1KONA

Crystal structure of e.coli yebc
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
244
structure length
233
Chain Sequence
GHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLDANPRLRAAVDKALSNNMTRDTLNRAIARGANMETIIYEGYGPGGTAIMIECLSDNRNRTVAEVRHAFSKCGGNLGTDGSVAYLFSKKGVISFEKGDEDTIMEAALEAGAEDVVTYDDGAIDVYTAWEEMGKVRDALEAAGLKADSAEVSMIPSTKADMDAETAPKLMRLIDMLEDCDDVQEVYHNGEISDEVAATL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein yebC
publication title UNPUBLISHED
rcsb
source organism Escherichia coli
molecule tags Unknown function
total genus 63
structure length 233
sequence length 244
ec nomenclature
pdb deposition date 2001-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01709 Transcrip_reg Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1konA01
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1konA02
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1konA03
3F9KA 1KONA 1WJEA 1K6YA 1E0EA 1WJCA 1WJDA 3HPHA 1WJAA 1WJFA 3HPGA 1MW7A 4F3QA 1WJBA 1LFPA
chains in the Genus database with same CATH superfamily
3OIOA 1LFWA 1HA8A 3SI8A 3M9AA 2PEBA 3D6HB 1U0JA 1SIWB 5FKLA 1S5ZA 1B3TA 5ETTA 2MSTA 2LA6A 2GZWA 1VISA 3VF0B 4ANJA 1BJAA 4P9FA 3NOGA 4F50A 1MSEC 2FQ4A 2WV1A 3O2PE 1XGNA 1NH3A 5DO2A 3K4JA 3J80K 5T41A 1JLBA 3OL7A 4HF1A 4IHVA 1TNTA 4CHUA 2CXEA 2RS8A 5D6FA 4ENJA 2QENA 4ZLJA 1KN6A 4ETSA 2DA2A 4YP3A 3QSIA 3JRGA 1VK8A 3L7PA 1TAQA 2HURA 2XSJB 2V0NA 4A12A 3GV5B 3KDNA 3I54A 4E4HA 2P9CA 2RQPA 3E3XA 2HHXA 4QR2A 3KP6A 4IRHA 1GX5A 2UUTA 1ZM4A 1X0FA 1FWKA 3LPYA 3VYTB 3MM5B 2HHPA 3O8GA 2OO4A 2HNDB 3RBZA 3F8BA 2NPIA 4WZMA 3MD1A 4XONA 2H09A 2XF7A 2L41A 5HROB 3HKZA 1IRZA 2XZWA 3CCWA 4HDGA 3FSIA 2DO4A 4UUSA 4DL0C 2DA5A 2PEXA 4NLDA 4LBPA 5AONA 5GAEU 3K5LA 3H25A 3MD2A 4ZJLA 5EWEA 1FBSA 4M6YA 1CS4B 3BLYA 1FYMA 4CTAA 4DV5F 3OD2A 1YIJS 2VI6A 5KFPA 1V3RA 2OPQB 1U47A 3I0RB 4K4TA 2XHCA 2LVSA 3JB9k 3MZ8A 3GCWP 2ZSIB 3OMYA 2V63A 2HS4A 2LU2A 1P27B 3NNCA 1IZ1A 1R8CA 1YX2A 2M87A 4MEYF 4XLEA 3FFIB 1S97A 4QWDA 2DMUA 3EPZA 2MHNA 3G6XA 1W7PD 3BDEA 3SQOP 1ZAWA 1IUYA 4Y2AA 3TMOA 4OX9J 5FGMA 3HOXJ 1WZ2A 1JLAA 5FLXY 4URQU 2NVUB 4XPCA 1I51B 3MN2A 1Y1VJ 3K7AJ 1F0XA 2BANB 4DDFA 3U1KA 1YGYA 2ZH4A 1ZZFA 3VDXA 4S0HB 3PW7A 4DQRA 1Z1ZA 2DNQA 3OYFA 4DL5A 1S1WB 2XSFA 5IWAF 2XLJA 1F4KA 4DFKA 1SH0A 1SIZA 2HPIA 8ATCB 5L3GA 3S2DJ 1XBWA 2RDIA 1I5OB 1HQUB 1HBMB 2GWRA 2DYSH 5FLXU 3HOSA 2K9QA 3X2QH 3PRBA 3MMAB 4DR4F 1H9GA 5HNFA 2F8EX 2ZBCA 2CUZA 2M8HA 1AU7A 4C98A 1O57A 2VG7B 2V2ZA 1DQUA 3IKVA 2LDIA 3IAM9 2E2HJ 1GH8A 3IP0A 1KBRA 1YJVA 5KAFC 1FRHA 2F5FA 1TZLA 4IX7A 3NRVA 1WEZA 4HOBA 2B9YA 3KHHA 2AD9A 1B72A 2UXNA 1UW9A 1QM9A 1JLCB 2Z4PA 4MKYA 3F8FA 2HHTA 1MBFA 4ID5B 1NDKA 4PK4A 4UUXA 2OTJS 2XGDA 3LP0B 2YTCA 4OZ3A 3U7JA 3JYTA 2AS5F 4Y0FA 3L9FA 5JVHQ 3KK1A 5CQGA 3PRDA 3FKIJ 2GXGA 6FDRA 3OUYB 5H9EJ 4AM3A 4JI2J 2CNOB 3NAHA 2V7FA 3M30A 3GUDA 4OX6A 1VQNS 5KT5A 2Z30B 4DR6F 4PZVA 4JB8B 4MKAA 1RT5B 3D4JA 1R8AA 7FD1A 2KYXA 5KHDA 4NRUA 3GEZA 5KFMA 3LO3A 4BKXA 3KK2B 2MW8A 2X4HA 1VHIA 1DURA 1RHKB 1S1VB 3LP2B 3ZZPA 2KQRA 1ZG1A 3RRGA 5IC4B 3BG3A 5K7ZA 1X5PA 5HVGA 3R5GA 4C9YA 5LSRA 3JQKA 1S9EB 1TK0A 2GXAA 2GXBA 2GOMA 2YY3A 4MJKA 1MBGA 2G0IA 3R61A 2D3UA 3MMJA 1U0HA 5J4VA 3D1OA 2QBYA 3IRWP 4EJTA 1FO1A 5F0UA 3J7AO 3CUOA 3MM6A 3R97A 1FDNA 4P2MA 3LSGA 5EGOB 3WTXC 4YIFA 1S7IA 2U1AA 3GG1A 5LMUF 3LAJA 1VQ4S 2JC1A 2V8HA 2AYMA 3HHLD 3R6SA 5H1SV 1SANA 1WJFA 2CZVC 1WEXA 4C97A 4KT6A 3NGSA 5M2UA 1Y5IB 1HPZB 1SQGA 5CABA 3C15B 1YE9A 4KDPA 1J2VA 2E36A 4ZHRB 2D74B 2IDLA 3UVJA 2JVGA 5EN1A 3N28A 4UUTA 3Q0AA 2RNJA 3IAS2 2CQKA 4O3QA 5J2MB 4A3FJ 2QIFA 3U1DA 2UVVA 3QRFF 2YKNA 2NAZA 5M2PA 1OPIA 3KOAA 1YO5C 2DAOA 4ZP9A 2VDHA 4PQAA 1WOSA 4FXWA 4ES2A 3NWSA 4N47A 4I4BA 4O3SA 4Y4RA 3LQVA 5D0GA 3KP7A 5FLVA 2QVOA 1QRYA 1FRJA 2VFUA 1RAGB 1XG1A 2NLWA 3HZJA 3H2VE 1U1MA 2W84A 2DGXA 1T33A 2X1DA 2JA6J 4NLRA 1N32J 4HT7A 1EH7A 5D0RA 2W48A 4BC7A 1CSJA 4ZPCA 1JKHB 1S9GB 3H40A 3CDLA 2HBYB 3K70C 4XKWA 1YI2S 5KG6A 4G6TB 5DRKA 1Y39A 2B7BB 3V81A 2R8GA 2EA2A 3RB0A 1R0CB 1RR8C 3A02A 2GIFA 2X3DA 1RWXB 3UN3A 4I6AA 3K2AA 2KH9A 2B0GA 2BACA 2W1OA 2M45A 3QRPA 4KHRA 1VCTA 3GYGA 2KL4A 3KLEA 5C2GA 2I10A 3VGUA 2DDBA 4OIPF 4XSZF 5KFSA 1YITS 2DNKA 2KZMA 5DG9A 3BB5A 2DR8A 4KJIA 2R4GA 2FZGB 4P72A 3ZQFA 1SV5B 4OYIA 3GJSB 4JI7F 3A4CA 1GNKA 1Z05A 3TUZC 1M1HA 3HX9A 1RYSA 4KE5A 3SV3A 2HHUA 2QQ8A 4Q4ZF 3OFGA 2H9ZA 3KEYA 2H8WA 1QSSA 2FJBB 2QWWA 5KFGA 5LFAA 4TU7A 1ZG5A 2R2TA 3JTGA 4LRDA 3VZHA 2PG4A 3IO1A 5HBMA 1FXDA 3H5AA 5HI7A 2IIHA 2JPCA 4PJMA 1BE4A 4H4MB 1IKWB 4PUOB 1N5QA 5F04A 3GFLA 4B3TJ 2CYYA 3CJ5A 1U3EM 1R4MB 1U6FA 1J9IA 2FBHA 1JLFA 2ZVIA 3NAIA 5J1EB 2RMLA 1KOOA 5D5WB 1LDDA 4USJC 1FCAA 3GV7B 4CLZA 2FHKA 3CIMA 3CJQA 4LFAF 2D69A 2KI2A 3ZQHA 2V26A 3ET6B 3VV2B 1BXNA 3AB4B 2CU7A 1R8HA 1OISA 1T0TV 2CPHA 2KT2A 2WSCC 4ZA1A 3BSAA 3IWNC 1N5VA 3KYDB 5IOZA 3HRMA 5IT3A 2K4JA 1HWLA 3OXLA 4KPYA 1CJVA 2WSEC 4KN7X 1FJ7A 5D8HB 2XB5A 4PSXA 4IG3B 1VI7A 4MTEA 3FBNB 5LBQA 5J8FA 5LRSA 3J81Y 3RZAA 2IJLA 4QPTA 3CF2A 3HHHA 2M7AA 4DX7A 5KFAA 3HRSA 3OFEA 3PM9A 1HA1A 1Q86T 4KBIA 4CXFA 2YH1A 3M8FA 4BQAA 3OFHA 1I5ZA 2OPRB 3VB2A 4W90B 3QPLA 2LCWA 1N36J 1S49A 4EK2A 4WFXA 4F67A 4LF9F 3QPIA 1EP4A 3P9CA 5DLFA 3J81U 2QYGA 2CPYA 4U7BA 4USHA 5E17F 1KHVA 3K2YA 4XR6A 2OGUA 1U48A 1KLNA 2LFVA 1W2IA 4CO8A 4HQMA 1N25A 1FNMA 4FYWB 2UXDJ 1YLFA 2XROA 3NWTA 4I0WA 5T7LA 5IS2A 3L2UA 2DI3A 3ZMTA 5A6PA 3R27A 3A1YG 2EBEA 1RR7A 3MHYA 2RU3A 4KA4A 3H90A 1OCPA 3DLAA 3TP3A 2IJFA 2JVOA 5J40A 1WOPA 3PYFA 3EJMA 1YRXA 4ZK7M 3OWTA 4Q47A 3ZZTA 4XORA 3K4LA 1Y3KA 3DLEA 5CYQB 2NS0A 1GXUA 3KHRA 2ZH8A 3BN7A 2ZJ2A 3IH4A 2M88A 4AYBN 5JHUA 1JK9B 4R5PB 3SXYA 1ZM9A 3W62A 3OYMA 1IAWA 4F7ZA 4Z37A 5HLGA 1YJNI 3BV8A 3JW4A 4BAYA 2RHQB 1AXQA 4MFBB 3MCMA 3QPHA 2YSRA 4U7DA 3CCVI 1ETKA 1RT4A 1Y5LB 2EZKA 3BR0A 4HEA9 1WHWA 3AY0A 2Z8QA 1J09A 1S59A 5I42A 1NJYA 2F4IA 4QIEA 1TTHB 2CRGA 3HRTA 5IY5H 3QLHB 2X9DA 5K7FA 2PI4A 4Y6IA 2JEGA 3J7A1 1RADB 2W85A 3MAAA 1HHTP 3AG2H 4U0VA 2IRXA 5ICGA 3DOKA 1OKRA 1JNZB 1HNVB 1WJDA 2UVRA 4A3BJ 1EETA 3I5BA 1TWGJ 5ADZA 1FWLA 5KFFA 4NEYA 3VOEA 1MIJA 1RK8A 3OTDA 3HF5A 1RT3B 4XM3A 2YKMB 3FBEA 1X1BA 4ZDOA 2PN6A 4GC7A 2OD5A 2W8LA 2HZTA 1P92A 3CC2S 5M5XJ 4HR2A 5AT1B 3PX4A 4L5IA 5CZVA 4NCGB 4J9VA 2DN0A 4RW4A 3PHTA 3LWLA 1RAEB 4K50A 4RWWA 5E18F 3Q8RB 3R8YA 2DK8A 4CT9A 1HQEA 3W5YA 5DZ6A 3D6FB 4NB5A 5ETMA 1ZLJA 3GYNA 3G9CA 1E6VA 2RC4A 4HDUA 2BZ2A 1FKOB 4GO1A 2O03A 3L7WA 2V6EA 1WSUA 5GAEI 4A8YA 3GE9A 1WNEA 1Q81T 3ROUA 4BBYA 1LFBA 1OR7C 3MFKA 4QPQA 5JXSA 2VJ5A 3M8SA 4YB7A 3Q0WA 1HDDC 3U21A 2XDVA 1IR0A 1Y10A 1K61A 2Y0SD 4I01A 3D3CJ 3DKYA 3MMBB 4DV1J 3HFVA 3T1HJ 2BM0A 3M1VB 5FROA 1VZ0A 1VBXA 1MN9A 4RUAA 1P4XA 4OL8A 1QVFR 3FBCA 5KG3A 2JVHA 4BDZA 4LBIA 2RRBA 3S3MA 4K5SA 4ILMA 1JLQB 4A3KJ 5E3PA 5IT9Z 1IO2A 2E9RX 1LK5A 1K6YA 2QGUA 3AH6A 3DKDA 1VQLI 1K4TA 1OMSA 4DWIA 2IAJB 1J59A 3CJTA 4F8RA 3MPDA 2ZH7A 5ICEA 2DQLA 1CJKB 2KRBA 2HQFA 3UCUP 3PYEA 1PVEA 3V6DA 4ZVUB 4Q48A 4ZVHA 4CGZA 3QPSA 3M6UA 4K2JA 3VR1A 1PCAA 3MEXA 4WXCA 2N82B 2BEOA 3QYFA 1Y8RB 3PEHA 1EA3A 1PP7U 1CQMA 5GAGU 4KIFA 2C2MB 7FDRA 4MTDA 4IHYA 4TKTA 4DR2F 3NGKA 4M73A 4A3EJ 5IZHA 3CJRB 4USTA 3LSHA 2O6GE 1MROA 2KIQA 1T9WA 5HATA 2Q2EA 2G4BA 3A2KA 1YX5A 1SH3A 3GB0A 2DFIA 3IR7B 3VGVA 4XKBA 5LSOA 4F4AA 2H51B 4QSHA 1NK2P 2BJ8A 4J01A 3FBBA 3AL0C 3IWFA 2IFXA 4B3MF 3QAHA 2YNHA 2NXEA 2CWXA 4F25A 2IA0A 1KEKA 5HMYA 5MLCV 1S6PB 2OSRA 3QOEA 1VQOI 2BJ3A 1Q8LA 3TWZA 2OTLS 2F65A 2RF2B 3GPAA 2L9NA 2P8TA 5TRDA 2AZ1A 3I55S 4DSJA 3W66A 3PZPA 1K6OA 2CDQA 1G4CA 1G4DA 4OHZA 1UEVA 2DBBA 3E6MA 5C3EJ 1HNIB 1Z21A 4AC0A 1MKMA 1NCLA 2F9DA 3W7BA 1GV2A 1ODDA 3VTIA 2Y0SN 3ECHA 3BTIA 3QWLA 2W4PA 2UUZA 4OHXA 2HHHJ 2L54A 2JUCA 1DTQA 2CPIA 3CQZJ 3FVYA 4FYYB 4G1QA 4QOTA 1NO8A 3OR1B 4P6QA 5L9XA 5A8WA 4OYWA 1RP5A 2CQXA 2A3JA 2GJ2A 2YX7A 5J6XA 4UF4A 2DXIA 3A0HC 4WFZA 5LXRA 1JUMA 4KICA 4FPRA 3HDSA 5D3GA 3QO9A 3ENVA 2EG1A 4P7VA 2HYGD 3ASNH 1JLBB 3SDGA 3RGIA 4A8MP 1X9MA 2QZ8A 1A9NB 3GTOJ 3MF5A 1NAQA 2GJIA 3ULHA 5H9FK 2NXNA 2OJ3A 2DCUB 3L09A 5F6FA 2BQUA 3J80Y 2COMA 2A2DA 2GHWA 4EM2A 2ZJPF 1MSFC 3CCQI 4M3DA 1ZGWA 1B64A 4KIBA 4MNUA 2GIRA 1FXRA 4DG1A 3BO2A 2DR7A 3MM9A 1MDMA 2PIIA 1OYEA 3P5TL 1XB4A 3TX0A 4JV2A 2Y1IA 2YBVA 3DLBA 1HW9A 3KJQB 3EDPA 4FDFA 1KTQA 2DVIA 4U6PA 4AU7A 1HBNA 4N4OB 5KFOA 1XMAA 3CCMI 3J80U 5DZ7A 5DQGA 2ZBPA 4ALZA 3OTOF 1K47A 2L2OA 3HSRA 2ZJRF 2M5YA 4UUSB 3AD8C 1Q5YA 4CI0B 1KQ9A 2J6SA 3JRIA 2W2NP 4E70A 4HLYA 3ZQGA 1D8KA 3UCZP 3I87A 4CTAB 4DFJA 2OHDA 1RAHB 3R6GB 3SZ2A 4D5FA 3VAHA 4I2OA 4OI4A 4U0WA 4DV0J 1WKKA 3GTLJ 1V5EA 4RLEA 3RB4A 2RJZA 2PD1A 2EFQA 2GVDA 2C2RA 2ZXWH 1FDBA 2V50A 4BBRJ 1TU0B 1VDHA 5J1NA 2M0CA 1YTYA 1WC3A 4NYOA 2DTZA 3LSMA 3M8PA 4IOCQ 3BZ6A 2BVLA 3DYAA 4R1HA 1UVLA 2C42A 3WU2C 1T9UA 4DR5J 3CO7C 1IXKA 2L48A 2OSQA 4YIIA 1H89C 3QT6A 2YPZA 3OVSA 4F02A 1JLAB 2MZTA 2W7OA 4CUGA 1NDPA 1OJ4A 2C2NA 2MKCA 3S1NJ 1QZYA 1KWMA 3K59A 3W8GA 2IRUA 3CC4S 3IHUA 2XY6A 1S77D 4B3RF 4E7LA 1ZA2B 1ZS6A 3GLJA 1NEEA 3L00A 3KZYA 3IM8A 3G71S 2DHAA 2ZXIA 2ECCA 2EA4A 2WBMA 2DHXA 2NXUA 4CO5A 3RG6A 3HT3A 4ED2A 5DD8A 2DEJA 2H5JB 2HYIB 4NZ6A 4ZCIA 3P96A 4CO1A 2KISA 2MHEA 4PCQA 4A47A 5HQMA 2WBRA 4RBOA 5IQ6A 2XVCA 2BABA 1SL2A 2V5HG 3FSYA 2B7CB 4ZLNA 1DU0A 2FA5A 1NU4A 2A5WA 3F8MA 2WW8A 1S10A 3K70D 2OUGA 3FHZA 4DCOB 1M5SA 2C2EA 4RB3C 1AT1B 2B6AA 2A3SA 4II2A 4XBFA 4ZP8A 3A3OB 2JUGA 1B72B 5SUHA 2CUFA 2DB1A 5F8HA 1X5OA 2L9VA 3BQ2A 1HCRA 1BJZA 3F73A 4MQVA 1RT6A 4DZ6A 4KGMA 1F3VA 1HD0A 1IQTA 3JYTB 2XS5A 3AA8A 4O3OA 2F6CA 1Z3YA 2LY1A 2JFDA 4M94A 4MYUA 2ATLA 2KIMA 5A0YA 3C7JA 1MG7A 3MMCA 4KISA 1UG2A 3GU0A 3DRSA 1XPXA 3M30B 3EDQB 2EG2A 2RQKA 1VQ9I 5KFVA 4E0DA 4HYEA 1TUGB 2HDCA 4D9JA 2UU9F 1S7AA 1PJ5A 3CJ0A 1KYWA 3H9QA 4BACA 3QP6A 2EK1A 2AKWB 2K3IA 5BYRA 1FXLA 2J5PA 1UFWA 1E6YA 2M2BA 1SKSA 2L0KA 2FX0A 4ZPVR 2JVRA 4ED7A 3G82A 4NWBA 4DF8A 3OXFA 3EETA 4WCEQ 3Q3SA 1FERA 2F1FA 1WHYA 2YWFA 5H6QA 2M4GA 4C8LA 4RB0A 1VJQA 5K20B 2YKAA 1Q8KA 1U0HB 5ITHA 3EGWB 5HN0A 2QBYB 1FZPB 5KT3A 2IVMA 3NXZA 1TW2A 1MBEA 3MM6B 2HTJA 4MFEA 2EJRA 2ACMA 2M3AA 4RJVA 5A2QZ 5M3MJ 4YDXA 1YW8A 2EIKH 1V5GA 3OPKA 1MU2A 4HHHA 1WOOA 3LA3A 4MFDA 5BNGA 1KVKA 2IGKA 3DOLA 3UI3A 1YWXA 4BS9A 4DR1F 5DQIA 1HFEL 5AXLA 3HEFA 4B48A 2VPRA 4GDFA 3UVJB 2O8XA 2HQIA 2MKHA 3SDBA 4FX4A 1JT6A 2XGPA 1SAXA 4A3IJ 4PYDA 4Q5VA 2TDXA 1XCVA 1SJFA 2DH9A 2NS7A 4FE4A 2YKNB 2G9OA 4KQZA 3MUVP 3TOBA 1TVRA 4K4SA 3JRAA 4DN0A 2HZVA 3DLHA 1WKMA 4ZYAA 2ZUAA 3QOPA 3ZRGA 1PYTA 3IG1A 2KYZA 2YNFA 2A5YB 2HNHA 4P74A 4G8XA 2O66A 4NC6A 2E1OA 1F1ZA 3DM2A 1MMAA 2ME0A 1RAAB 1D8ZA 1F5AA 2RE1A 1L0OC 3RB6A 2V4JA 1JUSA 1NMEB 2KTQA 1ONVA 4J90A 3OYIA 3AT1B 1B9MA 1U5TA 2OZ6A 3E0JB 1TKTA 1X5SA 3NCPA 5E7OB 4ELUA 3SYTA 1OIAA 4GKKJ 3V6HA 2IM1A 2ZCWA 4LBHA 5B0AA 3TO9A 3GIIA 2E1NA 1NG6A 5E79C 5H20A 3TUJC 3VYSB 3G8QA 1H88C 2W8KA 1LB2A 1S7OA 3V81B 2GGPA 4Y00A 4U67Q 1D1UA 1CLFA 5K8OA 1FKAF 4DV7J 1WJEA 3I5CA 4FETA 2H48B 2JH3A 4I1TA 3LFKA 4PYAA 5F8IA 5IT9K 5HS7A 2FNAA 2BYVE 3CDHA 3I64A 2ABYA 1RZ4A 2HPUA 3E6BA 3EX7B 2KG0A 1CG2A 1C0TA 3HKWA 5KT6A 1AUDA 2L7KA 3CCUI 4F2SA 3HHEA 1P7JA 3HXMA 5D6GA 2XV4S 4LQ3A 3G96A 2BDPA 3GSIA 2JL9A 3ETOA 3LGNA 3FRZA 2YQ1A 2HQGA 1R89A 1FMVA 3MI7X 2FSWA 3TVYA 2VA3A 1T05A 1X4HA 1V54H 4QPOA 3TR5A 1KSPA 4BXXJ 4UY8I 3RQ4A 4XKCA 1UB9A 1J5OA 2H65B 3DXBA 2JEIA 5HBMB 4M71A 3L2QA 2LEAA 1U1OA 1EKEA 4K4UA 2AHOB 4ESJA 4I98B 1I94F 4EFAC 4XPEA 4FYDA 2LYCA 2X7IA 2F5EA 1U1NA 1JLFB 1Z4UA 2QMWA 4RU9A 3SBMA 4CDIA 3KHLA 2VHGA 2VKHA 2XMVA 3F56A 5ETLA 2W01A 4OJGA 2ZMEC 3V6KA 3Q8SB 4IQ4A 3CJQB 2VKVA 2MQOA 3PNYA 3MM7A 5DG8A 5LMNF 1ZR4A 1XWLA 1JKQC 2OEKA 4DHVA 1F60B 1FHTA 4HTJA 3IAM2 1P1LA 2EV0A 3W2AA 3PRVA 5J1RA 1NH8A 2MQNA 4BQNA 4MIAA 2WA0A 3RW6A 2Z1DA 3EMTA 2K2PA 1N6QB 2HQAA 5HMWA 3R7BB 5KFYA 1CJVB 4U88A 2X51A 2OPTA 4WBFA 2R7OA 5LMUJ 3Q8QB 4EM1A 3ZTQA 4S05A 3QMQA 5GAGI 2HQRA 2DMPA 4P1WA 1KR4A 1D0YA 3DDNA 2YUSA 2EFNA 5E5NA 5IPAA 1BIAA 3BR9A 1PKUA 4HYKA 1HNZJ 2B4VA 4JOUA 4ZVOB 5DTDA 4CCLA 4Q0BA 5HS8A 2CQ2A 1YJRA 4GYIA 3PFYA 2XI2A 1BQXA 5KFWA 2QLWA 1EP4B 1ACMB 1OSDA 2HSEB 2BM1A 4A46A 3DF8A 1VBZA 3GR0A 3C3WA 2LQBA 5HJXA 3B8HA 1OCOH 2W9BA 2OU2A 2W25A 3SJMA 5DCMB 4MHGA 1JX4A 5T7LB 2G7HA 4OIXA 3PEJA 5TJJA 2MEWA 3L2CA 1ITYA 2GO8A 3P5BP 1M1GA 4UY8T 2ADBA 2E7XA 2ME6A 1LE8A 4C2MJ 4IOAF 5BPIA 5K14A 4ENNA 2HFZA 3DLEB 2KRRA 2YU9J 4KH0B 4XDCA 1FNNA 4DJBA 3HBLA 2ZM6J 1WC6A 3JSMA 4NUBA 3NBPA 3FNNA 3NWRA 1UTAA 1MH4A 3BG9A 4ZC3A 3TW6A 3PJWA 2OBPA 4I64A 5A6WA 1TFYA 2KN4A 3ILIA 1RT4B 3HHNB 4ECYA 2E60A 3D66A 2FJXA 3HZEA 3V4MA 3T5KA 5I42B 2EZIA 4Z2YA 2HRYA 3P6YC 1T3NA 1QA6A 5FRMA 4HI2A 8AT1B 1R71A 3MAAB 2XMKA 2R9LA 2FVPA 3LL7A 4HDHA 2IM3A 3OR2C 4IEJA 1RTHA 3DOKB 2YWWA 3EYZA 1H7XA 3C14A 1RXOB 3NCRA 1IW7F 1OLTA 1MMDA 1EETB 1XIQA 4DS5A 2AO9A 1SPBP 4JI7J 1C1CA 4NZ7A 4N9HA 3IXQA 3LANA 1GT8A 3MPWA 4ZLLA 4XICA 4NLGA 3M07A 4LJMA 5HANA 3BGFA 1IBLF 5LL6d 4WK8F 2WK4A 2OD4A 3THPA 3K5MA 1NG7A 5BR8F 3S1MJ 3ENWA 4RW4B 1WSRA 4F52A 2RH3A 3GQCA 2JA7J 1TW3A 1HQEB 3W9IA 3V7CA 3P9KA 4OYOA 2PX9A 4NYZA 2QSWA 1C0UA 5D4NA 1RRJA 1E6VB 3RUBL 3ABMH 3AQOA 5K9FA 2BHYA 1OY6A 4L76A 1U24A 1O3RA 1YIJI 2W2PP 2ZFHA 1RWNB 4ECWA 4OYPA 4PGGA 4UW2A 2M4KA 1EKSA 2LXFA 2KZGA 4LFAJ 5ICCA 3EZUA 3ISZA 3UDVA 4M5JA 1MMGA 1EV7A 4RWXA 2HEOA 2MG4A 2MY8A 2NNNA 3UE2A 1EIYB 2XLIA 2MZQA 4CLPA 3MR5A 2VQEF 1WTBA 1ENHA 2EFOA 1DGRM 5FJ4A 4NZ0A 1YVFA 3UO0A 1M5PC 1PAEX 4PJJA 1SC1B 4ZVEA 3JSBA 1X8DA 1XS9A 3L95X 1JNRB 2DNGA 5BYSA 2W4CA 4NDLA 2QRRA 5KFJA 2RILA 5U47A 2EFWA 1G6BA 3N6MA 4NLWA 1ZRDA 5IV3A 2FC8A 2N7YA 3CJTB 1F9HA 2HAIA 1ZETA 1XMKA 1ZPVA 2D45A 1DZ5A 3QYYA 3P3DA 4NX9A 3CW2C 1WI3A 1MD0A 3ERMA 1VQ7S 3P5JA 2Z0GA 1K44A 3PHEA 5JVGQ 3V6DB 1QO0D 4MKVA 1Q8IA 1X1AA 4FNIA 4DX5A 3PM1A 3NNHA 1WJ5A 1T38A 4C48A 2KHCA 5HJYA 4JUZA 3EUHC 3DBHB 3D0SA 2BJ7A 3BJAA 4L3NA 4B9UA 3BY6A 1MROB 2GIQA 4F0HA 2MABA 4I56A 2BBYA 2M34A 3V8JA 1Q7LB 2Q2EB 1B4SA 3LWFA 2OTJI 2B5JA 4KGKA 3PO4A 4USMA 2HBZB 1LQ9A 1AHDP 3FRYA 3IRRA 2YNHB 4BU2A 4QIFA 2RU9A 3LSTA 2V9PA 3L9ZA 3FEXB 4Z6YA 2NVQJ 5A2QK 1S1XA 5LGUA 3AFHA 2XTJP 3BDPA 5EG0A 3BTCA 4RNOA 1AW0A 1VQNI 3OS0A 1DTTA 3Q23A 3VALA 4LQ9A 3ZZOA 5B0DA 2X1AA 5IYCJ 1N88A 3LAMA 2KM8B 2NNYA 3IC1A 3ZXWA 1K8AT 2W24A 5GADI 2ID3A 3C18A 1TWAJ 3K6GA 2BQRA 1HKQA 4O3PA 2V9WA 4CLYA 3D0IE 4DU8A 1DTQB 3OHAA 2X1FA 4RAYA 3BBCA 4CZZA 1KFDA 2V68A 2JC0A 4G1QB 3KLGA 4NYPA 4C9DA 2K5CA 2VBZA 4O6JA 5LEKA 1UL3A 5IT4A 3PUFA 5J1PA 5A8WB 3RPUD 4WZQA 3U1LA 3MPVA 2K4BA 3H9JA 5IOYA 2YWKA 3GVAA 4DV2J 1U2RA 4DV4J 1R4NB 2IVFB 4AQYF 2B0LA 2GC8A 2AX0A 1B59A 4C2MA 3F21A 3MKYB 4X6AJ 5D3GB 3NGTA 3QO9B 4FCYA 2IYIA 2W2OP 2V94A 2QSFX 4PSWA 4CCOA 3VAFA 1WG1A 2NXNB 4OHYA 1VQ4I 1B7FA 2UUAF 3UW1A 5LM7E 2VE9A 5I3QA 5F1RA 2PDAA 2A18A 2BXJA 2APOA 3EGZA 4DSKA 1NB2A 1IRXA 3OJUA 4OX7A 3K89A 5J2NA 5D8LB 1BR1A 4DG1B 3FMSA 3MM9B 1P1TA 2GO9A 1MDMB 2XAUA 2IMOA 4I99C 1TK5A 5C25A 3PY8A 3OLBA 4EBCA 3VGSA 2ASLA 2HEKA 1TAUA 1RI7A 1H8AC 3HFZB 2NUUG 2BOLA 4F4ZA 2NXCA 3RBDA 4S04A 4DIQA 3AG4H 1ZQ3P 1AA1B 1HBNB 2UUCF 5KG1A 2HHWA 1F3FA 1YW7A 2K3PA 3LWMA 5FRNA 2MZ1A 1HNWF 4GC6A 1SMTA 2CJQA 4OX8A 4ZCMA 5TGTA 3H0PA 1XMOF 1N48A 4CM0A 2VH7A 2RAQA 3KZIC 3TBIA 4KYZA 1SQEA 3MR7A 1FFSB 1NK4A 2H94A 2ZXHA 1W36C 3T9NA 2R2RA 3T1YJ 1AFJA 1DBDA 1P4WA 3R2CJ 2FU4A 4JV5F 4WTOB 2Q3PA 1XC9A 4URSA 2ZFWA 1R1UA 2XUBA 1OYYA 2H5EA 3MUTP 1ZR2A 1FJEB 2Y9YA 3SCJE 4PGHA 1F5CA 2Y2ZA 3HSFA 4I7FA 2B43A 4DPXA 2XI3A 3TZWA 3WU1B 4BJ5C 2QQBA 1U8BA 3FMBA 1K1QA 4ZIVA 2BJ1A 2GVDB 3AA9A 1R0AA 3I31A 1NSKL 4EGZA 3BF4A 4DUZJ 2ACJA 4IQMA 4HG2A 2UV1A 3ESWB 1W5TA 5CQEA 1FP2A 2D3O1 3M8ZA 3M8PB 3N6LA 1RHQB 2VIHA 3ISNC 3DYAB 4IHSA 2CW7A 2RKHA 3K8VA 2A6EF 4MTPA 4R8UA 4TXSA 4CH0S 2X1BA 5EDWA 1YBTA 2XGEA 4UQGA 3NMAA 3MMYB 1WJ9A 2UUBF 5LJ5Y 1OCTC 2E19A 3R5BA 2VC1A 1NKCA 2RRAA 1TKXA 3CC7S 3G73A 2DPJA 4ABZA 1BN5A 1JUPA 1YITI 1FLIA 2QV6A 2QF7A 1E3PA 6FD1A 4TU8A 4J7CA 2XS7A 2VBXA 4AIHA 4ZTJA 1S76D 2LFBA 5EDNA 4B3MJ 2KZZA 4K0KF 4DLGA 4F4YA 4MT1A 1Y3JA 4C8OA 1VRUA 3TQ1A 2IAIA 4ANEA 4CYCA 2V9KA 4LFCF 2IS2A 3JREA 4LFBF 4ZZDA 2B6AB 5GMDA 1I27A 4B43A 4PG6A 1DFDA 1Z9CA 2DK5A 4OYBA 3H42A 5D78A 4ZVSB 1JXSA 1X3UA 4AIKA 1I6XA 2Y69H 3HJVA 4QCLA 3H3ZA 5KFXA 2DNZA 4C3MA 3RYLA 3WTWC 1F43A 2JHEA 4Y2MA 4G6VB 3CMES 3NAUA 4M5KA 1BI3A 1RLDA 4IO1A 2CNNB 2IBOA 1FBQA 3G8TA 4M74A 3GO5A 3MMAA 4Y28C 1TT5B 2G9WA 2GCFA 2ADCA 5A0YB 4Y13A 1SKRA 1BC7C 4NOHA 3MMCB 4XDDA 3OLAA 3SZTA 1Q79A 2KDZA 1TL5A 1OSCA 1V3SA 3DRSB 2XAQA 3DTIA 4HT5A 3CMYA 2HVRA 4J9RA 1L5UA 4A8FA 2V79A 2E34A 1NZ8A 3TKYA 2RD5C 1FRLA 3DFGA 3BH6B 4WKYA 3D54A 2LF8A 3ISPA 3OL3A 1NDCA 1FWZA 4B3SF 3PIPQ 4RA2A 4FPIA 3MZHA 3I3LA 1E6YB 3CCRI 1R7IA 1NH7A 3NOCA 2XKOA 1OCRH 2XYGB 5ERIA 3G82B 2V67A 1X19A 4JX6A 1ETWA 3RKWA 4PJ0C 4L74A 4OAZA 3R5AA 4FF1A 3GTJJ 1NJXA 1EH6A 4OHVA 2KM8C 4E7HA 5GVQA 3IFEA 3WDOA 3VAIA 2XG8A 2VPXB 2WCXA 5KAIC 1N56A 4LR9A 3KLVA 2CRLA 1R58A 1R23A 1HW1A 1YHQS 2YR2A 4YY3J 5HVQC 1MU2B 2X1EA 2X6WA 3GX4X 4LLNA 2ZFUA 3WHBA 1HBUA 4D3HA 1P9YA 1AB8A 2AXLA 2IGNA 3DOLB 2HFVA 1ZHFA 4DL3A 2H6CA 1DAXA 1HR0F 3CSKA 4TY9A 2WC2A 3FXLA 1VQSA 1Y4ZB 1G3TA 1UP1A 1R6VA 3UDLA 3OYLA 5AE1A 2BE5F 5CYJA 4JYKA 2Z2ZA 1OYDA 1G3SA 2R0QC 2UV8A 1UFKA 3TUIC 4C8NA 3QNWB 2DA4A 3T6BA 1OPZA 3MKZA 3BR8A 3VVTA 3PJXA 3ENAA 3FKJA 2MY7A 2XMWA 4J9KA 2JSXA 3SCKE 1TVRB 4AXJA 3BKTA 3NRBA 3W3SA 1MSWD 1XNQJ 4U7UD 2JT1A 2GAHC 3GMGA 5CAAA 1SFUA 5B7WA 2A07F 5CVRA 3IG1B 2YNFB 4LVOP 2M3DA 3NS6A 3S2HJ 1F9FA 1VOMA 1QSLA 3DM2B 5KOXA 4BY7J 1LKZA 3DEWA 5DUKA 2V4JB 1NUEA 4GRSA 1CPZA 3GWCA 3I59A 3ZN0A 1U5TB 3D1HA 4J37A 4ZVFA 2LKPA 4M3EA 1TKTB 5C7PA 3EVMA 3J7ZI 4ZH4F 3BPDA 3WIUA 4ZP6A 1WF1A 3ZO7A 4DN9A 3SSRA 2RN7A 5HLHA 1TP7A 5E0OA 5EGYA 4DV3F 4B3XA 2NS8A 2ZO4A 3TANA 1ETOA 4GVLA 2D1VA 3D7SB 3CC2I 2GGPB 3SEZA 2BGCA 5ILSA 4ESBA 1MBJA 3G2BA 3FZBA 2RQMA 2E66A 2L08A 3PW0A 1I6JA 1M5KC 3HJEA 1S1TA 3EM1A 3N79A 2BHZA 1JLEA 2CV0A 1YBUA 1C0TB 1TR0A 1LUJB 3KTQA 2FOWA 4M3GA 1M1KT 3HG9A 1LXJA 4JI6J 3KG4A 5IT9Y 3JTPA 1IN5A 1BI1A 2IP2A 3NL0A 5IV4A 3KMQA 1UHMA 3CESA 3O8HA 2A1BA 3HHLA 4PAAA 4JI5F 2X1CA 3EYIA 4XO0A 1SC6A 2DYRH 2LDYA 3BG7A 3EUNA 2N4DA 3C2HA 1UHWA 4EEYA 3CD0A 5JFRA 1D0ZA 2J8SA 1T05B 4ANCA 2IGOA 4ZLPA 2DCLA 3W3CA 4H4KC 1TV6A 1WH7A 5DV5A 2J0QD 5H6RA 1J5OB 3IBCB 5DCFA 5IT9U 4RU2A 3HUGA 2YWEA 3MD3A 1VRQC 1BGXT 5BMZA 2L3MA 5GPAA 2VKZG 3JTNA 1AWCA 1IM6A 2NSBA 4RNHA 3HD2A 5L3EA 1ACIA 1JTXA 3VZIA 1KS2A 1LW2A 3HC7A 1FJCA 1R31A 2FB0A 5HVHA 4OZ2A 1YJ9S 4F3QA 3HL2A 2E1MB 3A0BC 3R7NB 3MM7B 2PE8A 4LIRA 2PLYA 4M5LA 5IM0A 4TLRA 4XN0A 2QT7A 1D09B 2J9EA 4FQGA 4EUVA 2DXFA 1YG2A 2ROPA 5HP1A 3MR3A 2Q66A 4TYBA 2QL5B 3OYHA 4E7IA 3O1LA 4WYLA 2CQCA 1R27B 3PNVA 2J8AA 4WWCA 4PDKA 5HS9A 3J7ZT 4H4MA 2M0GB 1SAUA 3RAXA 2ZOFA 2E7VA 4NLPA 1KU3A 4IOCF 3HSJA 4JI4J 3IBWA 1S12A 4Z2XA 1P2FA 5D4PA 3RRKA 4BEHA 2H5IB 4PG4A 2Y0BB 1HQCA 5TISC 2KVQE 4URGA 1H38A 1WWXA 2RQ4A 3H2UB 2N7CA 3QU6A 1SL0A 4UUWA 4Q0BB 4E7SA 5JI6A 4IKFA 2AJ2A 2IPQX 3VEPA 2EV5A 4B4CA 4F26A 3PX6A 1EAYC 3CLOA 2CPXA 1WF2A 1BWEA 4EJVA 4ID8A 5H2FC 4O23A 1Q7YT 1ZTRA 1JXVA 3NQOA 3DHXA 4CO2A 3W61A 4IDKA 2W9BB 9ANTA 1N5YA 3CDIA 5L39A 2FF4A 1SJQA 2CG8A 3VODA 2QUFA 5C4XJ 2BOAA 2FY1A 3KG1A 2F8HA 4R79A 3ZTOA 3GLLA 4UTGA 4ETXA 1LE8B 4ED5A 2F4VF 1L3SA 4FKXA 2GLOA 4AYBA 3GFZA 5K14B 2PJRA 1U1QA 1LOUA 3GCMA 2VZ9A 1NXIA 1E17A 3DCFA 2HVEA 3Q0VA 2L7MP 3GCXP 2PMZN 2ZKZA 3JSMB 4JBAA 4IXAA 3WC0A 2HVZA 5F27A 3BCAA 1K0VA 4QIGA 2ESNA 2WAQD 3G1LA 5KTQA 1Y0NA 3H5RA 2KO1A 4AIDA 2KHMA 4CQ1A 2R8KA 3MURP 3OSPA 4JYAJ 2P6SA 4LF7F 1M90T 2LYVA 4BH9A 3DDKA 1OCZH 3WX8A 2HIYA 3T6JA 2CJAA 4PXDA 3QPTA 1PC4A 3R9LA 1LK7A 4OLOA 5CXTA 3BBBA 2NYIA 2YH0A 3S1QJ 1RTHB 3C14B 1TKZA 3K2ZA 1N78A 4RGXA 2K9LA 4AD9A 3RW7A 2HFSA 4GKJJ 2DEIA 1C1CB 1C2PA 2NREA 4G1IA 4LF1A 5JLWA 2OFGX 4F93B 2V4JC 1VI0A 2V2QA 4W1UA 2LBFA 1U5TC 1AYEA 3PFEA 2STTA 1HLVA 4WJBA 4DBRA 2V1XA 1YLXA 2FNPA 4AUKA 4D5CA 1FEXA 2XIGA 2CZ9A 1SJ4P 2N3LA 3Q8YA 1C0UB 2JK3A 4DL2A 3PSFA 4Q44A 1ITPA 4ZITA 4I2PA 4JI1F 1ZAXA 3H5NA 1Y0HA 2VJIA 4DL7A 4FE7A 4XLAA 1XSDA 3AQPA 1GXQA 4LT6A 4WWSA 4EQQA 3TX8A 4DEZA 4WIIA 4K4YA 1QUVA 3I9V9 3M9MB 1XC5A 2RSQA 5I4MA 3FDYA 1A04A 4Q5SF 2Z9OA 2O8KA 2E2JJ 2ZBQA 2V2KA 2IHR1 5JUMA 5C24A 1QE1A 3G86A 2EPIA 3CCLS 2EB7A 1GXLA 1Y56A 1U49A 3F6VA 3LMMA 3FF5A 1KFSA 5FDLA 4GO7X 1AFIA 4KO0A 1R3NA 4ZN1A 1X4AA 5EWFA 3BO4A 3CC4I 3PR4A 2O5DA 2OUMA 2DA3A 2CQQA 3G71I 1W36D 2KFYA 2WAQN 3QGIA 1SD5A 3EXCX 4ILRA 2NXJA 2NVTJ 3M2UA 3WHCA 5KFNA 4BY1J 4K4XA 4IH7A 4OI3A 2ESHA 4XK8C 4XOPA 3NNAA 4YB1P 1VQKS 2MFZA 1HD1A 2DNNA 1WHXA 3TOQA 3I5AA 1G2HA 2VJJA 3H20A 2RUGA 4D7MA 3GZ7A 4CLUA 4MIWA 4NA3A 2YWHA 2JLEA 3PX0A 1F9NA 3B02A 3IR5B 2DU9A 1I6HJ 1FDAA 3NP5A 2Z57B 4NXMJ 1QAJA 1CQNA 3ISND 3BCBA 1J5EF 2E5ZA 2VFRA 4PXBA 3W63A 3HD1A 4X4PA 5F08A 3E51A 2DTJA 4BWJA 4N8NA 1WTFA 2U2FA 3I71A 2QM3A 4DOZA 2WVBA 4WPAA 2VG5A 2D1CA 2B5JB 4R0EA 3ZQ7A 4OWRB 5LRRA 2XMTA 1W4MA 1RLCL 1B0PA 4OIOF 2JA8J 4GO5X 4RAFA 4X64F 1Y9OA 1RYRA 2HWVA 1C4AA 1TMJA 1S1XB 5H9FJ 4BE1A 1KQSR 3W6VA 3U02A 3HXLA 3S3OA 5EG0B 2GQQA 3GW2A 4A3JJ 1DTTB 4FT8A 1DDNA 5KFRA 2WOMA 1IUJA 5JVTA 5A2QY 1G1XA 2AZ3A 1ZOTA 3MCZA 2VDIA 2EBGA 2ZZTA 1JJ8C 3ZNJ1 3V6JA 1VQMS 1ZREA 3TRGA 4RX6A 2GMLA 1I3OB 3CDBA 4K59A 3IH2A 4F92B 2JFKA 1RWPB 5B09A 1S4FA 2ATCB 2MGZA 4LF4J 2OMLA 2E1RA 3KLGB 4XTTA 3FCVA 3I56I 1KTVA 2FMYA 4XLFA 1MW7A 4NLOA 2WWYA 3CDUA 2IXSA 2AV5A 4WXHA 3EGVA 3ICLA 5DM7Q 5A2QU 2J5AA 3WE2A 3F23A 3B78A 3BGLA 1OY8A 2XAJA 3R7SB 3KK3A 3BGOP 2RNEA 2DGVA 5EEGA 1F5TA 2R5YA 4XRSG 1ZAOA 1P8GA 4C8KA 1PP8F 2VJUA 1USSA 2ZH2A 5HL7Q 3ZMDA 5CVVA 3T5XA 3QGHA 5CVUA 1T9VA 4QWEA 3DOMA 2LMDA 1VIXA 3PW4A 4NC7A 4QZVB 1AKHA 2FD5A 4CCJA 5CZXA 5DD4A 1XSVA 3VAJA 3QRRA 5J2NB 3Q8VA 3W65A 4HZFA 2POKA 2OIHA 2D3OR 1VFJA 2AQFA 4IL6C 1L3KA 1R8BA 2HDDA 2MC3A 4KRWA 2E5GA 4WP8A 2CADA 4X84A 5C25B 1H9TA 3HOTA 2PA3A 1LEBA 5JLXA 1QPIA 3PYGA 1N34F 1QQIA 4C30A 4RDUA 1R22A 2JWTA 4WF9Q 1WGXA 5IQQA 1BBYA 1EZZB 4FS2A 5HODA 4LFUA 4JQFA 4HQEA 3FZ2A 4N7TA 2J5OA 1XERA 1RU1A 3K5NA 3PO2J 3HSZA 3AD7C 4AIJA 2YKQA 2OD6A 1NHUA 1ETYA 4JI8J 1MJAA 1RESA 2OH2A 2VIXA 2A6OA 2LD5A 3TW0A 2DR6A 1QDUB 5CD4A 2BVMA 2O1PA 1BUXA 3LQQA 1YZ6A 3R2DJ 1KVIA 5DDRC 4OYAA 3T5HA 4O3MA 3LGMA 4BYYA 1NM2A 4LIVA 4I7FB 3QAUA 4IUFA 4XL9A 1PG5B 2KXNB 2G2OA 5KT7A 4I02A 2JQ7A 3LW5C 4LR8A 4LD5A 2HFHA 1R0AB 1Q5VA 1W0TA 2XHKA 4ECQA 3CULA 2BOPA 3GMEA 5DLGA 2K8GA 3DBLB 4P75A 4KH1B 4P52A 2J76E 3EPIA 5B1BH 2C2ZB 3TJ8A 4OX9F 1YJUA 4R8UB 3F8NA 3CT9A 2YKPA 3HVRA 2RVCA 3CO9A 4ZJQA 1ON2A 2WADA 2AP6A 1NDLA 4AE5A 4J9PA 3ZZZA 5A8KA 3BG6A 2CW0F 1N33F 3OYEA 4QW8A 1IR2A 2R4FA 3NWGA 1TKXB 3N01A 1LXNA 3E5QA 4IOBA 3IRQA 4LRCA 3DEEA 2DPDA 2OPSA 4RKUC 2UZKA 1M0SA 1D9AA 3PV8A 1BLUA 4ATNA 1BQNA 3E6CC 3LH2S 2GBYA 3ZQCA 2K3KA 2MKSA 3CIZA 3G6VA 2I6WA 1PO6A 1DP7P 4C3IJ 2HKOA 4X4TA 4RLQA 5JJBA 4DPYA 2HS3A 1RSCA 1U7LA 2FZCB 5L3CA 5KFQA 2RRNA 1Q8BA 1TMMA 5DGBA 1R5HA 1VRUB 5KCMA 1K9MT 1FESA 4TU9A 3ZR8X 4CYCB 1P4AA 2AF6A 1C4CA 1B6AA 2CPEA 1ZK8A 3H59A 1IRFA 2RAEA 1PJ7A 1LEAA 4HVZA 4LGWA 1A0OB 5F8LA 3FIWA 3UPFA 1DY3A 3TVKA 2HNYA 3CCJS 3GJTB 1FA0A 2D1HA 2M52A 4P2SA 3QZ8A 4B3OA 2BKNA 1Y6IA 1XTAA 2FRHA 2XGQA 4IG0A 3MTKA 5M3FJ 4E7JA 1FNXH 2V8PA 1JGSA 2DFFA 4M63A 3S3NA 1FIPA 4JI2F 3RSNA 1IDYA 2FTRA 4AQYJ 4EO6A 1EX8A 1RJJA 3IAS9 5KNLA 4JP0A 3A8JA 2RDDA 4J91A 3V5RA 3PQJA 1QD1A 4KV8B 3MR6A 5K5QA 3LUYA 1GT0C 4L0ZB 3OV8A 4N5SA 3NGDA 2MGQA 1XNRJ 1O5JA 2XMUA 3BM7A 2MZRA 3FK7A 2AU0A 4I69A 2CFOA 1IJWC 3DRYA 3CXCR 2LVWA 3G4SS 4OHWA 3WC2A 4M72A 4C3KA 4NC8A 1FRMA 4IKAA 2ZBRA 3RQIA 3DRRA 4OZ0A 4IZZA 3HM5A 3OYGA 5D4LA 2I2YA 1L3LA 4WE1A 2UUCJ 2R7ZJ 3ILLA 1USTA 2A6TA 1U1PA 1MMNA 1SFEA 2XC9A 1ZM2A 4LSLA 5JVGF 3W60A 2V6CA 1YYVA 2XWXA 4A5MA 2LP4A 2ZEJA 2D2WA 1HBUB 3H98A 1XDSA 5K8NA 5BYQA 1UW4A 4LR7A 3HGYA 5L38A 3A01A 4AL7A 3HVTA 3MAJA 3OIQA 1RTJA 2DR9A 2F7VA 2J9DE 1RWUA 4A5NA 1S9HA 2I5UA 4EZ9A 4JI0J 4A4JA 2OQGA 2BA9A 3A8IA 3KJVA 2D3ZA 5E2QA 3S8SA 1NTCA 4QIWD 4WFAQ 1WEYA 5E3NA 3GJQB 3FXKA 1QZEA 1TUWA 3M1EA 2IJRA 2E7WA 4M9SA 5DM6Q 2GIZA 3OYCA 2ID6A 3FWEA 1K1SA 2WTFA 2KRHA 2PMHA 1HWKA 2YXLA 2EC2A 1AA7A 3NGUA 2JRSA 3DV8A 2HHSA 4A0ZA 2E9TA 4B8XA 1BHNA 3IM9A 5B0BA 4M5GA 5SZTA 1R43A 4QLCU 3MTJA 2ZWPA 2M8GX 2XPUA 3KUHA 5ICFA 3MPYA 5KFIA 3MGJA 3I59B 3TO7A 4HX7A 4KT0C 5HQLA 4JI3J 2J0WA 3EPGA 1FSHA 2DT7B 3O5TB 1N32F 5AJ3F 2ZOGA 3S15J 1PILA 2K3FA 4DYQA 1NLKL 3K69A 3WTZA 4OLPA 3K9TA 1HI1A 2XSJC 1U8SA 1WC1A 3JQJA 4NL5A 1DHMA 4BJ6C 2L02A 4BL0B 1SJ3P 4KITB 2VB6A 3H35A 3VWSA 1YIOA 2CJYB 1UMQA 1Z2LA 1U09A 4X65F 4IHXA 3UR0A 2FVSA 1ZELA 3H2LA 1S1TB 4IQJA 3PSIA 2GIVA 4LF6F 1W7WA 1JLEB 1YDLA 4FN5A 4CNZA 1XEZA 3DXSX 2QTWA 4NLTA 4B17A 2RNGA 3VAGA 2R42A 3Q24A 4GXOA 1HL6A 4XRSA 1ZLKA 2NUHA 3I32A 2HQDA 2K9SA 4CO3A 3AODA 3HHLB 4HF0A 2VPZB 2MZSA 2DFEA 4G7ZF 1UFLA 5DETA 2FBIA 4ZTFA 1NPPA 4CLLA 4BXFA 1KLMA 1SB6A 1FEHA 3ILOA 1TV6B 1D0EA 1FKPA 4YQWA 4HRIA 2VL8A 1D9FA 1VQOS 3KP2A 2B9XA 3HUGB 4ECUA 3CD7A 3T5LA 2VQGA 2MBFA 4NI2A 2EILH 3PCOB 2FDNA 2F63A 3GONA 3OL9A 4I76A 4CLFA 4QIWN 5ETVA 1WCMJ 1LW2B 1WACA 3TOAA 2QGFB 4B3SJ 1RPWA 4PJLA 1FTCA 5G4DA 4OYMA 1KKHA 5CKTA 2C3MA 1V5VA 4RNFA 2KZVA 3B73A 4A8XA 4B9VA 3GTMJ 2WRMA 2M8EA 3QP5A 4O4GA 3FK6A 3T1AA 4ZPDA 2IS6A 2W1BA 2VFTA 4DFMA 4A48A 1MNMC 3UNYA 4KNYA 5IM0B 1VQ7I 2QSFA 4DV6J 1A5JA 2F8MA 2GFFA 5FD5A 2CUYA 4XK4A 5HP1B 1IM4A 3BR3A 2FUG9 3MKLA 2OI2A 2HGCA 3OL6A 3TUPA 4LB6B 3O2IA 3VAMA 3OT9A 2HGNA 2KJCA 2ZDPA 3W5XA 9ATCB 1D8JA 2XBPA 4U0YA 4BEHB 3E8OA 1D1CA 2KIUA 2HRUA 5D0HA 5KT4A 2QKMB 4NLUA 3CP2A 3KP4A 4WP9A 3I0SA 4ZVGA 3CCQS 2DIUA 1JJ2R 1H0HB 2V2VA 4N41A 4AFFA 2GMJA 4DU7A 3NMRA 1X31C 3RYRA 4BE2A 2HU9A 2HI3A 3S1RJ 1N36F 1TQLA 2UVWA 5JHFA 5CYVA 2ZBIA 4DR7J 4DXLA 4DZDA 4LSNA 1N6QA 2HKXA 1SFXA 4UZCA 4A3CJ 3HPHA 4KIAA 2HNZA 2R5ZA 3NY0A 4BHQA 4IDKB 3CCTA 3J7AY 1TK8A 5IYDJ 2JLFA 4K2XA 1N5YB 2QYCA 2UXDF 3FDSA 4PG5A 3J80Z 3BWGA 3DLLQ 2GQCA 3TZYA 3M9NB 5EX3A 5EJCA 2YX1A 1X1CA 5F64A 2PJRB 1EARA 4NXNJ 1YRUA 2LEBA 3A03A 4CCMA 2LNBA 1BI2A 5IP9J 1KC8T 4C6AA 1SFOJ 1TBXA 3AJDA 1D9DA 5GPCA 3R0JA 4DSEA 4RO0A 4JBCA 2YPRA 2RVJA 3CJ4A 5DCMA 4LJZF 5HLIA 5DS7A 2ALYB 1HW8A 3ZFVA 4CLSA 2IY5B 1T0FC 3F22A 2M7SA 3LSKA 3I6PA 1OR7A 2FGCA 3QT7A 1JKPC 2LG4A 2KIFA 4W4MA 3WG9A 1YX3A 2OJED 4I09A 3UNGC 1QU3A 3GP9A 3RTVA 2BJDA 1VTNC 2QQAA 4GVBA 4A2UA 2VPYB 4JX4A 2C28A 2DT6A 1TKZB 2CQGA 2K02A 1HDPA 2ILZA 1Q53A 2HAFA 3PACA 4BUPA 1U26A 4JI5J 4KT5C 3QT5A 5DQHA 1C1BA 1XR6A 1ELOA 1F2HA 3OIPA 5J2PA 1HWIA 4DUYJ 5C42A 4OMYA 4IO9Q 2HVSA 3CMAI 3WTYC 1YJ7A 1S6OA 5KG5A 5D5UB 3F8CA 1N52B 3G2XA 2KT5A 1I3AA 2LBFB 1PYSB 3E2EA 1JWWA 1O4XA 1FVSA 2QLFB 1LNWA 4O0NA 3P49B 2FLNA 3FM5A 5E1XA 4DR3J 2C3PA 3HTSB 5HLFA 4LB5A 1O0PA 4LSZB 1T3OA 3TP2A 4ZYHA 2FMLA 1GK8A 4I2PB 3HO1A 2Y48A 5C44J 4J9NA 1O3TA 3GTPJ 1ETQA 3M8EA 1VJWA 4DCJB 1JTYA 3IP4B 2PBIA 5J8CA 1IDZA 2HWTA 2DRBA 3VQTA 2M1BA 1KU9A 4ZPTR 2HTSA 2L5QA 4NCBA 3DKXA 4X4NA 5HOOA 5KG7A 1IXCA 3W8PA 1QE1B 5C24B 3M8JA 3T1HF 4K4VA 3S1TA 1F1BB 3GLXA 5ETSA 5LD2C 1VQ9S 1U0SA 2A61A 5CLSA 3FK4A 5FDLB 2BY2A 2QLJB 5E20A 3HK2A 1LWEA 4KO0B 1K83J 3KYLA 3FGVA 5CYMA 1NPKA 2DA7A 4CNYA 3O8WA 3CC7I 4NASA 3AOCA 1XN9A 2IM2A 2WAEA 1RUSA 4DF4A 3N5BA 3G1OA 2PMUA 1S6UA 4P7TA 1VQYA 3ELKA 3MZYA 3M2UB 1PBUA 3MKWB 1IXRC 2HZCA 2OAZA 3BDDA 1OQYA 3UKGA 4EBEA 5F3TA 4WTYA 2BKOA 4XLCA 5AXMA 1HLWA 3CJ3A 4B9TA 2EFGA 4UY85 2R7DA 4A8SA 1Y8QB 1KA8A 3KETA 3WG7H 2MJNA 4ZN3A 3RAMA 5IOLA 4WU3A 3SSQA 2ZJRQ 5F0CA 4DQPA 3RB3A 5GP9A 4YR2A 2WB4A 4OINF 2BV3A 2EZLA 1W1WE 1SKUB 2MQ8A 2P5KA 1YSJA 2QCOA 3FEYB 4QWAA 5HDKA 3ABKH 4W98A 2O3DA 4X62J 3CNQP 4ZP7A 3KXDA 1NK9A 3L7OA 1BW5A 2H6BA 4RW6A 2VUMJ 4ZYEA 4RNNA 1ETXA 3BYPA 4B44A 2VG5B 2R7SA 2MLYA 2WVCA 3HTUA 3CMEI 3NS5A 4HX4A 4PEOA 2ZNZA 2V69A 4G6DA 2CGPA 4RGUA 3EQLF 3TI0A 3FBFA 3HHKA 1U1LA 2JSPA 1VQ5S 2CAJA 3W9HA 3K0JA 3M6VA 2XCPA 2F9JA 1EQMA 4LF5J 1UAAA 2DOFA 1FT8A 3Q2SC 4FHTA 3LP1A 3H92A 2WOMB 1DQAA 2E5LJ 1O6XA 1V3FA 1S79A 2ERRA 2A2CA 2ZC2A 2LU1A 3E1SA 5A76A 1REGX 4G3IA 3VCDA 2G7UA 4HH0A 4LREA 2CJ9A 3GFIA 1RC9A 3LA2A 1KDNA 2HHHF 3D1NI 2H54B 2MGZB 4ED0A 2LKXA 3HHDA 2I8EA 3KEOA 3GTKJ 3A12A 2QFJA 1RCOB 3ZMUA 2HBRB 1W2BR 2UP1A 3RZOJ 5E3RA 3OY9A 4RPFA 2PT0A 4EWTA 4F04B 2V4QA 4L9NA 1YFHA 3CZ6A 3M8WA 3ZTPA 2DW4A 4XRMA 5EHHA 1JJ4A 1IRGA 1FT9A 1PYOB 3KK3B 4GRIA 1X2NA 4XOTA 3ZZUA 3PQKA 1WHUA 2R5YB 1RAIB 5DS9A 3LPEA 2I1RA 2OCCH 1KD1T 1RT2B 1IBMJ 3BROA 3DOMB 2FPHX 3GG0A 1G2EA 1OCCH 5CH7B 1AKHB 4O0IA 2ZWOA 1O7FA 1LPQA 3POTA 2ZD1A 3FJ2A 1WPKA 3ZN1A 2B8PA 2O5RA 2ECBA 1EQ0A 4K8RA 1UVIA 2VKDA 2BUNA 3PDNA 1VNDA 5CVIA 3KE2A 4RW8A 3GR1A 2FQQB 2B4UA 2J7WA 3IWLA 2HS0A 3E6DA 3TARA 1UVMA 4Y2IA 5AXKA 1S6QA 3D6MB 2VL1A 1FK9A 2BE2A 1XK8A 3C2GA 3U1MA 4AXIA 1U8WA 4AWXB 4QU6A 3V42A 2EKNA 2GX8A 4H54A 1FX2A 5KFCA 3MEKA 2KT0A 2NS1B 2ICWG 2YX4A 1UJ4A 3OYNA 4CO4A 5D5XB 4Q7AA 2JN6A 4CLWA 1T11A 1B0VA 1FE4A 1FTTA 3DGVA 4KHMA 1RBAA 4DV0F 2HQ3A 2G2ZA 2MQQA 4C4WA 1SEUA 2R8JA 1IV6A 3DPUA 3JRBA 2XRLA 1VF9A 3VYRB 1B4AA 3HCXA 3FZVA 3G8SA 3DPLC 2A6MA 4M3FA 1A7GE 4YG2F 1Q78A 4P2FA 1SC3B 4YEJA 1FX4A 4ANDA 4R8HA 4C2UA 4ZVPB 3BJ6A 1HWJA 5HLTA 4XMYA 5F8MA 3KIOA 3U1NA 3PJ9A 4HI1A 5KFLA 3FXRA 4S0MA 2DXDA 2LA4A 3TA2A 2XGXA 4HL9A 5A8KB 3MXHP 2VE8A 5BS6A 1IGNA 4G7HF 1NZAA 2EEYA 3H5SA 2B7EA 2KFDA 3LAKA 1MLAA 1QTMA 2OPSB 2X0LA 2FD2A 2CQDA 1Z91A 3N6NA 1XMQJ 4KTQA 1BQNB 1SBRA 2HBQB 2C3OA 4M9XA 2HK2A 9RUBA 2AIRB 2Z3YA 1G6NA 3H4DA 3GYXB 1N4LA 2X6XA 4IRCA 1IBKJ 1ZKGA 2BYCA 2KXFA 1HW2A 1U6GA 4C0HA 2ZJQQ 2ZC4A 2ROEA 2C1EB 2VQHA 4HLXA 2BY1A 5EWGA 1RWVB 2H4WB 5C5JA 1RWMB 3T8RA 4MIMA 1U78A 1VK3A 4V2GA 1Q1KA 2DA6A 4WYWA 4PKDB 4HH1A 2HNYB 4YHHJ 2BX6A 4NNJA 5HK4A 4LF8J 1YJ9I 1S1UA 1U9NA 3ELHA 1FOWA 3I4HX 2J7KA 3QWPA 1ZM3A 4A8WA 4J9SA 2ROGA 2EINH 3R5DA 4B3OB 1WD6A 1KU7A 3QZ7A 1Z67A 4IG0B 5D0EA 3RBEA 4P9UA 4CH1A 2YNIA 3ZC4A 3HJFA 1UWBA 2R3VA 4NQWA 2K86A 4YELA 2W7NA 5CA5A 3OXGA 1ZZNA 1T7PA 1SD6A 3REOA 4ES1A 1VIOA 1RCXB 2OMOA 4Y3CA 3WZ0A 3CJKA 3RU0A 2MQMA 2QO3A 2CQ4A 2AJ4A 5LGTA 3OVAA 2DD8S 4JK1X 1B0TA 5KG4A 3KEQA 4RMNA 4OI6A 1WVRA 4NRTA 1S0OA 2XPWA 4ZDNA 2D9OA 3W2WA 1AOYA 3T3FA 1MWZA 2WY7Q 2Z2SB 4XKVA 4OZLA 1PIEA 3DTKA 3SIPB 3BH7B 2Y1JA 3H1CA 2DGUA 1X4CA 4DI6A 4IJAA 5F9NA 1F2GA 4YR0A 2ZUGA 3M7GA 3DRRB 5E3QA 3E01A 2X3GA 3QATA 2MJUA 1N34J 4OI0A 2AJQA 2YQ0A 5GAHU 3OSGA 1LVAA 4WE1B 5FKOA 5HQ8A 4HSTA 3ILJA 1UEKA 4LSLB 3CDWA 2GQ2A 1A31A 1XD7A 1UFMA 4WP3A 1CQTA 5EX0A 4WIQA 2DJWA 1J75A 4BJTA 3ZXSA 2BJEA 3PFOA 2HOAA 2R93J 4USIA 4Y17A 4DQ2A 5K8MA 1VQ8S 3IN5A 1IN8A 3A01B 1REPC 5F8GA 1KQGB 3HVTB 3CVKA 1RTJB 2FJAB 4OI2A 2K1RA 3D28A 4KKOA 4P2XA 2Y30A 2E44A 3DDIA 1SJ1A 1S0VA 3KJVB 4A6EA 2JDJA 3B82A 3G6YA 6AT1B 2BQ3A 4RBVA 2XULA 5GTHC 1UJ6A 1TL8A 4M5DA 2MSSA 5E3CA 1TWCJ 4GFBA 2L9SA 4DGWB 3FQKA 4RNMA 3TAQA 3OR1C 2IA2A 1ZH5A 1RNLA 4CIOA 2E71A 5FD1A 1KU2A 1RHJB 2Z2MA 1UKUA 2DH7A 1R0BG 2DY1A 2QMXA 3TO6A 3F41A 2C2DA 3I96A 5DDGA 4DV5J 4WK1A 4PQUA 4CLTA 3I58A 2JRTA 3VVUA 3QIPB 4P96A 5E33A 1B7YB 1N33J 3ML6A 2HLTA 3Q89A 4RW9A 3G3ZA 2HPMA 3L2VA 3IA0A 3KX2A 1CBKA 1IC8A 5LGNA 2CG4A 1IQZA 2SXLA 3OW2R 2PFDA 4F4XA 4GKKF 2VU5A 1QPMA 3M3YJ 1ULYA 4Y33A 3EYYA 2HGLA 4QR1A 4J9MA 4USVA 1EJ9A 4YB5A 2KMUA 4DNCA 5DM7F 3Q22A 3GIMA 3GYHX 3O3KA 4ZVQB 2KVIA 2DO0A 3MOZA 4DV7F 3VYUB 2ZMEA 3CCES 3NARA 3CO0P 2GNKA 3X1LB 3EVOA 4CA0A 4LIWA 2XNQA 1A6IA 1DU6A 4XIDA 4IOAQ 1X58A 3PO3J 3G6ES 3LGHA 3CCZA 5IWAJ 2V34A 1ON1A 3KKFA 2LTPA 1RETA 2ADUA 3JS9A 4K2EA 2R7VA 4MK8A 4PXCA 2CPJA 3CD5A 5DDOC 1U1KA 3PIOQ 2VOPA 4K7QA 2QA4S 3E5XA 1DQ9A 1B1BA 2JA2A 4DR4J 3M6XA 1KQFB 3K4MA 1E3OC 2IBDA 3IGNA 1KLMB 3TJ9A 4F0KA 3S6EA 1IJEB 3OBIA 4F3OA 1FJGF 1BWVA 1FKPB 3OOPA 2EIJH 2RUSA 4K4ZA 3HLUA 1I1GA 4KMFA 3JAMZ 4NI2B 3CCLI 3D5LA 2WSFC 1JIHA 3S17J 4DL4A 4PXEA 3CJSA 3R1HA 4OJ3A 2VONA 1J27A 1Y00A 3JSYA 4F91B 4DFPA 3KP3A 2GA7A 4C3JJ 3V8LA 1A36A 3I53A 1ZYRF 4I68A 3CGIA 5ETNA 3DP7A 3QU3A 4G65A 1GVDA 2AGQA 1HXDA 4ILLA 5FJ8J 2W4SA 3GBGA 1S7EA 2COBA 1UMJA 4O4GB 1K78A 1A6QA 1G3WA 3EUAA 3ONQA 3SZGA 1ZG3A 1XJWB 3M2VA 1S8NA 4LG3A 2FE3A 4AL6A 1GXTA 3JCUC 1VQKI 1N0VC 1L3TA 4J9QA 1YZ7A 3ZMSA 2MLGA 3BZKA 1PDNC 2MDAA 3GIKA 4DR6J 3FHNA 3GTGJ 3UQSA 3W1YC 1XMXA 3WHIA 4QTRA 3FKBA 2W9AA 2IDEA 3RKQA 1XX5A 1BQMA 3GXOA 1NSPA 4PRFA 3M05A 3KFWX 2AEFA 2FHJD 1AUSL 1KZHA 1HQ2A 3HSEA 4B09A 3I0SB 1M5VC 1TLHB 2BBEA 2VA2A 2LY2A 1HNZF 3MDFA 3LSJA 2VF3A 2GOXB 1WFXA 5K7HA 4OZ1A 4L9JA 3IBFB 2FJWA 2HYJA 2LMIA 4BHCA 3HOVJ 4OMFG 3OSFA 3P45B 3QYBA 5LSLA 2NRAC 4LSNB 4NLXA 1BR4A 4CDGA 4LRBA 2HNZB 2R5ZB 3EWGA 1NHAA 4IFVA 4QQBA 2MSYA 3HOYJ 1WC5A 4Z7YA 2MKIA 1NB7A 3OR2A 3B6BA 3NEKA 1RA6A 3QGPA 4ITVA 5HMZA 4QW9A 3QJLA 2BEFA 5B1AH 4G7OF 1H2VZ 2I9SA 2P9EA 1MGTA 1S29A 2G0EA 2RS2A 3O6BB 3ZTRA 3GFXA 3MUMP 4M5IA 1VQMI 4EGYA 1PJ6A 3HOUJ 2PMZA 1YBAA 1UZCA 4H4OA 4ENKA 2W82A 3NEUA 2XB0X 1H72C 4HKQA 3R0AA 2N8GA 4IHWA 5AJ3J 2RKIA 3EVWA 5K1YA 2ZM6F 1CF7A 3K4NA 3F9KA 3ETMA 2CUEA 2DNPA 1QAXA 3DMJA 4IRGA 1TL3A 2E1PA 2LQ9A 3TA1A 2DFHA 3LAPA 1JQGA 1X1PA 2VKEA 5J3LA 2JEJA 2ZH3A 4X65J 3H0DA 4NE9C 3LOUA 1RHUB 3GFHA 1UPMB 4LF6J 1NSAA 3TEDA 1T2KA 2VC0A 2QMUB 3KLFA 3GWZA 3M2RA 4YOEA 2FGOA 3GFMA 4EEFG 2QE5A 1YJWS 4GVBB 2PO4A 4E7ZA 2HVQA 2HQNA 2L01A 3BR1A 2P9GA 2VV5A 4L72B 2R92J 4M6VA 2C3YA 4BQQA 2DPIA 3WTUC 4BBSJ 1TQMA 3MQ0A 5IYBJ 2J9DA 3VFZA 1C1BB 5KVRA 1K79A 3LA7A 5J2PB 5HSPA 5C42B 2VXZA 1YRNA 2XS2A 3FCWA 2J6TA 2VJ4A 4TN2A 1RUOA 3R1LA 2CV2A 3DWLE 2R8HA 1MBHA 3DC2A 2LREA 4RM2A 1V3ZA 2DT5A 3K10A 1KHWA 5EF6A 5E3AA 2F4OB 1D0XA 2LEPA 2MLKA 1V4RA 4L18B 1ZARA 2EWHA 2F4MB 4OU0A 3ENQA 4AYBD 5HLFB 2AEJA 2DNMA 4Y52J 3K17A 1IUFA 4DBQA 1T08B 2AEMA 1J7KA 2AT1B 5GTIC 4HA8A 4UT4A 2Y1RI 4EZ6A 5KFKA 1OJLA 4RM3A 1WDDA 2OLWA 3J7Z5 1GHCA 3C2BA 2XMMA 2KXHA 2BW3A 4V19X 2K85A 1EJ7L 3BOQA 2VBYA 3L2RA 5D5VB 3DLGA 3HP6A 2MYFA 4EMSA 5KFUA 1S72S 3EUHA 2CQ7A 2XKPA 3F0NA 3FC9A 1LDKB 1ZGAA 4YUDA 2AYGA 4PUSA 1JLGA 1HARA 2VQFF 1BOBA 1WC4A 1W5SA 5DM6F 4FVMA 2DO7A 3L3CA 2IT0A 2A05A 2RHSB 2HQCA 1JJCB 2MB0B 1LWEB 2ASJA 2KDOA 2LK2A 4N4NB 5AIPA 1GMWA 2W2QP 5CYMB 2WAQA 2WHOA 2B4PA 3AL0B 3PFIA 1FPQA 2B4OA 4FF2A 2OCEA 3DPTA 4XLHA 2XAHA 4N76A 2CVEA 3CCRS 2FOKA 1YJTA 2AGOA 2XLKA 3K1PA 2X1GA 5HVFA 3EGNA 3C3LA 3PG9A 3PNIA 1TFWA 4DPTA 2YKOA 1WI8A 2FVQA 3DKWA 4RB2C 1K4SA 5E3LA 3ZMVA 3WGGA 4EYIB 4BCAA 3MEEA 5LOQA 4GGGA 4RUHA 5B0GA 1MBKA 5IFMA 4C11A 4DJAA 1MJ9A 2MLZA 2BY0A 5KK1A 3K1MA 1Z2ZA 2H3EB 3N4MA 1Q95G 2E5HA 3TAMA 3FXUA 5RUBA 4RW6B 4C8YA 1TL7A 2EH3A 2QL7B 1W0UA 2BVZA 1ZA1B 2Y9HA 4FNHA 1X4GA 3CCJI 4WFBQ 2FUG2 1UHSA 2Q0OA 4LF9J 3I0TA 4N9IA 1ICEB 1RHMB 2R7XA 5D4RA 1QTNB 3DN9A 1QSYA 3DLKA 4B08A 2CNLB 2AJ0A 4U7CA 1VR6A 3BJOA 1ZN2A 1QGPA 2CZ4A 5ILUA 3HMJG 4IR9A 2UUWA 1RU2A 2HFUA 3N4WA 2CV1A 3LP1B 4OV6A 2UV8G 3S7RA 1BC8C 5FLMJ 1TQIA 4MLOA 5BPDA 3RCOA 3AHPA 1NK0A 1P7IA 4EI2A 4P71A 3IMQJ 4ICLA 2F5DA 1LWXA 4Q2MA 3BS9A 2DMQA 3Q8UA 2VPLA 1LKXA 2F40A 2QKLB 4CCHA 3IL2A 3S8PA 4QWBA 2NPFA 3RI4A 3G4SI 4HBLA 1GAOA 2VPWB 3E5UA 3BEGB 1RGVA 2K7KA 2K7JA 1IKXA 2OFHX 1QHHD 4XAKA 2DHGA 4WXWA 5THWA 2CKWA 4C8MA 4HNUA 1T9YA 2WB1D 2HG4A 4DV2F 2F5CA 4DV4F 5KOWA 3WQPA 5ETRA 4KMUX 2DITA 5GAHI 2XM3A 3FISA 1I39A 4H0EA 3EXYA 4FVCA 1PGZA 1SH2A 4KFBA 2OPPA 5CHCB 2CH0A 3C6TA 2M2EA 4L3KA 3BYRA 2ZH9A 3POTB 3CE8A 1D3WA 2VBWA 2ZD1B 4KHPF 2DT9A 1D5VA 1NNDA 2DGSA 2WONA 2GAGC 2L4MA 1QVTA 2JNJA 1SKWA 2XQCA 4C2TA 2HRTA 2L3DA 3ZOBA 3NKYA 2P0WA 1HBOA 4WXOA 2M4MA 3Q9SA 2ZKUA 4RW8B 4A8QA 3C2PA 5F8NA 2P81A 3QQCD 5KFHA 1S6QB 3AXMA 4YEAA 1Z6RA 4G12A 2L7FP 1CVJA 3HOZJ 1RTDA 3PKMA 2JZYA 1LV5A 1FK9B 2BE2B 2IRFG 2R7RA 3VSKA 2MMYA 5BXIA 5HMXA 3T19A 5B3SH 3T1YF 1HC8A 5I3UA 4B9SA 2CDRB 3DCAA 2ZOMA 4MGRA 2Q8KA 3JRFA 4ECRA 4A3GJ 3M7VA 3N0VA 3DLLF 1HBXG 5E41A 2Y9ZA 2F4FA 3PJRA 3HIFA 4LUBA 4HEA2 3I4NJ 5FFXA 1SUQA 4UV9A 1GLNA 2MXYA 1RB0A 2RQCA 3OQ2A 1N0UA 2CQIA 4DUZF 1XCBA 3ASOH 2PGCA 2UXCF 2GVZA 2EFPA 5B0EA 3JAMK 3UD3P 2AX1A 1VRTA 3K1NA 2ILYA 3THVA 1TP4A 1JKRC 1VQPS 4CM2A 2Q1ZB 1TC3C 2YU3A 2XHWA 2L4AA 2IS1A 3TQNA 2JTVA 3FX3A 4HV5A 2NCKL 2GA1A 1R9TJ 3GZ5A 3D67A 2NSCA 3D5RC 3A13A 2WB1N 5A8RA 2JLGA 1FJLA 4LLLA 4Y2KA 1A35A 1WJBA 3R5CA 3AOBA 1OMIA 4P55A 3V2UC 4M5MA 1YI2I 2PA8D 2V4RA 1UELB 3CJNA 4NPOA 5GAHJ 1S99A 4C0OC 3TZZA 2ZHBA 4BDYA 5DG7A 2KT3A 1O7LA 3FBIB 3BR5A 1H3DA 3MEGA 2EK5A 4IO9F 2R7TA 3IH3A 4OMZA 1FRXA 4XIUA 3HM9A 4BHBA 1D5YA 1TWFJ 3M1CA 4DR2J 5C2CA 4HNVA 4EYHB 5K5MA 1EF4A 3H5YA 3WTVC 1JXEA 4O44A 1S6LA 1HF0A 1RISA 1R5GA 5GAEJ 4IYQA 4ESFA 3GTQJ 1TUVA 5F0FA 2WZ1A 1SI9A 2GHVC 2K7LA 1S1UB 2EW9A 4PG8A 3KLHA 1DPUA 2DPUA 4UOGA 4LLGF 2DQRA 3HKZD 5ETPA 2QJ3A 1TL1A 4F4KA 2Z2LA 3CJ2A 4MQ9F 2GM4A 2YNIB 1UWBB 4LF2A 2V6AA 3I82A 4NQWB 4AT1B 3SZPA 2LXUA 2DGOA 3CMQA 4HLBA 2Y8YA 4IRKA 3HSDA 3VWBA 3CJKB 5B0FA 4UHTA 2XYHB 4AVZA 1H6KX 3CDAA 4NLVA 1YG0A 3D5SC 1IN7A 5D4SA 4RBUA 3A8EA 2V1UA 1WKLA 2CQNA 4X66F 4FBUA 2Q6CA 1X1DA 3MCSA 4WKRA 3HOWJ 1TELA 3W2WB 4ZPAA 3ZQQA 3CF5Q 3B6AA 1FFWB 5DJBA 2HHQA 4C0BA 1HOMA 1P6RA 1T94A 3FMQA 1PBAA 2RREA 2FJVA 2MTLA 4YFKF 1ZRCA 4L9VA 4U7UK 1VC5A 3E01B 3CJ8A 3MM8A 1QJHA 1F9EB 2XF5A 2ZKTA 1MJBA 1DLOA 3PW2A 2DGTA 4M3BA 3BQZA 5F0WA 1T03A 1QHGA 2A10A 1W7PA 1U2WA 1V9OA 1HSJA 1Y7PA 4KV8A 1NJWA 3P4UB 2QA2A 1SL1A 1RAJA 2HW3A 3BR6A 3DRXA 1UA1A 3FUYA 3KUGA 3FXMA 4YY3F 1VGYA 3TNVA 2FVRA 5HDGA 1GMUA 3FMWA 4R0JA 5DEQA 3TDZC 1HNXF 2VD3A 4ETZA 4EGLA 1KYZA 2DK2A 3BZQA 1LW0A 5AE2A 2E1AA 2CJJA 4DMZA 1WELA 3Q8PB 4PWWA 1HMVA 3WGIA 4OV1A 2K1RB 4KKOB 3A1YA 4DZJA 1ZBTA 1X4OA 2QEXS 1WJCA 2ZH1A 2XPVA 3K4KA 4FTHA 3D5MA 4C7QA 1KOHA 2JWNA 1EKRA 2C6YA 2OV7A 4USUA 1CULA 1Q1VA 4Q43A 3UFCX 4DW6A 4BLGA 1B9NA 4HF2A 1XGSA 4USWA 4DPUA 4YFXF 2A6HF 3OTOJ 4FYXB 4M5DB 4HHUA 1UVNA 2E29A 2W4DA 2IEKA 3LA0A 2A68F 1XNQF 3OL4A 3JXOA 2PSZA 2MH2A 1N5TA 2OP5A 2XAGA 1HHQA 1RZMA 4OJ1A 3T41A 1WH5A 1XN7A 2QSHX 2ETHA 4ON0A 5L1JA 3TVZA 3HKZN 5KFZA 4G94A 2FEZA 1SJRA 4PQUB 3O3LA 2KRCA 2EBIA 1RHRB 1CJUA 2W9CA 2RT3A 4H4KA 4RW9B 3ZZ0A 3CD6S 3GILA 1IN0A 3M8QA 5I3PA 1E2XA 1FTRA 3TO8A 3RIRA 4U95A 1VQ6S 1ZAVA 2OA4A 4P5OA 3BGUA 2VN2A 3IKTA 2GMHA 1S0NA 1RBOB 2ZZMA 2KJVA 3TGNA 2W7PA 1NKEA 1POGA 1KQ8A 3CLQA 3D68A 5D4OA 1PJRA 1JT0A 4PWDA 2ZMEB 5EEAA 4RGSA 3TA0A 1TL4A 1X4BA 1R00A 3KLNA 2JJ7A 1XGOA 3M9OB 2CVIA 2M8DB 3SEQA 4B3RJ 4X1EA 2KL8A 3CP8A 4PG7A 1JI8A 3CCSS 2UWMA 2ZXJA 1ULRA 4L5JA 4JI6F 2STWA 1LVKA 3ZTSA 3SYZA 2R3SA 4EU0A 4D0PA 3RTRA 3IRXA 1LEOA 1WC0A 1HKTA 3BBFA 2HZAA 1VMBA 4PPZA 2MD0A 2KHDA 2RV8A 1X4FA 5J2QA 3UD4P 3QODA 4BWMA 1FD8A 4FS1A 5B08A 3KJFB 4PZJA 3KK1B 1GEHA 3CUNA 4HSRA 4YR3A 3OSNA 5DYMA 4P9SA 5B0CA 1J5YA 2EK6A 2DNYA 3TEGA 3BPSP 5EZGA 4FX0A 3W2VA 1WSVA 3MECA 1FNOA 4YDDB 1UCNA 1B8IA 1FBUA 3BTLA 1CJTA 4N56A 2FIUA 3DGPA 3HRUA 3MPUB 4LG0A 4XRFA 5GADU 2GZOA 2CJKA 4I6ZA 3WIVA 4B9NA 4ZS6A 2FLLA 2X6YA 4HDVA 2Y0MA 3MAHA 2PMWA 4Q8EA 3PTWA 3N05A 4PWUA 4M5HA 2ELJA 3D0GE 4LRAA 1HYSA 2OKQA 4EO8A 3SQNA 4X4UA 1MMLA 4DS4A 3ITHA 1PC5A 1RT7A 1QBJA 2LLZA 3N5FA 4HTIA 1JJHA 4OZ5A 4PABA 3SQGA 1K78B 4UXNA 1T98A 5M2RA 3AG3H 2QG9B 3I56S 2EPFA 4BNCA 3E97A 2CS3A 3M2VB 1ZYQA 1U9OA 4DYRA 4JX5A 2Q1LA 1QY7A 3MR2A 3Q86A 3DU5A 2VG6A 2CWKA 3H8YA 2M30A 4O3NA 1KONA 3CPWR 2YWGA 4OIRF 3OYDA 1IKYA 3F0CA 3RR8A 3S16J 2UU9J 2K40A 1BA5A 4JI4F 3QT8A 1BQMB 2OELA 4DPOA 4UOFA 3KUEA 2HR3A 4D1QA 1BOAA 4ECVA 2DJNA 3CUQA 2ZE2A 2NOJB 1S3JA 3F6OA 2W00A 4KYWA 2Q6BA 4BQOA 3DHWC 4KN4X 4YIRX 1S9FA 2DCEA 2KJWA 2XY7A 1Z1DA 5E1ZB 2HXIA 3RJPA 3GTYX 3TL4X 2HOTA 4X4OA 5DGAA 1BL0A 2UXXA 1C0WA 5LEJA 2QYOA 2ALZA 1VQ5I 1GTEA 2DHHA 3UN2A 3PXGa 2FZKB 4ZVRB 4IFVB 3OHBA 1TQPA 4HNTA 5H9EK 1FMWA 3SFUA 3UDCA 2NVYJ 3WODF 3OR2B 1Q4RA 5ILVA 4WCGA 3K5OA 2Z58B 2EQRA 4NLSA 4ED8A 2ZJQF 1S5LC 2QL9B 1LJ9A 2IMWP 5FKNA 4RZRA 4DR1J 4EJUA 2UXBF 2IYGA 3NG8A 2O67A 2KKHA 3K8WA 4V2FA 1LWCA 1GFWB 5M5WJ 2HVIA 3OV7A 5FKMA 2LQ5A 2LKSA 1CC8A 4H4OB 1GV5A 2B3TB 3OOUA 1P9QC 3A4TA 3AOAA 2EZHA 2XZTB 1T6SA 1W26A 2RKIB 1DGWY 1CF7B 1YRTA 5EUHA 3I5UA 3EICA 4U87A 2WAFA 2XF6A 2KU7A 2OTLI 2JA5J 3DMJB 4UVCA 1RE1B 4KR0B 1TL3B 1FVQA 5AXNA 4OFZA 5E8IA 3I55I 2DMNA 4L6V3 5L8RC 3M32A 4JYAF 4PPDA 2LDUA 2P7CB 3OYBA 4I2QA 2ZB9A 4MK7A 4W97A 1F5BA 5K8PA 3Q0UA 3KLFB 3M2RB 3CDEA 1U2FA 5C4JJ 3KLEB 1U25A 5G0RA 1DRZA 1U4BA 2HOEA 3K58A 1SC7A 2QFIA 3HB9A 4EMDA 3BT9A 2IS4A 1KQKA 1APSA 1WI9A 2F48A 4GKJF 5D8KB 1IV8A 4C3HJ 1Y5NB 2LOOA 4I0AA 1PUFA 1YRNB 3SCLE 4ZKAA 1IG7A 4NCAA 4N8OA 2ZDOA 1U6ZA 1DPRA 2YQ3A 1FJGJ 2K9NA 1V5IB 4A0YA 4YMEA 4XLNF 3D3BJ 1JXLA 4ZVTB 3EZOA 4IRIA 3MEDA 4HACA 2ZZNA 3LQRA 3O44A 1RTZA 3L1PA 1VBYA 1N54B 5HDNA 1R6YA 3VHQA 3JSRA 3CO6C 4W92B 4O3RA 4DX6A 3IV5A 3C6UA 4BS2A 5JR3A 1UA0A 1FP1D 1G3OA 1IXSB 1EHWA 2G0CA 4YN3B 4WX9A 2ELHA 2Z16A 3QYEA 4L9TA 4TY8A 2EKYA 3QJJA 3SHFA 3N9UC 4I7HA 3BC8A 4OYXA 3KHGA 4JV0A 2V1DA 3SMZA 4Z7CA 2BW3B 2DYAA 4YS2A 3BPVA 3DLGB 1G59A 3DLJA 3SCIE 2GHPA 1MH3A 3QFWA 3K0LA 4CYUA 1OS5A 4I6YA 3QAEA 2PJPA 3JTOA 4J5OA 2KKOA 5FLXZ 1T9XA 2YNGA 2XNRA 2B63J 1JLGB 4ECSA 2PEHA 1I94J 1QVUA 2XMJA 4NLYA 4A3MJ 1SC4B 3BSNA 4OZJA 1REVA 3C8YA 2M9HA 4QYZJ 4BHPA 2VFSA 1E3HA 2CMPA 5EZHA 3OVBA 3ZZRA 3D2WA 2CA9A 1S4EA 2Y8WA 2PFFB 3V7SA 2CQHA 3G1MA 3BQYA 5LMNJ 2VT2A 1X2MA 2HFNA 4DCPB 4EM0B 1L3UA 4MO7A 1Z7UA 2Y3YA 1JHHA 4M9ZA 3PW5A 2HZDA 4E7KA 1AZSA 2AGPA 2P5LC 2RB7A 4BE0A 3BREA 2XC7A 1NHVA 2BZTA 2YS9A 3MFIA 2KRFA 4U8VA 4KSEB 1MNDA 3MEEB 2AYEA 1K7AA 2BXYA 3GJRB 5KFBA 1WG5A 2F2EA 4C11B 2KPMA 2M9KA 2ZH5A 3HHGA 3MWBA 4RLFA 2DDAA 3TEHB 4NXMF 5CJ9A 4A69C 5D6EA 1ERDA 1G7CB 3C46A 1RTIA 3TAMB 4ZJOA 2CJXB