1KONA

Crystal structure of e.coli yebc
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
244
structure length
233
Chain Sequence
GHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLDANPRLRAAVDKALSNNMTRDTLNRAIARGANMETIIYEGYGPGGTAIMIECLSDNRNRTVAEVRHAFSKCGGNLGTDGSVAYLFSKKGVISFEKGDEDTIMEAALEAGAEDVVTYDDGAIDVYTAWEEMGKVRDALEAAGLKADSAEVSMIPSTKADMDAETAPKLMRLIDMLEDCDDVQEVYHNGEISDEVAATL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title UNPUBLISHED
rcsb
source organism Escherichia coli
molecule tags Unknown function
molecule keywords Protein yebC
total genus 63
structure length 233
sequence length 244
ec nomenclature
pdb deposition date 2001-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01709 Transcrip_reg Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1konA01
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1konA02
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1konA03
1LFPA 1WJCA 1MW7A 1WJEA 1K6YA 1WJDA 3HPGA 1E0EA 1KONA 3HPHA 1WJBA 4F3QA 1WJFA 1WJAA 3F9KA
chains in the Genus database with same CATH superfamily
2HYIB 1CGPA 4LLLA 2WBRA 4KRWA 1SJFA 5IT9K 3HFKA 5BYRA 1OCZH 3RIRA 4ZPBA 1LFWA 3TEGA 1SCJB 3NWRA 4O44B 3COAC 1V3FA 3E6CC 4ILLA 4NCGB 4K0KJ 4YG2F 3T5LA 3KP6A 1ZZFA 3PEHA 4NZ6A 3HVRA 2H5JB 2XF7A 4USHA 3OSGA 2ADUA 2RVJA 5F8NA 1S6PA 5BR8F 1T39A 2H65B 3TNVA 3KUHA 4M63A 1WTFA 4ECSA 1VQOI 3I32A 1N52B 4FPIA 4FX4A 4KY3A 1FWKA 2B4PA 1B4AA 1FJEB 3PZPA 5B5EC 1R36A 5IT9U 3P7NA 2IPQX 3M9AA 3GB0A 3W9HA 4CT9A 5A6PA 1E3HA 3PFEA 4WCEQ 4HH0A 3DP7A 1KLNA 1X8DA 1IBKF 1RHKB 3OIOA 3JYTB 1UVNA 4M5KA 1SD7A 2ZKTA 3GUDA 4N8NA 4ZIVA 3OT9A 4F4WA 1A6LA 3Q8SB 3GQCA 4RU9A 4FETA 2CFXA 2W2QP 2E1RA 2Y1LB 2YS9A 3QAEA 3I53A 4ZLPA 2V1XA 2X1EA 3TW0A 1T98A 4C8YA 2CUZA 3KHGA 1SVOA 2HEOA 3JCUC 2BKNA 3DLGB 1WC3A 1O7FA 2VG7A 3DNCA 3TI0A 4E7IA 2ZC2A 2E29A 2UZKA 2RDDA 2KKHA 2OPPA 1FBSA 1YW9A 3C19A 1S1XB 3MMCB 1VF9A 2R2TA 5EJCA 3TW6A 5M2PA 3PQKA 2HOSA 1WI9A 2CPYA 1VBXA 2Q1ZB 3RBZA 3L7OA 1U3EM 2BKPA 3QATA 4JV5J 3HL2A 1SC7A 1OY6A 5EZGA 3OL6A 3RBXA 5D15A 1VQ4S 4RNOA 1D0ZA 2QQ8A 2Z5UA 2MH2A 3K69A 5EN1A 1WKMA 2QKLB 4USIA 3EDRB 1TWGJ 5F27A 2OAUA 4IDKA 4KFCA 2EFVA 1Z0XA 3MD3A 3OL3A 3L9FA 4ECTA 4WFYA 3GZ6A 2RREA 3OR1B 2YKNA 2FE3A 3K1MA 3R7BB 4OU0A 1FFGB 3ECOA 3QLHA 4LF7F 5ETSA 4P6QA 1YQAA 2JSPA 2JHEA 1SFUA 3VQSA 1S6QB 2QENA 1E6VB 3ELKA 2PMZN 4ZK7M 2ZZMA 3SCJE 2PT0A 3KK1B 2J9DE 5FJ4A 1IXSB 1SC6A 2OJED 4LRDA 1WH5A 3LOUA 4M5HA 3CVKA 1WJEA 2L7KA 1VQPI 1M1GA 4DZJA 3E5XA 1QA6A 2GXAA 2LDYA 3C16B 2FHOB 4PSWA 5IT4A 2KHCA 1G1XA 1NAQA 2BVMA 4V1Ak 1BL0A 3NS7B 2QWWA 5F8LA 2NLWA 4GC7A 1S48A 2G2OA 5I42B 4LF9J 5LEKA 4YDXA 3H5XA 2CNOB 1TV6B 2OHDA 4MIWA 2OPPB 4HYKA 5FROA 1S76D 3P5BP 3NRBA 1Y56A 1OR7A 1UW9A 5A8RA 4HKQA 1QHGA 2DTJA 1YE9A 1LB2A 2XB0X 3CO6C 1S9EA 3WTYC 3CMAI 3SXLA 5E3QA 1OQ6A 1MSEC 5C2CA 4M3DA 3UQSA 5D5WB 1HC8A 4KMUX 4K2XA 1ZA2B 4O3RA 3VAFA 5KFXA 1HMVB 2BQUA 1FWLA 2MSSA 1WOSA 4LF1A 3WG7H 1JLQA 3QJPA 3X1LB 1DQ8A 3MPYA 3E3XA 4U96A 3VB2A 3M8PB 2JEFA 1SL2A 4P10A 4UV8A 3FBNB 5J8CA 2LF8A 1RT1A 5CCLA 3JRHA 4S0HB 1DPRA 3GMGA 2JLGA 4JI0J 4UOFA 1CLFA 3GO5A 4RO0A 1ROFA 3QU3A 1PJ7A 4KYZA 3FM5A 1XNRJ 1TL7A 1LVKA 1VGYA 4A0ZA 3CC2S 3W2WA 2YU3A 1S1WA 4ZYAA 3W9JA 2QN6B 1P7IA 1SJRA 3TJAA 3G1MA 3KZIC 1QAXA 1HKQA 4O0NA 1U25A 4BH9A 2H1KA 1MBEA 2V4JC 1RT5A 3QOPA 4G94A 4HI1A 3HTUA 5HODA 1BUXA 5CVRA 2L9VA 5ILUA 3GJRB 5EWFA 3DI6B 2MEWA 4IH6A 4WU2A 3PR4A 3MKYB 4CQ1A 1FBQA 3RYRA 3TYTA 4N47A 1N0UA 4M5DB 4ES1A 2LY1A 2X6OA 3LSMA 3EPGA 1LWXA 1AZSA 2DNLA 2LBFB 1QLNA 1RCXB 2HQRA 4CZZA 2DFHA 1ZGWA 2XRNA 1VHFA 4WFZA 2NYXA 1VQOS 2CUJA 1NH3A 3M8WA 3PR5B 5GADI 1T0FA 3EZ5A 1HYSB 2M87A 1NKEA 2OI2A 3N5BA 1VRTA 2ZH2A 2O3FA 4F4XA 1WC1A 1OYYA 3LSPA 2KP6A 2W7AA 4Y00A 1J5EJ 3MPWA 1L3VA 5EGOB 2HRUA 4JI0F 2EK6A 3PW5A 2UUBF 3AFHA 2HHPA 1EKSA 4QPXA 2R2RA 3HZJA 4RNHA 3VOEA 2CWKA 3GTGJ 2CZ4A 2XMVA 1P2FA 3KLHB 2P7VB 2IIHA 4M3BA 3DOLB 1JGSA 3OYAA 2GMJA 2XI2A 4EBCA 1WC5A 4DUZJ 1LXNA 2HFOA 5KFEA 1G2EA 2YR2A 5LT5A 3GPAA 2XM3A 4LB6B 1ZG1A 5CYJA 1TC3C 3FCHA 3JRFA 4PJMA 2V2VA 3N97A 4EQQA 3D9BA 2X1FA 1RT5B 1ZTRA 1U6ZA 4J9RA 3UDVA 2WAEA 2ZVSA 2U2FA 3SCKE 1ZHFA 4IHSA 3HGGA 1SD4A 1C1BB 3RR7A 3W2AA 4JI3F 3MVPA 5H9FJ 2LKSA 1NEEA 4UNOA 2QE5A 3LFKA 2VB6A 4LVNP 1T0TV 2R5YA 5IT9Y 3CCSI 2BX6A 1VIOA 1HMVA 3A8EA 1UWBB 4GFBA 1WJDA 4NUBA 3VYUB 4XOTA 3CF2A 4M5JA 2HBYB 2KU7A 2OSQA 1RYRA 3R2DJ 2BY3A 4IRCA 3HHKA 2O9LA 3SJMA 1PYSB 3PJ9A 2ZWOA 5JXSA 2FX0A 2DNNA 1AWCA 4DV4F 3F6VA 1GUUA 1KRPA 1QZZA 4XLPF 2RKIA 4DV3F 5BJRA 3BOQA 5L1LA 2IPOB 4ZDLA 2W8KA 4PGGA 1PAUB 3M8QB 4R8UA 3H9GA 2EZLA 3ZZOA 2FDNA 2LKZA 4DGWB 1QJHA 2N7YA 4TQRA 4EM2A 3O2PE 4B44A 1VQLI 4JI8J 1HWJA 3AG1H 3CIMA 3BV8A 3KNGA 2B9XA 3JRDA 3FBCA 1ON2A 2IBKA 2HQ5A 4L9TA 4C11A 2H1LA 4F0KA 2ZXIA 2IA1A 1JLEB 2VHGA 4GXOA 4HW0A 3FRYA 3KYDB 5GAGU 1FP1D 4KE5A 4A5MA 1N5TA 3Q8QB 5M5WJ 1PSDA 1HNZF 2UWMA 4CO1A 4KIAA 4RB3C 2W48A 1IKYA 3JRBA 1Q79A 4A48A 2MW8A 2WZ1A 2LVWA 1NHUA 4OFZA 1W4MA 4URQU 1UG0A 2WTFA 1RT1B 1FIPA 4HHHA 2DT5A 2FQ4A 2AJ2A 4RW8B 4DV0F 3DOMB 5C3EJ 5THWA 4JBAA 4XKVA 3PDNA 4ZVOB 3MM7B 2I6WA 2ZJQQ 2FJBB 3QO9B 3GV8B 4C2MA 5GPAA 1UAAA 5E18F 3EETA 3ZQFA 3M7GA 2YNHB 1Y8RB 4LF9F 1VQ9S 1UKUA 5CVUA 1ZS6A 2UUAJ 4CCJA 4YP3A 2YVSA 3T19A 3T0YA 1LV5A 3PIOQ 1SVDA 2X7IA 2E5NA 1CQTA 1VQYA 2CA9A 4QBUA 2D74B 4A3GJ 5ERIA 3MM8A 3R1LA 3RRKA 2G0CA 1UHWA 5F3ZA 4A3EJ 1MMSA 2HWVA 3HHGA 1E6YA 3W6JB 4G65A 4Y13A 3PV8A 1UHMA 2Z30B 3KUEA 4M9ZA 4A3JJ 5DDOC 5AXMA 1LPQA 4WYWA 3RB6A 3BR8A 2VJUA 2ZBCA 2VJIA 3THTA 4LSLB 3WGIA 1FPQA 1IJFB 1RAIB 4O3OA 3C2BA 4CH7A 4RW4A 2A6EF 4ZLLA 5DJBA 4QZVB 1W1WE 2K85A 4C8MA 2ID3A 2MJUA 4RA2A 2A61A 2FSWA 4L3NA 2A10A 1B3TA 5IYCJ 2LVSA 3W65A 1O5JA 3CCJS 1UELB 4RW6B 1BI2A 1R00A 3CO0P 4PZJA 2W84A 1O3QA 2E2HJ 2XDVA 3SDBA 3D5MA 1X9MA 2XRLA 3DLLQ 4KFBA 4CTAA 3I5UA 4X6AJ 3BTIA 1T9UA 2KZMA 3TQNA 2EFPA 4MJKA 4IOBA 3H5NA 1ACMB 2HNZB 4EMDA 2Q2EA 3BG6A 4CICA 4BS2A 2AEJA 1J5OA 1LW2A 3R60A 1ZM9A 3CLQA 2Y9YA 1Z7UA 4DFJA 1VQ7I 4K0KF 3U1KA 2AQ4A 5KFBA 3BB5A 2VPYB 2OCCH 2OTLS 3BJAA 1VBZA 4E7LA 4BYYA 2XC7A 3M6VA 5BQTA 5BR8J 3DBLB 1IUYA 4ICLB 1XMBA 4DFKA 1U6GA 2F4FA 1HBMB 1RTHA 1IM4A 4ED3A 3MM9A 1EA3A 2JT1A 2FBHA 2ZM6F 4YDDB 1UVIA 3BYRA 4PG8A 1VRTB 1HBXG 1VBKA 3LAKA 4CDGA 1JLEA 2Y1JA 2G1DA 3JW4A 1QDUB 2MQPA 4GO7X 3TVZA 3QT6A 5M3MJ 5F8HA 1IN4A 1YFHA 4ZIWA 1HNVB 1RTDB 4DPXA 3OWTA 4J9QA 4EGZA 3I4MJ 4HEA9 3TWZA 2A6MA 1GX5A 4OYPA 3J7AN 2WSCC 4L75A 3Q5FA 3CMEI 1YJ9I 2IBOA 1YJ7A 2AYEA 5HS8A 1I50J 3BG5A 3OL7A 3J7Z5 3BGRB 3TARA 2EI5A 4ON0A 3GILA 3CCRI 1F9EB 3GMEA 2DR8A 4BQAA 1WSVA 2KJCA 3O44A 4F0MA 3RPQA 3R6GB 4EMSA 5KFMA 3SDEB 4PWDB 1XR7A 3CDWA 4XOPA 1DLOA 3DLBA 4LBHA 4UOGA 2MBFA 2HFSA 1U0HA 3U1LA 4A12A 4M73A 3K58A 2D41A 4HRIA 2KT3A 5GAGJ 3CGIA 1AROP 1K0TA 2KL4A 2GO9A 3WTTC 3OL4A 1N5YB 1L5UA 1MSWD 4RW7B 1IJEB 1OYEA 3FBIB 4FF4A 4UUSA 2CW8A 2SXLA 2YWWA 2J7WA 1KHWA 5J1UA 3IHUA 3CNQP 2H3EB 2E2JJ 4DU8A 4LIVA 4HDVA 4O3NA 2NOGA 1NTCA 2VC0A 1NK9A 1XJWB 3UD4P 2HQNA 3SQGB 4AC0A 2AQFA 2LLKA 3KDOA 2E5GA 4TXSA 2E60A 3DGPA 3DRPB 2FJXA 2LCWA 4RBOA 3S3OA 4PZVA 1XQIA 4M72A 1LQ9A 4G6TB 2BJ1A 4JV1A 3QMQA 1A7GE 4C9YA 3IWXA 1S7HA 1WORA 1P8GA 3BR9A 2Z56B 4FE7A 1S7EA 3AG4H 1EQ0A 5DZ7A 1RWOB 1YW7A 2HWHA 2M8GX 3VF0B 4B08A 2CJ9A 2PQ8A 2MH9A 4LSLA 2DYRH 4M9XA 2EJRA 3LH2S 4IF4A 2W1BA 2ZB9A 3MD1A 5IC4B 1CJUA 1OCCH 1QUPA 2HFHA 1T3NA 2BE2B 2K1RB 5KG3A 4F26A 2LR8A 3L09A 1NXIA 3CXCR 4CGZA 4OIPF 1TAQA 4DQPA 1L3TA 1U48A 1ERDA 1SH0A 4IXAA 3ZMUA 1RC9A 5B0AA 1GLNA 3GE9A 4Q4ZF 1T9YA 2BEFA 2GZOA 2VIXA 2CYYA 3J7AO 4CO4A 2PSZA 5GAEI 1X5TA 1EZZB 4LR9A 2NCKL 4DJAA 4LMYA 5CVVA 1FX4A 3T9ZA 2ID6A 2CKWA 5K5MA 2RGVA 2CRLA 3QYEA 2YNIB 5J8FA 1RCOB 1LEAA 5LMNF 1XPXA 4Y52J 2DCUB 4DR2J 4RW7A 1K78A 3HUGB 1Q5YA 1RHUB 2F63A 4ED5A 1S1XA 4XKBA 1YJWS 4YUDA 5GAHJ 1RWPB 2YQ3A 2QKMB 3O6QA 3FBFA 3PL8A 4KGKA 1PUFA 2BUNA 1ZARA 2HFZA 4Z2YA 4I56A 2RNJA 1Q95G 5LSOA 2EZHA 1SV5A 3KMQA 5A0YA 3LP2A 2XGXA 3M8SA 4FYYB 2DOEA 2DPIA 4KFBB 2Z4PA 1U5TB 2IT0A 4Y17A 4I4BA 1KLMB 2QQAA 4FVCA 2H5IB 3KLGA 3OXGA 3MKLA 4Q47A 3NAUA 3S8SA 2E1MC 4IRHA 3A8KA 1HI0P 2ZUGA 2LQ5A 2HU9A 3BDEA 1RWWB 1XGMA 4GYGA 3K70D 2YNGB 1R6YA 1JLFA 3QNWB 3SDEA 1R8BA 2Y9ZA 3ITHB 4PPZA 2X4HA 3TZWA 1ZA1B 4E0DA 4DSKA 2LTPA 5G0RA 3DLEA 2A1BA 8RUCA 1G3OA 4AVZA 2DT6A 5GMKa 1DUXC 1Q82T 4PJJA 3A0HC 4O4GA 2ZZTA 4K5SA 3EXYA 1HA8A 4IFYA 2RF2A 4XSXF 4M1KA 3QIDA 2RKHA 3CLOA 2KDOA 4DL6A 2VPLA 3M1CA 5B3SH 2DN0A 3FXMA 4EWTA 5IT3A 5FFZA 1OLTA 4LR7A 5F08A 4DUZF 3M32B 4LRCA 2KJBA 2A6HF 2XF6A 4BWJA 5HVGA 2CDRB 5F8IA 1IXKA 1R8HA 3MCZA 2CDQA 1BD6A 3FXOA 2HQIA 2KB2A 3KP2A 2VJVA 3O6BB 1V5FA 4DFPA 2V9VA 5KFIA 1APSA 3K8VA 4ZVQB 2FB0A 2NS0A 4UB8C 2O61A 1OISA 4UOHA 4NLWA 1U0JA 3MD2A 2HMIA 1SC4B 1MD0A 2M4MA 4DR4J 5HLTA 3IXQA 3BTJA 5D0RA 4NLQA 2O5RA 1A35A 4A46A 1JQGA 5LGNA 2IRXA 1U09A 4QR0A 1CPZA 2V9WA 4DSIA 2M9HA 4ZLNA 3CJRA 2DHHA 2RDPA 4AIHA 4BCAA 4TU7A 4CLTA 2OTJS 1FWZA 1JNZB 2PEHA 3RQIA 4HH1A 2BE2A 4WXOA 3G96A 1IBLJ 3UNYA 3CDHA 5KOWA 1A6IA 1OWXA 1TNTA 1PAEX 4I64A 1UFMA 1M5VC 2AP6A 4BJTA 2B6AB 3M4XA 1FE0A 3FDSA 4JI7J 2EIKH 2FTRA 4DPOA 2ZXWH 1HNIA 3GTMJ 2Z2ZA 3E5UA 3CUQA 4J9UE 3OJSA 3JTGA 2M5WA 1XGOA 2BW3B 4FS2A 5CVIA 1RAHB 4GVLA 2OU2A 2K27A 4X84A 1H9TA 2D2WA 5KFVA 1JIHA 2DIUA 2RH3A 3EGWB 3M2VB 5T7LB 4OQJA 1J27A 3TDUC 1YYVA 4MKVA 2W9BA 3CCWA 3H7HB 3M07A 4F55A 3ERED 4M9SA 1S7IA 3IFEA 2J6UA 4DR4F 2L9NA 4AXIA 2M88A 4A2UA 4L9JA 5FLVA 3NGDA 2DXFA 2CXEA 4PK4A 5D6FA 1ZM3A 2DPUA 1ZR4A 2AJ1A 2OV7A 2ZITA 3FGVA 2QQBA 1IUJA 3SSSA 4HF0A 3OS0A 2DDAA 3SIPB 4IX7A 4O6JA 3IRXB 2NNNA 1YZ7A 4CCMA 1RHJB 3LSJA 3OR2B 1S8NA 2Z9OA 1HKSA 1LWCA 4BL0B 2F9DA 2DGUA 3UR3C 3E6BA 1CF7B 2HNYB 2NZ4A 2L7MP 4UV9A 1SVMA 2XGDA 1YO5C 4ALZA 2VG5B 4ZVEA 3ZZPA 3HOVJ 4ED8A 2LXIA 2IGMA 4BDZA 5A2QU 3QPHA 2CQGA 2C3PA 4OHWA 1SV5B 2OZ6A 4HSTA 4M6YA 3K7RA 3GYHX 3V6DB 4ZTJA 2ZJPQ 4DR3F 1QPMA 2FXAA 2P2CB 4XICA 2XQCA 3CTRA 1D0XA 2ZEJA 3T1AA 1XSDA 5JVGF 1D1UA 1H2TZ 4OZLA 1HIYA 2D1HA 4I2QB 3M8QA 4DW6A 2HYGD 4IOCF 2JVGA 4KQZA 1BHNA 5FDLA 2WW4A 1MROA 3D6FB 2FHKA 2EV6A 2B3TB 1C0TA 2JOQA 3FXKA 4OZNA 1WTBA 3DFGA 5K14A 3ZOBA 2DMPA 1BC7C 4LG0B 1LXJA 1NDKA 3GIMA 1UJ5A 3FXRA 3RZDJ 1V3RA 3SV4A 2LF7A 3DLAA 2FVPA 3AT1B 2FZKB 1ZGJA 1X19A 1P4XA 2MB0B 4QPTA 2WSEC 1KOHA 1ULYA 2KM8B 4IG3A 3C2HA 4FXWA 1GEHA 3SCIE 2QSFA 3A12A 5ETOA 2Z1DA 2R42A 4J9SA 5IYBJ 5C42B 4BY7J 1BA5A 2IXSA 1UFLA 1UTAA 2XY5A 1WVRA 2DTZA 4AUKA 2ZKZA 3NBPA 2M2BA 4NL5A 2DHXA 1N54B 2Z2YB 1JNRB 1R7IA 2KVIA 3CO9A 1YBTA 3LUYA 1S7OA 3W6VA 3IBWA 4ZJLA 3M9MB 3KK2B 1RB0A 1MH3A 2P9CA 4ANCA 4LIRA 4WZMA 2RNGA 3C7JA 4C2TA 2VXDA 2WOMB 4BEHA 3T5HA 1U2FA 2UVRA 1FTRA 1LDKB 3UD5A 1B64A 2F4VJ 5A8WB 5E1XA 3CDUA 3PO5A 3DDNA 2LYVA 1OSCA 1HHQA 4G7HF 2B4UA 2YNFA 3LNQA 1ZAVA 2WRMA 4YFNF 2KFDA 1ZH5A 3NS5A 2AHQA 2ASYA 3WGHA 2GIRA 4EO6A 3PIPQ 3AJDA 2PJRB 4OHXA 1POGA 4L9NA 1JKRC 4HX7A 4DYQA 5TJJA 1W2BR 1ZBTA 3MURP 2QA4I 2CQKA 2IS2A 4XDDA 3QGIA 4FPRA 1JJ8C 2CQ7A 1EQMA 3DLGA 4OX6A 1RI7A 2ZOGA 1WHVA 3F41A 1OCPA 4HDGA 4BKXA 1ZG3A 2JUGA 2QMXA 1RJJA 2FPHX 4HQMA 3QBCA 1UA1A 4CCOA 2L9RA 1JWWA 3VZHA 4QYZK 4AXJA 2XLJA 2WB1N 3GG1A 4X4OA 4B4CA 1KTVA 5I42A 4E70A 3AD8C 1OPCA 3MWMA 3BBBA 3LA0A 4O5VA 2RNEA 2B7BB 4NBQA 1S0OA 1U4BA 4JV0A 3HFZB 4DSFA 1HSTA 4FQGA 4WKYA 4DLGA 1XTAA 4E6KG 3OR1A 3D4JA 2Z2LA 2HR3A 3MM8B 2RJZA 4LFBJ 1P92A 3MEXA 2W00A 1R1UA 1R0CB 4I09A 1VQ7S 4K8RA 3ET6B 3LAPA 2HEKA 5LBQA 4RUAA 1MNMC 5DTDA 2W82A 3LA2A 3QODA 4EJTA 2B4OA 3BDPA 1K8AT 2C2EA 2FUG2 2CPJA 3AL0B 4LRAA 2RQQA 3S32A 4MNUA 2MHNA 3I0RA 3N0VA 1BC8C 4OYOA 2AQEA 4NCGA 2OFHX 2FLNA 5B1AH 4Y2AA 1FTZA 4OIXA 2UUAF 1SKSA 3H2UB 1SQGA 1ZTWA 1HDDC 1VQMI 2PJPA 3O8WA 3EVOA 3DGVA 3FSIA 3VSLA 3N5FA 4B1RA 3PM9A 4PG6A 2KRFA 3BGOP 2ZHOA 1K7AA 4WPAA 4M3FA 5F9NA 4MTDA 1HNWJ 1TQIA 1RZMA 3WU0A 2ACMA 1L3UA 2L9DA 4X65F 3A2KA 5FLXY 1MJBA 2JWNA 2VZ9A 3DKDA 2P8TA 3CZ6A 4RUHA 4AU7A 3P9CA 2KXHA 2IC3A 1IN6A 1XNQJ 2PD1A 4GKKJ 2KRBA 3I0TA 2R7DA 2LRDA 3D66A 3H98A 3S01A 5LJ5Y 3A13A 1OCTC 3R6LB 1LEOA 1HKAA 4IRIA 3Q8UA 4KC5A 2LP0A 2PC6A 2LY9A 3KDNA 4Z7YA 1S9EB 3MZHA 4JP8A 3VPRA 2DXEA 4U7BA 2L02A 1S9GB 4I7HA 2RDIA 1S0MA 9ANTA 4G6DA 3AOBA 1FC3A 1FRHA 4B3TJ 3GIRA 2HVQA 2UUWA 1JKOC 1XNRF 3KLEB 3BH7B 1FE4A 3V7SA 4DPTA 2Y3YA 2ISZA 2UXBJ 1MN7A 4ZYEA 2Q79A 1RTIB 1TL8A 2H51B 2E35A 2ACYA 1FOXA 3ENQA 4XRFA 4AFFA 2VPXB 2BV3A 3ENWA 1IBCB 4IL6C 1J5YA 1IQTA 2Z57B 4LRBA 1R23A 1OIAA 3TBIA 2FA5A 1XGNA 3AOCA 3CJQB 2X1DA 3FQKA 4OLOA 4K2EA 1HW5A 2Q43A 3DCFA 1R27B 1RU2A 4LSZB 1QRYA 3KG4A 3MEDB 1OQYA 1HNXF 3MUVP 5HQ8A 3UN3A 5J2PA 2FD2A 3GCMA 1GK8A 2DRDA 3WGGA 2I1RA 1YJVA 2FBIA 1T08B 2DYSH 4JP0A 1BI1A 2O6GE 4A93J 1K44A 1GT8A 4EZ9A 1RWUA 2V5HG 1KYZA 1FESA 1HBOB 2HKXA 2DH8A 1B0PA 1Y5IB 3WIUA 1F43A 1F3VA 2FVCA 2LQ9A 1KVJA 1G8XA 4A3FJ 6AT1B 4LQ9A 2IM0A 2QTWA 1G6NA 1SAUA 3DPLC 2H94A 3A1YA 2HURA 3CCVS 2XKOA 3N28A 4ZPDA 3GW2A 2ZJQF 4P2MA 3QIPA 1CJTA 1APLC 2G9WA 1W7WA 1ETWA 1Q0NA 4BAYA 4ECRA 2E1PA 1QSYA 4YEAA 2VJ5A 3FXLA 2ELHA 4ENNA 2HZVA 4GRSA 3LWFA 5HDNA 1QVGR 5HVQC 1H7WA 2I0XA 1G3SA 3PHEA 4RS8A 2AYBA 3HHDA 4ZYGA 1Z91A 1VQKS 3VGUA 4B9MA 3H5RA 3E1SA 1RNLA 2LD5A 2P6TA 2D3O1 2HFNA 2X9DA 2WTEA 4OYWA 4QU6A 3DBRB 2QA4S 4XLHA 3IR5B 3D6HB 2VG6B 1RT3A 4BLGA 2X1CA 2EILH 4BEHB 4IOAF 2DY1A 3BZQA 1IRFA 1C0WA 1SIZA 2CRGA 4IVNA 3W1YC 5IT0A 3FMRA 2EA4A 4J9NA 4GRIA 3M30A 2EWNA 5D8KB 5DGAA 2A6OA 2DA6A 1S77D 4YY3F 3WZ0A 2CPIA 1PILA 3BQ2A 4WK1A 1S7AA 4FS1A 4C7QA 4OZ0A 2QQ9A 3QPTA 4R25A 2R5YB 3A1YG 2HGMA 2L3DA 3VGVA 4JI7F 4CLUA 4MIBA 4FCYA 4FF2A 1S4EA 5MAOA 4J9KA 3G6VA 3DEWA 3GCXP 4PQAA 1L3LA 1O51A 5K9FA 2WK4A 2GA7A 3LP2B 4KAIA 2L9SA 4O4RA 1LE8B 1RRJA 4ED7A 4EVIA 4HPQA 4OMZA 2ZZNA 2AO9A 3OHBA 3Q3SA 2HHHF 1IBLF 2DRBA 3TOQA 4ZP6A 5E3LA 1U2WA 1SB6A 2W2MP 2RRBA 4DR5J 1AA7A 1K78B 2BJ7A 3LQRA 4OJGA 2IVYA 2H48B 1OYWA 1GV2A 5LGTA 3IKTA 4IZZA 2W8LA 2KZVA 2L54A 4GVBA 3WX8A 3HOYJ 1VR6A 1R89A 2VODA 5KFLA 2VDHA 5KG4A 3FEXB 4H54A 3ET6A 3NGKA 3CCLI 1MLAA 1RTZA 4KN7X 2PA8D 2RS2A 2JZ5A 4ESBA 2J0WA 4PSXA 1KHVA 2BEOA 1DHMA 3GZ5A 3G6XA 3FMBA 4ECQA 2NZCA 5KAIC 3PFIA 3ZZTA 3MMBA 1MJAA 4OAYA 4AIKA 2R8IA 4J00A 4HDHA 3PNVA 1WHXA 1H2UX 2EG2A 3RRGA 2QEXI 2X1AA 3HT3A 3IBCB 3MM5B 3IBFB 2MQOA 5FD1A 4ZTFA 4ZPCA 5M2UA 1DGRM 1MBFA 2GGPB 1D1BA 4RGXA 4PR6A 5T14A 3U27A 1IKXA 4PFPA 2ETHA 1RT4B 3OJUA 1HHSA 4CYCB 3C6UB 2KQRA 2M4GA 4P9UA 2D45A 5B09A 1WH7A 3JSMA 3CC7S 2PI4A 4BWMA 5GTIC 2TRTA 3OV8A 2Q2EB 3TMOA 1TQPA 3M8ZA 2XZDB 1Q78A 2J0SD 2BJ8A 3HSFA 3LSHA 4MKAA 2H27A 4CM2A 4BBSJ 3ZXWA 1DURA 4LRFA 3BBFA 3CF5Q 4UT4A 2BR0A 2R8JA 3P45B 1YBAA 1TK5A 5J1PA 1PP8F 1H3DA 1H72C 2YKMA 3DEUA 2HKOA 4P2SA 3GV5B 4B3TF 3ZQCA 4URGA 4O3QA 3NG8A 3HKZN 4XQFA 3OL8A 4AQYJ 2YKPA 4GGGA 2R8KA 1SANA 2D3ZA 2F5GA 4X64J 1REVA 2EC0A 3QSYB 4PXDA 3LGMA 3R7SB 1U78A 4XTTA 2A5WA 3CJ3A 1DQ9A 1F9HA 2UXXA 2KM8C 3R3TA 1X0FA 3FKBA 2H4WB 2UVVA 2MLZA 3K70C 3KHRA 4C3MA 2C2OB 2BM0A 2OPTA 3BH6B 4QIWN 2HK2A 1S6PB 3IMQJ 1HNXJ 2PMZD 4CNZA 2H6BA 2J7UA 1HNIB 4IKFA 2EG1A 1HQCA 1DP7P 2W24A 4JX6A 2HQFA 3HEFA 2DNOA 3ZCOA 5ETLA 1VC5A 4KIGA 3MFKA 2OO4A 2W57A 4I69A 3Q8YA 3S16J 3T6JA 2C1EB 2V68A 3QWPA 3PKYA 5KK1A 4XLNF 2DMQA 3BG3A 4H4OB 4NA3A 1ZG5A 3VV2B 4DZPA 4FISA 2F5EA 1BN5A 3T6BA 2JPCA 2STTA 5EX0A 2ZBQA 1FMWA 3DTIA 3DLHA 2EV5A 1XSVA 5A8KB 4OX8A 1J2XA 3S3MA 3V6JA 3IS9A 2HGCA 2DEIA 2QCOA 4NC6A 4ICLA 2GZWA 4DXLA 2QF7A 3TA2A 1IRZA 3FUYA 3PJWA 3POTB 4TYBA 2VBZA 3FZ2A 1YJUA 1QZYA 2HWIA 4BBYA 4NLVA 1IDZA 3CJSA 3BROA 2HQCA 2B43A 1S79A 2W1OA 3CB4A 3J7YJ 1AFIA 1HQ2A 2IGKA 4F2SA 3MEGA 2KN4A 2HXIA 3RI4A 1WRJA 1RAFB 4QIFA 4ESJA 1FCAA 5C44J 2ZH6A 2YPRA 1N36J 2KZZA 2HZDA 4YMEA 4ZH4F 3D5SC 2FY8A 2J9DA 5DCMB 5DQGA 2LQJA 5JMNA 4HACA 5EUHA 4CLKA 1JXLA 1WWXA 2AT1B 1BQNA 4B48A 2FMLA 3AXKA 1UCRA 3AKZA 4DR1F 3ISNC 4OHYA 2F4OB 3AB2B 1ZK8A 2M3DA 3HHLD 4CH0S 3OVBA 3BQ1A 3E5QA 2VOPA 3KLGB 4IEJA 5CPRB 2XC9A 2AXTC 1CULB 1MWZA 1MG7A 1RAJA 1OFCX 3CCQS 2KJVA 1RBLA 3Q22A 5B0FA 2VQCA 2PA3A 3QGHA 1MBKA 4Q44A 1RQ0A 1CJTB 3Q23A 2R7OA 2V8PA 1NPPA 3L7UA 4LFBF 1HLVA 1YIOA 3KLEA 4DL4A 4ED2A 2FBKA 3S93A 1XERA 4B9VA 2E5JA 4KPYA 4DL0C 1RPWA 2IVFB 1HPZB 1MU2B 2MKIA 2QYCA 2ISYA 2ZOMA 2KT2A 1VJQA 3CJTB 4XKCA 2G1HA 2UUZA 3VSKA 3GFIA 3R5JB 4P7VA 3JSRA 3L3CA 4KTQA 4X65J 3ZZYA 1EETB 5IPAA 1UB9A 3CJKA 4DR2F 3BY6A 3R8YA 1MMNA 4BHPA 3WE3A 2OLWA 4K7QA 1X4PA 1W7PA 3UE2A 4LF2A 4DR3J 2ROGA 3ZNUA 1IR0A 3HUGA 2HQAA 3VAKA 4U88A 4P2XA 3V4IA 2OEJA 2RVCA 3R27A 2E9TA 5D78A 4YEJA 3TZZA 3KLHA 2BVLA 1UMQA 1XN7A 1WOPA 3A4TA 3JAMK 2I5JB 2JTVA 1Z2ZA 3HJEA 2XHKA 4ZC3A 1VQMS 4C3JJ 2E5LF 4J9LA 3KIOA 4F3MA 4R79A 2EW9A 2ZFWA 3PXGa 2JFDA 4DMZA 1XD7A 3PNYA 5G4DA 5CVJA 1Z05A 2M2EA 5F8JA 2J6TA 2UU9F 1RWMB 2DT9A 3W7BA 1X1AA 2ILZA 2Z8QA 1IBMJ 4J19A 5D4NA 3TA1A 2XWYA 5ETNA 3RQ4A 2VA3A 2NYHA 2LYCA 3I5BA 2O0YA 1R31A 2ICWG 4JI1F 1UP1A 4C8ZA 4ZN3A 2QYGA 2D1CA 2GMLA 1ZQ3P 2LBFA 3L1PA 2R7TA 3HPHA 2AD9A 3PW2A 1MMDA 1VCTA 2DK2A 2W9CB 2ESHA 2EA2A 2E1AA 1NJWA 2R7WA 3I54A 4M94A 2A2CA 3ENVA 3W2WB 2CW7A 4DQIA 3QYBA 4NNJA 4JK1X 2AYGA 2RQPA 4G9YA 3SDGA 3R7NB 3MEGB 3PRVA 1Z21A 3GVAA 4BHBA 2L48A 3OHAA 2JLFA 2YTCA 2IAJB 3EZOA 4I6YA 1N56A 2PDAA 3DHXA 1U6FA 2BY1A 3V6DA 5D4PA 2D3UA 3G71I 4P2FA 3VALA 2PFDA 3KLFA 3KXDA 2Y1IA 3KE2A 1BGXT 4UOCA 2GLOA 3KLVA 1XDUA 5CHCB 2D7SA 3S15J 1JLFB 5F0WA 2V63A 2O3DA 2B0LA 3R5DA 2JWTA 2MLGA 3QQAA 1FERA 4PJNA 5KFRA 4ZOSA 2RRAA 2F7VA 2HAFA 1T9WA 4C6AA 3GG0A 4NLGA 2DNKA 3I0RB 3KLNA 1T9XA 3PIPF 3S2WA 2VQEJ 5HS9A 4N0BA 2XPUA 4J9OA 4M5LA 4NCBA 1Z9CA 2BE5F 3Q8VA 1X4CA 4Y34A 1GXTA 1O3RA 4F67A 3QJJA 3R5AA 2ZMEA 3TZXA 4J9PA 5E3CA 4JBCA 4YR2A 2C3YA 5JVHQ 1Y3JA 3HSDA 3ISZA 3BSCA 4CA0A 4GO5X 3D5LA 1OJLA 1G6BA 2YNIA 4EFAC 1LDJA 1RP5A 3K5PA 3DEEA 4NLXA 2UV1A 3FQLA 2MZRA 2A07F 2ZJPF 1EP4A 2JK3A 2DO7A 3JSBA 5GADU 3WU2C 5DGBA 3G8SA 2VL1A 3PYFA 2EIJH 5A6WA 1H89C 3GSIA 4NYZA 4X4VA 5GTHC 4HDUA 5J4VA 5KFTA 4A6EA 2QMUB 5U47A 5F9LA 3BCAA 1JJ2R 1T56A 3H40A 2IRUA 2HLTA 1FNOA 1BMQB 5LXRA 2AEFA 2YPYA 4DS4A 4HLYA 3J81U 2ZH4A 1NJZA 4ED6A 3PX6A 1XMAA 2M8HA 4K2JA 4RW9A 3H3ZA 3UN5A 3Q0AA 1VNDA 5E7OB 2DNGA 3G3ZA 1HWIA 1W36D 2MKYA 4EM1A 3B6AA 2XMKA 5C7PA 3OSFA 4P75A 2B63J 3JRCA 2Y0BB 2GC8A 4HVZA 2G9OA 4TY8A 2DTRA 4NE9C 2ATLA 1XMQF 1NK0A 1Y6IA 1M1HA 2ESNA 4BGDA 2GXGA 1UWAA 3NS6A 4RB2C 3GLJA 2LDUA 3J80K 2QBYA 2XVCA 2BY2A 2LC2A 3ZQGA 1BR1A 4RW6A 3FM3A 3QOEA 5L8RC 4NCAA 2Y0SD 1ELOA 5LM7E 2DGTA 1N33J 4EJOA 1VIXA 2EC2A 2GIFA 4F7ZA 1ZR2A 2AEMA 2GW8A 2MSYA 1LE8A 2OD4A 2XWXA 4B17A 4ZHRA 5DDRC 5C5JA 2KKOA 3K2ZA 1Q1KA 2V2QA 4C0BA 1S1UB 2HHQA 1B7YB 1DDNA 4RGUA 4L6V3 1KU7A 4ASNA 2WWYA 3K5LA 4G1IA 4M74A 3EGNA 3VYTB 2IAJA 3TVYA 3CCSS 1Q7YT 1TL1A 5EGYA 5CAAA 2DA5A 2IA6A 1ULRA 4N8OA 3HJFA 3OSPA 4RNFA 2VG6A 2IW5A 1TT0A 2X3DA 5C4XJ 1R5ID 1X2MA 2EZKA 1YQHA 5E0OA 4Q0BA 3M7VA 2XULA 2K3PA 3SZTA 4IYQA 2OQRA 5A2QZ 3M1VB 2OMOA 2AZ3A 1GXPA 2LECA 2H5EA 2GV1A 5H1SV 1TQMA 2GIVA 5K14B 2YX1A 4FN5A 4OHZA 1TZ0A 2F5CA 2ZBPA 3AH6A 3UDLA 4K4VA 2Y2ZA 4G1QA 1Q53A 2CJBA 3DLEB 3HB9A 1AB8A 3T9NA 1WACA 2BMBA 4BJ5C 3GIKA 3V6KA 1DFDA 2ZH1A 3OXFA 2HGNA 4B9LA 2F5VA 1CJVA 4U9RA 2QL5B 2LFBA 5GAEU 2ZJ2A 1MMLA 1WFXA 2V1NA 1B4SA 2HKEA 1VK3A 1V6HA 2PN6A 3H3UA 3I4HX 5FKMA 1V4RA 3S1MJ 1AA1B 1UEVA 3MWBA 2DCEA 1KS2A 4IRGA 3GTKJ 2MQMA 2XI3A 1WHUA 2KFNA 5E3RA 3I0SA 4WFNQ 2NR0A 4LVOP 1F60B 4QJVA 2F4IA 1JKQC 4I01A 4ED4A 3CD0A 3HOXJ 4ZJZA 2CW0F 2N3LA 5KFPA 1T03B 1DJ0A 1QAIA 3TUPA 2R7VA 1CJKA 1VISA 5DO2A 4ECUA 1W0TA 1GXUA 4IDKB 4X62J 1IV6A 2KLOA 2A3JA 8ATCB 3SSQA 3UPFA 2V8GA 4KR0B 1YX3A 5J1EA 4IPAA 3MTKA 2IGOA 5MLCV 2LOOA 3PSIA 2KRCA 4X64F 5GAGI 2VPRA 3UCGA 1ZRDA 2ZSHB 4OV1A 1G3YA 3QJLA 5D0EA 2PG4A 2MGZA 2HGLA 2DEJA 4OIOF 1H73A 1AU7A 5DG8A 1K79A 1I27A 3T1YF 2CV0A 4LJMA 4BQOA 2OD5A 3CW2C 4F2RA 4JI1J 5DETA 4EO8A 2GFFA 2PFBA 2CV1A 2MZSA 4GKJJ 2L2OA 4NB5A 3ZTPA 4OIQF 4W92B 2XAJA 2DOAA 4CRJA 4HR2A 5KT7A 2NS8A 4B09A 3BLYA 2NS7A 3MTJA 3E3VA 4KO0B 1MW7A 3DMJA 1CEZA 3S1RJ 2H4YB 5HLIA 2DJIA 4DJBA 2FU4A 2UXDF 4WE1B 5ICGA 4QWQA 4I1TA 3L7WA 2V9PA 3I56I 4OWRB 2VIHA 2V1UA 3H1CA 3PX0A 2DXIA 3HHLA 4DYCA 3DPUA 2EV0A 3JQMA 5EG0A 2KYZA 5ETTA 2ILYA 4I6WA 1M1EB 1VJWA 3VYSB 3K0LA 2CJXB 1TW3A 1CQNA 2YKMB 3PJRA 4EJVA 3LPEA 1S57A 4DG1A 1JKPC 2VN2A 4DDFA 2DBBA 1D9DA 3PO2J 2DA1A 4CXFA 1S97A 2QEXS 1R49A 5KG7A 2DO4A 2VQEF 2K06A 2CWXA 2M8EA 1YOVB 5DUKA 1WI8A 4OI6A 1P4WA 3RU0A 3KHLA 4BDPA 4D3GA 4Z37A 1FDAA 2ZDOA 3RKXA 1XX5A 2HHHJ 1W5CC 3SZ2A 1MZBA 2MTLA 3I5AA 1LFPA 2FZGB 2MZQA 2E19A 4NYPA 1U1QA 2AGQA 1F9NA 4B9TA 5JVTA 1VRUA 2NXJA 2V2ZA 4NOHA 2WBMA 1YJNI 5E17F 3TOAA 4L0ZB 5A2QK 2V26A 1R8PA 2WW8A 4DI6A 4DQSA 3V7CA 1ZAXA 1C4CA 2X6XA 3BYPA 5E33A 4ANEA 2CPHA 5IWAJ 3FX3A 3H5UA 1URRA 2J8SA 3IAM9 1R9TJ 1GMWD 2P4WA 1Z1DA 2BGCA 2JJ7A 3RKYA 3WTWC 5HVFA 1KQSR 4RLFA 1WG5A 5LHGA 4V19K 2OKQA 2ZVIA 2CJKA 1NU4A 1YJTA 4DX6A 5IM0B 3K4MA 5LD2C 3Q83A 1K9MT 4W4MA 4DV1F 2R2SA 2E1OA 2MSTA 2NVTJ 2BRKA 1RETA 1ZM2A 5HMYA 2HVDA 1NK3P 3AHPA 3H36A 3BZKA 1KQ0A 2WAQN 3NKYA 4N4NB 3M2RB 1RSCA 1MROB 2K5CA 1Q8BA 1REVB 1X5PA 5F04A 1OMSA 1HF0A 4C9DA 2L4MA 2XAFA 5B0EA 2R9LA 4JI6J 1T95A 2DITA 1T6SA 1KEKA 1KWMA 2AGOA 2R4FA 4RLQA 4CP5A 1YHQI 3JTNA 3ZZRA 3GFLA 4P9SA 2VPWB 1TT5B 4OI0A 1FT8A 1VQ5S 5F6FA 3M1EA 2HDCA 3B8HA 2BJEA 3H4BA 1FKAF 2I5UA 5D6GA 4EBDA 5GMEA 2COMA 1NK2P 1BIBA 1SH3A 3L2UA 4UTGA 4DSLA 2B5JA 3R4KA 3CD7A 1VC0A 4A3CJ 2DLLA 3FSYA 3DLKA 5CZXA 1HHTP 2AX0A 3N4MA 1KU2A 3DWLE 1RAOA 1QNTA 5D77A 2EIMH 2IA0A 2XYPB 1VLYA 3WIVA 1SXLA 2LA4A 4CUGA 5LSRA 1EH6A 4RAYA 1P9QC 2C2ZB 5A2QY 1I1GA 4DV5J 4MKBA 3U1NA 4QU7A 2K2PA 2HVEA 3C66A 5F8MA 5L1IA 4PKDB 5ADZA 3QWUA 1QAYA 3CWJA 3L2WA 3P96A 3E8OA 3MPDA 5LRSA 4R8HA 3C14B 3SQOP 2DNHA 3K8WA 2LG4A 2CADA 2MYFA 3DFEA 5IOLA 1IKWB 5E3AA 4WKRA 2M4KA 1BE4A 1RT7B 3I4NJ 3FK4A 5L3FA 5DM7F 1N5QA 1Z3YA 1Y1WJ 2JFKA 4B43A 1YTYA 4ELUA 4DCJB 4LR8A 4A8OA 2IYIA 4FYWB 1D1CA 2GOXB 2DR6A 2LH9A 1YLXA 3H2VE 3CDBA 3E0JB 3ADAC 2GAUA 3W5XA 3OYCA 5D4LA 2JRMA 3GYNA 2YWGA 4Q2LA 1R6VA 5ICFA 2BACA 2ZKUA 4DX8H 3MAAB 3IRQA 1YLFA 4YB6A 2L4AA 1TWAJ 3OY9A 3THVA 3OV7A 3C2GA 3G9CA 4QIEA 1I6HJ 3LSIA 3K17A 3UI3A 1UJ6A 2RD5C 4QOTA 2XYGB 2YH0A 4V19X 1EH8A 3FKJA 5ETPA 2KXNB 3MN2A 4UZBA 2JA7J 3EUHA 4IO9Q 2OIHA 2NXEA 4RMNA 1BM9A 3N4WA 1BQMB 3QLHB 2X85A 5FO5A 5KT5A 1IW7F 3DDKA 4TU8A 5J3LA 1AHDP 1PJ6A 1CQMA 4F4ZA 3HT0A 4LK0F 1AKHA 2DNZA 2CQPA 5HP1A 3JXOA 1NUEA 1XGSA 4QQBA 1NB7A 2G13A 2WA0A 1BBYA 2VFTA 3ZTRA 1FRJA 4UVCA 3BEGB 2Y0SA 2DR9A 2YWHA 2NXCA 3CE8A 1RTIA 2CNNB 4OYIA 4B3MJ 4JV5F 2W85A 2V2KA 4Y28C 4QIWD 2GWRA 4MO7A 4NZ0A 5K8OA 3BJOA 4KMFA 3Q9VA 1P1TA 4QWCA 5M5YJ 3BP8A 5KFUA 3KP5A 4RM3A 2Z58B 4CIOA 4KV8A 2ZNYA 1TU0B 1LWEB 3B6BA 5L3BA 2MGQA 1NDLA 1R5HA 4I98B 4D9JA 2VI6A 2DIVA 1TKDA 3FK7A 2J9CA 2PMWA 1X4EA 1WJ5A 4BQNA 4WP3A 4G6VB 5HSPA 1FIAA 3R5BA 1FEEA 4NXMJ 2VASA 2BY0A 1JXEA 4FT8A 2FJDB 4ZZDA 1YK9A 3HKZA 3M2VA 1HBNA 1RA7A 1O57A 3RBDA 3KEOA 3LGNA 1QVFR 3OYEA 1FJLA 3K59A 2H09A 4BHQA 2F4VF 1U47A 2HZTA 5CZVA 3SXYA 4QWBA 4ENKA 4IHXA 1NRKA 4NLUA 4NDLA 3FEYB 4WWCA 3TO8A 4RW8A 4D7NA 1F5TA 3H5AA 1UWBA 4CCLA 3NOGA 2Q3PA 1A36A 4Y2KA 3WQPA 4FF1A 4V19J 5GP9A 4ZCKA 2F48A 1U1MA 1VQKI 3FBEA 4YELA 4MFDA 2Q0OA 2VKRA 4CDIA 2XS7A 1V5EA 2V50A 3ASNH 4HL9A 2BW3A 3FMSA 2YKAA 4C0HA 2ABYA 3G8QA 1YGYA 3GZNB 1JMTA 4H4KA 3QGGA 1VRUB 2JH3A 3C16A 1Y3KA 4OI2A 3VGSA 3CUQB 3CDEA 4L3KA 1KBRA 2RRNA 2RU9A 2A05A 2C3MA 3GONA 3AQOA 4RUCA 2Y8YA 1Q4RA 1LWCB 3BGUA 2XMAA 4F4AA 1T33A 1QAJA 2FF4A 4OINF 3O3LA 2QLJB 3B82A 5HAOA 3L95X 3HGYA 3DYAB 4CLZA 2RQKA 2YKOA 3MAAA 3JSMB 1X9WA 1WUUA 1BQMA 1DARA 2B8PA 2R7ZJ 5DDGA 3SFZA 4Y3OA 1YI2S 4CZCA 2FJVA 2RB7A 4X4UA 1LW2B 1JUSA 2KVQE 1ON1A 1JI8A 1SJQA 1YS7A 4DV1J 4BXUA 3CF5F 4CH1A 2COLA 1DTQB 5DG9A 3ZN0A 1S72S 2APOA 1I3QJ 1K6OA 2ZSIB 1B6AA 3MHYA 4IG0B 3KWMA 4OYMA 3BQ0A 5IOZA 1IKWA 4HX8A 2DH9A 3CO7C 3G71S 5LMUJ 2UUTA 4XAKA 1E3OC 4CTAB 2MZJA 4CYUA 2K86A 1GQEA 4USVA 1Z4UA 1X3UA 3TVKA 2B4VA 3F72A 1I6XA 4K4TA 4B8XA 2L7ZA 2HBQB 3KJNB 5CCMA 2E7XA 5L3DA 5DG7A 4FX0A 3DGPB 1B99A 1U1RA 2N8GA 5L9NA 2HNDA 1LW0A 2EVZA 5IZHA 5L3EA 1HKTA 4CSWA 5KFKA 3UDEA 1A6QA 2XAQA 4BQQA 3DF8A 1GHCA 2XMMA 3IUOA 4Q5SF 4K5RA 2VBWA 1LNQA 4UUSB 3EICA 1NHKL 1X1CA 4Y33A 4ZS6A 3W9IA 2M0CA 2OMLA 2XG8A 4ENOA 4I0WA 1ACIA 2CS3A 3MAHA 1MKMA 4F3QA 3SQGA 4HZFA 5HQLA 5CQGA 1ETOA 4JI5J 2QLBB 1NM2A 3HSJA 2CQBA 2L3MA 3I6PA 2YWEA 3TA0A 3ILLA 5J1EB 3SEQA 3EUHC 2YH1A 5LMNJ 3UO0A 4CO0A 5DS9A 3T1YJ 3KPHA 4TY8B 2UUCJ 4B3XA 1ZM4A 3J80Y 1YW8A 4IHTA 3WHBA 3QFHA 3KK2A 4K4XA 2BXYA 3RB0A 4B02A 1Q7LB 4HF2A 1SJ1A 4BACA 4Y2CA 2OSRA 1UG2A 5F41A 2HBZB 4IG3B 3MR2A 2IDEA 1FTTA 4DBRA 3CT9A 3PG9A 2KG1A 2O5DA 3W62A 1TKXA 1VMBA 2W4CA 1ZETA 2MMYA 4MFEA 4RL1A 4C2MJ 4LOCA 1RXOB 4QR1A 2RV8A 1RLCL 3C3LA 3IC1A 3I3LA 4N9HA 2VICA 2EFWA 4PRFA 4RGRA 3JQJA 2HPMA 5L3GA 4XRSA 5AJ3F 1DY3A 2AV5A 1UHSA 3P8BB 3ZMSA 2YXLA 4BJ6C 3JRGA 1FSHA 3BKUA 3EWGA 1U1LA 1FJCA 4PXCA 1WELA 3NCQA 5EWEA 3H5YA 3J7ZT 1ZRFA 5J2NB 2CO5A 1BW6A 2OA4A 4IQJA 1X5OA 1XEZA 5F0HA 1UPPA 5DM6F 1FA0A 2DXDA 3K10A 4NMLA 2RE1A 3NMAA 2JA6J 3ZTQA 3MZ8A 1IN7A 3EXCX 3PW4A 1HW9A 2G2ZA 4LQ3A 2J5PA 3HHHA 2IEKA 2D5VA 3OLBA 4AL7A 2L08A 3HOSA 2LQ8A 1FK9B 4LF8F 1HARA 4P5OA 3MOJB 5D4SA 1X58A 3H0GJ 4ITVA 5EEHA 3ZR8X 3JRAA 4X2BA 1BWEA 4MHGA 2HHWA 1TVRB 2CQNA 2KZGA 4QIGA 2ZNZA 1TELA 1OJ4A 4DNCA 1H88C 5K7FA 4BUPA 1PGZA 5J2QA 1RE1B 2OBPA 3KG0A 2UV8G 4FZVA 4UZCA 4ZYDA 2V8VA 3EM1A 4ECZA 3ZN1A 3L2VA 3Q89A 2HIYA 3GJTB 4NRTA 3RTVA 4KBIA 5J2PB 5LJ3Y 5I3UA 1E3PA 3H9QA 1FKPB 3J80U 2YY3A 4OYZA 4WXHA 4XR6A 4F0HA 2E5LJ 4G7OF 4P73A 3JAMY 2HQGA 4L18B 1PUEE 1QPIA 1WD6A 5DYMA 1OCOH 5ICEA 5HJXA 4TLRA 3DV8A 4PWUA 1EIYB 3TQ1A 3H5SA 2UP1A 1U26A 4OIRF 1I5ZA 2C6YA 1TL4A 3CESA 1K73T 1F6TA 1HD0A 5EDWA 1RA6A 2WAFA 3AY0A 5DQIA 3BSOA 3HRUA 1B9MA 4BC7A 3PW0A 4CLLA 2QC3A 2RMLA 3I9V2 1QO0D 3OSNA 3HZGA 4M71A 4KGXB 2A5YB 2WSFC 3CD5A 5E8IA 3QPIA 3TAQA 4I2PB 3I9ZA 2FOWA 5B66C 3U1MA 3OR1C 4DN0A 4XL9A 1RHMB 2K9SA 4NLOA 2DQRA 3W2VB 4DR7F 3UDCA 2EBIA 3QRRA 4HEA2 2EKYA 3VYRB 3ZMZA 2F2EA 2DK8A 1XDSA 3THPA 4EUVA 2M3AA 1DQUA 2OUGA 1JX4A 3S1QJ 1H0MA 4QLCU 2X48A 2LP4A 1J75A 5AIQA 3SZPA 2AJQA 1SC3B 4EYIB 3K5OA 2KHMA 1S6OA 2ZHAA 3U1DA 3CQZJ 4AM3A 1SIWB 2XNRA 2XSJB 1IVZA 1JUMA 2RAQA 4MMOA 2K3IA 1J5EF 2HLUA 4DSJA 1WKJA 5M5XJ 1C1CA 3MECB 4DV5F 4C11B 4XBFA 4DUTA 2L41A 5T41A 3RKQA 3Q2TC 4KT6A 4U0VA 3ZMDA 3GP9A 2GIQA 2B56A 4F52A 2ZE2B 3G4SI 1XB4A 2FNAA 3LL7A 2VQFF 3K1NA 1EJ7L 1TWCJ 4A0XA 2ZJRF 3M8PA 2ZBKA 3HXMA 2QSGX 3N79A 4NRUA 1FYMA 2QLZA 4KT0C 4RJVA 2XEXA 3JR9A 1F2HA 1D0EA 1VQ9I 3C3WA 3F56A 3M9OB 3RZOJ 4O0IA 1K1QA 4J7CA 5H9FK 2B51A 3W6KB 5KTQA 4YQWA 3H9JA 1K61A 1UPMB 5GAHI 2W9BB 1Q16B 4NYOA 2UXCJ 4HSRA 3C18A 1BI0A 4OYAA 4DS5A 3VCDA 1MBJA 1FVQA 4EGLA 1NSQA 2C28A 3BJ6A 1MGTA 2XSJC 4KV8B 1P1LA 4E98A 2WC2A 2EK5A 5IT9Z 1FRXA 4USKA 4B9UA 1PKUA 2JPBA 5BS6A 1K4TA 1AXQA 1IGNA 4I7FA 5EEGA 4NLTA 3AOAA 5GVQA 3HVTB 2RQMA 4QIVA 1REGX 1G3WA 2VT3A 2GS8A 4XSZF 1HQUB 1NHVA 1VK8A 4MFBB 4U8YA 2STWA 3EE3A 4K4UA 3MI7X 2R7XA 2H54B 2JC0A 2ZH3A 2HHVA 2GJFA 4PABA 1QM9A 3I4PA 2G0JA 1S29A 3O1LA 5FGMA 3GU0A 2TDXA 2XASA 3IN5A 2M34A 4OAZA 2OC6A 1KYWA 2E1CA 1U7LA 2JEJA 1JGGA 3EDQB 4NC7A 2IS4A 5KT6A 5K7ZA 4YFUA 9ATCB 1YRXA 2JC1A 3MCMA 4XONA 5HLFB 2BANA 1FKOA 1U1KA 2FZCB 3WBZA 4ECYA 2P5VA 3FEZA 3BKFA 3MM5A 1V5IB 1CSJA 4P72A 1EETA 3DKXA 1D5YA 4CCHA 2WAQD 3OYMA 4ZDOA 3TO9A 1R8CA 3W63A 1VQ4I 3PFYA 3KFWX 1XIQA 2IY5B 3OFHA 3V81A 1SEUA 5HMWA 1HBOA 3HX9A 2EFOA 3BN4A 3E01A 4W97A 1VQSA 4U7DA 5K8NA 5CJ9A 2KL8A 2GO8A 3HI9A 2XBPA 2DGWA 4PXBA 4W90B 3KCCA 1HQUA 2XV4S 2MY8A 5L1KA 4QW8A 2JA5J 1LK5A 3PNTA 1W5TA 4TYAA 3DN9A 4GVBB 2ZWPA 2XSJA 2EB7A 1LWFA 2W7PA 1PYOB 3K4BA 4LMZA 4H4OA 4BE2A 1IWGA 3CDIA 2ELJA 2F8MA 3EZUA 5GPCA 2DPJA 2ZO4A 2LEAA 2LNBA 4MK9A 1YS6A 1WC6A 1GTHA 1FDBA 2FLLA 2LU2A 4QR2A 1JLBA 1VQNI 2IA2A 3TANA 4LIWA 3HF5A 2YNFB 1KZHA 1PBAA 4PWWA 3H4DA 1REPC 4N77A 3SYTA 1J59A 5D3GB 3DBHB 1IC8A 1KSPA 1MDMB 3TP2A 1TTYA 3H0DA 3HHNB 2WVFA 1KD1T 1KQFB 3JSPA 2AU0A 1CVJA 3BCBA 3M9NB 3T5KA 2CU7A 2R0QC 2CFOA 2B7CB 1FMVA 2BBEA 3MR7A 2QUFA 1NKCA 3DDIA 4P52A 5C25A 4QCLA 2KYXA 1S1UA 1W7PD 2HRYA 2M7AA 1OPIA 1O4XA 4FE4A 4ILMA 3ZRGA 4OI4A 2VG5A 1D8ZA 2OH2A 2MLYA 4IH7A 5C2GA 3R9LA 1UJ4A 1JLQB 3M8JA 1FX2A 4F36A 5HDGA 3S14J 2JVRA 2GQCA 3TL4X 3QZ8A 5J40A 4UY85 1ETKA 3GWCA 5CD4H 2XO6A 1DLOB 2F3JA 3HPOA 5K5RA 4KB7A 3I5CA 4G3IA 3MMJA 3HTSB 7AT1B 4I99C 1OQ3A 5IP9J 4HNVA 1YWXA 1F5CA 1DU0A 1HA1A 1RT2A 1X4FA 3UVJB 4AD6A 2E1NA 2M7BA 2DO0A 1B0VA 2P5LC 2QA1A 5E20A 3PQJA 1IR2A 3HSGA 4TN2A 1WI6A 4HI2A 4RWWA 1RKJA 4I2PA 4F3OA 5KFAA 4TKTA 1S72I 1QGPA 2FOKA 3ZTOA 4LGWA 3D0SA 4DQ2A 2NQPA 1N0VC 1J9IA 2CG4A 3CCLS 2XHCA 4L5EA 3CEDA 2N4CA 2JSCA 1FT9A 4IHVA 2GVZA 4WU3A 2A69F 2BOAA 1VQ8S 4ZKAA 2IFXA 3GTJJ 3OOPA 4PG5A 3KLIA 5JVGQ 2E34A 1DQAA 5ITHA 2AWZA 1B59A 1SFXA 2B9YA 3HXLA 2GHVC 3NEKA 4II2A 3CJ5A 4QW9A 1KN6A 2VQLA 1G7CB 3RGIA 2R8HA 4LSNB 2XO7A 3D0HE 3T1HJ 3R0AA 1TFWA 4ZDNA 5CH7B 3ZQIA 1VQ6I 4OV6A 3KP4A 3GJSB 1P4AA 4UUVA 3ZZZA 2LY2A 1S9HA 3FF5A 1RTJB 2W2NP 3F23A 5JUMA 4LF6F 1BIAA 5E1WA 3OOUA 1IAWA 2M9KA 4ZVSB 2XGQA 3O2IA 4JI5F 3I58A 2MKKA 3G4SS 2NOJB 1IF1A 3A3OB 3LA3A 5KOXA 1Z7LA 3TX0A 1NK8A 4X4SA 1N34J 1H8AC 3LF0A 1EAYC 1N5SA 1NSKL 1ZAOA 2F8EX 3A4CA 3ZXSA 1N5YA 4FYDA 2UUCF 2LA6A 1NMEB 4DBQA 2MHEA 5KHDA 4X4QA 1FD2A 4QYZJ 3REOA 3N05A 1GMUA 4FXVA 2JNJA 2D1VA 3CJKB 4NLSA 3NNCA 4NEZA 2VLAA 4B3AA 1TVRA 2AW0A 1ZYQA 1IJWC 3WE2A 1I3OB 1M5SA 3KETA 2BHYA 2ADCA 3C6TA 2BYVE 3HOUJ 1TUVA 3RAMA 3LQQA 3OYNA 1HNZJ 2NAZA 3WTUC 1V3SA 3KYLA 2KI2A 4BXFA 1P6TA 4ZYHA 3L2RA 4WF9Q 1MWYA 2B9WA 1LQ1A 1R0AA 1EHWA 1S6LA 2F5DA 4KO0A 1GXLA 3G1LA 4JOUA 4LBIA 2DA4A 3IP4B 1BLUA 3N9UC 4A3LJ 2X1BA 3MAQA 1R22A 4UXNA 1T05A 4CI0B 5J2NA 3VDXA 3PACA 4XLCA 1Q86T 5K5OA 3TP0A 4O3SA 4LF8J 2NUHA 4PUSA 4O23A 4ENJA 1JB0C 2ZOFA 2V7FA 3I87A 2NPFA 1SMTA 4I76A 4DV6J 2ZFUA 4KGVB 1KFSA 3MM7A 4HX4A 2UXNA 2OTJI 3UCUP 3NGTA 2POKA 2DRAA 3B73A 4UVAA 2IS1A 3E51A 4LD5A 2HSEB 3CMQA 5AONA 1OKRA 1BC6A 5AIPA 2YSRA 1NHAA 3RKWA 2F8HA 4ZVUB 2UU9J 1U8SA 3V5RA 3BREA 3P5JA 5ILSA 1JTXA 2Q6CA 1A0OB 1DRZA 2Y69H 1VI7A 3MEDA 2DNMA 1S49A 3I0SB 4Q5VA 2XY6A 1GMVA 3FCWA 1QZEA 2O1PA 1P9YA 5CQEA 5F0FA 4IQMA 2M52A 5JHFA 4XLEA 2KPMA 1J5OB 3MEEA 3K4KA 1FOYA 2MPUA 1Y4ZB 2CUYA 3V6HA 2F9JA 3KX2A 2XSFA 3KJVB 4DSEA 2DMTA 4ZVPB 5LMUF 2MKSA 4I0BA 3G2XA 4KICA 3H90A 2FHJA 1ZLKA 2N7CA 4KHPJ 3IL2A 2DHAA 2COBA 1XTZA 3PVXA 3ZTSA 2ERRA 3I9V9 3HOZJ 3T5XA 3CCMI 2KT5A 2ZXHA 5IQQA 2K02A 4DX7A 3MFIA 1ENHA 3K57A 3QYFA 2I38A 4G1PA 3TUIC 2W9AA 3ULHA 1T05B 5DZ6A 5G0RB 3BG9A 4L72B 4JI4F 2CZVC 2W4DA 2J9EA 3SFIA 1T8IA 1X3WB 1WZ2A 3DU5A 4CHUA 4V2GA 2RHSB 3FRZA 5LL6d 4M5MA 2NSCA 3CJTA 2HHUA 1MMAA 3PO4A 1SVLA 3GFYA 2P9EA 2HVRA 2MQNA 3HD1A 2JMWA 2PMUA 1I1SA 4J91A 2HNDB 3FISA 4RLEA 3CJQA 3LP1B 4N9IA 3SSRA 2GXBA 3PJXA 4HT7A 2F1FA 1NLKL 4JYAF 1K0VA 3I71A 2CJQA 1SBRA 2OPSA 4Y2MA 6PAXA 2DD8S 4NLPA 4JOMA 3KJQB 4Z6YA 4ZDPA 2Z2MA 3MUTP 4A8KA 3K4NA 2DCLA 1R58A 3PY8A 5T7LA 5KFHA 1GVDA 3GX4X 5K8PA 3I96A 3IR6B 2ZH8A 3PUBA 2R8GA 3H35A 1LK7A 2FLPA 1UW4A 2EFQA 1C2PA 3G8TA 1S9GA 3FNNA 4UQTA 2E71A 1RUNA 2QLFB 3OPKA 3D1NI 4AQYF 1D9FA 2DAOA 2HS3A 1T9TA 2LFVA 3TEDA 3DRSA 2YKNB 2CV2A 3MOZA 3W5ZA 3LP0A 2HOTA 4Y6IA 5K5QA 3LW5C 1JLAA 2BJ3A 4JX4A 3SEOA 1O7LA 2B6AA 3VWBA 3NOCA 5EYRA 2R93J 1ZN2A 4ZLJA 1FK9A 4MTPA 4UUTA 4NXNF 3DTKA 2PLYA 2LXFA 3L2QA 3NNAA 2IGNA 3MR5A 2BXJA 1AW0A 1D1AA 5C24A 2KH9A 2CJYB 3N6NA 4B3MF 3ZQLA 2ZDPA 5CYQA 5HK4A 1HQEA 5HROA 4KKOB 3LOCA 2GGPA 1EKRA 4P96A 5I3PA 2VBYA 1SH2A 5AXLA 3TEHB 3OFEA 2HVZA 2FLOA 3NAIA 4ANJA 3OYLA 1BOAA 1Y11A 3VHQA 3FBBA 3CCEI 1RT7A 5DLFA 4EEFG 3M3YJ 1X4DA 1A04A 1HWLA 2YPZA 2HPUA 4PG7A 1AUSL 2AIRB 2MY7A 2BE9B 3EPIA 4Q8FA 3D0GE 1LFBA 2WV1A 3PSFA 4Y15A 5HI7A 4ES2A 1PJRA 5HBMB 2QL9B 3PFOA 1HBNB 1FO1A 4LG0A 3IAS2 1UJ8A 2PEBA 1NKBA 1EKEA 3MKWB 4EU0A 2O7OA 2WHOA 2JA8J 4YHHJ 3M1VA 2CAJA 4LREA 4DEZA 2RUGA 2HG4A 1LDDA 1M90T 1XMKA 4OZJA 1PDNC 2V34A 2OGUA 1IV8A 4NEYA 4CM0A 2HNYA 1N75A 3OYKA 3MM9B 4PEOA 2VJJA 4M95A 2MQ8A 3S7RA 2XPWA 4ZVRB 1QQIA 4A8QA 2C2KB 2QG9B 2YWFA 4YOEA 1GMWA 4C8LA 4LF7J 1S1TA 2ROPA 5AT1B 4E2FB 2R3VA 3M05A 1TL5A 4XMYA 3RAXA 4ITSA 5B7WA 5C4JJ 3HRSA 2GQQA 3HKWA 1X4BA 3I31A 2P0WA 2X6WA 3VR1A 1R0AB 3BZCA 1W36C 4YR3A 4HBLA 4B3OB 3OYGA 5B0CA 4M5IA 2BOLA 4USTA 1T94A 5E1ZB 2MLKA 1RISA 2QMWA 1RIOH 4RBUA 2ZM6J 4U87A 1RT3B 1ONVA 4AT1B 4J9VA 1VRQC 3RPUD 3LSGA 2XKPA 1V54H 2HVIA 3CMAS 3WX4A 3KMSA 3J7AY 5A0YB 2FVQA 1QVUA 1D3WA 1DU6A 3SCLE 3K4LA 2DHSA 4PUOB 1W0UA 2BZTA 3O3KA 3BR2A 2J0XA 1QE1A 3PX4A 4X4PA 1RZ4A 3OYJA 1YJWI 1AKHB 2W4SA 1SJ4P 3RSNA 3VEPA 3VVUA 2MC4A 2GMHA 2EXUA 2V69A 5IP6A 1FEHA 2X1GA 3C15A 1HYSA 1F4KA 5HNFA 4B3RF 3HM9A 5K8MA 4DR7J 1B8IA 2DNRA 3EDPA 2WB1A 3IO1A 3K5NA 1P27B 3DLLF 3T5JA 3BR6A 1VFJA 2IAIA 2NXNB 2X0LA 2P6SA 3ETOA 5A76A 4XN0A 1WDDA 3Q9SA 3ILIA 2U1AA 3FFIB 3CCQI 3BPSP 2DA2A 3DMJB 3GWZA 3HD2A 1YI2I 1H2VZ 1WF2A 4NHJA 3LA7A 3NWTA 1A5JA 2ECCA 3IKVA 2F6CA 2R7SA 3FXJA 2I9SA 4PG4A 5ETQA 2G7UA 4PDKA 4L73A 1RWXB 2QSWA 3BPVA 4ZPTR 2DGOA 2JRSA 5IV3A 3L00A 4AIJA 1P7JA 3F0CA 3A3PB 2XSDC 4J90A 3DRSB 1WWHA 3M8EA 3ABTA 3PIOF 5K20B 1NPKA 3B4DA 2B9SA 1O8BA 2XGCA 2GX8A 2XB2D 4KT5C 4PCQA 4DCPB 1LNWA 4F4KA 2QJ3A 4ZZLA 1U0HB 4RB0A 2Y8WA 2ZFHA 4PUOA 5KFGA 2A0FB 4PAAA 1U6BA 1HBUA 2HMIB 1JKHA 4TY9A 1NZAA 2Y0MA 5EWGA 3BTCA 3NRVA 3OTCA 3BSAA 3GYGA 2ZH5A 5IYDJ 3CC4I 4HYEA 1FDNA 4OX7A 4WXWA 3UN2A 3EJMA 4MQVA 4MKYA 4HQEA 3TUJC 3HG9A 4JI6F 2RF2B 1FHTA 3C2PA 4WFXA 3LAJA 2BRLA 1NH7A 1UEUA 1IBMF 3OR2C 3GFXA 5ETVA 1M5HA 3L7PA 2H6CA 2ZC3A 1FXLA 5ETMA 5AE1A 4X1EA 3S17J 2Z33A 4AL5A 3HZEA 5DLGA 2E66A 3VAGA 2GA2A 2Q6BA 2KIMA 2O8XA 1F9FA 2P81A 1RAEB 2D69A 3GFMA 1S99A 5H9EJ 3IH4A 3M8YA 5CLSA 5DCFA 2ZC4A 2CGPA 4ZVTB 1S59A 2AS5F 2NVUB 4OZ3A 4GYIA 3JQKA 3Q8PB 1O3TA 2EINH 2HVSA 4HHUA 3ITHA 3OYHA 3PUFA 1VFCA 2XYHB 2K40A 2HDWA 4ZA1A 5I4MA 2YNGA 3TAPA 3T1HF 2GVDA 3EPZA 1WJBA 4IOCQ 1JUPA 2EBGA 4MYTA 3MEKA 2EPFA 3SFGA 1RUSA 4D5FA 1ZPWX 3QFWA 3CJNA 4ZCIA 1N88A 1M5PC 2BA9A 3KKFA 3K7AJ 4J9MA 1UEKA 1XMOJ 2EH3A 4LF5F 2JDJA 2BYCA 2OELA 1DPUA 1N34F 3SI8A 4AVPA 1CF7A 4LFAJ 1X1PA 3HVAA 3MR6A 1OCRH 1JK9B 1YHQS 2OQGA 5EZHA 2CG8A 5FKNA 1W5SA 5B0GA 1WSRA 3D1HA 1LJ9A 3TR5A 3M32A 2FGCA 4CLSA 2ZH9A 2FIUA 5JI6A 1V5VA 5ICCA 4LBPA 3AFGA 3ILJA 4TV7A 4FYVB 3LALA 2L9WA 2RKIB 3JAMZ 3D5RC 1JLCA 1IKVA 2M1BA 1KU3A 2BQ3A 4YIFA 1PO6A 1X9SA 1EV7A 5F1RA 3NGUA 3V8LA 1MIJA 1RTJA 3UFCX 1FJGF 3CJ0A 1J7KA 2G7HA 2J0QD 1L0OC 2DGVA 1X5SA 3O8HA 5AE3A 4B3SJ 3RW6A 3TJ9A 5FKOA 1RKWA 1KONA 4DF4A 4MGRA 5KG2A 1RKIA 2BM1A 2UV8A 2CH0A 2GQ2A 1RK8A 2HWTA 2B0GA 4L0YB 3GEZA 4AL6A 4QYRA 1EF4A 4H4MA 1HWKA 3AXMA 3TDZC 4ID5B 1V9OA 4XRMA 3EGVA 1X1BA 2N82B 5IQ6A 5DRKA 2XROA 3B4MA 4WXDA 2V9KA 1N33F 1UETA 1NK6A 3NP5A 5CXTA 1YITI 4WCGA 3U02A 3L9ZA 1JJ6C 4X4NA 2JVHA 3TUZC 1MSFC 3AA9A 2R7UA 2NS1B 5FLXU 3CCJI 3HVWA 4D7MA 4C30A 3LP1A 4B9SA 3SZGA 4FHTA 3HSZA 3OUYB 4QWEA 1LFUP 1FI4A 3IRWP 1U2CA 1XMQJ 3CDLA 4B3OA 2JUCA 1KA8A 1T0FC 3F3XA 3C6TB 5KT3A 1YX2A 5L38A 2ALYB 1YRTA 1L3KA 4C3IJ 4FXDA 1KVIA 3MCOA 2XY7A 5KG5A 2WAQA 2KRRA 1PBUA 3RW7A 2RHQB 2YX7A 1V55H 1S1VA 2E7WA 3KUGA 3RYLA 3PM1A 1OY9A 3EUKL 1U9OA 4LG3A 3Q2SC 3MEEB 5D5XB 1DTTB 3LWLA 3GIIA 1UFWA 3B6CA 4NLDA 1N8RT 4MIAA 2XTJP 2C2NA 2VQFJ 1FFWB 1FXDA 3NY0A 4AYBD 1N4LA 2HTJA 1VDHA 3RRHA 2X3GA 1WC0A 3P49B 2K3FA 3IR7B 2JVOA 2NXNA 1N6QA 4B47A 1OO0B 1HNVA 2O8KA 4ES3A 1RTDA 2DOFA 4WYLA 2ZJRQ 4ED1A 2XAGA 2KTQA 2GVDB 4KHRA 4DF8A 2M8DB 1N77A 4D1QA 1FNXH 1YRUA 3NGSA 4JI4J 3U2RA 2MKHA 2AGPA 2WB4A 1U0SA 9RUBA 2XUBA 2ADBA 4OMYA 4C2UA 3J80Z 2EK1A 3OTBA 2UXCF 4BDYA 3K5MA 2IJFA 3V7RA 2OP5A 4RAGA 1IN8A 4C3LA 2EQRA 3ASOH 1OYIA 5HL7Q 4W1UA 1GVJA 3ML6A 1R43A 5FDLB 2KG0A 3ZMTA 5KFOA 1DGWY 3BSNA 4I2QA 2C2DA 4G7ZF 3KK3B 1XC5A 4A3IJ 2NREA 2HRTA 4IKAA 4FYXB 1XG1A 4C8OA 1XN9A 3D3CJ 4C48A 3OYBA 2WY8Q 1HI8A 1EX8A 3G1OA 5KT4A 4BNCA 3AAWB 2C22A 2HHSA 3BTLA 5D6EA 5DD4A 3RJMB 1D8YA 3IP0A 2DNQA 1S1VB 5GADJ 3UCZP 3EGZA 2CUFA 1SUQB 2MD0A 3NAHA 3ABUA 3MKZA 3LTOA 3K0JA 5JR3A 1QUVA 1Y10A 3CCMS 2OPRB 1JJCB 2VA2A 1FLIA 2V6EA 5IV4A 3ZQ7A 2QLWA 5FD6A 1RHRB 1G3TA 1LUJB 3OUYA 5L1JA 4KH0B 1FBUA 2F65A 4HLBA 4M6VA 2IS6A 3N6LA 4DV2J 4DV7F 3UD3P 2QBYB 3HIFA 4HOBA 3GTQJ 2WVDA 3DOKB 3S3NA 3EVWA 2GM4A 4NI2B 2HK3A 3DLKB 1F2GA 4R0EA 2MA3A 3V8JA 2DI3A 2H9ZA 3CCRS 4YFXF 3G86A 1VYAA 1QY7A 3KHHA 5J6XA 4JQFA 1E17A 1WJCA 2M30A 4WE1A 4AWXB 4LB5A 2IJNA 2MKCA 1RLDA 4ZPVR 1H74A 4IH5A 1B9NA 3HYIA 1U9NA 1QVTA 3FCVA 3OVAA 1CC8A 3M6WA 4DZ6A 4LFUA 4AIDA 1NJYA 4G6QA 1N78A 3CCTA 2CQ2A 3HVTA 4BXXJ 1RR8C 2HHTA 2ZBRA 3RZAA 3MUMP 2XAHA 4DR5F 3VAHA 2WB1D 3R61A 3QAHA 1WJ9A 3C14A 3M6UA 2MGZB 2E36A 3RJPA 4P7TA 5E3PA 3FDYA 3H8YA 3F22A 2UZAA 3W8PA 2ME0A 2C2RA 1HSJA 1FRMA 3FXQA 5CABA 1TKTB 1W7PB 5IWAF 1HR0F 4KNYA 2Y75A 4L5JA 1FKOB 4ECVA 3G6YA 1JLCB 3HHLC 1T03A 4MK8A 4USMA 1SKUB 5HVHA 1TKXB 3K9TA 2HAIA 4XKWA 4M5DA 4GO1A 4PQUB 1KQGB 1S12A 5ED4A 1Y5LB 1PG5B 2QA4G 4ZP9A 1F0XA 4KHPF 3K2YA 2XIGA 2Y48A 5F64A 3SQNA 4LK1F 3R5GA 3SEZA 1CJKB 2KJWA 1R4NB 3U21A 3I64A 3KLOA 4WK3A 1SQEA 2HS0A 4A8WA 1JHFA 1GAOA 1Y5NB 5F0CA 4P1WA 3EUAA 2A3SA 3BPXA 1H7XA 4Q43A 1FWPA 3BGLA 2DFIA 3D1QA 4TU9A 4KSEB 1JT6A 2K9LA 1XR6A 3BR0A 4LFCF 3KP3A 5HOOA 1MBHA 5LSLA 1TL3B 5DM6Q 4O4GB 4L74A 4WP8A 1NDCA 2M7SA 3HULA 2MD5A 1MDMA 4JV2A 5SUHA 3BR5A 4E7JA 3GR0A 1X60A 3BJYA 2Z3YA 1KVKA 1J0RA 3CUNA 4WXCA 1WEYA 1O6XA 4B3RJ 4H0EA 3WHCA 5JHUA 3OL9A 3PO3J 4CCKA 4A47A 4DWIA 5LHHA 1SFOJ 2IC3B 2LXUA 1HR0J 5H20A 2OEKA 3IWZA 4U0WA 3RYPA 5ILVA 2CNLB 4ZJOA 4DU7A 1AFJA 3IH2A 5H6QA 4XIDA 1RADB 4W98A 4NLYA 4J01A 2A18A 3HBLA 2F40A 5KFWA 2MXYA 1I94F 4OMFG 2MJNA 3C8YA 4EYHB 1PUFB 4UUXA 1YIJS 4RW4B 2KISA 3K6GA 1JE8A 3GF2A 1SQFA 3FIWA 2BE7D 4OYBA 5A8KA 2HI3A 3TGNA 1FRIA 4LF6J 2HQ3A 1LWFB 3I56S 3LANA 5CYMB 3KEQA 4CYUB 1E6YB 1SD5A 1YJNS 4WK8F 2QM3A 2B8QA 4DPWA 4BBRJ 1KFDA 2P7CB 2DGXA 2EZIA 4KPCA 4FNHA 2OF7A 4MIMA 5J4YA 4FASD 4K4YA 4DPUA 1TP7A 1GTEA 3J7YU 3OXLA 2KT0A 2YNHA 4Q45A 5LGUA 4XK8C 1KC8T 2ME6A 4EEYA 4G12A 1DZ5A 4PQUA 2ZMEC 2GAHC 3BO2A 4ESFA 2NVYJ 1Z67A 4RM2A 3GTYX 3Q0VA 2G2YA 4HF1A 3SMZA 4DL5A 4LIUA 4WIIA 3KZYA 2LK2A 1KQKA 2O03A 1GT0C 3M2UB 3DRXA 2QLXA 4NA1A 2GHWA 3E6DA 1YG2A 4QWDA 3HOWJ 3DC2A 4NC8A 2QFJA 1O3SA 2DNPA 3I59A 3J7ZI 3ZGKA 2DA3A 1CULA 3KYCB 4E7ZA 4A8SA 3HCXA 1XS9A 1F36A 1NK5A 5E41A 3OD2A 2GHPA 2OJ3A 1HL6A 2PGCA 3W8GA 4M6XA 1ZKGA 4DV4J 3A01B 1CS4A 3JTPA 3CSKA 2MYSA 4U67Q 3GLLA 4USUA 4DV6F 4KJIA 4PJ0C 2WVEA 4YRVA 3T41A 2RC4A 1O0PA 4F25A 5JFRA 4JI3J 3GFJA 1X7VA 4ZCMA 2J5OA 4LFAF 3ONQA 3CC4S 4C8NA 4NX9A 1TL3A 4IFYB 2DH7A 3OFGA 1ETXA 2JA2A 1SAXA 3AODA 3UNGC 2KHDA 1N5VA 2F4MB 3I55S 3IM8A 1F5AA 2QYOA 4G8XA 4CLFA 3ABMH 2JN6A 2XAUA 1MWQA 1YZ6A 4WJBA 1HWUA 4IRKA 4A3DJ 3JSOA 2LU1A 1JLGA 3KLFB 1K6YA 1KOOA 5CYVA 5E3MA 4XK4A 1RACB 1M1KT 2E9ZA 1R4MB 3DU6A 3KEYA 1TL7B 2MQLA 1LWEA 2O66A 4Z2XA 4DR6F 4F91B 4HTJA 1YRNA 1Q8KA 2PBIA 2HOEA 3HMJG 5C42A 2KO1A 3MQ0A 1Q8LA 2DW4A 3H92A 4ELVA 4ZVGA 1TWFJ 1Q8IA 4AUXA 2HYJA 1XK8A 2FQQB 2VDIA 3ZO7A 2R7QA 4KGZB 2DR5A 2V8DA 3FMWA 2CPFA 3JTHA 2BDPA 2R7FA 3BWGA 5KNLA 2CQ1A 2DGSA 3W2VA 2WY7Q 4OI3A 4XIUA 1X2NA 4RW9B 4B3SF 3DM2A 2CZ9A 2CJAA 2E44A 4CYCA 1QBJA 4F7VA 4G1QB 2H8WA 4NXMF 2CVEA 3IGVA 1BI3A 3G6EI 5E3OA 1ZPVA 3BZ6A 4JUZA 1UZDA 3IH3A 4BHCA 2NYIA 2C3OA 3KJFB 4RX6A 1T38A 4J5OA 3QT5A 1ZYRF 2HIQA 2ZHBA 4K4SA 1SKWA 3PTWA 2K7KA 1HQEB 4A5NA 1W26A 1SJ3P 2XHWA 3AJ2A 1S1WB 2EEYA 2GAGC 3T3FA 3BG7A 3D6TB 2HYFA 1YBUA 2ZBIA 3CMMA 2CQ0A 4DUYJ 1PVEA 4RBVA 3ENAA 4PYDA 3BM7A 3DXBA 3R1HA 2HNZA 3CJ4A 4ETSA 4WTYA 3DXJF 1YKWA 1WF0A 5I3UB 4DL2A 2Y30A 2RS8A 1FDDA 4BE1A 3D54A 4ANDA 1OMIA 4CO3A 2EKNA 3M30B 4BE0A 4LUBA 3CCUS 2Z99A 4N4OB 2BW2A 2HVHA 1DTTA 2DMNA 4ETXA 2PJRA 2VKVA 2V6AA 2G4BA 1X3ZB 2KFZA 3BC8A 3P9IA 4OZ1A 4IJAA 3AD9C 2ZD1B 2RAEA 2HZCA 2XLIA 4USJC 4ELTA 2VFUA 3D3BJ 1QTNB 4X66F 3UR0A 4C8KA 3MAJA 1WJFA 4LLNA 5IXUA 3G2BA 1FVSA 1RT4A 3QPLA 3LSTA 3EYZA 3KNAA 2PEXA 5HDKA 5F1JA 5FJ8J 5E3NA 2NPIA 1LW0B 1IRGA 3VFZA 3WTZA 5ETRA 2B5JB 4ID8A 1TZLA 1SPBP 1IQZA 3ULQB 2XMWA 1IWAA 1NB2A 2QGUA 1ZTTA 4DOZA 4OZ2A 1FYKA 2MZ1A 1Y0UA 2XLKA 1Y0HA 4RNNA 4RU2A 3C6UA 4UY8T 1Z3XA 1NSPA 3T8TA 3DKWA 2V94A 2BHZA 1K47A 3G87A 1I94J 2IBDA 3HM5A 2J8AA 1S5ZA 1IXRC 2FRHA 5JJBA 3IA0A 2VKHA 3AL0C 2E5HA 4DN9A 3WDOA 5DD8A 2DJWA 1E6VA 4DCOB 3E01B 2HQDA 1AZSB 2JSXA 6FDRA 3BQZA 2ASLA 3JTOA 1GXQA 3E2EA 3BT9A 2XMJA 2KIQA 4OJHA 1U24A 2OCEA 2PI5A 5BPIA 3WG9A 2AZ1A 5J1NA 4IOAQ 3AB4B 2HFUA 4IQXA 4LF4J 2DVIA 4ZVFA 5B0BA 4K4ZA 3T1BA 5E8GA 3W61A 1HLWA 4RUBA 5ETKA 3FVYA 3A01A 4N41A 3RTRA 3CD6S 3P3DA 3JRIA 1HD1A 3RB4A 2AF6A 4P71A 1NH8A 1TV6A 4X66J 5FLMJ 3ZP5A 3QO9A 3BF4A 3DM2B 2HNHA 3UW1A 2K7LA 2OZUA 4UVBA 1NPRA 3QU6A 1RWVB 3OW2R 5AJ3J 3WODF 1WC4A 4P74A 5F0UA 4ECXA 4OX9F 5D8HB 2IP2A 4FDFA 4F92B 4CNYA 4KISA 1ITYA 1Q5VA 5FB2A 3M4OJ 2ECBA 4HNTA 2XMTA 1Y39A 5KG6A 3OMYA 1IXCA 2VUGA 3HFVA 3TJ8A 1XSXA 4IO9F 3Q24A 5L9XA 3ZZ0A 2VPZB 1T7PA 1D9AA 2J7KA 3ECHA 2I5JA 4WIQA 3OTDA 1WG1A 3V81B 3Q0WA 1HW2A 1T02A 3I55I 1TKZA 5D4OA 5F8GA 2VD3A 4RPFA 2DISA 3CP8A 3D28A 4QSHA 3LGHA 3OBIA 4IRDA 5FLXZ 5D5UB 1TUWA 1CJVB 5GAHU 2CWEA 2V4JB 3ABLH 2ZUAA 4WBFA 1I5OB 3KOAA 2VE9A 1FP2A 3GXOA 3TP3A 2W2PP 1IR1A 2BJ9A 2VOOA 3GCWP 2DB1A 5IP7J 3NGRA 3WTXC 1AYEA 3MM6A 3P6YC 2M70A 2RUSA 2L0KA 4ZHRB 1PCAA 4V2FA 5KFYA 1RABB 3RG6A 4YB1P 2AJ0A 3J7YI 3F73A 4O44A 2E1MB 1HFEL 2IVMA 3NCPA 4EGYA 3CCUI 1S6UA 1IZ1A 4QPOA 4IHWA 1KQ8A 5LHIA 2XCPA 4K4WA 3F8BA 1IKVB 3GLXA 4S05A 2WONB 1B72B 4WFAQ 2V4QA