1KONA

Crystal structure of e.coli yebc
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
244
structure length
233
Chain Sequence
GHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLDANPRLRAAVDKALSNNMTRDTLNRAIARGANMETIIYEGYGPGGTAIMIECLSDNRNRTVAEVRHAFSKCGGNLGTDGSVAYLFSKKGVISFEKGDEDTIMEAALEAGAEDVVTYDDGAIDVYTAWEEMGKVRDALEAAGLKADSAEVSMIPSTKADMDAETAPKLMRLIDMLEDCDDVQEVYHNGEISDEVAATL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title UNPUBLISHED
rcsb
source organism Escherichia coli
molecule tags Unknown function
molecule keywords Protein yebC
total genus 63
structure length 233
sequence length 244
ec nomenclature
pdb deposition date 2001-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01709 Transcrip_reg Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1konA01
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1konA02
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1konA03
3HPGA 3F9KA 1LFPA 1WJEA 1KONA 1WJCA 1WJAA 1WJBA 1WJDA 1MW7A 1WJFA 1K6YA 4F3QA 1E0EA 3HPHA
chains in the Genus database with same CATH superfamily
2MJNA 4QSHA 5JHFA 2ZH7A 4UW2A 3ZFVA 4C0BA 2BGCA 2NXEA 2QYGA 3SDEA 5KT6A 1QE1A 4JUZA 1U24A 4QJVA 3UKGA 3QYYA 2VG6B 3OTEA 4BHPA 2E19A 4V19J 2E9ZA 1MSWD 1MBEA 1UJ6A 1GNKA 4KPCA 4DSEA 4B43A 1FFSB 5IOLA 1ZRFA 2UWMA 1XNRF 5GP9A 2RRAA 2K1RB 2NOJB 1O3TA 3U27A 2Z57B 4CYUA 3LWLA 4B3TJ 1EA3A 2F63A 2HFSA 2XEXA 1A04A 2VPRA 2LSOA 2VE9A 4MYTA 5F0WA 4ZDLA 3DDKA 5LMNJ 4O3NA 1RT1A 3K4NA 2LQBA 3LWFA 1PSDA 1S49A 2CVIA 4IF4A 3L7PA 1B0VA 1TR0A 2QENA 4YELA 4WF9Q 3OYIA 2HNZA 4CUGA 5D0RA 1MSEC 3ZZOA 2H8RA 4CDIA 2CRGA 5TISC 1WUUA 1FJLA 3SCLE 4F4KA 5HATA 1BI1A 4J9SA 3H3ZA 2DLLA 3QIPA 5GAGU 1FKAF 4Y4RA 2KO1A 3QRFF 4OV1A 1R00A 2DHGA 2OH2A 1RA7A 1AT1B 3QT5A 4ZCMA 4BBRJ 4WU3A 1V3RA 3Q0WA 2H9ZA 3PL8A 1S59A 1I94J 1WJBA 4AD9A 2I2YA 4LRCA 1Z05A 4S05A 1YG0A 4ZVEA 1UTAA 2K5CA 3BR8A 2BANA 2KISA 3FHNA 3NOGA 3W5ZA 1R8BA 3RTVA 1JNRB 1RTJA 1HBNB 2F4MB 1WJ5A 1DQAA 2OQGA 2AT1B 4A0XA 2DFIA 1Z6RA 2W8LA 2VIHA 1I3OB 3BR2A 2OPTA 1S72S 2R5YA 2L4MA 3HI9A 1CLFA 1KYZA 3PNYA 2KZGA 3TANA 2V8GA 1AHDP 2DN0A 3QPTA 3ZQGA 1HKQA 1ZTTA 2ZBKA 2W8KA 5L1LA 1TTYA 2EKNA 1KSPA 3ZZUA 2K40A 3HD2A 4M74A 4RW9B 2MZTA 6PAXA 5DG9A 2LEPA 3HFKA 2VKEA 1N5QA 2NCKL 5F8MA 4C3MA 4HHUA 4HYEA 1C2PA 4K4WA 2DKOB 1J5OB 2XS2A 2DR9A 2C2MB 1NXIA 3QU3A 3QRQA 2RT3A 5BYQA 2NS1B 5IYDJ 2A6HF 2H51B 1YW8A 3KLOA 2W25A 1QUVA 2EINH 4PUOA 2VBYA 1FP2A 2CPDA 3LW5C 1S9GB 4ZVSB 1ZAXA 1ZBTA 1YJ7A 4C2UA 2B5JA 1TL3A 3JTPA 1TP7A 3VZHA 2MYSA 3TJ9A 3TJ8A 3CO9A 3SV4A 5J3LA 5FLXZ 2O5DA 4DZPA 4ESBA 3JYTB 2RU3A 2NVUB 3LF0A 2VXZA 2LFBA 2KM8C 2DNGA 1N6QA 2ZZMA 3CP8A 1VQ7S 2C2NA 3CUQA 1URNA 2X1GA 3UCZP 2NNYA 3L1PA 3HHLB 4NOHA 3LFKA 3BEGB 1F5TA 5HMXA 3HULA 2UUCF 3CF2A 2XMUA 4DYRA 4GKKJ 4UOFA 3K8WA 4AL7A 5A8WA 1VR6A 3TI0A 1RKWA 5EEAA 1T8IA 4XN0A 1T03B 2ELHA 5IP7J 2UVVA 4MKYA 3DXJF 1OO0B 1R8CA 1G4CA 2TDXA 4USTA 3FMSA 3D9BA 1VLOA 2FBKA 4C3LA 2R8KA 2LD5A 1YZ6A 3LAMA 2VFVA 4B3SF 1RT2A 3E5UA 1Q53A 3IA0A 5HLFA 2QMWA 4L5EA 1P1LA 1IN8A 1VQ5S 2MY7A 1PG5B 3MQ0A 1FJGF 1M5KC 3HOZJ 2POKA 3G2XA 4K50A 1U8RA 1AKHA 1K83J 1BI3A 2X7IA 2WHOA 3BDPA 4DUZJ 3AG3H 3V6DA 3GBGA 2XF5A 1SCJB 4WK1A 1TL5A 2IPQX 3WTYC 2EBEA 3MAJA 3U1NA 1ZH5A 3WTVC 3CJ3A 1A9NB 2DPUA 4I6WA 1IBMF 4LFAF 3BTIA 2OD5A 5AXKA 5K20B 3S7RA 2NS8A 1SJ1A 3MM5B 3J80Y 1GXTA 4M5NA 4M8LA 1S6QA 3S1RJ 3KLHA 4CYCA 2K3PA 1X4EA 5H9EK 5FDLB 2HNZB 3QAUA 4O23A 2MDAA 1HQUB 4CO8A 2DMTA 4GO5X 1T7PA 3DOMA 5CH7B 1M1GA 1J09A 4WBFA 1N33J 2O7OA 1RWVB 2RGVA 3RZOJ 1SUQB 3ZQ7A 4PYAA 4EMDA 1P2FA 2HXIA 1S3JA 3HCXA 4KT0C 4X64J 3GIKA 2CV2A 1VS3A 4LIUA 2AIRB 4LF7F 1BE4A 4G12A 2E5JA 1TL8A 1SJFA 2MA3A 2XUBA 2B9WA 2O8XA 3RKXA 1SEUA 1ZG5A 1ITYA 1ETKA 4PG8A 2R2RA 3AJ2A 2IP2A 5BYRA 2HKXA 2NPFA 3CDEA 2EZLA 4DSLA 5LHIA 2Y2ZA 3RKYA 3KYLA 2AGQA 3RRGA 3MMAA 1ETXA 4DR6J 4IJAA 3I3LA 4G94A 3L2RA 2W7NA 3HOWJ 3FJ2A 1HKTA 2IS2A 1UEKA 3GR1A 1KHVA 5BXIA 3JTOA 5C25A 2ZD1A 4RL1A 2XGDA 2DMUA 2IVFB 4XPCA 2LQ9A 3HSDA 5KFYA 4DHVA 4OHYA 4OX9J 3J81j 4AYBD 4I99C 1LWCA 3B6AA 1HMVA 2W9CA 2HK3A 3HKZN 3ETOA 3G96A 1NLKL 2H6CA 2N7CA 3LP2B 1RHJB 3OUYA 2WY7Q 2MC4A 1IXRC 2ASYA 2R7OA 5E33A 2PEHA 3CMQA 3CE8A 2RB7A 4OYWA 2AGPA 2BOLA 4ZN3A 3NNCA 1RAAB 2J5AA 2JZYA 3DQVC 1P92A 2GHPA 4OZNA 3LSRA 3LGMA 3L2QA 4ZPVR 2JUCA 4Q48A 2XYGB 3UDEA 1S79A 3SCKE 4NWBA 3TNVA 3OFHA 1IN6A 1WELA 2ZNYA 2W4SA 5IM0B 3D0IE 3Q5FA 1BQMA 1BN5A 1X1DA 3US5A 2ASDA 1G3TA 4RLQA 3M2RB 2YU3A 2P5VA 2BJ7A 1G3OA 2FQ3A 1EZZB 3CCRS 4JI5J 2H54B 1QTMA 5D4SA 3KLIA 1D1CA 2FHMA 4JBAA 2A18A 1XDUA 1R71A 3D1OA 1Y5NB 3MCMA 2BDPA 3KP2A 1RK8A 5H20A 1HW8A 2E1MB 4QPQA 1S4EA 2ZBRA 4C4WA 1M0SA 4ELTA 2DHHA 3IXQA 4OYAA 3ZMSA 1U7LA 2WB1A 3C3WA 3RRKA 2MKYA 2H27A 1HBUA 2K8GA 1IQTA 3I9V2 2FDNA 4LVOP 3E6MA 1GXLA 3M30A 2P7CB 4XK4A 3J7A1 5C2GA 2LQ5A 4XMYA 2C1EB 3QFHA 2ZJRF 5K8OA 3NG8A 1YKWA 1NCLA 4WFYA 3QPHA 5IT3A 3K2YA 5DLGA 1S9FA 3M30B 1Q81T 4F02A 2Z2MA 5CYQA 3AT1B 2ZFWA 1REPC 3SYTA 3HD1A 3EUNA 1RHQB 1VQSA 2EZIA 3CCMI 3I96A 3QWPA 2XZDB 4CSWA 4BEHA 4U7UD 1SC7A 3MR5A 2DPDA 2HVEA 1H2TZ 4LIVA 1MBHA 3ILOA 3KLIB 1RQ0A 3QPIA 4LVNP 5ETLA 3K2AA 1P7JA 3DI6A 2XCAA 5CD4A 3NS6A 1C1BB 2QN6B 4MFDA 5ITHA 4KGXB 4DX7A 3EX7B 2BRKA 4NC8A 4KSEB 1TV6B 4ZHRA 5BYSA 2Q1LA 4FN5A 4ZYHA 3H4BA 2Y9HA 1OJLA 4FT8A 4YFUA 2MKHA 3VGTA 1U02A 1JUPA 2M7AA 2ZXHA 2LC2A 4ZKAA 1WVRA 4G8XA 3D6TB 1TQLA 2L7FP 2YWFA 3BGFA 2BE9B 2FD2A 5F3TA 1IUYA 3HT0A 1VF9A 3OVBA 4F67A 2DITA 3OS2A 2J0WA 2OD6A 3K5PA 3BPDA 1T98A 1H6KX 1YRXA 5HOOA 4LOCA 4CIOA 1Y3KA 1A0OB 4HV6A 2GIVA 3F8CA 4DL2A 6AT1B 2BJ3A 2HG4A 2QO3A 1OYWA 2E5HA 2RDJA 3WZ0A 5HROA 1K78B 1NZ8A 5ETNA 4HV5A 4LLNA 3QWLA 4OV6A 5K5QA 2QGUA 2RUSA 1ODDA 5JFRA 2VH7A 2V6CA 1KVJA 3W5YA 1ZAWA 3JXOA 2R92J 4RUAA 4RLEA 3DGPB 3OIPA 4L76A 2OZUA 3Q23A 2YBVA 2LF7A 2LK2A 4CXFA 3IR5B 1QZYA 5J8CA 1BC8C 4M95A 1B7FA 2XG8A 2CQ7A 4FQGA 2AXLA 4ANEA 3HM9A 3BR0A 4K4XA 4CO0A 3D2WA 2GLOA 4FS1A 3VYTB 1XNRJ 4A3IJ 2UU9F 3LUYA 3AG2H 3B02A 3QT7A 5C42A 4BE1A 3BF4A 4B9SA 2AWZA 3HMJG 3DLBA 4CTAA 2DOFA 2WAQD 2PX9A 3I9ZA 2CNKB 3DTIA 5C4XJ 1MGTA 2X6OA 1NB2A 3R6GB 4IH5A 5F04A 4QWDA 4TYAA 4ZVHA 5AT1B 2Z5UA 4FTHA 2MEWA 1SV5B 5GAGJ 3ZTRA 3J81Y 3C8YA 4TYBA 3IAS2 4HOBA 2RVCA 2PJRA 4ECRA 3R5BA 1U49A 3FSXA 4BDYA 2RJZA 4A5MA 3BR3A 3OY9A 2CQ0A 1D8YA 4B09A 2P9CA 3CXCR 4M5MA 4GVLA 4K7QA 5D8KB 4BGDA 4N47A 3KP7A 5CJ9A 2W4PA 4ECTA 2KI2A 1OYYA 3LAKA 1E17A 1QAXA 3HFVA 3KWMA 3AOCA 2FLPA 1Q1KA 2IM1A 1K6YA 2BYCA 5AIQA 4A93J 2HNHA 1Q1VA 1S7AA 3W6JB 2JVHA 2P8TA 1WGXA 4UB6C 1U2WA 4PJNA 3TX0A 5LRRA 3ZN0A 4PJMA 4ECQA 5HS8A 1ONVA 1FD2A 4MIAA 4BQNA 3ERMA 2QMUB 2FJ1A 5EUHA 3I82A 4NCGA 2LA6A 2ZM6J 3OYNA 4WWCA 4JI4F 4H0EA 1I3QJ 5DEQA 4L75A 3Q8SB 2RQ4A 2VQCA 5KFRA 2QQ8A 3KYCB 4DZ6A 5D78A 3GTJJ 2E1NA 1VFCA 1N52B 1LW0A 1OPIA 4FYWB 4EM1A 2XKPA 4QOTA 3Q2TC 1IZ1A 2B3TB 1N32F 2VPZB 3OT9A 4UB8C 3M2UB 4CT8A 1P4AA 1JKOC 1XTAA 4JP0A 4FZVA 2IGOA 3ECHA 1JUSA 2R7TA 3BZ6A 4RJVA 4USJC 1S1VA 2NR0A 3MUTP 1A31A 2V9WA 1NK4A 4DR5J 3V4IB 3M4OJ 4ID8A 1O4XA 2KRHA 4MH8A 1ZGAA 1PAUB 4ICLB 3D5SC 1VDHA 3CJQB 3L09A 1F5AA 2LXFA 1WI6A 3BG5A 1FF2A 2JZ5A 3QYEA 3QIPB 2CJBA 2EA4A 3NAHA 3R0AA 4I76A 5JVHQ 2HOSA 4E7IA 2B8PA 4DR2J 4KMUX 1BC6A 3K1NA 2QT7A 2HQRA 3HGYA 1T9YA 4XN3A 2KXFA 4ZPDA 2WVCA 5I42A 4RKUC 3W9HA 2OEJA 1FTRA 4LD5A 4QBUA 2OBPA 1ZGWA 3J81K 3GU0A 1XS9A 3SFGA 4Z7CA 3AA9A 2R0QC 1K1QA 2HZAA 4XTTA 1XQIA 4RGXA 5BR8J 3EICA 1U3EM 1XIQA 2HW3A 1R36A 2L9SA 3TW7A 1KTVA 3LTOA 2HLTA 2HR3A 3HK2A 1UB9A 1SIWB 2L48A 4OAZA 3MFHA 4D0PA 2KH9A 5KFJA 1Y10A 1R6YA 2J0SD 4EUVA 1YSJA 2IJLA 1T94A 3BJOA 1H74A 1Y4ZB 3CMAI 3D6FB 3M2RA 4A0YA 2HBZB 4NE9C 3MPDA 1GQEA 4QR2A 4ZJOA 4ZLLA 1U1PA 3UW1A 1SFKA 5HBMA 4OQJA 4FYDA 1O51A 2ATLA 4Q8EA 1VQ6I 2RKIB 3HHNB 1UZDA 2PGCA 3BGUA 2HGCA 1RCXB 4UUVA 3KLHB 3GV8B 4AL6A 3MFKA 3IAM2 1FC3A 3CQZJ 3VAGA 5CZXA 4PQUB 1D8KA 3DBHB 3CJRB 4Q5VA 2FJBB 1R5GA 1WC0A 4DL6A 3GYGA 1P6TA 2QG9B 4HDVA 1LNQA 4ITSA 2EBGA 1VQ7I 5M3FJ 3LP2A 2C6YA 4LFCJ 5LD2C 4YIFA 2G0EA 1AKHB 2PA8D 2DXFA 1SL0A 1QNTA 5L9XA 4BC9A 1ERDA 1JLEA 1HMVB 1WKMA 4DV7F 1JLBB 2B9YA 3DEWA 3MMBB 3UCGA 2M88A 1BWEA 1U1RA 2PI5A 2BJEA 1ETYA 3CJRA 3S1QJ 1NNDA 1NSQA 3OYEA 4JOUA 3IGVA 2DR7A 2Y0SD 1VQ6S 2C42A 4ZP8A 3JSMB 4ZPBA 1T39A 3NAUA 1LW0B 2DW4A 2DA5A 3OHAA 5GMEA 3HG9A 4TY9A 2E71A 2KL8A 1SD5A 4XRSA 4CLKA 3FBFA 4JP8A 5CVVA 2CWXA 1KOHA 4P2FA 2JEIA 1FTZA 1FI4A 4WFBQ 2N3OA 4RW7A 2B7BB 4AU7A 4GYGA 2Q43A 3QNWB 4KFBB 4KHPF 1NEEA 3M6WA 5HDKA 3HHLA 2HDDA 2CUEA 4OAYA 5A8RA 1J9IA 2IS1A 2FUG2 4NHJA 4UUSA 3F44A 3P9KA 1ZS6A 2ASLA 1U2FA 1RU2A 2MMYA 4CCJA 3ZZYA 3MCSA 5L9NA 3HHKA 4JI0J 1W7PD 3E5QA 3MECB 2VJVA 1MSFC 4LFCF 3K1PA 4QWBA 3OL9A 2AJQA 2KIMA 2YKPA 1Q82T 1Y8QB 3C16B 3IS9B 2DOAA 4D9JA 2CQHA 4YY3F 4C8OA 5ETTA 1AYEA 2LR8A 3VSKA 3UN3A 5DTDA 2IMOA 3CNQP 1A5JA 1ZG3A 3Q8PB 3IL2A 2CS3A 3FMRA 1AOYA 3EVWA 3BR5A 3CDAA 1RE1B 2XI2A 1H8AC 5DYMA 2ZBCA 1FX4A 4NQWB 1FFGB 3TAMA 3CCWA 2E1CA 2LLKA 2HRTA 2V2QA 2P9GA 4I6ZA 3NCRA 1M5SA 2A2DA 3G6ES 1S7IA 1BA5A 5BJRA 3E8OA 3AL0B 1N5YB 4ID5B 4JQFA 2WRMA 3HLUA 5K8NA 2UUBF 4JI6F 1WACA 3QPSA 2N4DA 3VGSA 4RUHA 3KHLA 3M8FA 3KE2A 4ZPTR 2XPWA 1SQFA 1SFXA 1VZ0A 3CCJS 3RJPA 1PUFA 4WKYA 3BO4A 1FJCA 3CJTA 3DKWA 3DLEB 1FRKA 3BPXA 1LXJA 3RSNA 1UJ8A 5H6QA 3HX9A 1J59A 3GJQB 5M5XJ 4NRUA 2LQ8A 5LXRA 2PA3A 1KLMA 3W7BA 3T1BA 3HOTA 1KRPA 4ZTFA 4ZVOB 3MM7A 4QWQA 1OCCH 4RNOA 1K73T 3GPAA 2VJJA 1ETVA 4N4NB 1VI0A 2ZWPA 2IJRA 1URRA 5CHCB 1RKTA 3L95X 3KK2A 3PTWA 2E1PA 2HYGD 2HSEB 4CRJA 1FP1D 3IRWP 5GMDA 3O6BB 1G7CB 3I59A 2QIFA 4OFZA 2YR2A 1LPQA 3Q8VA 2G9OA 4CNZA 1QZZA 5A0YB 1S0NA 3ADAC 3W2AA 1VQNI 3RB3A 5DETA 5L38A 1OLTA 2OSRA 2MLZA 2YWEA 2DK2A 3HZGA 2R3VA 3PDNA 4ID5A 2MLXA 1M1EB 2AS5F 3LGNA 3IRQA 3AQPA 4M9SA 4U88A 2MD0A 4NLWA 5HLHA 5AE3A 3BKFA 2FJWA 4MMOA 3FMQA 1MWZA 3FK4A 4X4NA 1JK9B 3FX3A 2HVDA 2GHWA 3JSPA 1IBKJ 4OI2A 1YIJI 1RTIB 1L3TA 1VK3A 5C4JJ 5LMUF 3P49B 1O57A 1OMSA 2KT3A 3LL7A 3KIOA 1NM2A 2MD5A 3MF5A 2KHMA 3PYEA 4P96A 3A03A 2JHEA 4URGA 4IFYB 4EJTA 1LJ9A 4NPOA 3HO1A 2W1OA 1S9EA 1U6FA 3J7AN 1TV6A 4UZBA 1D9FA 1S0MA 4JV0A 4QYRA 4K4TA 1NDPA 1TK8A 5DD8A 3AD9C 1LFBA 1EQMA 2OPRA 3BCAA 1RR8C 3AFGA 1WC6A 2B9EA 2Q6CA 3DCFA 3MMJA 1Z6TA 4YB5A 1VJWA 4G1IA 2E9RX 3LOCA 4YY3J 4OJGA 4I7FB 4ZCKA 3MKYB 3JSBA 1BUXA 5GAGI 3F0CA 3D5LA 1F60B 3AXKA 4HVZA 1F36A 3PIPQ 1Z91A 3PKYA 1B59A 5BQTA 4BDZA 1OJ4A 1YTYA 3T5KA 3WTTC 3DCAA 3GZ7A 3H3VK 2XSJA 4A5NA 4O44B 5JMNA 2DOEA 2DGQA 1U5TB 2KT5A 3PW0A 5KT7A 4G6VB 4CCKA 5E3CA 3OTCA 4U0WA 3HOXJ 1NH7A 1VFJA 4KITB 1HA1A 2R4GA 3V4GA 3KXDA 4QW9A 4ZPWR 2FOWA 4BE2A 2JEJA 3SYZA 3H5YA 1KQ8A 1GV2A 5ILSA 4H4MB 3MMBA 4OI1A 1OSDA 2C2EA 3RGIA 2GJFA 3O8GA 4R8UB 4CCMA 2BOPA 3RPUA 5CA5A 1CSJA 3SQNA 3I64A 4DXLA 2YVSA 3KG0A 3DLAA 3OBIA 4W92B 1KQFB 1VRTA 2R7DA 4OZ1A 4LRDA 2D2WA 4IKFA 4IRGA 3RDIA 3WHIA 1R49A 3I5BA 2F5FA 4DUZF 1UMJA 2A3SA 1PJRA 1XK8A 2WSEC 5D3GB 1S1UA 3A0HC 2IDLA 2OKQA 4DV6F 2UXXA 1S0VA 1E6YB 1W4MA 3OW2R 3VODA 5B0FA 1KEKA 2MGQA 1IN5A 2C28A 3M07A 1A6QA 3IR7B 5RUBA 1BY9A 2W4CA 2ACYA 3CJKA 4DPTA 3Q0UA 1NJIT 2OZ6A 4GRSA 4ZVRB 4NA1A 1JNZB 3VALA 2ZJPQ 4MFBA 4ECVA 3HPHA 4PG5A 3GYHX 4BS2A 1TUGB 5TRDA 1OMIA 1XTZA 1U25A 2L2OA 5DQHA 4RNHA 3W1YC 3L7WA 1WDTA 1RXOB 4B3RJ 3IM9A 2EJRA 2IA1A 4BEHB 3DYAA 1JLQA 4NLDA 4DEZA 3H1CA 1YITI 3GJTB 3LO3A 1DAXA 1TMMA 2CQXA 5F1JA 1DURA 4LIRA 3BDDA 1YI2I 5IC6B 4KAIA 4DR6F 3QU6A 1KQGB 1IRZA 2AKWB 2RD5C 3O2IA 4YIRX 3HTUA 3DOLB 1FEXA 3KHRA 3RAQA 3C2HA 2VC0A 4AVZA 2QYCA 3I55S 4W97A 4URQU 3MR6A 3OSPA 1OYIA 2KL4A 2AD9A 2ZBPA 1YBTA 1D1BA 2DDBA 2FBHA 2VA2A 2R7FA 1V9OA 4AQYF 1TWGJ 2FE3A 4DV1J 1JJCB 1CULA 4FP9A 1LNWA 3KLGB 2HVZA 4KR0B 3KP5A 3FZ2A 3NGRA 3ZQQA 3EUHA 2VQEJ 5DJBA 2PC6A 2C3YA 4KA4A 1FE0A 2L3MA 1XN9A 4CDGA 4KIBA 2MZJA 4LMYA 1NG6A 3IRXA 4BC7A 3FDSA 1RTHB 1XSVA 3TOAA 3P3DA 4YMEA 5E3OA 2V9VA 3DOMB 1FMVA 2ZKZA 1EF4A 4NLOA 1WORA 2EVZA 2EK5A 2ID6A 4I64A 1HNWJ 3NMAA 4OHZA 4BHQA 2NSBA 4Y2KA 4B1RA 2VODA 2X6XA 3Q2SC 1CQTA 2FY8A 1VRUB 3ZTPA 4CLYA 2HHHF 3ZQCA 5HMZA 1U6GA 5GAEI 2CFOA 4FBUA 3GZNB 3SQOP 4B47A 5D0GA 2HQFA 2Q79A 4ZLPA 2MGZB 1DQUA 3I59B 3FNNA 1U0HA 3KZZA 4Q45A 3H35A 1Z3YA 4E2FB 4X4TA 4HLYA 1YW7A 1P7IA 1X58A 2Y75A 1EP4A 4BHCA 4NDLA 2Z0GA 4JYAF 3FM3A 3R4KA 3WX8A 2LBFA 5E3RA 5CVJA 1NK5A 1BJZA 3HGGA 3J7AY 1KLMB 4LSLB 1GTEA 3MEGB 4XIUA 4C8NA 1U09A 4LREA 3T5XA 5E3QA 3NNHA 1GEHA 4ED1A 3OXGA 4K2JA 1O3QA 3VHQA 1H0HB 2HHWA 4YFNF 3S15J 5HMWA 3IUOA 2HKEA 3F41A 2KJCA 3G73A 1VC0A 2O67A 1FOXA 4LBPA 1X1CA 2DPIA 4A3KJ 2XMKA 2ATCB 3NXZA 3PZPA 3VOEA 3OYJA 2HIQA 4F04B 3ZZ0A 1VRQC 4DS5A 3LNQA 2HQ3A 3IAM9 2RDPA 3JQMA 3M8JA 3F23A 2HDWA 2DQRA 5F27A 3MKZA 3C2GA 4LB5A 1DLOA 2LNBA 1XR6A 3HHHA 4E4HA 1PP8F 4TKTA 3GP9A 1IAWA 3E01A 3ZOBA 3HHLD 3K6GA 2HYFA 1C0TB 5C7PA 1U1KA 3HOVJ 1B4SA 2WVBA 2IMWP 2R7UA 4NXMJ 3PSIA 3U21A 1FPQA 1FKOA 4F0HA 1GLNA 1FRMA 5F3ZA 2VUGA 2VFSA 3BBBA 4B3XA 3FSIA 1JXEA 1X4DA 3BR9A 1BQMB 3VQTA 4F92B 4C97A 3WTSC 2Y0SA 1JXLA 2EC0A 4F3MA 2CJKA 2ZJPF 4YP3A 2L0KA 1RWMB 4JI2J 5HP1A 4XBFA 3CCEI 2VXDA 2NOGA 2B6AA 5DQGA 1U1NA 4F7VA 1APSA 4U87A 5EG0B 2YWHA 5D3GA 3EVMA 5GTIC 3OIOA 3VAIA 2HVHA 2MLGA 2D3OR 3DTEA 4EZ9A 3I56S 1D1UA 2CO5A 3RTRA 1W36D 1FYLA 2OA4A 1YFHA 2N4CA 1K0VA 4DV5F 2YNFB 2X1EA 2O03A 2DBBA 3HOYJ 2MYFA 4P72A 2XS5A 5CD4H 1EH6A 3KJFB 2BM0A 4DL0C 5E79C 2CSOA 3J81Z 3IP0A 1KQKA 2FNPA 1QO0D 2CW8A 4DR2F 5J8FA 1FX2A 1T0TV 2CPXA 1K47A 5LL6d 3H5RA 4HSTA 3VB2A 3DPLC 3BSAA 4I01A 4J9VA 3CJ2A 3ZMDA 2HHHJ 3GTKJ 5KT4A 1IWGA 1HW2A 1I1SA 2J5PA 3R5GA 3UD5A 3CJ8A 4IRKA 3CUNA 1TTHB 1IBLF 2YKQA 3SXLA 3JS9A 2XSJB 4EYIB 2R7VA 2VA3A 1UHWA 4BHBA 2XY7A 1OPZA 2D3ZA 3Q8RB 5H2FC 4NA3A 4K2XA 1G6NA 4P7TA 5GTHC 1YRNA 3IHUA 1AROP 4EGZA 1YJ9S 4WXHA 5T7LB 2I8DA 3UVJB 4E6KG 1CJUB 4YN3B 3I0SA 4P2SA 3T5HA 2WSFC 1X1BA 1Y56A 3O8WA 1N5TA 4UOCA 2ZJ2A 4AD6A 2O8KA 1D09B 1JE8A 2NXJA 5GMKa 1U5TC 3KLFB 3T3FA 2W2QP 2VBZA 1ZOTA 3A4TA 3KJNB 2CQPA 3H4DA 1Q79A 5DG7A 2JDJA 3EQLF 2O3FA 2MTLA 2K9NA 4Q2MA 3BPVA 1S8NA 1VQKI 1YJNS 5HO4A 2EWNA 1NUEA 1BMQB 3ABTA 4F50A 3CDLA 1FOYA 1EV7A 4NXNF 5DQIA 1UZCA 2HKOA 2VPLA 2ZE2B 4WFZA 2A05A 4P9SA 2HTJA 3P96A 3BQ0A 4OU0A 1Q8KA 4RB3C 1QA6A 1JIHA 3IH3A 1VQ4I 2QL9B 3OL7A 2AQ4A 5E8GA 1AFJA 2R5ZA 3AJDA 2LXIA 1HNZF 4DR7J 5FKLA 3M9AA 4ZCIA 1VHIA 4OZJA 5BR8F 4ZPAA 4NX9A 1KU9A 1JJ6C 3BN4A 1FOWA 1KFSA 2A6TA 2Y0BB 2WVFA 3K4JA 4DR4J 4G3IA 3CCLS 2COLA 5HLFB 4X66J 4P55A 5L3BA 1SKRA 2ZD1B 1DPRA 1UFLA 2XROA 3L2WA 4ENMA 3SMZA 1WEZA 5CLSA 1LVKA 2L9NA 3M8YA 1U1MA 1NPPA 4OX7A 3R5DA 2XF7A 1QJHA 3N0VA 4JV2A 2X48A 1T03A 3PQJA 2IYGA 3JRGA 4OX9F 2CXEA 2XAQA 2JLGA 2K7KA 1RT1B 3SZTA 1IUJA 4E7JA 4K5SA 4C0OC 1PUFB 2XSDC 4DSIA 4HEA2 3EJMA 2K1RA 3UN5A 3CD0A 2V9KA 3MVPA 2XGXA 3MDFA 4LG3A 2D9OA 4P9UA 2OPRB 1YJWS 5J2MA 3RZAA 5KG5A 3EGVA 3E01B 2ZH1A 2EV0A 3U1DA 2Z4PA 4IR9A 3H42A 4IOCF 1YYVA 4CH1A 3AJ1A 2Z56B 2VG7B 1FDDA 3HB9A 2CV0A 3DFEA 4ENOA 1S6LA 1YRUA 1Z2ZA 4I09A 4ANJA 4NEZA 3CD6I 1HNVA 4XKCA 1FRXA 2UZKA 4NZ6A 5B5EC 2M4MA 2R3SA 2BY0A 1NH8A 2NYXA 1A7GE 1GXQA 3HVAA 2XWYA 4PABA 4OIRF 2ZEJA 2XGCA 1WWXA 4PJJA 3IKTA 1X9WA 2QGFB 3I0RB 4LT6A 3DLHA 5KFEA 4B9LA 2DGTA 4FF3A 2Y1RI 1QRYA 1GT8A 5A0YA 2GZWA 4KFBA 2A6MA 3WTWC 2ILZA 4LLGF 5FD6A 3VCDA 3R6LB 1JUMA 3GF2A 4C8YA 2AQFA 1S76D 3KUEA 1XD7A 3KOAA 1FD8A 3LSJA 5J1RA 2HEKA 1MNEA 3HRMA 1SKSA 2ACJA 4RBVA 4C8ZA 4F3QA 3AB2B 3NGKA 4J00A 2FNAA 3MAQA 1BI2A 3COAC 2QM3A 2KIFA 1CS4A 2R8IA 3PSFA 1N5SA 2WOMA 1MJAA 3SCIE 1G6BA 5IY5H 3DOKB 5HVGA 4CWBA 1R23A 3PRBA 4RUCA 1KONA 2Y1JA 5EZHA 2K9SA 2DT5A 1HNWF 4N56A 2UUAJ 2Q66A 2RNJA 4IXAA 2B0GA 3QP6A 3BREA 2LLZA 2E29A 3E1SA 5E20A 2MSSA 1E2XA 1AZSB 4NLQA 1XB4A 5D6EA 4IFVB 3WE2A 3V6HA 1ZZFA 3V4MA 4X2BA 2DNNA 3D1HA 1S1XB 2EC2A 5KFSA 3T8RA 3AKZA 1IKXA 1H73A 5HVFA 3ZNJ1 1BI0A 2M0MA 3G1MA 5CCLA 2C3OA 3W6VA 1WDDA 4PUOB 3W61A 4OYMA 2XTJP 2BJDA 1OQ6A 4HAMA 1JJHA 1JKHA 3C6TA 2FLNA 5D0HA 3O2PE 3BSOA 1SH2A 1R1VA 4BNCA 2KKOA 1FJEB 4LRBA 3P5TL 4Q8FA 3ASOH 2GOMA 2LMDA 3BJ6A 2BVMA 2GXBA 3FKIJ 2KTQA 3C14B 4USVA 1EETA 2H48B 1RHMB 2ROEA 4X6AJ 5FD1A 2DH9A 2STTA 3TAQA 3EYYA 3H98A 3T6BA 4RO0A 5HQMA 4Q4ZF 2DGSA 2VQLA 1FLIA 4IQMA 2YPYA 1U48A 2CJQA 1WHUA 4Y7NJ 1SC6A 1VQMI 3G6EI 4BQQA 1Y3JA 1S10A 2GXAA 3C6UA 3J7ZI 3KJVB 2AEMA 2V4JA 3RKWA 1NJZA 3A8KA 5F9NA 2A6EF 3TO9A 4W4MA 4OI3A 1W25A 1Q8LA 3OR2A 2RMLA 3RBEA 3DGPA 4ITVA 1F0XA 2HWTA 3BH6B 4C7QA 3UR0A 2FQQB 2C2OB 2X9DA 1X9MA 3A02A 4X0GA 1UWBA 1GUUA 3CMAS 4IOAF 2FU4A 5EGOB 4BLGA 5M2UA 2GQQA 4KV8B 1MBFA 4EO6A 4HNVA 5EDWA 3V4IA 3QJJA 1D5YA 4F4AA 2V7FA 2MKSA 4HZFA 4QIEA 5ETPA 1UVLA 1A6LA 2KG1A 2DHAA 3VSLA 4ESFA 3GV7B 1S48A 4WFXA 1IJWC 4MFBB 5F64A 4URSA 1LE8B 4TU8A 3DRRB 5C24B 4PWWA 4RR5A 1JXSA 4J19A 5HVHA 1FYMA 3D0HE 3H9QA 3B4DA 3H2UB 1PJ7A 1RZ4A 2HU9A 2PBIA 1RISA 3DTKA 2GVDB 5J1EB 1JMTA 3MFIA 2A68F 1V54H 2RNEA 4HBLA 1HI1A 2DRBA 3ZP5A 2CU7A 4RUBA 2CPJA 1NJXA 4WXCA 1S1UB 2L7MP 2OPSA 1Q16B 4PG6A 1FIAA 2K06A 5IV4A 1JLFA 3KETA 4WKRA 2O3DA 3GIJA 4IOCQ 2EV6A 4OYXA 5FLVA 1J7KA 2VL8A 4IEJA 4AYBA 5FLMJ 2ILYA 2L02A 3RB0A 3OYFA 4XDDA 3ZC4A 4LJMA 3HVTA 1B9MA 3H2LA 3JTHA 1SBRA 3GFHA 1VCTA 3D6HB 1SJ3P 2HYJA 3HT3A 2NYIA 2CDQA 1LWCB 4JI8J 4X65F 3S14J 4MTDA 2VFTA 4NEYA 2QLBB 4HDHA 5E5NA 3ISND 4ECSA 1K61A 2FTRA 5A2QU 2F5VA 3E97A 1RUOA 3EXCX 2PEBA 1B0PA 4RW8A 3F0NA 2R8HA 4PJ0C 1NO8A 1FJ7A 3WIVA 2XCPA 5DLFA 1BL0A 4KH1B 5I3QA 1R89A 3E0JB 1T33A 2XAUA 3L00A 1W1WE 2CAJA 1S7EA 4G1QB 1WOSA 4LIWA 3NGSA 2BVZA 3X2QH 2E9TA 1VMBA 2MQ8A 3IFEA 3SJMA 4A6EA 1UW4A 1MROB 4IO9F 2EA2A 1Y00A 1JGGA 5I4MA 2QLFB 2XMTA 3PFOA 4X4VA 3OHBA 1UW9A 2UXNA 5LM7E 2YQ0A 2LECA 1FY7A 1C1CB 3MWBA 3PO2J 2K3KA 2G1HA 1UAWA 2CPFA 4OIOF 4FETA 2QTWA 1H0MA 2QE5A 3P9IA 3OS0A 3A01A 4UT4A 3DGVA 5JVGF 2XC7A 2KDZA 3ETMA 1GVDA 3IV5A 2QA4I 2UUTA 4JI2F 1FWKA 1SI9A 3M4XA 4RB1A 2HS3A 2MSYA 1X5TA 2H94A 4IFVA 3HHLC 3NEUA 1REVB 1WH7A 1HWLA 5IFMA 2P6TA 2L9VA 5EN1A 3TP0A 2H6BA 5F0HA 1H88C 1G3WA 1TWFJ 4C8MA 2JLEA 4FKXA 2MQMA 3IH4A 1WHWA 2E2IJ 1UFKA 1FT8A 5L1KA 4XLNF 2UV8A 1UHSA 2LG4A 3R61A 3LMMA 1VYAA 2JSXA 2UZAA 1T02A 4LF2A 3KK2B 2LY9A 5K8PA 4HI1A 2BKNA 2F4FA 3JQKA 2IS6A 3MM6A 4X4OA 2DMPA 4RGRA 2CDRB 3M7GA 3TUIC 4FX4A 4AUXA 3ZXWA 1FK9A 2WB1N 2G0JA 2W9BB 4TLQA 1NH3A 3GLJA 3I5UA 1EAYC 1NBEB 4CLWA 1X4HA 2WBRA 3BSNA 2F9DA 4CLPA 2KMUA 3MAHA 4PZVA 1EQ0A 4Z37A 3GCWP 4FASD 2DJIA 2G1DA 1FXRA 1Z4UA 4RPFA 2W1BA 4WCGA 1MWYA 1R58A 4XK8C 4AL5A 3PIOQ 3CDWA 2FJAB 5FB2A 3SFUA 1B72A 4ED5A 2CJJA 2IYIA 2LF8A 1OCOH 1WH5A 3BKUA 2U2FA 1RT6B 3HKZA 4ZPCA 3S3MA 2E44A 4NYOA 1PDNC 3HKZD 2HNDA 5LSRA 1ZR2A 1O8BA 1IKWA 2M45A 3MGJA 4Q44A 2PMHA 4O3SA 3G4SI 4MJKA 3SZPA 3R27A 3MZ8A 5ICEA 2MZ1A 1HNVB 1XR7A 5D6FA 1YBAA 3IG1B 1ZREA 3F56A 5K5MA 4Q0BA 4IFYA 4MHGA 1HFEL 1YS7A 3IGNA 2LVSA 2AJ2A 5FJ8J 3MZHA 1WPKA 2CG4A 4MEYF 4AXJA 3PY8A 3GJRB 5HJXA 1RTIA 1NK2P 3CJ4A 3L7OA 1FEHA 3W3SA 3CCZA 1J27A 4ASNA 1RSCA 4IO1A 5JHUA 2B4VA 4OI0A 4I68A 5GADJ 3S3NA 1K1SA 4NC7A 3NBPB 3LSGA 2Y8WA 2AJ1A 3DU6A 3GXOA 1UJ4A 4V2FA 5L3CA 4IKAA 1UJ5A 1QVTA 4QIWD 1FOKA 1YG2A 2I9SA 2QLWA 4ED8A 2GVZA 5E1XA 4P2XA 2DB1A 1RTHA 5SUHA 4F7ZA 3DDNA 2EK6A 3GILA 4Y2IA 3JRDA 4AFFA 2PD1A 3CP2A 3E51A 3ITHA 2HXOA 2GMHA 3S8PA 4ZCLA 3CPWR 3MEXA 2LQJA 4MKVA 3PV8A 2PIIA 1UFMA 4DCJB 1Q8IA 3G6VA 1P9YA 3ISPA 1FWZA 2AV5A 3O5TB 3JAMU 4OYZA 1ACMB 5DCFA 2QWWA 2DI3A 2ABYA 4WP8A 3AD8C 2FX0A 1T05B 2BY1A 2EFQA 1RT7A 3QT6A 4GC6A 5KHDA 4Y28C 3WIUA 1GVJA 3ICLA 3AD7C 5EHHA 3W64A 2ZH3A 5CYQB 2BJ9A 3VYUB 3EZOA 3KK3A 3CESA 1Q8BA 1S97A 3A3PB 3DOLA 3RQ4A 2OUMA 2W57A 1ZA2B 4DV5J 3TDUC 2YY3A 3GFXA 2HRUA 3JRHA 3KZYA 3QODA 3HVRA 2VB6A 4A3DJ 2KJVA 2YX1A 5IT0A 5D6GA 1OR7A 2KKHA 1IRFA 4FYYB 1WF1A 2R9LA 2F40A 2CQBA 4EJUA 2CFXA 4UVAA 3H5SA 5IP6A 4CO2A 3GB0A 2GQ2A 4IDKB 5FO5A 2BW3B 3C14A 4IQXA 2Y8YA 1ON1A 1F9HA 1U1QA 1HL6A 1RGVA 3QGHA 2NXCA 4X62J 3OYLA 1YWXA 2W7AA 2JWNA 1S4FA 1H7XA 5IT9Y 1PYVA 1QE1B 1CG2A 4ANDA 2E5GA 2IT0A 1X7VA 2YWGA 1S9EB 1WG1A 1ITPA 1YQAA 3KX2A 1XBWA 3SEQA 3GIMA 4IOBA 1ZN2A 5KFPA 5DO2A 5L39A 5J2NA 1I1GA 3OTBA 4DUTA 1S1XA 4HH0A 2WADA 1VK8A 2DIUA 4B3TF 4ENKA 3FKBA 2Q8KA 3TGNA 3JSRA 2BANB 3G1LA 4GMKA 2CQ4A 2ZXIA 1Y39A 1SVLA 1FWPA 2AX1A 5E0OA 5ILUA 1RBOB 4DV4F 2HFNA 3V42A 4X4SA 4BACA 4BYYA 2Z2ZA 1XMOF 3FXOA 2MHNA 4U7CA 1B0TA 1RT7B 4RWXA 4A48A 1L3LA 1U9NA 4NLTA 3MPWA 2F8EX 2EB7A 3PNIA 3LSTA 2IM2A 2CWEA 4DQIA 5KCMA 3EPIA 1NKCA 2VU5A 2BOAA 3CC4I 5KG7A 4PWUA 1LV5A 5A2QZ 3BYRA 3RYLA 5M2PA 4NZ0A 1TW2A 4ECXA 2WONA 2G4BA 3VYSB 1RBLA 1EB0A 2FA5A 4IHSA 5HI7A 2ZM6F 3RAXA 3C6UB 2PMZN 2B4UA 2CKWA 2AP6A 1RWNB 1CPZA 2PE8A 2ELKA 3BBCA 4ZYGA 5I3PA 3GWCA 4Y33A 4DZDA 2VQEF 3LP1B 3OYKA 4U0VA 1J0RA 3ZXSA 5DDGA 2H1KA 2JJ7A 3RQIA 3BJAA 4DR1F 8ATCB 3JAMZ 1S29A 2GC8A 4XRFA 1RWOB 2GA2A 4DS4A 4I0WA 3I5CA 1RCOB 1EJ9A 1XERA 2ZOFA 2ZZNA 2XLKA 2DNQA 2EG2A 4W1UA 2H5JB 1QSYA 3O3LA 1XMQJ 3OTOF 1WG5A 4ZVGA 1KP6A 1M5PC 2RS2A 4RX6A 1HPZA 3CUOA 4RS8A 5LHHA 3R2CJ 4LFBJ 2HQIA 5H9EJ 4MYUA 1OY9A 1P9QC 4HRIA 1MMAA 1IWAA 5CYMB 2DIVA 1Q1HA 4K4ZA 1MMSA 4II2A 4C2TA 1V3ZA 1Y5LB 3S93A 1FA0A 1MDMA 3PJRA 3VAHA 1ORKA 1FBSA 3M1CA 1PYSB 5DCMA 4UZCA 1TAQA 3OYCA 2LFVA 2A2CA 2KM8B 1TC3C 3GYNA 4EGYA 4BU2A 2XKOA 1WNEA 3K4KA 2ZJRQ 3E3VA 1WSUA 2JRMA 4C3IJ 4EJOA 1IBLJ 5F8GA 1ZLJA 3EGZA 3NP5A 3N6LA 3LQRA 5I3UB 3FISA 1WJAA 4I0BA 2V1UA 4Q43A 1V5IB 1GHCA 4L3NA 2V9PA 3DFGA 4LF9J 5K5RA 1OR7C 4I98B 3W5XA 5D4LA 5K7ZA 4K0KJ 2J5OA 3GJSB 3MEGA 2BKPA 5EG0A 3ZGKA 5MLCV 2MG4A 4F55A 4I1TA 2FZGB 4LF7J 5CKTA 2FGCA 2AJFE 2HVIA 3VFZA 1VBYA 1D9AA 3AAWB 3ZQLA 1KVIA 5IT9U 1S1WB 2V2VA 2QSHX 4CICA 3KP3A 3GSDA 3GQCA 3HXMA 5IOZA 1F4KA 4OI6A 1HBMA 1IBCB 3OJSA 4N5SA 4RLFA 2Z2LA 2BZTA 1IQZA 3OR1B 2V1XA 3OIQA 1IXKA 4FE4A 3J80Z 4JI7F 2FBIA 2A5YB 3F8NA 5H9FK 3MWMA 2KPMA 3V7CA 3RUBL 2HK2A 2KZVA 5AJ3F 2D3UA 2KN4A 4I69A 1WJEA 5LLQA 5ETMA 4FHTA 2HBQB 3KZIC 2A0FB 2MY8A 4TLRA 4B3RF 1TFWA 2ZFHA 4DPOA 2UXDJ 1BM9A 3HHEA 2G2OA 4XR6A 5AONA 2EPIA 4YR2A 1BOBA 4R1HA 3MM8A 2DDAA 1WOPA 5FIIA 2ZB9A 2VG5A 1IM4A 5E17F 3R7SB 1FTCA 4RB0A 4PXCA 5K9FA 5CAAA 1SC4B 4UOGA 2Y1IA 2KIQA 2L08A 2HQAA 5HBMB 1NSAA 4NXMF 4PCQA 2EFVA 1Y7PA 1UVMA 4B9NA 2J0XA 3DXBA 5EGYA 3IRXB 2KHDA 4C0HA 4YHHF 3L2UA 1Y9OA 2GAUA 4OYIA 1FTTA 3Q22A 3GO5A 2B56A 2R2SA 3THVA 1SVDA 4XKVA 2IEKA 3RR7A 3O8HA 3FRYA 3EUKL 2QX0A 2QA4G 2MZRA 4LRAA 1N48A 1I51B 3Q8YA 4RW9A 1BQXA 3J7YI 3S1NJ 3U9GA 3C19A 2KZZA 1NK3P 2X6YA 2I5JB 2X1CA 4NASA 4LFBF 2JEGA 1B70B 3FCVA 2VF3A 2CQDA 4P74A 1RI7A 3SDEB 1GMVA 1ON2A 1HKSA 3A8IA 2O66A 1D0ZA 4BBYA 2KU7A 3W2WB 5J6XA 3SDBA 4I6YA 1QU3A 3PW7A 1LWEB 5C2CA 3K70C 1YE9A 3T1YF 4WP3A 2E66A 2O1PA 3ZZRA 3CD5A 1TWCJ 1NG7A 2IAJB 2IGNA 2QL7B 4OZLA 1KGSA 2D69A 3I4MJ 1C0UB 5F41A 4DX6A 5HMYA 1DZ5A 3KHGA 3DMJA 1NK7A 5ICGA 1BBYA 3NOCA 3POTA 4WIQA 4ZLJA 3M05A 1SH0A 1TL1B 3G71S 4LMZA 4HKQA 2DQLA 4L9NA 2AHOB 3BY6A 2UVUA 4NLPA 4A8WA 2ZXWH 5D0EA 3RIRA 2HNYB 4V2GA 3I87A 4F3OA 3FK6A 4R5PA 4F4ZA 4XRSG 3IC1A 2QQ9A 1YIOA 3AG1H 2OJ3A 2YKNB 2HOEA 2C22A 4KGVB 1RIOH 2KT2A 3M6VA 2DYAA 1ZAVA 1XMOJ 3M8PB 4KJZA 4HF2A 4ES1A 1S5ZA 1H9TA 3CJKB 4CH0S 4S0MA 3V7SA 5LGTA 2LDUA 4DSKA 4RAYA 3MKWB 1FNNA 5F08A 1L5UA 4DQ2A 1XJWB 2BW2A 3D0GE 2ISZA 3MPVA 1S12A 3MMCA 1D8JA 1YK9A 1IDYA 1FKOB 3UCUP 3MPUB 3I0SB 4F91B 2XI3A 3V81A 2AEFA 3H5AA 1YS6A 3UVJA 3HYIA 3CCVI 4AT1B 1QAJA 3BJYA 4FXDA 3P8BB 4WCEQ 2JOQA 3HJEA 5L3GA 4IHTA 2RREA 2M87A 1UEUA 1F9EB 1BXNA 2BXJA 1HQEB 2LYCA 2BQUA 1RLCL 3R6SA 3FHZA 1TKDA 3IWNC 2OFGX 4QYZJ 4KICA 4B4CA 1PCAA 3K4LA 4E70A 3FZBA 4IG0B 2L3DA 4QPOA 5BNGA 2YNIB 1JLGB 1UG2A 5F8IA 5I42B 2M2BA 2L7KA 2GIRA 1ZR4A 3D5MA 2F48A 4ED6A 2G0IA 3JRBA 4X84A 1M5VC 1QVFR 4A8KA 1U5TA 4K59A 2XHKA 3S01A 2BBEA 3GCMA 3WU0A 2KLOA 3HPOA 1AUSL 4JOMA 3TQEA 4NBQA 2C3UA 3DU5A 1WFXA 1LFPA 4KIFA 2FC9A 2WSCC 3EUAA 1FRIA 2CQ1A 4AXIA 2MQPA 1TFYA 5LMNF 2I5JA 3PO3J 4N7TA 1S99A 1FNXH 1KZHA 2PFDA 2JPBA 1T11A 1Z21A 1HSTA 4USMA 4KPYA 1FRHA 1HD0A 3GR0A 5DDOC 1RHKB 1YRTA 2UXBJ 4RAFA 4Y65A 1TL7A 4M73A 4P1WA 1IR1A 1XGOA 1SB6A 1FZPB 2XMWA 3QBCA 1VLYA 2C3MA 4ZZDA 2OCEA 1YX3A 2L01A 5ERIA 4DOZA 4DV7J 4B3MF 3WODF 3R3TA 3MR3A 3DLLQ 2HQ5A 3I58A 1OFCX 1K44A 1P4WA 2XZTB 2RF2A 2K4BA 1BLUA 3ENQA 5HS9A 5F0UA 1VQOS 2XGEA 4A8MP 2FGOA 3AOBA 2GGPA 4WYWA 2KIUA 3MCOA 3BGRA 5F8HA 3EMTA 1G59A 2QSFA 1F43A 1S5LC 2CW0F 2OTJI 4NRTA 3BROA 2YKMB 3KEOA 1MBKA 3RBZA 1RABB 1SC3B 2K4JA 4DV1F 2IIHA 3FFIB 3S2WA 2RN7A 3H5XA 3C1DA 3Q3SA 3NWGA 4MTEA 4CCOA 3W6KB 2GA7A 5GPCA 3QRRA 5HDNA 3SSRA 3HRUA 1NU4A 4L3KA 1R3NA 3K7AJ 4KYWA 2OP5A 3K58A 3MMAB 2CH0A 4HX4A 3GTGJ 4DR3F 1RWUA 3QIDA 1IV8A 5GADU 1W5SA 3OYDA 2CQCA 1B8IA 2LDYA 2A07F 2F5DA 4FBTA 2Z58B 4KYZA 3W9JA 3BR1A 3QQAA 4PXBA 2MQNA 3HZJA 2K9QA 2J6TA 4HF0A 4N9IA 2K7LA 3DPUA 3J80K 4KB7A 2OTLS 2WA0A 4ZJZA 1TT5B 4D3GA 4A12A 1T56A 2ZH6A 5ICCA 1VBZA 5E3PA 2CJXB 4LITA 4IYQA 4DBQA 2MFZA 2A61A 4UVCA 3VWSA 2Z9OA 3IH2A 4I02A 5KG6A 3OVSA 3W3CA 3MN2A 3JB9k 2OMLA 1B6AA 2OSQA 1R7IA 2HIYA 1IXCA 1D9DA 3UD4P 5C44J 5DCMB 4CZZA 5G4DA 2MLKA 2VBXA 3M7VA 3KP4A 1KS2A 2CRLA 4L0ZB 2BA9A 2CQNA 1HWIA 4HDUA 1RTDB 1YZ7A 2B51A 2A10A 4DFKA 2F4OB 3SFZA 5ETOA 1I50J 3WU2C 2M1BA 2JVRA 4ZS6A 1U9OA 3G4SS 2KRFA 3W2VB 5KFBA 4DMZA 4USWA 5FRMA 4DN9A 3ZN1A 4E7LA 1W0UA 3UDVA 1VQ4S 4J9QA 3BQYA 4KIAA 3N4MA 3HSRA 1U8SA 4IG3A 3NRVA 2V2KA 2IGKA 4ZP7A 1XGNA 1NDLA 1UG0A 4EJWA 2HPIA 1SD4A 4ETXA 3OV8A 1I5OB 3JTGA 1ZRDA 3LP0B 1O3SA 1R0CB 4ZVQB 3V6JA 2IRXA 4AM3A 4QU7A 4CT9A 1Y0UA 3N05A 1XSDA 1LKZA 3ZQIA 1TL7B 3GEZA 4BY1J 2RQKA 4HACB 5J1PA 5J1YA 1FMWA 2FJVA 3HP6A 2DJNA 1DY3A 4I56A 2N8GA 3FBIB 4H4OB 3MUVP 4P2MA 1I39A 5KNLA 1HR0F 2FHKA 3F73A 4WWSA 2HEOA 2PI4A 1MH3A 1YIJS 2ZDPA 3GTYX 4O3PA 3NS5A 3T0YA 3FGVA 3ERED 2HGMA 3OTOJ 1XMQF 1SFUA 4DFMA 2HNYA 5KFMA 2V0NA 1EHWA 2YQ3A 1TVRB 4PAAA 3PW5A 1ZTWA 3IWZA 3OMYA 5DDPC 2BHYA 1BW6A 1PP7U 4WTOB 4D3HA 2NSCA 4TXSA 4DPUA 1DRZA 2GCFA 5F0FA 3CCUS 5KK1A 3DMJB 3EM1A 3QPLA 1RC9A 3IWLA 4J5OA 3PRDA 2V68A 2L54A 2B4PA 1QVGR 3PX0A 4BH9A 4M5GA 1OWXA 5L3DA 2VIXA 4BDPA 1Y0HA 1T3NA 3F8FA 1G2HA 4LG0A 1TKXB 5L8RC 3PJWA 5LBQA 2NVXJ 1FBQA 1SMYF 1BQNA 3A0BC 2W01A 3MAAB 4ZP9A 1AA7A 1Y1WJ 5IYBJ 4PPZA 3R1LA 2MH2A 2FMYA 5EX3A 4RZRA 4DFPA 2V4JC 2MSTA 3S2DJ 1W5TA 2FLLA 3RPUD 2QL5B 4CYUB 3KMQA 3MEDA 5J2MB 4LF4J 1IR0A 1E6VB 3M32A 3ESWB 1NZAA 2GMJA 3KDOA 2OFHX 4OHXA 4DLEA 3NCQA 2EZHA 2R93J 1XNQF 2M5WA 1S72I 2FUG9 2W4DA 4C8LA 4B3SJ 1T8EA 4OX8A 4FF4A 1MN9A 2CZVC 3CWJA 3W62A 4Y52J 1YJVA 1JKHB 3C6TB 5KFWA 4B9TA 5J1EA 4TY8B 3AHPA 2JLFA 5KTQA 3C3LA 1KBRA 4DX8H 3TUJC 2IA2A 4LFUA 4BKXA 2DY9A 2HHVA 1IKVA 2XO6A 1IKXB 4HT7A 3MM8B 4NMXA 1BD6A 5C24A 3PJXA 1TNSA 2YKNA 4G6TB 1R8AA 4DYCA 3ZTOA 3HRSA 4RNFA 2WBMA 3BCBA 2B7EA 4X62F 4WIIA 4R25A 5FKKA 4U8YA 5M2RA 3NS7B 2UVWA 4ZLNA 1QVUA 3PR4A 2M4GA 3GONA 4IH7A 2HOTA 1IO2A 2HQNA 3J7YU 4PXDA 1RBAA 2LDIA 4USHA 2WTFA 3S3OA 2X1AA 3J80U 1HNXF 5D15A 5DM6Q 5A8KA 2GZOA 3GTMJ 4CP5A 4XLCA 4FVCA 3W65A 3TVYA 4EO8A 3BQ1A 3S1MJ 2VJUA 4DZJA 3DNCA 5LGUA 5DV5A 1K4SA 3QJLA 3BLYA 4YB7A 5IV3A 2X1DA 2CPHA 3CCES 3ENWA 5MAOA 3Q8UA 3ABKH 1HWJA 4ILRA 2RKIA 5EWGA 1U26A 2AU0A 3D66A 3W60A 2ADCA 3V8JA 1XC5A 1T0FC 4MAKA 2R7WA 2OUGA 2IBKA 3VZIA 4OJHA 4B48A 3PHEA 4WPAA 4DNCA 1S6UA 3R1HA 4USKA 4FXWA 1DDNA 3BGLA 1OY8A 3LGHA 4X66F 1NJYA 1WI3A 4Y2CA 1UELB 2IW5A 5D8LB 4YOEA 1NPRA 1IRXA 1N78A 1VQLS 3TZWA 1N5YA 1I6XA 4HHJA 2BMBA 1R0AA 2WVEA 5LEJA 1J75A 4ZVFA 3W2VA 5IPAA 1R8HA 4EVIA 4RM3A 3ULHA 4QYZK 4USIA 2MW8A 2W24A 2QLJB 2DT9A 3OLAA 3G2BA 4FS2A 4K5RA 4B08A 3JRCA 2HTSA 1HSJA 4LGWA 3M9OB 1FE4A 2H5EA 2Z1DA 3OYAA 3TUPA 3AXMA 3I6PA 1ZARA 4LK1F 1LK5A 2LH9A 1YJUA 4TVAB 5HLIA 1UFWA 2DR5A 4B9MA 2APOA 3MTKA 2CMPA 1JHFA 3DLJA 4EFAC 3BN7A 2BV3A 2OAZA 4ED4A 4X1EA 3CW2C 4ES2A 5EEGA 3AG4H 3L3CA 3I71A 2JFKA 4JX4A 2HAIA 3NQOA 1FXLA 1TW3A 5BOXA 1DQ8A 3I0TA 3PM9A 4RW7B 3PCOB 2DPJA 3K5NA 4KKOA 3JTNA 2WOMB 1MH4A 5DDQC 5ETSA 2CUJA 4XDCA 3REOA 2P8IA 4U9RA 5CZVA 1LEAA 1DQ9A 3M2UA 1FJGJ 5D4OA 4A47A 2OMOA 4E98A 1XG1A 4MTPA 2BY2A 3HSZA 3JSMA 4FPIA 2OC6A 4YQWA 4JK1X 5EF6A 3CCQS 1R0BG 4PJLA 3BSCA 2ESHA 2DK5A 2HWHA 1O5JA 1TKTB 1LK7A 3DEUA 2DJWA 4LR9A 1LFUP 2V6EA 2H8WA 3SDGA 1O6XA 4D5FA 5HROB 4WX9A 1S7HA 2CQIA 3MEKA 1BIBA 3QOPA 3GFLA 3PXGa 2ZJQQ 1OCZH 2QBYB 1WC1A 2R2TA 3R5AA 1AUDA 2XASA 1Z1DA 3N5FA 4ZYAA 3WU1B 3SBMA 5IYCJ 2YKAA 1CVJA 2NREA 2XGPA 1RHUB 4K4SA 2XSFA 1IG7A 1XMBA 3D1QA 1NRKA 2UXCJ 5M5YJ 5LMUJ 4CA0A 2YNGA 1JT0A 1IKVB 2R7XA 3RW6A 1S57A 3VGUA 2GNKA 4V1Ak 5H6RA 4U95A 3TUZC 2H4WB 5HSPA 3SZ2A 3NY0A 5BPDA 2AMCB 3DKDA 4UOHA 3W9IA 1F2HA 2AF6A 2LP4A 5CVRA 4LSZB 3FEZA 2H65B 4G7OF 1ETWA 2A5WA 1WI8A 1X4FA 2G13A 3LA0A 1PO6A 1J5OA 1L3VA 4A8YA 3OWTA 3TO8A 1Z0XA 3B6CA 3BTLA 3BO3A 3NWSA 1UA1A 2Y0MA 2ROPA 1FVSA 1JQGA 4M5JA 5B08A 2ZO4A 5A8RB 4XIDA 3RBDA 4WXDA 3H20A 3DV8A 2CPEA 1SH3A 4HSRA 2WV1A 3F8MA 6FDRA 4PG4A 2MZQA 2KRRA 2QMXA 1R4NB 3TARA 5HL7Q 2I10A 2IXSA 4NC6A 1UVNA 3NGTA 2E5ZA 4NLYA 3HHGA 4M5LA 2V4QA 1LDJA 3CCRI 3LOUA 3S6EA 1K79A 4CLTA 5HVQC 3HRTA 1L3SA 3DHXA 3FXLA 1MU2A 4KRWA 2M5YA 4DF8A 3MM6B 4HLBA 1VHFA 3DM2B 1M1KT 4I2QA 1VQYA 1ELOA 3DRSA 2MJUA 2ZZTA 3GTLJ 3OPKA 5DG8A 5HK4A 4C2MJ 4DPYA 3CJQA 1T38A 3BZQA 2HLUA 5K7HA 5E3NA 3OYBA 4M3DA 4A8SA 4RW4B 4F2RA 2IRUA 1X5SA 2YPZA 1ZA1B 1R5HA 2KB2A 1V5VA 3PX6A 4M3BA 3ABMH 3KNAA 2W7PA 2L5QA 4J37A 4O6JA 4P7VA 2D5VA 2X3DA 3GLXA 4WXOA 4HL9A 1X2MA 1QM9A 3A4CA 3CGIA 2ACMA 4DV2F 4A8FA 1RPWA 4JI4J 5HQ8A 1J2VA 3MD3A 4IO9Q 1ZM2A 1HF0A 3NARA 2HZCA 2DYSH 4LR7A 2M2EA 1UVIA 3QSIA 5DZ6A 3CDUA 3ZRGA 3ET6A 4XOTA 5IM0A 1F9FA 3EYIA 3J7AO 1Q7YT 3LPYA 2QV6A 3NWRA 3SCJE 5HAOA 1QHHD 1DU0A 4HX8A 3HOSA 1V3FA 1LE8A 2Z8QA 2QSFX 3ZMUA 4EV0A 3TOQA 3TBIA 7FD1A 2R42A 2LKXA 1NHVA 1KD1T 2RHQB 4M3GA 2ID3A 1OYEA 1NJWA 4IDKA 3QFWA 4ERDA 3DLKA 4UY8T 2V6AA 1G8XA 2VG6A 3V6KA 1W26A 3ZZZA 4HYKA 3LSKA 3TWZA 4OIQF 2H1LA 1ZLKA 1UWBB 3DRSB 2DNMA 4FKYA 1EKSA 4YFKF 4XRMA 4PPDA 4MKAA 3W63A 3GTPJ 5KAFC 3FBCA 1I5ZA 2X6WA 1AB8A 2VASA 2WY8Q 3KK3B 4W90B 3Q9SA 4QWAA 4N77A 4QPXA 1Q4RA 3E3XA 4M9ZA 2LXUA 4J9LA 4KIGA 5B0DA 1YHQI 3BB5A 3CMEI 3T1HJ 2DNZA 4CLSA 5G0RA 1MMGA 4NI2B 2R7RA 4DLGA 2ISYA 2XHWA 1POGA 3HSJA 4OMZA 1KTQA 5GAEU 3R7NB 5K5OA 1HNIA 3DLGA 4DI6A 1GDTA 1WCMJ 4B3MJ 2XMVA 1B9NA 3TEGA 2F4IA 2YSRA 5HS7A 3NLCA 5D8HB 4KFCA 2N3LA 2E60A 2KRBA 5JJBA 1MMNA 1SC1B 5ICFA 2XMAA 3HF5A 3CMMA 2RAEA 2MXYA 4QWEA 2LBFB 3H2VE 2HQGA 5KT3A 2V94A 4C2MA 1EP4B 4G9YA 2ZSIB 2FLOA 1Z77A 2HHSA 2A1BA 1GV5A 1N56A 4OI4A 3A13A 3EYZA 2P81A 2QA4S 3CJSA 1ZM4A 1FIPA 4DN0A 1PYTA 1WSRA 1D0EA 2CV1A 5AXMA 4MK9A 2J8SA 3T6JA 4XLAA 3DEEA 5B1BH 3RYPA 1AZSA 3FEYB 4WJBA 2F5CA 3QT8A 3KLVA 3JSOA 2JVGA 4KO0B 4NCGB 3ECOA 2DFFA 4A3GJ 1O0PA 2P2CB 4R5PB 4N41A 2XB0X 2DA6A 4UUTA 4IOAQ 2KP6A 2FRHA 5D4PA 2COMA 1SKWA 4QU6A 1IR2A 2E5LJ 3ZMVA 3ZO7A 4U7DA 4U6PA 4DQSA 4UY85 4XM3A 4I6AA 1KU7A 3WTZA 2CJ9A 3UQSA 4V19X 1RKIA 2HZVA 1YX5A 2ZBIA 1NHKL 2OJED 2VKDA 1IJFB 4OJ3A 4CLLA 4HEA9 2KVQE 1IN0A 1TKTA 1TK5A 3KEQA 2GIFA 5E1ZB 2WC2A 1MG7A 1HQ2A 2GS8A 3IO1A 3JR9A 1OPCA 3OTDA 1M1HA 4OIXA 2PDAA 4M5IA 2DK8A 4MIWA 2LTPA 3CC2S 1ZG1A 3KJVA 1FEEA 3G6XA 2DGWA 2Q1ZB 1FNOA 2BUNA 1RLDA 3ZNUA 4QWCA 4F4WA 3S2HJ 3CJTB 1IM6A 3PEHA 2UUAF 4DV6J 3L4BC 3CC7I 2DHSA 3RW7A 3QZ7A 1FDAA 4TN2A 4GKJF 3FQKA 1QTNB 2JRTA 2YWKA 2Y30A 4XKBA 1SD7A 1H38A 3JYTA 5U47A 4PKDB 2K3FA 1ZKGA 4KDPA 2DISA 2V67A 4EZ6A 1ZZNA 4NQWA 3HJFA 1N8RT 2B5JB 1WD6A 2AXTC 2YX4A 4MLOA 3H90A 2EPFA 3N6NA 9ATCB 4J91A 5KFFA 2EV5A 1ZK8A 3JW4A 1N88A 2WK4A 2ZDOA 4GXOA 5KG1A 1WHXA 2YNHB 2VG7A 4A46A 1R8PA 2YNGB 1IF1A 5B1AH 2HVSA 2HAFA 1NSKL 4J90A 1FRJA 4Y2MA 4KE5A 4N8NA 2XPUA 2GGPB 2Y31A 5EYRA 2FVSA 2W2OP 2R7QA 3BM7A 2W2NP 3WG7H 1J5EJ 3TQ1A 4DX5A 3G87A 2BHZA 1S7OA 4Y13A 1LQ1A 3CC2I 4KO0A 2VQFJ 2ME6A 3L9FA 1IRGA 4ZH4F 2CNLB 2OPSB 2QQBA 1GXPA 3HPGA 3TA1A 4EM0B 4UVBA 2WVDA 3T41A 4WK8F 2RQQA 1TZ0A 3QLHB 2CQ3A 3NGUA 1JKRC 4M1KA 3TZYA 1RT2B 5KOXA 1U47A 2CJYB 2V8PA 3RAMA 2W84A 4K4VA 1TQMA 3JREA 2CPYA 3MEEA 3SSQA 4MO7A 4ER8A 1TBXA 3R97A 2M8DB 1JHHA 5ADZA 3HDDA 2NPIA 4R0JA 1HNIB 1F9NA 2X3GA 1N77A 2QVOA 4DSJA 4P10A 1CULB 5I3UA 4IQ4A 2VT3A 1LWFA 2JL9A 2VQFF 1RAGB 3GUDA 3CCTA 2JK3A 4F2SA 2D3O1 4XKWA 4G65A 4YHHJ 3F6VA 1YJWI 3IR6B 1RAHB 4O3QA 3EETA 2IAJA 4DV3J 2DU9A 4ECUA 2XVCA 3NRBA 3Q86A 4LB6B 4NMLA 3WTUC 4BWJA 5GADI 4FF2A 3K57A 2H1YA 3KKFA 2QUFA 2K2PA 1ULRA 2A6OA 3CO7C 4R8HA 2ICWG 1KKHA 5K14A 1RUNA 2W2MP 1XN7A 1R7JA 3I4HX 4UUWA 2QF7A 1HBUB 1LWEA 4LF6F 5LGNA 1FCAA 1HR0J 1RWXB 3KK1B 4KGKA 2XO7A 5E41A 2CIMA 3N79A 3OS1A 3RCOA 3IRRA 3CTAA 3HVTB 1HPZB 3CD7A 2PI0A 3WE3A 1J5YA 4ESJA 5FLXU 2D1HA 2CWKA 3W8PA 2ZITA 4Y3CA 5D5VB 1OIAA 2OIHA 1T9XA 2VKHA 1EETB 4NL5A 4A3EJ 5H9FJ 3WGIA 2OPQA 5AE1A 4RWWA 9RUBA 1SKUB 1CJVB 1D0XA 2TCTA 2DO0A 3KEYA 4ZTJA 1T9UA 4FYVB 3BG3A 4XLEA 4PUSA 2GQCA 2YH0A 3MAAA 3LPEA 4F8RA 3EDPA 1BIAA 3G82A 5DZ7A 4K0KF 1B7YB 2ALZA 4N76A 5EZGA 2HMIA 3MOZA 3E6DA 1HQUA 3H3UA 1FSHA 4AC0A 2DGXA 3Q83A 1LDKB 3BZKA 1HI8A 2BZ2A 4IH6A 5AXNA 2R8JA 1X3UA 5F8JA 1QBJA 1MNDA 4PQAA 2ERRA 1Z3XA 1GFWB 3EPZA 2YTCA 1WHVA 3FQLA 1MBGA 3MM9B 3FEXB 2HFUA 2BR0A 3FCHA 5GPAA 3MPYA 4HHHA 4ZIVA 2D7SA 4JV1A 2E7WA 4HNUA 4MGRA 2ZHOA 3K7RA 2PMZD 2IDEA 4R0EA 3CMES 4YB1P 4M5DB 2VI6A 2XM3A 2EH3A 3WHBA 4FDFA 1ETOA 3UD3P 2VJ5A 2QJ3A 4IVNA 1SMTA 3IMQJ 3QYFA 3L2CA 3I4NJ 1RACB 1HBXG 4A4JA 4H4MA 1HDPA 1ZPVA 3PUBA 5KG2A 3EUHC 1CQMA 1X9SA 4ZVUB 4JB8B 4EBDA 3K17A 2RDIA 4OYOA 2CYYA 2J8AA 9ANTA 3TP2A 5TJJA 2O9LA 1UCRA 1VGYA 2B6AB 3FC9A 3V8KA 4HG2A 2NQPA 4N4OB 4Y3OA 5HLGA 3LSIA 1CBKA 5KFIA 1WJFA 4QIFA 4HPQA 4Q2LA 3HM5A 3VV2B 4QCLA 4F26A 2ZH9A 3PUFA 2G7HA 4Y2AA 2ZVSA 1P1TA 3D28A 1TL4A 2OPQB 3B73A 4C11A 2NVYJ 2D41A 2VPXB 4EATA 1XSXA 3BO2A 1E6VA 4YDDB 1RHRB 3GFIA 3VAFA 3HZEA 3ONQA 4A8XA 2OI2A 2EWHA 2B7CB 2JTVA 3RU0A 3L7UA 1P4XA 4EM2A 3FBNB 1SUQA 3RI4A 2K3IA 1CQNA 1I6JA 1XEZA 1MNMC 1KLNA 3TRGA 2OO4A 2B0LA 3ABLH 1DHMA 3TEDA 4DWIA 1XNQJ 1DP3A 1Q86T 5KFVA 4RGSA 3D0SA 3TJAA 5CYMA 3EVOA 3MR7A 2DNOA 2JWTA 4PGHA 4XQFA 1HKAA 1XPXA 3RPQA 1ULYA 1RB0A 3ROUA 1U8WA 3W8GA 1ZHFA 2EIMH 4CLFA 5IT4A 1USSA 1BC7C 5J4VA 2UXBF 1EJ7L 4A2UA 1WJDA 3Q9VA 4ICLA 2AQEA 2HYIB 4CCLA 2O61A 1W2IA 3DOKA 3D1NI 2J7WA 1SJ4P 2BXZA 3CULA 1JLCB 3VVTA 2VPWB 2CZ9A 4MKBA 2O0YA 4JI5F 2NZ4A 1R31A 2F1FA 1LEOA 5A76A 2GA1A 3D4JA 5FLXY 2HVQA 1SJRA 5FKOA 2VOPA 4H54A 1QUPA 2CUFA 4NLVA 4LSLA 3ITHB 2I6WA 2VKRA 1UAAA 4MEXF 2QA2A 3J7ZT 4G1PA 4DL3A 2A69F 4CHUA 3IM8A 4Y17A 4Q5SF 2MKJA 4K8RA 3DRYA 2MKCA 5LXYA 2AJ0A 2AX0A 4OYBA 3OFGA 4M6YA 2F3JA 4JX6A 2ZH2A 4KKOB 1GMWA 5DM7F 2COBA 3QLHA 1MLAA 4FVMA 5IP9J 3PKMA 2EI5A 4JI3F 3IWXA 5E1WA 3QAHA 3R2DJ 2ZSHB 4DF4A 1R43A 1RESA 2FVRA 4E7ZA 4LF5F 2XNQA 2HFOA 3DC2A 4I4BA 2IBOA 2KYZA 2J7KA 3VYRB 4G7ZF 2FJXA 2VFRA 4EJVA 4ATNA 5LEKA 4DG1B 3G8QA 3BV8A 2EIKH 3U7JA 4YR0A 1GMUA 2ZH5A 4JI1F 3RYRA 4EK2A 1TELA 3TEHB 1C4CA 1FESA 4FF1A 4IQJA 4RW6B 3AFHA 2GJ2A 4LUBA 3QYBA 3MR2A 3H59A 1U78A 4OYPA 1SXLA 4PK4A 3M1VA 2N82B 1H72C 1SFOJ 3R5CA 2GWRA 2CG8A 3CCJI 5FD5A 4I7HA 1MBJA 2XMMA 4D7MA 1KQSR 3HSGA 1C1CA 3TQNA 2RS8A 2YWWA 2CQKA 2OTJS 5CQEA 1R0AB 3FDYA 3ELHA 2XAGA 4IHWA 3CJ5A 1N0VC 3ZQHA 3A3NB 3CCSS 3H8YA 4BS9A 1B1BA 3DI6B 2R4FA 4O3RA 4AIHA 3TZZA 4IRHA 1HLVA 5KFAA 5KVRA 5T7LA 3H0DA 1JI8A 2KVIA 4RMNA 1K0TA 3K4MA 4NCAA 3MEDB 3S17J 2OV7A 4G6QA 2AZ1A 3N01A 2FF4A 3P7NA 5GAHJ 4L9JA 4FX0A 1VQPS 4DUYJ 2XY6A 3TYTA 5IT9Z 2JH3A 4DQPA 2DXDA 3FXMA 4G7HF 3T8TA 1B64A 4LG0B 2WONB 3LANA 1SANA 1S6PA 3PNTA 3NGDA 2XNRA 4OOIA 3OSFA 2OTLI 2GMLA 3FRZA 1STZA 2HI3A 2L41A 1VI7A 3N9UC 2QKLB 2GBYA 1N34F 1EKEA 5FLXK 2EG1A 2QEXS 1N4LA 5LFAA 3K8VA 1K78A 4GRIA 3A3OB 4I67A 1N34J 4GDFA 4IPAA 3RRHA 2HHQA 2UP1A 4ENNA 4WE1A 3F3XA 2ZE2A 1RZMA 2IC3A 2C2ZB 1WJCA 5J1UA 4WK3A 4DJBA 3MM9A 3OJUA 5KFHA 1LWXA 2M9HA 2FVPA 2EXUA 1REVA 1FT9A 3MMCB 2XRLA 1UL3A 4L5IA 4X4PA 2PQ8A 2W85A 2K9LA 3G82B 4V19K 2VZ9A 3T9ZA 4GYIA 3BG9A 4C8KA 1YLXA 1OQ3A 3PHTA 2Y69H 3K5OA 1QSSA 4KISA 4G6DA 1N0UA 2MPUA 1H3DA 4LBHA 4ZITA 4OZ5A 1NKBA 5DGAA 1XMAA 3LAJA 2Y48A 2HHPA 7FDRA 3ZPLA 1HW1A 3M3YJ 5KAKA 4U67Q 2ZMEA 4B9UA 3CZ6A 5ED4A 3DKYA 1Z9CA 3UI3A 1EKRA 2V1NA 4O0IA 1KQ9A 2DA7A 3CLQA 2MQLA 3M2VA 4LK0F 4N8OA 4HTIA 2EIJH 1AW0A 3FMWA 3H5UA 1XGMA 5EWEA 3CCVS 4PDKA 2IJFA 5A2QY 2DGUA 4GGGA 4M71A 2RNGA 1X5OA 2IRYA 3M8QA 3BBFA 2CQ2A 1RWKB 2QCOA 2BW7A 1RKJA 4EEFG 4ANCA 1S6PB 2FVCA 1U2CA 4BL0B 2AYEA 4C3HJ 4C3JJ 2PLYA 1HD1A 4M5HA 3WC2A 4IRDA 1XWLA 1EARA 4ILMA 2Y0SN 2YS9A 3D3CJ 4WFAQ 1DTQB 3GIRA 2Y9YA 2B4OA 4M94A 5CYJA 3WBZA 1JJ4A 2DT7B 5BS6A 3RBXA 3PG9A 3QO9B 3MKLA 3J7YJ 2BABA 2XGQA 2NXNA 1FDBA 5E7OB 4GC7A 4LSNA 4PFOA 5DUIA 2VE8A 2VICA 1SQGA 1MJBA 2G7UA 4KUMA 3DLKB 3GE9A 3HXLA 4I7FA 1F2GA 4PSXA 2GXGA 4ZA1A 3DLLF 3FVYA 3O44A 1JLFB 4OX6A 3I54A 5IWAJ 4RA2A 2D9PA 2Y1LB 2LU2A 3M9NB 3CDBA 3PEJA 2DTRA 1LEBA 1TZLA 5HP1B 1WZ2A 1UZHA 2J0QD 2E2JJ 2KFYA 3ZTSA 1BR1A 2DNLA 1BHNA 3K10A 5KG4A 5KT5A 1T0FA 4CYDA 5GAEJ 2YH1A 4LFAJ 1IBMJ 1E6YA 3VWBA 2OGUA 2HQCA 4GFBA 1Q78A 2X85A 3DRRA 2U1AA 5L3EA 1HHTP 2FYXA 3MM5A 3EDRB 4I2OA 3LA7A 2FMLA 5IXUA 3GLLA 5TGTA 3FXJA 1HNXJ 2QLZA 1VC6A 4XO0A 4IG3B 1C0TA 4QR0A 1YJ9I 2QLXA 2YUSA 1EH8A 4WE1B 2CA9A 1GMWD 1R9TJ 4J9KA 2JJ4D 2RF2B 3OUYB 2WW4A 3HTSB 1VRUA 4KV8A 4U96A 5B0GA 2CUYA 1I27A 4MIMA 1UHMA 1RAJA 5EGOA 2HHUA 3KLEA 1IKYA 4X4UA 5AXLA 3L9ZA 4R8UA 3T5JA 1WEYA 4Y34A 4ZP6A 4PG7A 2PMZA 1C0UA 4F93B 3PM1A 4CM2A 1IVZA 4OLPA 2ROGA 1YJTA 3PO4A 3E5XA 4K4YA 2F4VJ 3SQGB 2L4AA 4J9RA 1TQIA 3CCYA 1TUWA 2L9WA 1V6HA 5JVTA 3MM7B 1LB2A 3OSNA 2VBWA 8AT1B 3CO6C 4JI1J 2FJDB 1OKRA 2DA4A 1PGZA 4QPTA 3ASNH 2M0CA 4KHPJ 1IKWB 4QLCU 5DDRC 3S32A 1SIZA 5L3FA 5A2QK 1GX5A 2MH9A 4ECYA 3ILIA 2EW9A 2VFUA 4G1QA 2XLIA 4HW0A 2M70A 4W98A 3QO9A 3I0RA 3THTA 2ZVIA 1O3RA 5CVIA 3T1YJ 4U7UK 1QPMA 1N36F 2M4KA 1Z1ZA 3PX4A 4WZQA 2GOXB 2XYHB 1CJTB 3JSYA 3TOBA 4NYZA 5CXTA 3R0JA 2DD8S 4ZDOA 1OS5A 3OVAA 5D5XB 5K8MA 1PC5A 4CLUA 1DBDA 3Q0VA 3TO7A 4Z6YA 3VAKA 5F6FA 2BEOA 1UWAA 4DCPB 4TNOA 4PXEA 3CCLI 5KG0A 2BM1A 4CYCB 5M3MJ 1WTBA 1UMQA 3U1KA 1S6QB 1BR4A 2HZTA 2CJAA 1YI2S 5D4RA 5J47A 3JQJA 4DL4A 1V5FA 4O0NA 1J2XA 1C0WA 4OJ1A 1VC5A 2DEJA 4HR2A 2KFDA 1E3HA 3F72A 2QBYA 2OPPA 4ZJLA 2V8DA 4A69C 2HZDA 1WC3A 2IFXA 5KFOA 1QHGA 2KYXA 2VPYB 3V2UC 2CGPA 2I38A 4KJIA 2DCUB 3SXYA 3C15B 3NEKA 2FVQA 3OOUA 4KMFA 1JKQC 1X19A 3PYFA 4LF8F 1HYSB 2HFVA 4J9UE 1K4TA 4X64F 2HQDA 2GX8A 1SAXA 1CF7A 5FGMA 3M8PA 4D7NA 2ZKTA 3PFYA 1YGYA 1MN7A 2JRSA 1IW7F 2EFOA 2BV6A 1NSPA 4EBEA 1HNZJ 4DR7F 1RNLA 4UQGA 5B66C 2EZKA 4P6QA 1DGWY 3FF5A 5FKNA 3FXUA 1JLBA 5E3MA 4ED2A 4CI0B 3FK7A 4NXNJ 2DODA 3KMSA 3PFIA 5CQGA 4DR3J 4XAKA 1F3VA 3SIPB 2NXNB 4LF1A 2UV8G 1SFEA 3B8HA 2XV4S 2W9CB 1DU6A 2ME0A 1H2UX 1KA8A 1YJNI 1BGXT 3TX8A 4KT6A 2ZKUA 4GVBA 3WX4A 2XAHA 2HHTA 2VL1A 1DGRM 1G4DA 4C98A 2F2EA 3LQVA 1MU2B 2E7VA 4F36A 1X0FA 1JJ8C 4FNIA 2AW0A 4Y15A 4ES3A 2ECBA 3F22A 4NLRA 4AE5A 5FROA 3CDIA 3UNYA 1CGPA 3JRAA 1NK8A 1M5OC 3PW2A 1W2BR 4X65J 4PRFA 4JI8F 3UDCA 1TUVA 1O7FA 2EFWA 1FX7A 3HSEA 4X4QA 4Z2YA 5LJ3Y 2I0XA 3CT9A 4KH0B 2EFGA 2FHJD 1K8AT 2UUCJ 3ENVA 4Z2XA 4PWDB 4HF1A 2OCCH 3DBLB 2JN6A 3MCZA 4RNNA 2GO8A 1RWPB 3PNVA 3IKVA 5JR3A 4C48A 1S0OA 2DFHA 4AWXB 5ETKA 1WI9A 2WW8A 4HTJA 1K6OA 4B3OA 2IBDA 2DGOA 3CEDA 1P8GA 4MK8A 4RU2A 3LP1A 4ZC3A 4CO1A 5DM7Q 2H3EB 2LU1A 4NLGA 3K1MA 4O4RA 4ZMMA 1KWMA 5B3SH 2X51A 1UETA 3AY0A 1TQPA 1JLAB 2WV0A 2XF6A 2DNYA 2JX2A 5IOYA 2AYBA 1D3WA 3FXKA 2I8EA 3AODA 1W0TA 3GW2A 1RUSA 1GT0C 1HHSA 2QRRA 2Q3PA 3Q0AA 1DPUA 4HNTA 4D5CA 4H4KA 4J9MA 2E1RA 3OOPA 4C6AA 3H25A 3OYMA 2P4WA 4EEYA 2DMNA 1N25A 1X2NA 3P9CA 1Y6IA 3D5RC 3DBRB 1S9HA 3AQOA 4BY7J 3PQKA 3WGHA 1S1VB 2VJIA 1KYWA 4HH1A 2PFBA 4RM2A 4A3CJ 3CVKA 1YJRA 3JRFA 4LF8J 3OR2B 2ZCWA 1SL1A 1V4RA 3CMYA 1FO1A 1N75A 3ILLA 1U0JA 2FSWA 1WKKA 2YXLA 4HLXA 4PYDA 4L0YB 2XYPB 1QY7A 1CC8A 1RT5A 3KNGA 6FD1A 2QZ8A 1QAIA 5FKMA 4TY8A 5IZHA 5LT5A 3Q8QB 3KUHA 3KG4A 2HDCA 1A36A 2E1AA 1RR7A 4XORA 1R4MB 2R7ZJ 3CLOA 2QQAA 1JXVA 3AAFA 1KN6A 4L5JA 2EFNA 1N6QB 1NK6A 1OQYA 2YU9J 3M6XA 4OHVA 4L72B 2PFFB 4UHTA 2RKHA 1DTTA 4FPRA 2EK1A 3T5LA 3TAMB 1CJKA 3GWZA 4ZYEA 2JVOA 3JAMY 4IRIA 1GTHA 2V63A 2NUUG 4XICA 2BX6A 1N36J 2NVQJ 2E7XA 3U2RA 3ZR8X 2LKPA 3UE2A 2FZKB 5K14B 4ECWA 2E5LF 3DRXA 2OAUA 3GVAA 2RSQA 4PSWA 2LEBA 3KFWX 2JMWA 2VV5A 3T19A 4B02A 4XLPF 3VTIA 1HBOB 4OWRB 1UA0A 2BE5F 1J5EF 4BQAA 1VQ8I 3MD2A 4O4GA 4IX7A 5J2PA 1D0YA 2M3AA 4C11B 2M8EA 2LYVA 3H0GJ 3G71I 3G9CA 1UEVA 4R79A 1DARA 2HHXA 1APLC 2W7OA 5ETVA 5IS2A 2DMQA 4BJTA 4LRFA 1P6RA 1HW5A 1H98A 2UUBJ 3S16J 4F25A 3M6UA 4YDXA 1IGNA 5DGBA 1ZM9A 3T1AA 2ZBQA 4NB5A 4A3MJ 2CADA 2MLYA 4A3FJ 3B4MA 4USUA 3MEEB 4OINF 4S0HB 3ELKA 1S1TB 1PUEE 5LJ5Y 1VNDA 3E6BA 3G8SA 2W9BA 4DV4J 1NHUA 4BCAA 2MBFA 4XSZF 4ABZA 3BTCA 3RKQA 2YQ1A 1U1LA 1K9MT 4M72A 2VQHA 3ZQFA 2ALYB 1VQKS 4EQQA 4OHWA 4QIWN 4P71A 4M3EA 5KFLA 4ZJQA 1YO5C 3KLEB 3HIFA 3OL8A 1MD0A 2J9DA 4DQQA 4U0YA 1PC4A 3GFZA 3NAIA 3K70D 2NS0A 1KU3A 3VDXA 2HBYB 1F1ZA 1UPMB 3PYGA 1ZTRA 2DA2A 3ISZA 2OPPB 4FXVA 5KT2A 2Z16A 3VR1A 2QFIA 4GKKF 4II3A 5KFTA 2PO4A 1F5BA 1XDSA 5C5JA 2VUMJ 1TL3B 5FFXA 3OR1C 4RB2C 4C9DA 1HARA 1T6SA 4C3KA 3IBFB 1RJJA 1JGSA 1SAUA 1Q5YA 3BH7B 3GZ5A 1S9GA 5J2NB 1RAOA 2JEFA 1FBUA 1SPBP 4H4KC 1JX4A 3KLFA 1WWHA 3QJPA 1V3SA 3C16A 3GX4X 3IS9A 4NUBA 4B3OB 2Q2EA 1IN4A 1OISA 3SHFA 3CJ0A 3TA0A 4IHVA 2NYHA 3QP5A 1IV6A 3JAMK 3KPHA 3MECA 2I5UA 4U8VA 2E36A 1Q5VA 5J40A 1I3AA 4ED7A 4ETZA 1YHQS 3A8JA 3V5RA 2VJ4A 1FFWB 1U6BA 3BQZA 2GW8A 4KGZB 1HI0P 1RYSA 2BEFA 3ZCOA 3CTRA 3OL6A 4MQ9F 2X1FA 3VAJA 3ISNC 1NPKA 3ZMZA 3GTQJ 3PVXA 1RADB 2KJBA 2OLWA 2XULA 4UTGA 5ILVA 4I2PB 4B3AA 4YUDA 2VOOA 4HI2A 4ZDNA 5LHGA 3AOAA 1PAEX 3R60A 3WTXC 5B0EA 1Y8RB 1X4BA 2R5YB 4DQRA 3KJQB