGQA 4PDKA 1SBRA 3VWSA 2EPFA 1KU7A 3LSPA 1PP7U 4TU7A 3K4NA 2STWA 4JI8F 5J3LA 3HPHA 3ZZTA 5FB2A 2D1CA 3NBPB 2BYVE 2MYSA 1RA6A 3PSFA 2HZAA 4NQWB 1I1SA 3A13A 2X1AA 1RT3B 2IAIA 2AHOB 3H0DA 4JI7J 1RT1B 4NXNF 2VFTA 4DV4J 5LLQA 3DLKA 5JHFA 1JHFA 1MWYA 4FTHA 4A48A 3A01B 4QPXA 4AIHA 1MMGA 2A6TA 1WF2A 1WC4A 3R27A 1ETKA 4QBUA 4DV1F 4UOGA 2EBGA 2ZH2A 3VSKA 1VQNI 3HOUJ 3G71S 1VQKI 2J8AA 1Y0UA 4WZMA 3GYXB 4I0BA 2N3LA 2BM0A 1OYEA 2VDHA 3TO9A 2QA4S 2VN2A 1N5YB 2CQPA 3ELHA 3IBFB 2CPYA 2RHQB 3NWSA 1ZK8A 3RBDA 2BHYA 5LSLA 5KFBA 3K8VA 3W5YA 2I0XA 1KHWA 3FDSA 2DT5A 1L3VA 2NSCA 4KIFA 3DFGA 1HQEB 2H5EA 5EYRA 1YJ9S 1MSWD 3KLGA 2VI6A 2XMUA 3COAC 1NB7A 3PFEA 3GW2A 3FMBA 1FTCA 4TU9A 1EETA 4DR3J 3DBHB 2M4GA 5C42A 2O3FA 3CCSS 4HV5A 2ZMEA 2BVZA 4OIQF 2QT7A 3BPVA 2CQ7A 1X0FA 2AEFA 2W01A 2XRNA 2HYIB 1UFLA 3KNAA 4UVAA 2BV3A 1IVZA 4BXXJ 3B4MA 1C1CB 4FP9A 1C2PA 3JRHA 5J2PB 2LLZA 3MM5A 1A0OB 5EGOB 1AROP 4W4MA 2YPYA 4A3IJ 5KT5A 4DL5A 1SH0A 1OYWA 1MWQA 1T0FA 5IC6B 1ZAOA 2W24A 4RUCA 4M9XA 3HXMA 1FF2A 2R2RA 3EQLF 4OZ1A 3GTKJ 2E1NA 5C24A 1S4EA 2ZNZA 1ETXA 3LAKA 2W4DA 2CJXB 3ONQA 4H4KC 2Z4PA 1SFEA 2P81A 3M8RA 4CM2A 3PUBA 4LSNB 4F36A 2M45A 3CSKA 3UWTA 2HZTA 4PG8A 4JYKA 4P5OA 1ZR2A 1F60B 1S3JA 4B3RF 3ML6A 2PDAA 2V4QA 1HA1A 2JUCA 2LQBA 2Y9ZA 3AOCA 1PAEX 1BI1A 3VODA 1FYMA 4AL5A 2R5YA 2C3MA 4H4MA 1IXSB 1SUQA 1P4XA 3R7BB 3PJ9A 2NNNA 3MMBB 3MZIA 1CJKA 2G4BA 5K8PA 1W1WE 4ESJA 2OSRA 3AOAA 2DT9A 2Q1LA 3D1NI 1YBAA 2L54A 5DCMB 2KT3A 2WY8Q 2XMKA 2OI2A 2F5VA 4L18B 1VQ6I 2ZKZA 4JP8A 4FF2A 2HKEA 3L00A 2RQQA 4QSHA 3ZMSA 1E3OC 4KV8B 3DM2B 1R00A 3ZMZA 1HC8A 2L48A 2IPQX 2XB0X 3ZQ7A 1XBWA 2OQGA 1EB0A 3B6BA 4IG0B 4A6DA 2NXUA 3M7VA 1ROFA 4PWWA 4XAKA 2FHMA 3TJ8A 2E7WA 3JTHA 3IKTA 4AQYJ 1F9EB 1B3TA 1JT6A 3IRXA 2OTJI 1W7PB 4KH1B 3OYLA 1KFSA 1VQLI 4B3TJ 3PRVA 3WU2C 2JT1A 1FRXA 2K7KA 2GO8A 5KG7A 4HHUA 1YJWS 1JLGB 3ZQHA 5E3AA 3PNYA 4FS1A 2ELHA 5LXRA 4KJIA 1TL7A 2ZXJA 1HBNA 4ZIWA 1VQ5I 2IJLA 4LF5F 3FMQA 3FDYA 2ZBCA 2ABYA 3TI0A 3HEFA 3GTLJ 4PXDA 3IH4A 1QZEA 2E5HA 1R9TJ 2Y9YA 1CJTA 4GVBB 4YDDB 2BJ8A 3H5RA 5FIIA 4WPAA 4YIFA 3M2VB 1HARA 2ECCA 1FSHA 1SQGA 4CRJA 4IXAA 2CXEA 2HRYA 5EHHA 1W36D 3H7HB 3CDAA 2QA4I 4B3MJ 2VPZB 2XG8A 4DPYA 5BMZA 3KJVB 4OZ0A 3CCUS 1YKWA 4Q7AA 1H89C 1TZ0A 2VKDA 2L9WA 5H20A 3TP0A 4JV5F 2WCXA 1FNXH 1XGMA 4ES2A 3H5NA 3NGKA 1SV5A 4LF9F 2ZNYA 2BJ1A 3DOMA 1APLC 3T1HJ 4BHBA 2IA6A 3QBCA 3H40A 2XASA 4LF4F 1HR0J 4MFBA 4WP9A 1UP1A 4HF1A 3A3OB 1HBMA 3QT8A 5D0RA 2CJQA 4LLGF 1U45A 2LCWA 3P3DA 3TUPA 4KT5C 4RW8A 4KISA 1X2NA 3PR4A 1H74A 4CLZA 2HEKA 1SFXA 4ZCKA 2V2VA 5DG7A 3O8WA 2JTVA 5HVFA 1YQAA 1RTIA 4ZDLA 2OUMA 2GXBA 1GX5A 1UWAA 2ZHBA 3IFEA 3OT9A 2X48A 2ZXHA 2BRLA 2GO9A 3MFKA 4V19X 5D4NA 2MKHA 2H54B 5KFIA 3G6XA 4R0EA 4NI2A 4LF9J 1S72S 1PUEE 3QWUA 3FSYA 3ZP5A 4OZ3A 4EMSA 5IT9Y 1RT6B 3PYDA 3IBWA 4DF4A 5J2QB 2XQCA 3D1QA 3F3XA 3C2GA 1WZ2A 3IWNC 1WI3A 1BJAA 4NA2A 1S1XA 3FGVA 3FJ2A 2QENA 2OTLI 2VG6B 3OFEA 2LRDA 1D0YA 3H5AA 2VD3A 4IZZA 1Z3XA 3IAM9 4EM2A 3U1NA 2C3UA 1TK0A 3MOJB 1Q86T 1JKRC 2J6SA 2VPRA 3W63A 4YR2A 1RBOB 2LVWA 1VQ7I 1RP5A 1BR4A 1YZ7A 2HTJA 2PJPA 3CJ8A 3DOKA 3PYEA 3I9V9 3GMGA 3V81B 4N76A 3SI8A 1POGA 1UZCA 4E7HA 3GCXP 2DEJA 4ECUA 1RIOH 4ZHRB 4B44A 5DDQC 2H27A 5F8LA 4NLTA 2UV1A 3A0HC 4UY8T 1BI2A 3TAMB 3AD8C 1IBCB 4BEHA 2QQBA 3IRWP 1U02A 2XHKA 4JOMA 1IJEB 4A3MJ 1AB8A 4G1QA 3KKFA 1W7PD 1V6HA 2CU7A 4DS4A 4Z2YA 2PX9A 3A4CA 4F7ZA 2DR7A 1X8DA 4ED0A 4UV8A 3MM9B 1AFJA 3FM5A 1FXRA 2ZWPA 4DOZA 4DU8A 2W2NP 4A5NA 5E3CA 1WJDA 2CWXA 4IG3B 2GOMA 5CLSA 1CJUB 4XOTA 1S10A 3P4UB 1ITPA 2QKLB 2GIVA 4PQUA 1NK6A 2MZQA 2IHR1 1TL1A 4O44B 5KCMA 2MZSA 3ISZA 5C5JA 4IOAF 3ISNC 2WAQA 1VQ8I 1OCOH 3CT9A 1MBFA 2D41A 3L2CA 1JUPA 1FBSA 5D0GA 2LVSA 4LG3A 5DQGA 1U8RA 5K14B 1CS4B 4BXUA 3Q2SC 2RQPA 2ZD1A 1K1QA 1VQLS 5I3PA 4LT6A 3Q83A 3CULA 2LKXA 2RU9A 5ETRA 1KQSR 1RT5A 4EO6A 2QLZA 5KOXA 2MSTA 4KA4A 1HDDC 3H0GJ 3OY9A 1TP4A 2YQ1A 3A8KA 3J7YI 2XO6A 4K4TA 2ROEA 2B9WA 4ILRA 4WFNQ 3OSGA 4S05A 2CPIA 4BJ5C 2FIUA 2RRBA 2DTJA 2RC4A 3KLEA 2IVMA 2IW5A 2L9SA 5CVVA 4P52A 2LNBA 1GXPA 2HZVA 4ZLNA 1DAXA 2JA2A 3NMAA 1PYOB 2R9LA 1FKPA 1OPCA 2X51A 1Z3YA 3HHKA 4MT1A 4NLPA 4XRSA 3JSYA 1WVRA 2MLXA 2ZJRF 4RAZA 5ILSA 5LMNJ 3H92A 4XORA 3HUGB 4LD5A 5G4DA 3NEUA 3AJ1A 1KQKA 3KHLA 2D7SA 4LGWA 3RZDJ 1UPPA 2B9EA 1FFWB 3RR7A 1SL0A 3BBBA 2CUZA 3RCOA 2BZ2A 4RNFA 3WHBA 4NLXA 3A3NB 3CO7C 1DU6A 1B70B 3G82B 4DEZA 3GIMA 3MZYA 3ITHA 1SH2A 1D9DA 4P55A 4WP8A 1OJ4A 2ISZA 3HMJG 3RBZA 3VAIA 5KNLA 2JA6J 2QYOA 3VWBA 3OTEA 5DYMA 2AU0A 4UOHA 1RYRA 5KTQA 3DRSA 3HHDA 4B9NA 1FBQA 2NLWA 2MSYA 4MGRA 2G7HA 2CJAA 2RAQA 5K20B 3SCJE 1AA7A 4YB5A 1HKQA 5TJJA 1EP4B 3H98A 4WU2A 4D0PA 4AVPA 2H51B 5KFEA 4PG7A 2J0SD 4WXHA 5DDPC 5AJ3J 3OHBA 3SXLA 1HA8A 5J40A 3H2VE 4ZLJA 3D5MA 3W2WB 3PIOQ 1NHUA 4E70A 3E3XA 3C15B 1MZBA 4X6AJ 2HVHA 4IHTA 2EIKH 4EMDA 5DDOC 4PYAA 4B48A 4UQGA 4BAYA 4PQAA 5CXTA 4C3JJ 2DHGA 4K5RA 2AO9A 2PMUA 2D1VA 3SEZA 1QJHA 1GT0C 2H4YB 4P2XA 2QE5A 1YTYA 3NBPA 1UMJA 1K78B 5THWA 1IJFB 4ANJA 2HNZA 4M5DB 3PKMA 3VCDA 2RN7A 5J1NA 1T03A 2XF7A 3GCMA 1RAAB 5J4VA 3VVTA 2HW3A 2F4IA 3CMAS 1RESA 4A8OA 4ECYA 1EQ0A 1SJFA 1H7WA 2GAUA 3E6BA 3MI7X 1N5VA 4XRMA 1S9EA 2HQDA 4J9NA 3MPVA 4U87A 3E3VA 2V4JA 1JIHA 2HYJA 5IM0A 3WTSC 3AG4H 1RWVB 1RHKB 5D4PA 4HACB 3ZR8X 3HVAA 2PQ8A 4LREA 3ENAA 4N56A 4QYZK 1C0UA 1ICEB 4K5SA 4N77A 3RB0A 1V5IB 3V6DB 2CRGA 4DV2J 5IZHA 4GKJF 2CPDA 4I09A 3A1YA 2BA9A 3JSBA 4RW7A 5HJYA 3WTVC 4QR1A 3TA0A 2MKIA 1TTHB 2UUAF 1RAEB 1ON2A 2UXNA 4MH8A 1WKJA 2CSOA 2PEHA 5T14A 2XGXA 1AUDA 4P1WA 3BZ6A 4DV0J 4ED6A 2ZCWA 3GJSB 4L9TA 4BQAA 2LDUA 3T19A 2HPIA 2PMHA 2DA7A 4AD6A 5HMWA 3QZ8A 3T41A 4E7LA 2UZKA 1FHTA 2R7DA 1OO0B 1S6LA 1CULB 5HAOA 3PV8A 1KQ0A 5J2NB 2IXSA 2HOAA 2OPQB 4QIEA 4IQMA 5BYQA 2LH9A 2JRTA 2CNLB 3JTOA 2R7UA 1AOYA 2VE9A 1UVLA 2JNJA 2LG4A 1IRGA 1LNQA 4M71A 4ZYDA 2KDZA 4NWBA 4N9HA 3RZOJ 2HHQA 3HSJA 3NNHA 5LJ3Y 2BW3B 2BVMA 2KP6A 2MH9A 2DOAA 2CQKA 3BPDA 3TOAA 4IPAA 1S0VA 3O44A 2U2FA 4XLFA 2RNJA 3O2IA 3L4BC 2Y8YA 5F0HA 1T33A 4HDHA 3PX6A 1UAAA 1TLHB 2D3UA 3AXKA 4R8UA 3KK3A 1CF7A 1RTDB 2CQ4A 1VF9A 4DN9A 3D1HA 2GHPA 3OTBA 3HTSB 4A3BJ 4JI1F 4WWSA 1S7AA 1HQ2A 1GXTA 2ZUGA 3CC7I 2BJ9A 2DYRH 3T8RA 3HHNB 2TCTA 3DLEA 2KVIA 3RW7A 2OPPA 3GR0A 4LRBA 1I3OB 1U9NA 1JLBA 1HBUB 2H65B 2QSFX 4FVCA 2AF6A 4MFDA 1HKAA 1IXRC 1U47A 1V3SA 2XB5A 4IR9A 2EFVA 2M3DA 3ILJA 2ZH3A 2DNGA 4IO1A 4ZZDA 2FU4A 2AEMA 2RNEA 2IRFG 1GXLA 1CSJA 1W5CC 2C3YA 4R79A 5J1RA 2DNRA 2ZJPF 2WB1D 4NOHA 5RUBA 2MHNA 1JI8A 3SEOA 3I54A 4QQBA 2HEOA 2E2IJ 2BKPA 3E5XA 2UVRA 3BQ1A 1BQXA 3CJ5A 3PO5A 5E3LA 1UB9A 1R5ID 4NDLA 5KG4A 4XBFA 1O51A 3G6ES 1XTZA 2FLPA 3MEEA 1ENHA 2VPYB 4O0IA 1CVJA 1GUUA 1DQ8A 5EF6A 2F4OB 1C4AA 1E6YA 1FRIA 3L3CA 1P6RA 2I5JA 1D1BA 5C25B 3QGGA 4EK2A 2FJVA 4YFNF 3JSRA 2HHWA 3GG0A 3SSSA 3KMSA 1VHFA 3HVTB 1ZA1B 3MCZA 4KJZA 3J81U 3ZQCA 3L9ZA 4FASD 4OZJA 5BYSA 4LFAF 3M2UA 4D9JA 1A6IA 4UNOA 5LBQA 4I69A 1NJZA 1N33F 4EBDA 5HDGA 1VQPS 1U0SA 3H90A 3GZ7A 3IH2A 1WTBA 3K4CA 1FMWA 3X2QH 2R7OA 2VT2A 3KJNB 1YOVB 1HLVA 4OHYA 2X85A 4RKUC 1NH7A 2PEBA 2H5IB 3UE2A 3U7JA 4A12A 4KT0C 3U1LA 4LIVA 3EZOA 4W92B 4MKBA 1XMOF 4CUGA 2K3KA 2OH2A 2KZVA 3DFEA 3IBCB 4Q8FA 2DA2A 1CULA 1JJCB 1S72I 2Z56B 3WTWC 2VA3A 4USIA 5D4RA 5E3QA 2A3JA 2DNPA 2VBWA 3X1LB 2ZKTA 3TVZA 7AT1B 2CQXA 2E5LJ 2Y0SA 1Z91A 3S17J 2WB4A 4UT4A 1U24A 3UDVA 1R0AB 2FSWA 1FT8A 4LVOP 1ZPVA 3SSQA 4ANDA 4CO0A 4XLAA 4ICLB 4PRFA 4O4RA 1KS2A 5DUKA 2M7AA 4I02A 1BR2A 1KN6A 4IQXA 3NG8A 5KFKA 5HNHA 2EK5A 4KHPF 3LA3A 2XSJB 4RNOA 3AFGA 5HP1A 1VQ7S 4BQNA 1P2FA 1A04A 1FD2A 3KLFA 4URSA 2X6XA 1QO0D 2F9DA 2PI0A 1MG7A 2ZITA 3L95X 5J2QA 4UY8I 1Q78A 4OWRB 4ZC3A 5CVRA 4NRUA 3CESA 4QW8A 3LWFA 3ILIA 2J9DA 4LSLA 2F2EA 5HMYA 4CNZA 1BW6A 1SC1B 3F0NA 3PM9A 3CDWA 1HQUB 2G9WA 2FB0A 2Y0MA 2KQRA 2VICA 3J7AY 5HN0A 4GC6A 1TAUA 2HBQB 1JTYA 1X3UA 3CCVI 2BKNA 2M8GX 4KR0B 1IN5A 1YWXA 2CZ9A 2FBKA 1KZHA 4PUOB 5DD4A 5KFXA 4E6KG 1NM2A 3TAMA 2M52A 1R7IA 4A69C 2HVZA 1X7VA 2DLLA 4ENOA 3V8KA 5CCMA 2UXCJ 1S6PA 2DK2A 2H6BA 5D8KB 2EFOA 2KI2A 4RM2A 1TU0B 4D3HA 4UHTA 3O6QA 4A93J 2CZVC 3QAUA 4NEYA 3KLGB 4M3DA 4L73A 4EFAC 4PJNA 1NK8A 2HQCA 1S1WB 4HVZA 2PJRA 2LQJA 3MM8A 2AT1B 4ZVUB 1SJ1A 4IOCF 2HFNA 3ERMA 3WX8A 3MPDA 3E97A 5IP7J 5IWAF 5KFFA 4OX9F 2K8GA 4JOUA 3IWFA 3LP0B 2FUG2 3Q0WA 4HRIA 2W48A 3BGFA 1BLUA 1SJRA 3HSDA 2E66A 4M3EA 1RK8A 9ANTA 1KSPA 1V3RA 1UVIA 4ID5A 3BSOA 3J7ZT 1RA7A 3G8TA 1SQEA 2QLWA 1DJ0A 4KIAA 2E9ZA 2JRMA 3KHHA 1K4SA 3BG7A 3REOA 1I94F 4AT1B 4BE0A 3FVYA 1Y00A 2HHHJ 2VU5A 1QE1A 5T7LA 1J5EJ 4ZCIA 2QZ8A 3OVAA 3VGVA 3H42A 1I39A 3R0AA 1PJ7A 3R60A 4X4OA 1H73A 5GMDA 1RZ4A 4OYWA 1S1UB 4RLFA 2BX6A 2XM3A 2ZUAA 3HSGA 5KFSA 1XEZA 1E6VB 1JLEA 4FKXA 5GPAA 1H98A 4C3HJ 1XMXA 3AAFA 2N3OA 3GLXA 4WBFA 2ETHA 4B08A 1T9VA 2OEKA 2WTFA 1C0WA 4DN0A 1YO5C 2C2RA 1KNZA 4KO0B 4A8SA 4RW7B 3MPUB 1MMSA 4U8YA 1KONA 2ADBA 4KV8A 4MLOA 1V5FA 5J47A 4ELVA 1ZHFA 2H09A 2A68F 1A7GE 2O01C 3FCWA 1VQ4S 2JWNA 1ZGJA 1IKYB 4NASA 5GAGJ 2JQ7A 3M1VB 4PK4A 1JMTA 3RG6A 2XAGA 1N5QA 3QPHA 3QP5A 1S76D 4F91B 1FTZA 4KB7A 4WXOA 2AZ1A 3MEDB 1RTZA 3S8PA 4XIDA 2K3PA 4E7KA 1TKZB 5CD4A 2UXBJ 3F8FA 3BYPA 3TEDA 1JT0A 5KAFC 1I6HJ 4DL4A 2V7FA 2IJNA 4CLYA 3M3YJ 2X1CA 2MC4A 3L7PA 1ZOTA 4YHHF 3RUBL 2LEPA 3CC7S 3W9JA 1J9IA 4CIOA 3G1LA 2BY0A 1KVIA 1IAWA 2EZKA 4U7UD 3DDIA 4PWDA 3K0JA 4B17A 1N48A 2H4WB 3ROUA 2OTJS 4WZQA 5D77A 1RWMB 2XY6A 2A6OA 1B8IB 1G3TA 3IR5B 4A8YA 4J9PA 4I2OA 4X4RA 3KP6A 1OYYA 4M72A 4Y00A 3HOYJ 2HBRB 1B64A 1WELA 3GO5A 1HQEA 3D6MB 4HZFA 1TWHJ 3HULA 3UN5A 1T98A 4HKQA 4Q44A 5H9EJ 4XDDA 2BW2A 2CJKA 1VMBA 3CJ0A 2IRYA 4FVMA 5K5MA 4C3MA 2DMQA 4UZBA 4JI0F 4QIGA 2CJ9A 5IT0A 2HXOA 2K27A 1FEEA 2HQAA 1RT1A 2HDWA 2RQKA 4ID5B 4C11B 1O3RA 2RVCA 4I2QA 3EJMA 1SAUA 3KX2A 3OYDA 4X4UA 3KLIA 4K4SA 3TRGA 1RBAA 4DX7A 2B6AA 2XHWA 1WOSA 2BACA 3L7OA 2HZDA 5MAOA 1OFCX 3ILLA 3I5CA 2AXTC 3VDXA 2GFFA 2X0LA 2FMYA 2G9OA 3IS9B 3KZIC 4IFYA 1VJQA 2E1MB 3I32A 3FBFA 2XNQA 1JKHA 4L6V3 3FF5A 2IFXA 4URQU 4WFZA 2ZB9A 5C3EJ 2ZBIA 1REGX 4LF1A 2HDCA 2JHEA 5M5WJ 1TW3A 1FKOA 4WK8F 2RHSB 1FXDA 4G1PA 3ZZOA 9ATCB 2DPJA 1FA0A 2IVFB 5FLMJ 2Y0BB 3KWMA 2DJNA 3H35A 4MO7A 2YKMB 3K58A 4M5JA 2OA4A 4FF3A 4QIVA 1HBXG 3OTOF 3M2VA 3U1DA 2HIQA 2YKMA 5IYBJ 5GAEJ 5BNGA 3I55S 2JL9A 4GYGA 3VGTA 3M9NB 5L1IA 4DR1F 4WK1A 2AW0A 4OQJA 1UELB 2XHCA 1VQOS 4AIJA 2AXLA 4XLCA 2HR3A 3H4BA 1KDNA 1KQGB 3NWRA 1X58A 3T5JA 3G3ZA 4BGDA 1XCVA 2QSGX 2LQ9A 1G1XA 3ZC4A 1KTQA 2DR8A 1TP7A 1T7PA 2Z1DA 2VQEF 2B6AB 1S7OA 1IN6A 2CQDA 4CO5A 2QLJB 3KNGA 3QOEA 3FXJA 5D5VB 1D5VA 3D2WA 3OTOJ 5HDNA 2VJJA 3LGMA 2B9XA 5HBMA 1RTDA 3OUYB 1YBUA 1S97A 4AUXA 4B3OA 2DA1A 3ABLH 1RUOA 1JQGA 3CGIA 2QQAA 3THVA 2POKA 1LK5A 2UVUA 4OYIA 3RB6A 1MLAA 4BC9A 3IRRA 3GTMJ 4OIXA 1D5YA 2CPJA 3J81Z 3TANA 3IL2A 1VQ4I 4R1HA 2H8RA 4BHPA 1K0VA 3JSPA 4FBUA 3R5BA 4LF8J 1HW2A 2EV6A 1BL0A 3I4NJ 3FKIJ 2VKEA 5F9LA 3OL4A 1T0TV 4TKTA 2WBMA 3T1AA 3ZOBA 1HW9A 4MKYA 2MH2A 1R3NA 4RBTA 5K8MA 3GIRA 4U9RA 2Q0OA 3W2VA 4FXVA 4USVA 1MSFC 2OFHX 4CH0S 3I4PA 1WACA 2YNGB 1RWUA 2VBYA 1FE4A 2Z2ZA 5KFZA 1ORKA 5B1BH 2HS5A 4QW9A 2E9RX 2V2ZA 2DXIA 1TL5A 3MD2A 4ILLA 3OR2A 1CJKB 2G1DA 3HOWJ 1U1PA 3CNQP 3DOKB 3NGRA 5D3GB 3UD5A 1DQ9A 4FYXB 3N4WA 4TY9A 1IXCA 4ZZLA 1R8AA 4BKXA 3BJOA 4ZVGA 2BR0A 2O3DA 5C25A 3CCMI 5F0CA 1LDKB 1ZREA 1BHNA 1BMQB 1T9XA 2KIUA 4OU0A 3KJFB 1QPMA 2CMPA 4ZH4F 5FLXY 4PABA 2HXIA 4IX7A 4FE7A 4ZYAA 3K5PA 2P9CA 3J80Y 1KRPA 5IV3A 3V6KA 3U21A 4YUDA 3G2XA 4DLGA 1YHQI 2TDXA 1RAHB 3W2WA 1NJXA 1R4NB 2R8GA 3I56I 4RW4B 4Q2MA 1S1VB 2V9WA 1U6BA 4LF4J 2HHUA 1UAWA 1ZS6A 4N47A 3K2AA 1Y5IB 1QAXA 3N6MA 1BGXT 1JUMA 1KU2A 2ZKUA 1EP4A 4XRFA 1GK8A 2ILZA 4ZN1A 1BQMA 2BMBA 3OJSA 2KIFA 1LK7A 3JS9A 3DRXA 3AJ2A 3D0IE 4G6VB 4V1Ak 1TFYA 2OF7A 2D1HA 4HV6A 3P5TL 4WX9A 3M1EA 3QU3A 2F4FA 2VIXA 3RR8A 5KFTA 1GQEA 2XNRA 3OXFA 2HKOA 3KLOA 4O3SA 1Q1KA 1HYSB 1D0EA 4ESFA 4OMFG 1EKRA 4EJUA 3UD3P 1TQIA 4I2PB 3CCYA 1RKTA 2CQIA 1TQPA 3K5NA 1T08B 3U02A 2RV8A 2GGPA 3SQGB 1VQMS 3M9OB 2L3DA 1E6YB 5AE1A 2HGCA 2J5PA 2AJFE 3EUKL 4Q5SF 1SL1A 4X84A 2K86A 1MWZA 5JLXA 1V55H 1N36J 2M70A 4DYCA 1GLNA 4M5MA 2DXFA 2W4SA 2YBVA 1IRXA 4I64A 4OX8A 2AGOA 3BH6B 1D8YA 3T5HA 2F7VA 3GIKA 1VQOI 3QPIA 2MLGA 2EH3A 1X4OA 2MPUA 3OTCA 4DUZF 3S1MJ 1Y6IA 5KFYA 3CQZJ 3SJMA 4II2A 1P4AA 3T9ZA 1JLFB 4JYAF 1R89A 5AXMA 1V54H 4UV9A 1U0HB 4ED3A 3GV7B 4RZRA 2Y0SD 2DMNA 2VBZA 2R8IA 1HHTP 1STZA 1U5TB 4IO9Q 4X4PA 3CD7A 3SFUA 1B1BA 3ZTOA 2OIHA 4AL6A 3IO1A 1NK5A 4XKWA 2DTZA 3K4BA 5HK4A 1HPZA 1PO6A 4XQFA 4OX6A 3NP5A 2DITA 1MU2A 1V3ZA 4NMLA 2RU3A 1W25A 4A3CJ 2XO7A 3I59A 1SAXA 5L3FA 2EA4A 4FNHA 3QO9A 3NGSA 4FX4A 4K0KF 2YU3A 3WODF 1X5SA 1UA1A 2XROA 5CYQA 4RO0A 4B3SJ 2OZUA 4IG3A 2JJ4D 3KLEB 3O6BB 1J2VA 3UD4P 1ZM2A 3ETMA 2RD5C 1J09A 3QRFF 2QRRA 3R6LB 1W7WA 3DLBA 2VG5A 1J5OB 4QLCU 2H5JB 3W60A 4QU7A 2EQRA 2JC0A 1TL1B 2OO4A 3QJJA 4YELA 1C1CA 2MG4A 1ZGAA 1RZMA 4QYZJ 1WPKA 1XD7A 5L9NA 5ETLA 3T5LA 4MIMA 1VRTA 4RB2C 3MAAA 4LB5A 1AKHB 1T03B 2N4CA 4M5NA 1U1MA 3ZZYA 3QYBA 3AG2H 2K5CA 5DV5A 3US5A 3I0SB 2HHHF 2OU2A 4IQ4A 2WY7Q 4P2SA 4LRAA 2CQQA 2YNIA 4WKYA 1LKXA 3KYCB 2ZM6J 3WGHA 4WCGA 1VOMA 2IGOA 2HQGA 3KEOA 5F6FA 3EGWB 3ET6A 1W0UA 4HDUA 3CD5A 2QKMB 1XK8A 4N7TA 3TX8A 5FKKA 3UQSA 2R0QC 3IC1A 4TQRA 5KFGA 4NCAA 2JLFA 1N5YA 4AU7A 1H72C 4DQPA 2V0NA 1I1GA 3ISPA 3HOSA 1SANA 2L7FP 1YJWI 4HDVA 2P9EA 1AZSB 3SIPB 3DEUA 2UUCJ 1NK3P 3ET6B 3AA8A 1V5GA 1X4EA 4CGZA 1MH3A 3W62A 5CABA 4LFCJ 3TW0A 3T1YJ 2GIZA 1BE4A 1JX4A 2UU9J 3K7RA 3EVOA 2COLA 2NSBA 3Q8UA 3OL7A 4U67Q 2LEBA 1FJLA 4I6WA 3C2HA 4IRGA 2V4RA 4P96A 1RJJA 4DPXA 2GA1A 1QVGR 2W9AA 4RGSA 2HWHA 2VC1A 3DWLE 2A0FB 1R6RA 3CJ3A 1WH5A 5GTIC 3OYKA 2Q43A 4LMYA 3RI4A 5FO5A 4XLEA 4IL6C 1RHUB 4JI2F 4KN4X 4O3OA 4PPZA 2V8PA 4MAKA 1FOXA 4TY8B 4HSTA 4BCAA 1G6BA 4BWMA 3BZQA 4MIWA 1F43A 1J2XA 1DTTB 3M8QA 1FI4A 4DSEA 3HC7A 3CO0P 5TGTA 2QVOA 3LSTA 1DHMA 4NYZA 2IYGA 1ETQA 3H25A 1U9OA 1U0JA 2HFZA 4K0KJ 2HS0A 4JI3J 2GNKA 4ETXA 3BKUA 3CUOA 2XZTB 3HKZD 5F1JA 4ENNA 1T11A 2EFQA 2FHOB 4PJJA 3AOBA 5DLGA 1IKXA 4OZ5A 3VYRB 1P7JA 3TVKA 3QSIA 4XRSG 1QRYA 1NSPA 1Z6RA 5E2QA 5ETNA 2ROGA 1LXJA 2RF2A 4M5DA 5M2PA 5IY5H 2DPDA 2VKVA 2HOEA 4I98B 5CQGA 1P92A 1I51B 1N6QA 2FXAA 1X9SA 2G0CA 4OI0A 1ZARA 3QPLA 2ASLA 2B5JB 4Y3CA 1WJ9A 3CUQB 3LA0A 2Q3PA 3EYIA 2LXFA 3HB9A 4IFVB 2XZDB 2Y8WA 1YJTA 4TQSA 2CQBA 4PPDA 3MM7A 1X4BA 4P74A 2FMLA 3Q8PB 4KMUX 3IH3A 2AQEA 2HNDA 2Z2LA 5EGYA 4FYDA 2ZM6F 3P5BP 4J37A 3D0HE 4WXDA 1GVDA 4A47A 5KFDA 3H1CA 3KDNA 4DJAA 2XMAA 2GZWA 2QX0A 2UUAJ 4PCQA 4E7JA 5L8RC 4DUYF 3A12A 3H3UA 5T41A 4EZ6A 1MMDA 2BEFA 3PIPQ 3MMJA 2XMVA 2KH9A 3OWTA 5KFUA 1KR4A 5J1EB 1NMEB 3QMQA 1X31C 3EZUA 3NWGA 3W1YC 2VDIA 1GTHA 2V9KA 3CB4A 1S6PB 3K70D 5CD4H 1YHQS 2GJIA 3PFYA 2VKHA 5FGMA 2HNHA 2MLYA 5AXKA 1S99A 4ZN3A 4CTAA 4YEJA 1O8BA 4PXCA 4XOPA 2XCPA 2L0KA 1H9GA 1HI0P 4XN0A 4QPQA 2VJVA 2M9HA 2NPFA 3S3NA 3QIPB 2VQGA 4ECQA 3IG1A 1G4DA 2D9OA 3DBLB 3MWBA 1YJNS 1QZYA 4MKVA 3DCFA 2KXHA 2M9KA 2FX0A 3DOLB 2YWEA 1FJEB 2CFOA 3MTJA 1H7XA 5EJCA 3FUYA 2KZMA 3MMAB 1KQFB 4UB8C 2RMLA 2VPXB 4YQWA 3PACA 1IQTA 5EEGA 5HP1B 3LAPA 4M63A 3RU0A 2HQ5A 2XAHA 2MC3A 2A5WA 3Q8YA 3M2RA 2XLJA 2HVQA 2VQEJ 2KHCA 2O0YA 1NU4A 1IWAA 1N36F 5DG8A 3NAUA 1D8ZA 3BYRA 3PR5B 4NLGA 2LR8A 5GVQA 4X4QA 3H0PA 1OCRH 1U6FA 3MWMA 4DV3F 2BHZA 1Y10A 3LH2S 1VYAA 3HKWA 3G1MA 4ID8A 4PSWA 2W9CA 3L2UA 1EAYC 2FOWA 5AONA 1AT1B 3RAQA 1PJ5A 5C42B 3B78A 2DRAA 2RQ4A 4A3LJ 2DHAA 1X19A 2EINH 2FHJD 2UV8A 5AJ3F 1P7IA 3G86A 1MBHA 1YJRA 3TZYA 5EZGA 4A8WA 2QLBB 1RTJA 3LP1A 4LFUA 5HOOA 2G0EA 2JC1A 1U48A 5KAKA 3HKZA 1TUWA 1NJYA 1I5OB 5C4XJ 1FVQA 1R8CA 1JNRB 3PYFA 3M8ZA 3BDDA 1U0HA 2NZ4A 3WC2A 4O6JA 5F08A 2HHXA 2LKPA 4EJOA 2BVLA 2K1RB 2RJZA 2PEXA 3CTAA 3CP2A 3R2DJ 2KJBA 4JUZA 4AVZA 4BBYA 1FY7A 2NREA 2BY2A 1MD0A 1YRXA 4Q0BA 2K9LA 1U7LA 2WW4A 3Q0UA 2V68A 4U0YA 4CICA 5F0UA 3RSNA 3DRPB 3MCMA 3DU5A 4RB3C 3SBMA 2Y69H 5IS2A 1TWGJ 2PA8D 3BG9A 3NS7B 4IEJA 3M6VA 3BQYA 2MD0A 3JRDA 2JVOA 1W5TA 4M3BA 1ONVA 5D15A 4L9NA 1VLYA 2GC8A 1WC1A 1B7FA 3MKZA 1XGOA 2HRUA 5CYJA 2Z2SB 4OMYA 1IDZA 4O3NA 1SL2A 3C6UB 4EJWA 1VRQC 1SFUA 2I10A 1FP1D 2JSXA 2DHSA 4XLHA 1N75A 5B5EC 1RKIA 2LTPA 4I7FB 4DV0F 3M32A 3DGVA 2V69A 5HMZA 1ZN2A 1U6GA 4MTDA 4WTYA 1XMAA 2FUG9 4NE9C 4EEFG 4MFBB 4C2UA 3CF2A 3J80U 1VGYA 2FJBB 3IA0A 1P4WA 4D1QA 2PFFB 1G7CB 5ETTA 1YIJI 1X3WB 1YVFA 4X64F 1MKMA 2K85A 2R92J 4J9OA 3AL0C 1MJ9A 4C0HA 2AGQA 1ZRDA 4E8UA 3OS1A 5JVGF 3PFIA 1S57A 4U7UK 1TKTA 2ZC2A 2NS1B 4MK7A 4TU8A 1NHVA 1G2HA 4OX7A 5IOZA 5DZ6A 5AIQA 4ZOSA 2QA4G 3ULQB 2G7UA 2Z16A 2VQLA 1SD6A 2BBYA 4NC8A 2AP6A 4JI1J 3NL0A 3S2HJ 3TAQA 1P6TA 1VFJA 5L1JA 5CKTA 2RGVA 3DV8A 3BJAA 4B9MA 1WC6A 1BC7C 5LGUA 3HP6A 1HNWF 3GTQJ 4C11A 3E2EA 3HDDA 2V1UA 5D78A 3HX9A 2LXIA 1NDLA 4XPEA 1T94A 3RB3A 2XS5A 2KHMA 3ZN1A 3CD6I 4YS2A 4A4JA 2R2TA 2FVCA 3PYGA 3GEZA 2P5LC 2OMOA 1OCCH 3Q5FA 2GVDA 2XULA 2G2OA 4R8HA 4HYKA 3V5RA 5J2MA 3GIIA 3LSIA 3P45B 2B7EA 2B8PA 1HHQA 2NUUG 4HHHA 2MGZB 1Y9OA 3BBCA 1X5PA 1N78A 3MMYB 1UW4A 3BT9A 4DQ2A 2GMJA 4NLQA 1F0XA 4W1UA 3LF0A 2P7VB 2YPZA 4CWBA 1K4TA 2ZHAA 4G1QB 1SKWA 2H48B 5A8RA 2OPQA 1OYIA 3EWGA 4M1KA 3CO9A 5ED4A 3I5AA 4E0DA 5M2UA 1TWFJ 1FRJA 3DEWA 4KBIA 3WTTC 1HW5A 3MR6A 3PCOB 1JB0C 5E18F 4DX5A 1XWLA 3P8BB 1FESA 4AIKA 2W7AA 4DQIA 3CD6S 2P2CB 5H9FK 3D6TB 2VBXA 1TBXA 4PFPA 2SXLA 2RRNA 5FKOA 1RGVA 1NHAA 3FEYB 3ABTA 1RC9A 1KU9A 2B5JA 2WAFA 2M8HA 2LXUA 3PL8A 1NRKA 3RIRA 1EHWA 1IKYA 1NTCA 5J6XA 3OYHA 1GXQA 2J9DE 3LWMA 3Q22A 5FD6A 3MD1A 1A9NB 2XAFA 1QVTA 5J1YA 4XONA 4J91A 3MAHA 3ZXSA 3E5QA 4RNNA 3W9HA 1G8XA 3BTCA 2Z2MA 2J0WA 3R8YA 4DV4F 1IN0A 4C2MJ 3FBBA 1VZ0A 2K9NA 4HEA2 3I31A 1A6LA 4IH6A 4R5PB 2G13A 2ZC3A 3DU6A 1RTHA 2E29A 4NPOA 2B4UA 2E60A 2RAEA 2PMZN 5B0BA 2JFDA 2P0WA 2BRKA 1HKSA 3M8QB 2V5HG 4JV0A 2DCLA 1GAOA 2W57A 1ZRFA 4DSJA 4KSEB 1Z67A 2XGDA 3HL2A 4QIFA 4FPIA 2DMPA 3K2ZA 2MBFA 4HLXA 5HS7A 2DGUA 2EC0A 3SV3A 5E0OA 4Z2XA 2ZJPQ 4AIDA 3PX4A 1K9MT 3CDHA 2BXJA 2MQQA 3FISA 1ZA2B 2HHPA 1YJ7A 3SEQA 1NZ8A 2H9ZA 2DOFA 1TAQA 3LPEA 2DU9A 3P5JA 3IP0A 4HF0A 3OYNA 4DBRA 3CCQS 4N0BA 3PFOA 3OR2B 4CA0A 4ELTA 1HXDA 4QOTA 3S2WA 5FJ4A 4DCPB 5HVQC 5A8WA 4ILMA 4W97A 2WONA 1O3QA 2WSFC 3DPLC 3CIZA 3PW4A 3FQKA 3WGGA 5HS8A 3HSEA 2HQFA 1WSUA 6FDRA 1HI8A 3POTB 2A10A 3D54A 1CJTB 1IF1A 1L3LA 4PGGA 3TO8A 2MQOA 3BGLA 4NLUA 4ECVA 3AD9C 1B8IA 2LFVA 4V2GA 2W4CA 2V94A 3CMEI 3D28A 3EXYA 3OQ2A 3FMWA 3ECHA 4KAIA 1YI2I 2NXCA 3M6XA 4AYBD 5E8IA 4ZVQB 3JB9k 1WEXA 1PGZA 4DU7A 1OKRA 2D9PA 3QQCD 4C6AA 2PFBA 2K40A 4BS9A 2J6TA 3E8OA 2L01A 4JP0A 3I64A 1SQFA 2ZMEC 1OLTA 1JJ2R 5B08A 1YW8A 2L02A 4DPTA 2DCUB 1RSCA 5DEQA 4DSFA 1KP6A 3IR6B 3OYGA 2JEJA 2GHVC 4HI1A 3MKWB 2ZFUA 4FXDA 4HH0A 2OZ6A 2XWYA 1QGPA 3QLHB 5A6PA 4UY85 4LF8F 2C2NA 2AJ2A 3EGNA 3VAKA 2UXBF 1T9YA 2E71A 1YRUA 2V8VA 1DTQA 1JJHA 2XSJA 1MIJA 2DBBA 1CBKA 4Y13A 1CJVA 2EBIA 1L5UA 1NKCA 3G87A 4GKKF 2NVXJ 4M73A 5FRNA 3E51A 2ZEJA 3NS6A 3AL0B 4ICLA 2HRTA 3NGTA 1QA6A 2Q66A 2E9TA 4CSWA 2X3DA 2G2ZA 3E01B 1B0VA 2YX4A 2HMIA 2UP1A 2OUGA 3G96A 3I59B 1I6XA 3FBCA 2OEJA 1R0AA 3CMES 1BQNB 3L1PA 3OL9A 1NDKA 4ZHRA 2JH3A 2BOLA 5E3PA 4XKVA 1IW7F 3SCIE 1Q7YT 1HW1A 2BE5F 1IRZA 1OY8A 2KT2A 1D1CA 2HS3A 2BUNA 2E5JA 2KJWA 2EKYA 3R5JB 3DTIA 1EQMA 5DRKA 3DDKA 3SCKE 1KQ8A 2MQLA 3BOQA 5JUMA 1TVRA 2K02A 3IHUA 4USTA 2CQGA 2M1BA 2O5RA 1MMNA 3ABMH 3LSRA 1GT8A 3EXCX 4CCKA 1FDDA 4TLQA 1VISA 3UCUP 2BGCA 2M5YA 4BWJA 2ID6A 2ZXIA 3GTPJ 2Z5UA 1KLNA 1NJIT 2C2KB 3SQGA 2MZTA 1RXOB 3TA2A 4ZVPB 3T5XA 5LHHA 2W9BA 2QBYB 3HHGA 1S8NA 2NQPA 3H3ZA 1DGWY 4F8RA 4C8YA 5LL6d 4J9SA 5ETSA 3ABUA 2QBYA 4ZPVR 2QSFA 4WE1A 3O2PE 4IOCQ 2BJEA 2B7CB 4F0HA 4DGWB 2HFHA 1SI9A 1XR7A 3P6YC 3I4MJ 2XEXA 5JVGQ 5F8MA 3WBZA 4G8XA 5KT4A 2PT0A 3AFHA 2PG4A 3S1NJ 3W6JB 3GPAA 5A2QU 1SC3B 4O0NA 4IH7A 1PC5A 2C2EA 1HQUA 4C3KA 4ZITA 2YR2A 1IUFA 3KYLA 4CT9A 3TVYA 4LBHA 2X1DA 3HRMA 4NB5A 1FLIA 4KPYA 2XCAA 4I76A 3K70C 1LJ9A 4UOFA 1RCXB 2V26A 4OHXA 2CQ1A 3M9MB 1SPBP 4O23A 2LK2A 3IC7A 4RS8A 4DCJB 1FIAA 4RBVA 5ADZA 1U1QA 1T9UA 1KWMA 1GEHA 2FDNA 1XS9A 1URRA 2CW8A 2A6HF 3UCZP 5LMUF 5K1YA 2N4DA 1S5LC 3LGNA 2IP2A 2DPUA 2XC9A 5DDRC 1T8EA 1YBTA 3KMQA 3LOUA 2MQMA 4K2EA 3W6VA 2DYAA 4H4OA 2M8DB 4ZCMA 3DRPA 3FX3A 3VHQA 1SC7A 4OI2A 4Y4RA 4GMKA 2OBPA 2R2SA 4I01A 5GAGU 2BE2B 2XGEA 2OPPB 3UCGA 1KLMA 2BXZA 1X4GA 5KFLA 2ZBQA 2Z8QA 2ELKA 4WXCA 2F63A 4EM0B 2ILYA 5D4OA 1ZG5A 2IC3A 2FHJA 2R93J 5J1PA 3W6KB 4Y65A 3N97A 4F93B 2A2DA 1FYLA 4P72A 2M34A 2X6WA 3K7AJ 3LA2A 4OL8A 3MMCA 3CJKA 4ZPCA 3F22A 1E3PA 2DY1A 1SFKA 3Q23A 1ZZNA 2KRHA 2AHQA 3HSFA 2LU2A 3MM8B 1YIJS 2JSCA 3F8MA 3QRPA 4RB1A 4DR5J 2MZJA 4LF2A 3C7JA 3AKZA 1QVFR 1PP8F 2BEOA 3F9KA 1X1DA 2VOOA 1DQUA 2XDVA 3IRXB 4IFVA 2F4VJ 3CZ6A 1RNLA 1UWBB 4JV5J 5BR8J 3ZQIA 1CG2A 1BWVA 5L9XA 2M2BA 3BQ0A 1P9QC 4ECXA 3P9KA 2ADUA 3I0SA 2HVRA 5DUIA 3P49B 7FDRA 3FWEA 3D3CJ 1VC5A 3FK4A 4HHJA 3TUIC 4ERDA 3WC0A 5HODA 4ED7A 1W2IA 3L7WA 2ZBPA 3K57A 3W8PA 5L3DA 3NWTA 2XPUA 2E2JJ 2B63J 5EDNA 4MJKA 1JXEA 3G73A 3ZN0A 1TUVA 2E34A 1A5JA 3M1VA 4DPUA 2XGCA 4Y0FA 4CYCA 3GONA 2W84A 1LWFB 2RUSA 4B8XA 2GOXB 2AYEA 2X1BA 1X4PA 4LOCA 2JZYA 2YSRA 4DUZJ 3PW5A 3TO7A 1HFEL 3MR2A 4DR6J 2UUTA 2WWYA 1HWLA 1GVJA 2NVUB 2KRBA 2CH0A 3C19A 4MIBA 2DO4A 2YH1A 4JYAJ 3H2LA 4ZDNA 5EEHA 2X3GA 3R2CJ 3S01A 5L3BA 2JUGA 1DQAA 2IM2A 2QSHX 4RUBA 3UO0A 4OI1A 4AE5A 4B9UA 1TL3B 2HAIA 1WWHA 4J9MA 2LY9A 3BG5A 3R9LA 3HM9A 5K5RA 3V42A 1D0ZA 4WE1B 2EEYA 1IV6A 4FN5A 3N79A 3ZZ0A 1J59A 3K17A 1DBDA 2NAZA 4GC7A 2DNOA 4UB6C 4I7FA 3GZNB 5GMEA 1FJGF 2NR0A 1X4AA 4JK1X 2M2EA 1YG2A 3ZMUA 1VBZA 3CWJA 3OL6A 2ADCA 2AQFA 5HROA 1U2WA 4J9LA 1X0PA 5A8RB 1WOPA 3HBLA 1R8BA 3DHWC 2J6UA 1YRTA 3E7LA 3PKYA 3TO6A 3PQKA 3C8YA 3JQMA 3OYCA 2AYMA 3OJUA 1IC8A 2ICWG 3E5UA 4HNUA 2A18A 1VK8A 4ZP9A 4B9SA 4E4HA 5HO4A 4LF6J 3MCNA 3M9AA 4ITVA 1OCTC 4KQZA 4B9LA 2OGUA 1NK4A 3BB5A 5HBMB 4HQEA 4PYDA 5HLHA 5J1UA 4BEHB 1MBJA 2BBEA 3DLKB 4IRKA 4PWUA 4NUBA 3JRAA 4IHWA 4BYYA 1RWOB 3PO4A 2XC7A 2C3OA 3M8JA 3K9TA 1BOAA 1ETVA 5HQ8A 4F7VA 3HD2A 2D3OR 2DNYA 2VPLA 4UXNA 3QNWB 1VRTB 3MAAB 1TL3A 2DNNA 2PIIA 2R7QA 1QM9A 4NYPA 1Z0XA 3BSCA 3ZMDA 1H8AC 3C46A 1WKLA 1UVNA 4CYUB 2ME6A 1VJWA 4LITA 3IRQA 1UZHA 2FVRA 1YQHA 4P73A 3CCES 3LAMA 2ME0A 3VOEA 4CDIA 1AKHA 3J7YU 2NYIA 3FC9A 1OCZH 3BZCA 3E1SA 1VQNS 2MB0B 3VYUB 2D45A 2O1PA 5TRDA 4RBUA 2DA5A 2ERRA 5ILVA 2HLTA 3WU1B 1IXKA 1O0PA 1RT2A 4L5JA 2FY1A 3LUYA 4RWWA 1N33J 4BH9A 3F6OA 5B3SH 2ZH1A 3H8YA 2FVQA 3KYDB 4IOAQ 1RRJA 1TWAJ 1SVLA 1HBUA 2IAJB 3RPUD 1UMQA 5EG0B 2APOA 3S7RA 1DDNA 1JJ4A 1Y5NB 1B9NA 5DO2A 5E1ZB 3FMSA 2KG1A 2IAJA 2EWNA 3K1NA 2CKWA 2RREA 5BXIA 3OVBA 5BOXA 4P10A 2V8GA 3K4JA 4EJTA 4DV2F 4ZTJA 3H9JA 2EJRA 2XI3A 5LRRA 3EDPA 3MMAA 3PIOF 1YW9A 1CQNA 1AW0A 3N4MA 1LWXA 5JHUA 2ATLA 3WX4A 1S48A 1B0PA 2VFRA 1FDNA 1QD1A 1ZYQA 4KGMA 1RCOB 3PNVA 3ZRGA 2P6TA 4EQQA 4BQQA 2E5LF 3HZGA 2BXYA 3CJRB 3PM1A 2PFDA 2BW7A 4NLWA 3DPTA 4BLGA 1VS3A 5AXLA 2E5ZA 2L7MP 4DV6F 3HDSA 2PBIA 1JE8A 3NMRA 3CTRA 1HBOA 2XAJA 5F8GA 2BANA 1K73T 2WADA 2P5KA 4DIQA 4JB8B 2UUCF 3WZ0A 1HNWJ 3NRBA 1FJ7A 1FEHA 1BWEA 4HH1A 1D0XA 2PC6A 3BBFA 4F4WA 1YX3A 1U1OA 4DHVA 3T1YF 2JZ5A 3KLNA 4I4BA 1U1KA 2M0GB 2AX1A 3CCLI 2OPSB 4A46A 5IQQA 3I5BA 1H38A 1Y39A 5L3CA 3HYIA 3JTGA 2C2ZB 3R5GA 3LAJA 3OTDA 2GMHA 4C8LA 2COMA 1F36A 1WWXA 4P9FA 5FLXZ 1X1BA 2MSSA 1WC3A 2B7BB 5HS9A 4CHUA 4X1EA 4K4YA 2LC2A 2HS4A 3NGDA 4J9RA 3FK7A 2R5ZA 5SZTA 3MFIA 3UFCX 2L5QA 3ZQFA 4I2PA 1U8WA 5K8OA 2ZZTA 4LMZA 2XMWA 3QOPA 3RTRA 4Y2KA 2DVIA 3KK1A 4RW6B 3KG4A 3TZXA 5HNFA 1QQIA 2JRSA 3MR7A 4DV5J 4G12A 2B43A 4I67A 1N6QB 2A2CA 1GMWA 2ZXWH 1XQIA 4OHWA 3K1MA 3A2KA 1SVOA 2DB1A 3FBNB 3H5XA 2F48A 1W36C 1YLXA 1EZZB 1WRJA 1TZLA 1DUXC 3AB4B 2CPZA 2W1BA 2H1KA 4EU0A 3VF0B 3AJDA 1O4XA 3HOZJ 3QT5A 3VFZA 4XO0A 1PVEA 3L2VA 4OX9J 5E8GA 1R1UA 1ZAVA 3DOMB 1UJ8A 2DAOA 2FD5A 3CPWR 2GCFA 2J5OA 3BZKA 4DZPA 4BACA 3BM7A 2F5DA 2GV1A 1JWWA 2OKQA 4A8FA 3FEZA 1NH8A 1X5TA 3MR3A 4D7MA 2X6OA 1UEKA 4KYZA 4NXMJ 1Q1VA 5HMXA 1VQ9S 1IN7A 2CQ2A 2W8LA 3DPUA 2M87A 3TARA 4JV2A 1MROA 3CDIA 2OP5A 4F4XA 1G3SA 3Q8QB 2M88A 2HI3A 4X65F 1MH4A 3LGHA 3DXSX 2FBIA 2M7SA 2WRMA 4C7QA 1IG7A 2OC6A 3EICA 1TVRB 3BKFA 4UUWA 2OCEA 1K6YA 1Z05A 2N7YA 1Q16B 1Z2LA 1UFMA 4XICA 2WV1A 5LEJA 3C16B 1KOOA 5D6GA 4Q5VA 5I42B 1CJUA 4GGGA 3CC2I 2XAUA 2WAEA 3CDLA 5EWGA 1RT7B 2E1AA 5KG5A 5L3EA 1WG1A 4QU6A 2JA5J 3FEXB 1MJBA 5LGTA 4CLTA 2KM8C 4MEYF 2DK5A 1BQNA 2JDJA 3K5OA 1J5YA 2J0QD 5CVUA 2VT3A 4BUPA 1W26A 4D5CA 5KG0A 2DR5A 2MGZA 1U09A 3BH7B 2H94A 3HVRA 3QGHA 5D4SA 5JVTA 3Q8SB 2O03A 2R3VA 3AA9A 4XN3A 3SFZA 3OFFA 3OR2C 1WH7A 4LF7J 3EETA 4KIBA 2FYXA 2I8EA 2ZVIA 1RKWA 1QAYA 3FKJA 3KE2A 4I0WA 4I6ZA 1USTA 1BW5A 3HPOA 1YYVA 2W2MP 3QFWA 2Z58B 4B3RJ 3SYTA 3TEHB 8RUCA 4L0YB 1PBAA 1HKTA 4F50A 1LVKA 2RDJA 4NI2B 2EXUA 3ICLA 1DRZA 2K7JA 1NEEA 4CCJA 4YHHJ 2JSPA 1BIAA 2K2PA 2BOAA 3M8SA 3CMAI 3HLUA 1FK9B 5FFZA 1Z6TA 1C0TB 1DURA 3FBEA 1ETWA 2QN6B 3CJ4A 2DQRA 5BPDA 2DK8A 1XGNA 4N4OB 5DETA 3BG6A 5CAAA 3MD3A 2RDPA 3EUAA 4G7HF 3FRZA 3EM1A 2VXZA 3O1LA 4B02A 3B82A 1U1RA 3DKWA 3RGIA 2UUWA 4AYBN 1ETYA 3HT3A 4IDKA 2CNNB 2C22A 4TN2A 3EX7B 4M6VA 4HX7A 1AU7A 3N0VA 5LFAA 3E6DA 5M5YJ 5KT7A 2Y3YA 1FWLA 3ZXWA 1XX5A 4U0VA 1VQSA 9RUBA 4FETA 4PJLA 5K7FA 2V8DA 1KQ9A 3T3FA 4J9QA 1QVUA 2CW7A 4JI7F 5CVJA 3M6UA 3CCVS 4E7IA 1TC3C 4LJMA 1VIXA 2KRFA 3H36A 3DKDA 1IN8A 2DFHA 5DM6Q 4O4GA 2J9EA 3Q0VA 2IS1A 3LSJA 3H5YA 4IRHA