1KONA

Crystal structure of e.coli yebc
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
244
structure length
233
Chain Sequence
GHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLDANPRLRAAVDKALSNNMTRDTLNRAIARGANMETIIYEGYGPGGTAIMIECLSDNRNRTVAEVRHAFSKCGGNLGTDGSVAYLFSKKGVISFEKGDEDTIMEAALEAGAEDVVTYDDGAIDVYTAWEEMGKVRDALEAAGLKADSAEVSMIPSTKADMDAETAPKLMRLIDMLEDCDDVQEVYHNGEISDEVAATL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title UNPUBLISHED
rcsb
source organism Escherichia coli
molecule tags Unknown function
molecule keywords Protein yebC
total genus 63
structure length 233
sequence length 244
ec nomenclature
pdb deposition date 2001-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01709 Transcrip_reg Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1konA01
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1konA02
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1konA03
1WJFA 4F3QA 1MW7A 1WJAA 3F9KA 1LFPA 1K6YA 1KONA 3HPHA 1WJEA 1E0EA 1WJBA 1WJDA 3HPGA 1WJCA
chains in the Genus database with same CATH superfamily
2M0MA 4CCHA 1ETYA 4I67A 1IXRC 2N3LA 2W57A 2VG6B 4JB8B 3M9MB 3HVTA 3J7AN 5CVJA 5LEKA 3LOUA 4K2JA 2VPRA 1IUFA 3ILIA 1VRTA 3EX7B 1D8KA 5FDLA 2XUBA 1SMYF 3OL3A 2GXAA 4II3A 1E2XA 4JI0F 5CKTA 3OYCA 4KIBA 4RW8B 1I27A 2ISYA 3DXJF 2A2DA 2Y1LB 3FGVA 3MKLA 1KU9A 3CJSA 1D3YA 1YZ6A 5BOXA 3MTJA 4TQSA 5E20A 4F50A 1B7FA 2OPRA 2YNGB 3J7AY 1U2RA 1S79A 4M94A 2ZEJA 3CJKA 2JEJA 1ZGAA 1FO1A 2CNLB 1T9WA 4XO0A 2XASA 5E2QA 1P6RA 4OYIA 4ID5B 4M63A 4QLCU 2PJRB 1YS7A 3PRVA 4WZQA 5IT4A 5LSRA 5L46A 4BE1A 3C6TA 3VGUA 1KP6A 2KP6A 4UY85 5AJ3F 2LEBA 3L9ZA 3A01B 1U0SA 4LK1F 2R7RA 2XTJP 2VBXA 5B7WA 4IDKB 4M72A 2NXEA 2MYSA 2KXNB 1FBSA 5D3GB 5BNGA 2ZVIA 1HW1A 1T94A 1XDSA 1UWAA 3VYSB 4PJNA 2YKMB 4K4SA 3QT5A 4OHZA 2ZH1A 4FXWA 3L2WA 5K8PA 3HSJA 5HROA 4BHBA 4J5OA 1MJBA 3BG7A 4Q2LA 4DPWA 2HYIB 2DYRH 2W8LA 1RTDB 1AB8A 5KFDA 4OHYA 3PCOB 1XMKA 4DV0J 2KMUA 3W2WA 2JLGA 1R0AB 1S6OA 5ILVA 4UUVA 3K58A 1UB9A 5B08A 3CMEI 3BKTA 4HW0A 1VQNS 1R8BA 1XJWB 5IYCJ 4Q8FA 2LEAA 1X60A 4ZHRB 2R7WA 1O3SA 2RU3A 2XNRA 4DHVA 1N36J 5IM0B 2M52A 1YJTA 2GIRA 3K4NA 4QR2A 2MSYA 1NJYA 3AY0A 3BG3A 3GVAA 3GTGJ 1Q95G 2VDHA 3I31A 1UKUA 5I4MA 2FJBB 2DNOA 4Z2XA 2JRSA 3Q3SA 3KNGA 3SV3A 1VQ6S 4F3MA 3UN3A 1C0WA 1S9FA 1FNXH 3FSXA 2CJKA 2VQFJ 1XSDA 2MLXA 4LG0A 1RAAB 3S17J 4K8RA 1X4AA 1VQ5S 2J0SD 2BKNA 1SQEA 1TAUA 1S6PA 3IG1A 1BOBA 3OUYB 4NZ6A 4XQFA 1SFXA 4YEJA 2AHQA 1C1CA 1TP7A 1FESA 3HSDA 2W4SA 4CUGA 2NVYJ 2ID6A 2FC8A 1IKWA 4E70A 1A7GE 1VCTA 1FOYA 3DHXA 3WX8A 4C3HJ 2B7EA 3DWLE 2IRYA 3WU0A 2DT9A 1KC8T 2PFFB 2WY8Q 3OVAA 2BOAA 4XKBA 2OTLI 5B0DA 1TW3A 1J5EJ 3MDFA 3K2YA 2BJDA 2NSCA 1HFEL 1ZQ3P 4ED6A 3HRSA 4TY9A 1RR7A 5FRMA 1FYLA 2BW7A 4CI0B 3OTCA 4DV3F 4IH6A 3ASOH 4NEYA 3NL0A 2WVBA 2XMKA 1S72I 3OYLA 3AL0B 3KZIC 2M2BA 3AFHA 1REPC 4CYUA 4NPOA 1MJ9A 3ICLA 3HSFA 4JI2J 2K8GA 1UWBA 1SC4B 1RKJA 1JIHA 3DTIA 5KG6A 5I3PA 1IBLF 2ZZTA 3MFHA 2R2RA 2NUHA 1QAXA 1Z21A 3KLFB 4ZLNA 2R8JA 5LJ5Y 4IF4A 5FFXA 1FLIA 3IGVA 4UUSA 2XQCA 4WWCA 2R5YB 1B7YB 2PI4A 3SBMA 5AE3A 2DA1A 4TV7A 2P8IA 2PO4A 1NU4A 1ZAOA 2ADCA 2XY5A 4N4OB 2F9DA 2WB1D 2RV8A 2KL4A 1FRIA 4FHTA 2CWEA 3GEZA 5GPCA 1A6LA 2AQFA 5ICGA 2FHJA 1U02A 3QP6A 3P49B 3CJ0A 2L9WA 5LOQA 3OTBA 1WKKA 3GYXB 4ECXA 1C2PA 1DQ8A 2RS2A 1ZG3A 4O44A 2HDDA 4HSTA 3EPGA 1WJAA 1LWFB 2XNQA 2PG4A 3TUZC 4IHYA 2X6WA 5KK1A 4KGXB 5EX3A 1G7CB 1KQGB 1TKTB 2BJ7A 3NAHA 1DDNA 5C2GA 5BPDA 3FQKA 1P7JA 2CPJA 3OW2R 1WSVA 5KFEA 3PJXA 2CQPA 2HQCA 3WIVA 1IG7A 1NH7A 4B3TF 3T5XA 2Y9HA 3K4MA 5C24A 3BYRA 3HOVJ 2DO7A 3V7RA 3I5CA 4CLYA 2M2EA 4C9YA 3W9HA 2HWIA 4V19X 5I42A 2JVOA 3RB0A 1YTYA 3OT9A 1EKRA 2G1DA 5B09A 2HS0A 4CM2A 4FQGA 4YIRX 4L73A 4HACB 3QJJA 1W0UA 2HWHA 5IV4A 3NMAA 1MU2A 2W00A 4FX0A 4KT0C 4BS9A 3GIIA 4OI0A 5IS2A 1LE8B 5J4YA 2WWYA 2DNLA 1YG2A 3PYFA 5E3AA 3EGVA 2E2IJ 1HBMA 3EGWB 4NRUA 3WHIA 4B3OA 3FDSA 5D6GA 2GMLA 1WH5A 1VHFA 2WK4A 3T1YJ 2M5WA 2G2OA 1UEUA 4J9VA 3CCSI 4NX9A 2WB4A 1RT5A 2K7LA 4MYUA 3MVPA 3VODA 2EFQA 2VE8A 3J81U 4DS5A 8ATCB 1IAWA 2VJ4A 3LSPA 5KG3A 3HZGA 4ID8A 4OYBA 1GT8A 4PSWA 1Y9OA 2HS5A 4JI5F 2QGUA 1YJNI 5AJ3J 5FD6A 2DHGA 4NI2B 3MWBA 1GXUA 3H0PA 4OYWA 1LW2A 1YRXA 3OBIA 2IRUA 1PILA 3QYBA 1WHUA 1VQ4I 2L7MP 2R7ZJ 3BT9A 5CYMA 3CZ6A 3JTPA 2DR5A 2ZH5A 2M45A 2HNZB 5L9NA 3I64A 1L3LA 3WC2A 2FA5A 4ZVRB 1AA1B 1I51B 1DFDA 5CYVA 2OPQB 2ZO4A 5A8RA 2R2UA 4RGRA 1OKRA 4ZOSA 3IRQA 2GCFA 1AXQA 1OSDA 2LU2A 2AYEA 4XORA 2PQ8A 1QUPA 1WF2A 3BGUA 3R5CA 1S29A 4C11B 2MLKA 3UD3P 2KDOA 3WTTC 2MB0B 1S7HA 3X2QH 4A3DJ 3HFVA 4ECVA 4C8NA 2IPOB 1FPQA 3LSTA 2EI5A 3EUHC 3OL7A 4HI2A 4D9JA 5HQLA 1R6YA 3J80K 4HV5A 2FC9A 2DVIA 5F8IA 4GYIA 4EJTA 5CD4H 3H2UB 3Q23A 5CVIA 2BXJA 3MMCB 4BYYA 3F8BA 3TUPA 1C4AA 4A8MP 3D68A 1WC0A 3GIMA 4TXSA 1ZM4A 1T0TV 2RN7A 2QL9B 1IKVA 1W2IA 1WSRA 1H98A 4U8VA 2FOKA 1O0PA 4C2MA 4LR9A 1KN6A 2BQUA 1VK3A 4URGA 3GMEA 2VXDA 2CG8A 4I64A 1LW0A 3SQGB 2VJVA 2FGOA 1RAGB 1ZOTA 2OMOA 2VA2A 4LFBJ 5GADJ 5HANA 1Y1VJ 4XRSA 5B66C 2H4WB 2UXBF 3QSIA 2LYVA 4S0MA 3WDOA 2ATCB 2ID3A 1J2XA 2QC3A 1UJ6A 3FBFA 1TKZA 2OU2A 1VZ0A 2F3JA 3T8TA 3TEGA 4FETA 2IY5B 3CMAI 1FF2A 2PMWA 3B6BA 3H98A 3E6DA 3MEGB 2Z58B 1IN7A 1GV2A 3IWFA 3AA8A 1NKBA 3S32A 5D4PA 2LCWA 1T0FC 3KOAA 2V8VA 5K5QA 1HW8A 2AJ1A 4R5PA 2Y8YA 4YRVA 1GTHA 2G7HA 2WC2A 4DNCA 5ADZA 4XDCA 1YI2I 9ATCB 2CADA 2QLXA 2KH9A 2R7QA 3DLKB 4LQ9A 4DR7J 3JRIA 1ZAXA 1TL1A 5D5WB 3G71S 2LY1A 2DD8S 4N76A 3LAJA 1E0EA 1FTCA 2FRHA 4ZA1A 4OIQF 1K79A 4EGYA 1KQ9A 3ITHA 3DN9A 2HQGA 2LQ8A 7FD1A 4M9XA 2HQ5A 1RBLA 1UFWA 3UCUP 4RW9B 2V4JA 3JRGA 2HHXA 4X4RA 2IW5A 2TDXA 1S1TB 4GKJF 5CPRB 4BE2A 3GFXA 3ISNC 2FLLA 4JI1F 4EBEA 3QGIA 4PZVA 1RWVB 3BB5A 3MF5A 1NK8A 1XTAA 1GEHA 1XN9A 1S4EA 3GX4X 1J5YA 3R1LA 1IW7F 4KFCA 4LQ3A 3Q2SC 3HC7A 1IR0A 3L4BC 3TP0A 1X5SA 1WHWA 1RR8C 2PMZD 2VQGA 4KN4X 1UAWA 3ISPA 3S15J 2XSJB 1FKAF 2O3FA 3FKBA 1S1VA 2ZOMA 5FROA 2CUJA 3GFYA 2A3SA 2Y2ZA 1YO5C 3EYYA 3MZHA 1EQ0A 2LP4A 4RDUA 1ZM2A 1WG1A 3KE2A 4CYCB 5MAOA 4V19J 4PFOA 2B0GA 1RE1B 2LXFA 3TX0A 3SMZA 4C0OC 1CS4B 2XMMA 3FFIB 4U7UD 2OHDA 1YOVB 5FJ8J 4RW6B 2M5YA 2X9DA 1NK3P 4A8WA 2Y9ZA 1GUUA 1R9TJ 1R27B 2BANB 3N6MA 1RQ0A 1BW6A 1WUUA 3M4XA 1J5OA 3ZQ7A 1VQ8S 4UW2A 4FS1A 3KYCB 4CH7A 1U48A 1L3SA 4K4VA 2OUMA 3OFEA 3ZZPA 3L1PA 2ZC3A 1K73T 4P5OA 2VHGA 3U1NA 2AIRB 2IC3B 4YUDA 1WELA 3PNIA 5DS9A 2MA3A 2KVQE 4DSIA 4DPUA 2XS2A 4I2OA 2KJBA 2HQ3A 3TO9A 1X5TA 1U78A 3RRKA 1VOMA 2DA3A 1PAEX 2KM8C 1RNLA 2MQQA 5D6EA 2GJ2A 2RREA 1JXVA 1IDZA 5HS8A 1XK8A 1P27B 1W7WA 3L95X 3ENWA 2WW8A 4F26A 4UB8C 3FMWA 4I6WA 3B82A 4LSNA 1HD1A 4MKYA 1IWGA 1HQUB 1ZZFA 5IOYA 3SIPB 1G3YA 4OIRF 2RC4A 3RW6A 2RUSA 3PKYA 3GU0A 3MM9B 2JHEA 3LUYA 1HNIA 3NCQA 2MY8A 4CLUA 3WTWC 1IBMF 2FOWA 4A3CJ 1KWMA 4HF1A 4EGZA 3M32B 4IQ4A 3PM9A 4FYXB 8AT1B 1RJJA 3MR7A 2A5YB 3DU5A 3M8QB 3G8SA 2BE2A 4G6VB 1WTBA 1WQ2A 1PAUB 1X4OA 1RT1B 3E6MA 2ZVSA 1SKWA 2IBDA 4KIGA 2DHXA 4R25A 1Z91A 4DN9A 5ETQA 1IRGA 4A0ZA 4ZPCA 1VIOA 1BL0A 4AL6A 4M9ZA 5E3OA 3LWMA 1S10A 5E1WA 3CCEI 4MK8A 2VQFF 1DY3A 3HSRA 3C8YA 4JUZA 2BW2A 3KLGB 4O4GB 2Y48A 4UZCA 2A0FB 3FBNB 2Y0SD 2CXEA 2ELHA 3K1PA 2HKEA 5K5OA 1E6YA 4ZVGA 3ZP5A 1VQPS 2O0YA 5KOWA 3LP1B 1HNXF 4CO4A 3POTA 3J7YJ 3ASNH 4O3SA 4AFFA 1ACIA 3UQSA 1XBWA 1OCTC 2MPUA 4F3QA 2HNZA 3V5RA 4LF8F 3TL4X 3T5KA 5A8RB 4HVZA 3QODA 2JJ7A 1Y5LB 3D5SC 2FJDB 2E5NA 5H9FJ 3GZNB 4A0YA 2F8HA 4C30A 3GJTB 2X3DA 4OHXA 3ENQA 2DGSA 3D4JA 1HD0A 3UCGA 3DOLA 1BLUA 4XDDA 3NY0A 4GO1A 3DRPB 1RTJB 2JA5J 5F8NA 4IHWA 4PXBA 4M6YA 2WCXA 3VAHA 4C8ZA 4XONA 2HYGD 4RA2A 1QSSA 4IPAA 5KFRA 1FDDA 2Z33A 3KTQA 1S1WB 1ZKGA 3C1DA 4ZIWA 1XSXA 1S9EA 5KNLA 4HQMA 3MN2A 1G6BA 1HHSA 1FP1D 1Z3XA 4XTTA 3WIUA 1OPIA 2MQOA 3KUEA 4NHJA 2DNGA 3V8JA 1V3SA 3RZAA 1SXLA 3EYIA 4AT1B 1S9GB 1O6XA 1NK9A 2VPYB 2HQIA 2W2NP 4PKDB 2UUWA 2E1OA 4LGWA 4YN3B 3M30B 1N5SA 1SAUA 3M9NB 2QTWA 3P9IA 3ZCOA 3S1NJ 2CG4A 3JTOA 1RWOB 5IT3A 4FF1A 4TLRA 3LGHA 4CZCA 3FXMA 1E3OC 2JA2A 7AT1B 1Q8LA 4X65F 4M3DA 3G73A 3PIOQ 2BYVE 5EX0A 3JB9k 1RWUA 2BM0A 3I0SA 2ACYA 2O03A 3M8FA 1A36A 5KFJA 3A02A 2ZUAA 1J0RA 1VI0A 1MNDA 1QE1A 3HDSA 3N6LA 2J6UA 1Z6TA 1RC9A 2V9PA 1J2VA 4JI7J 1RT3B 1ETOA 5KFXA 3FXKA 2VQEF 4HL9A 2DXIA 5TJJA 3GFLA 1R1VA 4ED8A 1QZZA 5DO2A 4XPCA 3DOLB 3MUVP 1X9SA 1GVDA 2X1EA 2FVSA 5K7HA 4EM0B 1IJWC 4MKVA 3J81j 1HA8A 5K9FA 5L3FA 1RHJB 5G0RA 4NXMF 2OFGX 1R8PA 4O0IA 2HXIA 3D1OA 4HH1A 3RB3A 5KHDA 2DXDA 2HVQA 3V2UC 3FX3A 3BJAA 3KJFB 2HEOA 4D5CA 2UVWA 2VONA 3B4DA 1IWAA 5DLFA 3CIMA 2OH2A 4LSLB 3B8HA 2BJ8A 1N32F 4LFCF 4NCGA 3HDDA 2XKPA 1TELA 2YKQA 3FJ2A 2P81A 4KGVB 4ZYEA 4OYOA 4V2FA 2HNDA 4ABZA 3B6CA 3HL2A 3AAWB 2IGKA 1FJEB 4XN3A 4XICA 2JZYA 1HC8A 4KIAA 3T5LA 1T11A 1WOOA 1FK9A 3NS6A 1K1SA 3M2UB 1U6BA 4LF7J 3PEHA 4N4NB 2ZKUA 2NXJA 5L1IA 4LUBA 2IPQX 1B9NA 4KR0B 2N4CA 4CTAA 2HHPA 1I94F 2E5IA 4K5SA 5J1NA 2ECBA 5J2MB 2HOSA 3Q89A 5LMNF 1T05B 5H9EK 2DEIA 1OY6A 3HT0A 3EYZA 1NLKL 1TQMA 4NLTA 3CO6C 5DDQC 3LO3A 1V4RA 5FKMA 2M7AA 4PZJA 1PBUA 1VRUA 5BYSA 1PGZA 1FEEA 1JX4A 1XGNA 2PMHA 3MCMA 4A3BJ 1NHVA 3RPUD 3OXLA 1YE9A 3R6SA 1Y56A 5HP1A 4OWRB 4BS2A 2JVHA 2V1DA 2ERRA 1ZTTA 2ADUA 4ECZA 4XOPA 2PLYA 1JLEB 4MH8A 1UVJA 4QW9A 1N0UA 2UWMA 2Y0SN 1HBOB 2R7UA 2LY2A 5HLHA 5BMZA 2E44A 1SKUB 3MMJA 5KT5A 3R2CJ 4C8YA 3HB9A 1R22A 1EF4A 4DV4F 1B0TA 4NLYA 3H7HB 3QNWB 4W97A 3R0AA 3C2GA 4NI2A 4Y3OA 1CG2A 1RWWB 1VC0A 3PHEA 3V4MA 3NGKA 1Z3YA 2JVRA 3CCUS 4CICA 4YEAA 3QFWA 3BDEA 2QYCA 3EVOA 2V7FA 4C8OA 3SCJE 1U1LA 2JPCA 3JSOA 4F0KA 1YX5A 4HHJA 1IQZA 2J0WA 3PQKA 1W2BR 5LMNJ 1M0SA 3F6OA 5K20B 1NH8A 2YXLA 4UUSB 1Y0NA 3K0JA 3K89A 4UZBA 2DODA 4DZJA 3VYUB 1U8RA 1KYZA 2MZSA 2KIQA 4UF4A 1FIPA 3GTJJ 1NH3A 3PO4A 4A3JJ 4DFPA 1QO0D 2BHYA 3MCOA 5KT2A 3CEDA 4ZP6A 1YHQI 4K2EA 3HP6A 3ISND 3I0TA 2ZBRA 5E8IA 4X66F 3OIQA 1SPBP 2WVEA 1B4SA 2ZITA 4LF5F 4RX6A 2DCLA 3PJRA 4UY8I 1MD0A 5KFTA 4FDFA 5C42A 3X3UA 3K5MA 2N7YA 1TNTA 3CGIA 4ZDPA 1HKTA 2GQ2A 1JMTA 3MM7B 3S01A 2E9ZA 3S3MA 4HH0A 3GFZA 4LIWA 3NGUA 3MHYA 4I4BA 1XG1A 4RPFA 2VDIA 3HZEA 3QRRA 4Q4ZF 2VT2A 1AFJA 2V1NA 1QTMA 5IP6A 4FF2A 1O4XA 3PW0A 1P2FA 3T0YA 4B08A 5GAGU 1BQXA 3R1HA 2L5QA 4CHUA 1LEOA 2VIHA 4N7TA 3OR1C 1UL3A 1R0AA 1V54H 4UNOA 4PJJA 4IH7A 1JB0C 1VBKA 4ON0A 2N4DA 2DLLA 3U9GA 3P9CA 3Q8RB 2EV6A 4ZVTB 4LIUA 3BZKA 3U1MA 2W01A 4ECRA 2X6YA 3TKYA 3DDNA 3CJ2A 3LF0A 4A3GJ 4GRSA 4Q0BA 4DZ6A 5HBMA 3RAXA 1UHWA 4BBRJ 2Z4PA 1JJHA 2OSRA 5HVQC 1B0VA 4RAZA 2LBFA 2QE5A 1SANA 3T1BA 1FKOA 2QL7B 3M1VA 2MLGA 1RTZA 3W6VA 2A3JA 3TARA 3KJVA 2V4QA 2Q43A 3ENVA 1XMBA 4OIOF 1HBNA 1D9FA 2WB1A 1Z05A 2ZKTA 4DX8H 2DPIA 4LJMA 5GMEA 3ENAA 4JV5J 4FX4A 5HVFA 4DV3J 4ZH4F 4IHSA 4IKAA 4LG0B 2Z2LA 3LSIA 3UO0A 5HJYA 4U7CA 4MIMA 5F3TA 3WU2C 2AV5A 3VHQA 1F5AA 2WZ1A 2FY8A 4RU2A 1OS5A 2VQCA 1TUVA 2WAQA 3KP2A 2K2PA 4FVMA 4KBIA 1IVZA 4WPAA 4UOHA 1WI6A 3ZQFA 4J37A 4XOTA 1XGSA 1B70B 2W7AA 1SD5A 1JXEA 2PBIA 1KD1T 3JSRA 4DR6J 1M1KT 2PSZA 5GAHJ 3FXUA 4RR5A 4I0AA 3RRHA 1UCRA 2OZUA 1VISA 4JV5F 5J2QB 2RKHA 1WHXA 4ZVPB 1W1WE 2HHTA 2FQQB 2Y0BB 2CQHA 3E97A 2MSTA 2E5JA 1U25A 2MG4A 1VJQA 3M8JA 3ZZRA 2E34A 3ZTQA 3AG1H 4CYUB 2IXSA 2J0QD 4BLGA 4Y2KA 3U7JA 4PWDB 1HQUA 5M3FJ 4HF2A 4ED0A 1EP4A 2AS5F 1RACB 1FYMA 2XGCA 3W2AA 3EGNA 3TQNA 3J80Z 1T8EA 4E7JA 2PC6A 4ZDLA 2ZZMA 3NAUA 2QL5B 1DTTB 1JLQB 3HKZD 3VQTA 1S59A 1YJUA 2MXYA 5ERIA 1UW9A 2IVYA 3CCRS 1DARA 3CCSS 4X4NA 4B9LA 2A61A 5A0YA 1PUFB 2MGQA 3NG8A 2P5LC 4IG0B 4XLHA 3FISA 2Y3YA 2M0CA 2DN0A 4LJZF 5D8LB 1JKPC 5G4DA 3ML6A 4F3OA 2JWNA 5C4JJ 4A8XA 2HNDB 1BI3A 2FY1A 3DLBA 3FEYB 4AXIA 4U87A 3DLGB 1XMAA 1AUDA 1LWCB 3BOQA 1CF7B 3RB4A 1VBXA 3CJKB 1IV6A 3OYHA 3IM8A 2CAJA 4L76A 2PMZN 4CCNA 3DU6A 3HJFA 2H94A 1LDKB 3K4KA 3FQLA 3CUNA 2RKIA 2CQDA 1T05A 3WTZA 3CW2C 2QMWA 2DR8A 3R3TA 2I10A 4KPCA 5GAEI 4LF6F 4YG2F 2IGNA 3WG9A 3OVBA 3A1YG 1TZLA 2XZWA 3N4WA 1JGSA 2E1RA 3MZYA 1Z2LA 3CMES 2ZKZA 5BYRA 2BW3B 2BX6A 1ZRCA 2ZZNA 3M8PB 2R7SA 2FD5A 2JSPA 1PJ5A 2MKHA 3C15A 1FKOB 4L3KA 2CPZA 1HQCA 4NXMJ 3AH6A 4TQRA 4QW8A 2OPSB 4RWWA 1W26A 3DKDA 1XR5A 2CUEA 3LALA 4D5FA 4DMZA 2XF6A 3BREA 3J81K 3FIWA 9ANTA 2YVSA 2LDYA 1S7OA 3N97A 5I3QA 1WDTA 2OEJA 4ZN1A 1NMEB 3A3OB 3GMGA 3VV2B 2FNAA 5AXMA 4M3FA 1QU3A 4JBAA 3SZGA 3CO9A 3A8JA 4RW9A 4YY3F 1YJVA 2UU9J 3CD5A 2N8GA 4QYZK 3K6GA 4OMYA 3DLGA 2BQ3A 5LL6d 2MKSA 3IM9A 5B3SH 3QIPB 1JKRC 3HHKA 4ED3A 1GK8A 1MN7A 1CJTA 1FEHA 3RBEA 2B51A 4ZP7A 4OYZA 2D5VA 1ZR4A 2H9ZA 3KETA 2ZXHA 4MQVA 1VQ4S 5EGOA 1XD7A 2YNHA 4B3MJ 1NPRA 1OFCX 3MM5A 3UD5A 4HT7A 3EUAA 1YVFA 3V8LA 4RZRA 2A10A 2YWEA 3BDPA 1X58A 2F6CA 1KGSA 3AOCA 1IM6A 2VA3A 1MBHA 2W2PP 1UVKA 3M3YJ 5SZTA 1U4BA 1YX3A 2QCOA 3HVWA 4KO0A 3RQ4A 2BACA 5DS7A 5A8WA 1YK9A 3M6XA 2Y31A 2DEJA 2QN6B 4L74A 5IOZA 1YBTA 2GHPA 2XMTA 4USJC 3C2HA 4RBOA 1QAYA 3CCES 3ZPLA 2XC7A 2V8GA 4P9UA 1BXNA 3S2DJ 4KQZA 4DL0C 2LREA 4XKCA 1HWLA 1KU7A 4S05A 4XKWA 5EDWA 4K4UA 2MZJA 3RIRA 5DQHA 2F48A 4O3QA 1HPZB 3K5LA 2F7VA 1Z2ZA 2IS2A 4DSEA 1A5JA 2MFZA 3L09A 4J7CA 2YH0A 3F0NA 2VU5A 1MMAA 4LREA 2AQEA 2XMAA 4E2FB 2ZJQF 4FYDA 1X9MA 1N52B 3HGGA 3V6KA 3QYYA 5A2QU 3LAMA 1BD6A 4ED7A 1T33A 3OLBA 1CQTA 1HQEB 2F8MA 3H0DA 2Q6BA 5DUIA 4IQJA 5BS6A 3LQRA 4NZ7A 4QIWD 3RU0A 4CP5A 5CHCB 2CQ1A 3TJ9A 1IXCA 4EMSA 1BIAA 3OR1B 4C3LA 2CDQA 2RILA 3LTOA 3D0GE 1FDAA 3DI6B 2DNZA 5HI7A 2R4FA 3CC7S 5LSLA 1SH0A 2VIXA 3NEKA 2LBFB 3MM6B 3SQNA 3F6VA 4UOGA 3GP9A 3ZZ0A 3KYDB 4LD5A 4MNUA 4DR1F 4DSFA 2HGNA 3QPHA 1BW5A 2F4VF 1GMUA 4DXLA 1RP5A 1FRHA 3KKFA 4RNOA 4IL6C 1YIOA 2CV1A 3HPHA 3OVSA 2J9DA 3BG6A 3E1SA 2COMA 4GC6A 4O6JA 4B3SJ 3MR5A 1KONA 2WTFA 3KLGA 4K59A 3OFFA 2AGQA 1C0TB 3PO3J 3VSKA 4F4YA 4RW8A 4BDYA 1SD7A 2IYIA 1V3ZA 4X84A 2DMPA 3CCJI 1F36A 5I42B 3T8RA 4GRIA 4I7FA 2ISZA 3S2WA 1BMQB 3F8CA 1TK8A 1DP3A 5CH7B 4BAYA 4TN2A 1Y8QB 1NJWA 1URNA 2HKOA 2RB7A 1VI7A 3EZOA 4USIA 3PYEA 3BR1A 3L7PA 3PX4A 1S3JA 3H5SA 2OKQA 2A18A 2ABYA 3S6EA 3TRGA 1EA3A 4ED4A 1EH6A 1JLBA 1BUXA 4DR6F 3H90A 2XYHB 3JAMU 3UKGA 2YWWA 3O6QA 4U0VA 3P8BB 1DAXA 1USTA 1R4MB 2CZ9A 2XAFA 4RGUA 1RT2A 3PZPA 2MQLA 2HSEB 3DRSA 5LLQA 2JOQA 3S1RJ 5ICCA 4PUSA 2X1GA 1SJ1A 3W66A 5H9EJ 5F3ZA 3I6PA 4QYRA 5E0OA 3V6HA 2WV0A 4E7SA 4BQQA 1KBRA 1VJWA 3D6MB 4LMZA 2P8TA 4WK8F 1WOPA 3G4SS 3LFUA 3PW2A 5LGNA 4QIVA 3NGRA 3GSIA 2ELJA 1E3HA 2EA2A 2ASYA 4X6AJ 2ZFUA 3DLAA 3FXJA 2HAFA 1U24A 3HX9A 2QBYA 3K59A 4AD9A 1QQIA 4M6VA 2HFUA 2G2YA 4GMKA 3TJ8A 1H38A 2CZ4A 1EB0A 4XLCA 2G0JA 4UV8A 4YB5A 2AGPA 3U2RA 1U1MA 3PX6A 2ZJRF 1H2VZ 1WJCA 1SJQA 3W6KB 3JSMB 2OELA 2E71A 2QLZA 4UTGA 1FMWA 4C2MJ 1CSJA 3K7RA 4HDGA 3RPQA 1BE4A 1EKSA 2Y0SA 2EZKA 3CCLS 2HGLA 1C0UA 1NJIT 3KHLA 2EZIA 4K4ZA 1B59A 4ENKA 1AW0A 3OV8A 2ILZA 3DBLB 5LGTA 4LF9J 1DP7P 3D5MA 1JWWA 3HOWJ 5D4NA 4O0NA 2CNOB 3BPXA 2CPYA 1HBMB 2QYOA 4CQ1A 3C46A 2ESNA 1SFOJ 3SQOP 1ZGJA 3FRZA 1MBGA 4XKVA 1VQMI 3TBIA 3TX8A 3VGVA 1VQOI 3I4HX 5KFPA 1LV5A 4LF1A 3BJOA 3NWSA 3OFHA 3C19A 4P75A 2M8HA 1F43A 3GTYX 3FK7A 4K7QA 4NC8A 4PG6A 4ZJOA 1HNVA 2HLTA 2BYCA 1KVIA 3BTJA 2IA2A 2QLJB 3KK2B 4RMNA 1KVKA 1FE4A 4NOHA 2AGOA 1IKXA 3H42A 1RGVA 3OTDA 3OOPA 2D3UA 3M2UA 2HPMA 1UELB 3B73A 4TY8B 5EGOB 1YW9A 3MZ8A 2QSWA 1KQSR 1F9NA 3PW7A 3G71I 6FDRA 3S1MJ 2L9NA 1O8BA 3GFHA 2GQQA 2MYFA 4P7TA 3QJPA 3IGNA 4WJBA 1ZS6A 4KV8B 1RPWA 2DFEA 3DMJA 1UFMA 4CRJA 4OZ1A 4CO3A 2YKNB 4RGSA 1CJUA 2XEXA 1KU3A 2J5PA 5D4OA 3M1EA 1YIJS 1UTAA 2JSCA 1IRXA 2UV1A 2FQ3A 2M3DA 4M9SA 1XNRF 3J7AO 1M1HA 1FYKA 1TQLA 2OAUA 5F9NA 3G86A 3OXGA 3C6TB 1PIEA 1DTTA 2KFNA 3OMYA 4I02A 3M2RB 1VIXA 2BE7D 2VG6A 1CVJA 2EK6A 2FSWA 1R5HA 1N8RT 2DA4A 5CAAA 2HS4A 3GLXA 3LMMA 5LSOA 3AG3H 3EMTA 4ENOA 4RJVA 4JI8J 2CNKB 3QFHA 1I3OB 3CDIA 1MGTA 3E6CC 1R31A 3CDEA 2FDNA 5LHGA 2GVDB 3SXYA 2OJ3A 3KEYA 4BY1J 3G1LA 3DKXA 3RAQA 3I5UA 1FJCA 2B9SA 4A8FA 1TV6A 3IAM2 5AT1B 2RVJA 1N78A 2FJAB 3P96A 3CJ3A 5KFKA 2HK3A 4E6KG 2XSJC 1ODDA 1BR2A 2FBHA 1WD6A 3M30A 3GXOA 5DDOC 4B3AA 1TVRA 3HMJG 1YBUA 3I0RA 1R36A 5DCFA 3TDUC 2GHWA 3PYDA 2YNIA 1DHMA 3T6JA 4C0BA 3Q0UA 2GMHA 1BQMB 5FD5A 1JNZB 3C6UA 4UQTA 2H1KA 3E3VA 1BIBA 3BR6A 2OI2A 2VC1A 3L7OA 4BQAA 1RTJA 3Q8QB 1PJ6A 1KNZA 3NKYA 4CNZA 2IA6A 2W9BB 2D1CA 2ZBKA 4DR4J 1TL4A 4DUZF 3PO5A 2PE8A 2D3O1 3X1LB 3SSRA 3UPFA 4N8OA 4KNYA 3AXMA 1VQ9S 1AUSL 2FXAA 3GZ6A 2Y1RI 4NLPA 2MGZA 3TOBA 3K69A 2STWA 1D3WA 3HULA 4M5DA 5LM7E 4BH9A 2J76E 4L18B 5KT3A 1KLMB 1FKPA 1APSA 3BEGB 4NLDA 4LB5A 2OTJI 1GFWB 2D1HA 4DV6F 3I59A 1ZARA 5IT9Y 4AUXA 3U1DA 1JTXA 3EVWA 2O5DA 4UB6C 4ICLB 3DGPA 1IXKA 3TAQA 4JI3F 1DURA 3W7BA 3ZZUA 4F52A 4I6YA 4WK1A 1LDJA 2WTEA 4U6PA 2KKHA 4PG5A 3UNGC 2IAJB 4QIFA 3S2HJ 1E6VB 2CKWA 1IJFB 2OZ6A 3GILA 1HCRA 4M74A 5M2PA 2JPBA 1TK5A 5KFZA 5IYBJ 2JC1A 2V79A 5HMXA 2CV2A 2L4MA 1ZLJA 3MOZA 2W1OA 3GPAA 2ZFWA 1S0NA 4NA1A 4C11A 3S3NA 5E3QA 4WP9A 4W4MA 3TW6A 3OYIA 5B0GA 5CYJA 4ILRA 4KGKA 4Y28C 1SQFA 1C1CB 2FTRA 4NMXA 4ZVEA 1R0CB 1KHVA 4IOAQ 2FNPA 3MMAA 3OSFA 4M1KA 4HLBA 3FMSA 3SFUA 3BKFA 3PR5B 3QLHB 1EJ7L 1ZETA 5A2QK 2CJBA 2CIMA 1P7IA 3ERMA 4IXAA 3BSOA 2QM3A 4WCGA 4XBFA 2W4CA 2BGCA 1UG0A 3MR3A 4BACA 3HOXJ 3H9GA 1VBZA 2P4WA 2ZNYA 3KLHB 4A8OA 5J1EB 4EZ6A 1YITI 1RWMB 4Y2IA 2IJLA 4RUBA 2XIGA 4DL5A 4NLVA 2HOEA 1F2GA 3OIPA 1BWEA 3NGDA 4AYBA 1S97A 2J6TA 4DR2F 4AIHA 4G1QB 2YNHB 4CCJA 1V5IB 2OD4A 1UETA 4CTAB 3GTKJ 1XC9A 2MH2A 2X51A 4B43A 2I1RA 3NNCA 2YKOA 3QGPA 5BQTA 3HD2A 1QLNA 3A2KA 2AZ1A 4CT9A 4WF9Q 3IH4A 4OZ3A 1RAJA 3DFGA 4XIDA 4CGZA 5IZHA 1WRJA 4G1IA 1DZ5A 2NXCA 2HEKA 2RHQB 1P4WA 2VFUA 4BL0B 1FFWB 2A6MA 2MLYA 4N41A 2FGCA 4MIBA 3D5RC 2PIIA 2MKCA 2YUSA 3WE3A 2KHDA 3ELHA 1LWXA 1D1AA 5J2PA 3BQ0A 2EIJH 2AHOB 3A8IA 2IAIA 2NAZA 4B44A 4X2BA 5F0HA 2LTPA 5HDGA 2DW4A 3RR8A 2XF5A 3CJNA 3LA2A 1BJAA 4EJOA 2E2HJ 3TZXA 4WKYA 2F4MB 3RZDJ 2VL8A 4IRCA 2HFNA 1QHGA 1N88A 2YPYA 3DTKA 4JI4J 1VNDA 3PACA 1AKHB 4BXUA 5T41A 3FSIA 3K4CA 3SFGA 3Q22A 5DTDA 3TO7A 2XWXA 2HHSA 4O5VA 4WXOA 4MKAA 4E98A 2AF6A 3RTRA 3HHHA 1Q5YA 3CP8A 3W9IA 1B8IB 1R8HA 1IUYA 1X8DA 4DQSA 4EO6A 2UVUA 1XMXA 3BJYA 2NXNA 3BG9A 5KG0A 2QQBA 3ET6A 2V2QA 4R79A 4H4MA 1NCLA 4OIPF 1CQNA 2WVCA 2QKMB 3BG5A 1JHFA 2EEYA 3CD6I 2EPFA 2JA7J 1TLHB 2IGMA 5BPIA 4KT6A 4W98A 3O8HA 3W2VB 4FZVA 5E3LA 2EINH 4NA2A 1BOAA 3VYTB 5KVRA 3BY6A 4PAAA 3CCVI 3C14A 4CIOA 4KB7A 2Q1ZB 2GQCA 3TNVA 3BWGA 4OJHA 1X3WB 3DPTA 3HFKA 3HD1A 1JLFB 3VWSA 4Y00A 1XGMA 4BJ5C 2EIMH 2A6OA 2JJ4D 2G0EA 4ES1A 2DDAA 3RTVA 1VTNC 2K27A 1I1GA 4LLNA 1ZGWA 4NC6A 2KO1A 3WODF 2OC6A 3OTOF 1S1UA 3HLUA 3JW4A 2X1AA 4B9MA 1TL3B 3ULQB 4NQWA 2HWVA 3N5BA 4DV2F 4I98B 3MAAB 3EXYA 3BN4A 3ZGKA 3HGYA 2HVRA 5KFVA 1VHIA 3MMYB 2HW3A 1RIOH 1CGPA 3IH3A 5JI6A 1UVNA 1F3VA 3CDBA 2FLPA 3ZQHA 3OYDA 4BBYA 3PY8A 4V2GA 2QWWA 3FWEA 1WJ9A 4UUXA 1P4XA 1HNXJ 3BPVA 1XN7A 1HA1A 2DTZA 3BPDA 4L9VA 5F1RA 1MSEC 2K9SA 3TW0A 1TWHJ 1G4CA 2E1CA 4BU2A 4DGWB 1NZ8A 4RNMA 4KKOB 2HDCA 3KG1A 4PQUB 1RESA 1N4LA 3KHHA 3TP3A 2J9CA 2O3DA 2M4MA 3PFEA 4DCJB 2PA8D 2VQLA 2WONB 2EA4A 1M5VC 4S0HB 5ETLA 3GG0A 2KZVA 1QVGR 4KA4A 4Q47A 2A68F 2VF3A 1S76D 3CMAS 1N75A 1JLFA 1AOYA 1FE0A 2CZVC 3VZHA 3FHNA 2GAUA 3ZQQA 1LVAA 4FXDA 3IHUA 5F6FA 3CCQS 3P45B 3VAMA 4CLPA 4OINF 1N34J 4JP8A 3UI3A 2IP2A 1O51A 3O2PE 2LVSA 1QAJA 1M1EB 4O44B 1S1UB 4F04B 2UXBJ 5B1AH 1HBOA 4JOMA 4BQNA 1SC3B 2FJXA 1ENHA 4UVBA 1X0FA 1J75A 1GT0C 5HL7Q 5TISC 1TKTA 2VJ5A 1N0VC 2YY3A 3OS1A 1POGA 5H6RA 4Y2MA 5T7LA 3S3OA 2C2NA 4R5PB 2H8WA 2FHMA 2VFSA 2BY2A 3SFZA 2P5KA 4TYAA 5DZ6A 4DR4F 3CWJA 1F5TA 2AQ4A 4MLOA 5K5MA 1WFXA 3I55S 3RYPA 3GLJA 4N9IA 2HQRA 4ICLA 4U95A 2GA1A 1UMQA 3HXMA 1YHQS 5KFNA 3MTKA 1ZYRF 2MSSA 3NLCA 2XMVA 3QZ7A 1S0VA 3A12A 3S1TA 5E3NA 1K0TA 3A0HC 5DCMA 3K4LA 5HS7A 1JT0A 4F8RA 3Q86A 4GKKF 4X4UA 2H48B 1DU0A 4WXDA 4XR6A 3R60A 3DOMB 1R8AA 2YKNA 3TGNA 1X0PA 1X4PA 4CYCA 1S7AA 3IMQJ 5FLXY 4XK8C 3OLAA 3UR3C 4II2A 2V2KA 3BZ6A 1FTZA 1ZM3A 1LPQA 4CLFA 3JRAA 3WHCA 4RW7A 1SJFA 3A13A 3PG9A 4TNOA 1MKMA 3OUYA 2LYCA 4KTQA 2IM0A 4JI8F 5GTHC 2QA4I 1U8WA 4HV6A 4LRCA 4ED5A 4M3BA 3M07A 3MMBA 2PA3A 4XLEA 3IBCB 2DR7A 3RGIA 1LNWA 4X62J 4PEOA 5ETMA 3FNNA 2NPFA 4A3LJ 1ZG1A 1HBUA 5DGBA 5C3EJ 1RLCL 5K14B 1N6QA 4PJLA 5CLSA 1UA0A 5BR8F 1U49A 3BO4A 3GWCA 2JUCA 4CH1A 4LF4J 2J8AA 3PRBA 4C3MA 2R8GA 4JV2A 3FBBA 5FLMJ 2LNBA 2E7WA 5CQGA 5J8CA 4X64F 2GVDA 4BGDA 2C2OB 2P7VB 4N0BA 1XNQF 2DRAA 5HVGA 5D77A 1BR4A 2FJ1A 3WQPA 4M5JA 4LRBA 4ELTA 3HZJA 1FOXA 3EDRB 1FZPB 1WWXA 5HODA 2LU1A 4AC0A 1VQPI 4Y15A 1FRLA 1S1VB 3IRWP 5I3UA 4PXCA 3PW4A 1SKRA 1O57A 3EZUA 2QQAA 1FDBA 2EB7A 2UXCJ 1WHYA 2Z56B 3CJ5A 3PIPQ 4EJUA 4RWXA 1QPIA 4G3IA 1NK5A 5A8WB 3MOJB 1VQOS 3H3VK 1F2HA 3HKWA 2ZXWH 1S6PB 3ZMZA 3CUQB 4WXWA 4LIRA 4TLQA 1BN5A 4Z2YA 4Y3CA 2RDIA 3K7AJ 3J7ZT 4HDHA 4F2RA 4PYAA 2K40A 1UFLA 3A0BC 2KRRA 2DISA 3HCXA 2VFTA 2Y69H 3GFMA 4DPXA 2MQMA 1OY8A 5T7LB 1WC4A 4RUHA 4EUVA 2BDPA 1F9FA 3NWGA 5FFZA 4X4TA 2ZJPF 4HPQA 3HSEA 1R43A 2ZD1A 1AWCA 5F0WA 3PXGa 1U9OA 2D45A 4U0WA 1FVSA 1GMVA 1TP4A 2HWTA 1KKHA 4ZVQB 1IR1A 2EBEA 3W65A 2BE5F 3BH6B 1RCXB 1NNDA 5B1BH 1WI9A 5J1RA 5H9FK 4TVAB 2C3MA 2Y8WA 4JI0J 2DMUA 3HRTA 1FWPA 1WNEA 4MT1A 5U47A 3RR7A 1FFSB 4LB6B 3ZN0A 2XROA 2AXTC 1WG4A 2NXUA 4OHWA 2E5HA 3TQ1A 2FYXA 2CFXA 3BR0A 1N5QA 2X4HA 5EGYA 3IWLA 1Z1DA 1RISA 4WK3A 4EI2A 1R6RA 2JQ7A 4J9QA 4P96A 5EG0B 5HN0A 4HHUA 3JTHA 3AJDA 4OMFG 5LHIA 5D5UB 3M4OJ 3ZTSA 1TT5B 3HG9A 1T02A 4DR7F 1LWEA 4WP8A 2HHWA 1IRFA 3GONA 1SH2A 4NWBA 4BDPA 2FLOA 3F72A 3ILOA 5A8KA 3GQCA 1BC6A 2R8HA 3SDGA 4RNHA 4LR8A 3B6AA 4Q8EA 3GTQJ 1I6XA 1NK7A 5B0BA 4HLYA 2IM3A 3HSGA 2L9SA 2CH0A 2C2MB 5DG7A 1TU0B 5IWAF 5EWGA 3ABUA 2DJWA 4X4OA 2HRYA 2XY7A 1LFPA 3R4KA 3CUOA 3D3CJ 3QYEA 2HQFA 4RLEA 2Q66A 1MMDA 3K1NA 1O3QA 1SCJB 1W25A 3TJAA 1LXNA 2Q1LA 2HHHF 4YS2A 2CYYA 5HVHA 1JTYA 3V81B 2ZHBA 3BBCA 1ZR2A 4B02A 5IFMA 2GHVC 4F0HA 2M9HA 3KLVA 3OV7A 3QPSA 5K8MA 4MGRA 1Z77A 1RAFB 2YWGA 2P9EA 1OQ3A 1IN0A 1I3QJ 2KKOA 4FBUA 5HMWA 2XGPA 2V67A 1AT1B 3OR2B 1EHWA 2FZGB 3DEEA 4Y4RA 2L41A 3GR1A 4BJ6C 4DX6A 2CQXA 1LK5A 5LEJA 2RE1A 2CUYA 4MKBA 4ZN3A 1VS3A 5A76A 3SDEB 6AT1B 5KFGA 4WFZA 5G0RB 4QIEA 2K9MA 2MEWA 1DTQA 3JCUC 5DM6F 4B3SF 3D7SB 4DYCA 1I94J 4Y13A 4KYWA 3MWMA 3GCMA 3DBHB 1IC8A 3SFIA 2DT5A 3MEEA 3DF8A 2J7UA 3OR2C 1RHRB 2XMJA 5A0YB 4EGLA 4HOBA 1ONVA 3FEXB 4DI6A 4N9HA 1U47A 1X1BA 3QT8A 2UUBF 3PFYA 1RT2B 1VQKS 5E3CA 3Q83A 3KLEA 1WKMA 2LKXA 2QBYB 1HHTP 2C2RA 3WTUC 1LNQA 3Q0VA 3J80U 4ECWA 3F8NA 1U26A 4ER8A 3IUOA 4J9UE 3J81Y 4BC7A 4LSLA 1X1AA 3ET6B 2XYGB 2O9LA 1EQMA 2WADA 3I0SB 2Z2ZA 4FE7A 1FWLA 4EJVA 2OQRA 2RKIB 4L6V3 1IV8A 2EFOA 3RYRA 1H3DA 4CT8A 4DPOA 1S6UA 3OPKA 4Z7YA 2DFFA 1DQUA 2L9VA 3TEDA 3I53A 1D9DA 2HNYB 3AD7C 3IRXB 1T3OA 4WFAQ 2DKOB 4IRDA 3KUHA 3UN2A 3KZZA 3A3NB 1S4FA 1IN6A 2V68A 1VGYA 1WDDA 5E3PA 2ZBPA 4U7BA 1DRZA 4DL4A 5LFAA 2B6AA 3BO3A 4HEA9 1EX8A 4L0YB 2FUG9 4A5MA 2HVEA 4OLPA 3Q24A 2AU0A 5D5VB 1JLAA 3H3ZA 2HFHA 3J7YI 2N82B 5KG4A 2ZH3A 3E5QA 4TKTA 4JYAJ 2KHCA 3QRFF 4IOBA 5KAKA 4I6AA 2XO6A 4F4ZA 2R5ZB 2KFYA 2RS8A 2ILYA 1FBQA 2IBOA 3AHPA 4YR3A 2DMTA 2MQ8A 3J7YU 2DJNA 2GIZA 4HEA2 4IEJA 2NS1B 3O3LA 2X7IA 3K70C 1S7IA 2ZC2A 3W5YA 2QT7A 3GTMJ 4PG7A 1P9YA 2DFHA 4JOUA 4NLUA 4WU3A 2CU7A 2CSOA 2GO8A 4OJ3A 3CF5F 2L3MA 3QPIA 1ETQA 3CC4S 3HOTA 3N79A 1I1SA 5KG2A 2BEFA 3MAAA 2B8QA 1KOOA 3DXBA 4NLXA 1T95A 5J2NB 1P1LA 3ULHA 2GZOA 2LQ5A 1J5EF 3BSNA 1U1PA 1KVJA 4UUWA 1RAHB 4L5IA 2DK8A 2YX4A 5KFLA 4E7ZA 2CQNA 1R1TA 3HJEA 2JTVA 5F04A 1ZPWX 1VF9A 2HVSA 1H0MA 2KRCA 5IT9Z 1ZRDA 3MM6A 3BZCA 3G9CA 2JNJA 3HVRA 4KICA 3CC2I 1S5LC 4M73A 2IM2A 2DO4A 1MN9A 4C0HA 3ZZZA 3K57A 4DJAA 4LVOP 4FF3A 4CO8A 3QWPA 4AL7A 2RSQA 2DPJA 3HRUA 2RQMA 1WACA 2E2JJ 2K7JA 1NK0A 2V26A 2BUNA 4PGHA 3NWRA 1FSHA 1ZPVA 4LBPA 3A3PB 3UFCX 4ZPWR 4HI1A 2CQIA 3OYNA 2CJ9A 3CDAA 2Q79A 4NB5A 2IRXA 2QSGX 4ECSA 4JI5J 5J1UA 2WSEC 2DH8A 4AE5A 3N5FA 2COLA 5E5NA 4JK1X 2JDJA 3IBFB 5ETVA 5L3EA 2H1LA 1Q53A 3OJSA 3J7A1 3KK3B 4B3RJ 3NOCA 2I5JB 2KFZA 3PHTA 2B63J 4U67Q 1MBFA 2MKKA 4DUYJ 3KMSA 4G65A 1EKEA 3GYNA 1NHUA 3FUYA 2VE9A 5A6PA 1P9QC 2ZSHB 1NPPA 2ZOGA 1OJ4A 2GM4A 3G6YA 1OO0B 5ETRA 1P4AA 3B4MA 5HJXA 2KHMA 5GAHU 2W4DA 4HNVA 3KJNB 5LMUJ 3UE2A 2DI3A 1TKXB 3ZTPA 1UAAA 3IWZA 1B72A 3DHWC 4A2UA 1Q7LB 2WOMB 1YRNA 2YU9J 2VG5A 2KT3A 4USWA 5IC4B 1LOUA 4WFYA 3A8KA 2C2ZB 2H5IB 3ZZTA 2G13A 4DR1J 2DK2A 1SMTA 3GW2A 1KEKA 1KTQA 3J81Z 2K3KA 4CO5A 4YFKF 2H54B 3ABTA 2D41A 2XB5A 2KXFA 2QFIA 4EWTA 3I54A 5K5RA 2C3UA 1HXDA 4CYDA 1R7JA 2ZCWA 4RAYA 3DXSX 2AJQA 2HZCA 4ILLA 3OYAA 4GXOA 2JN6A 4L9NA 2XGQA 3TDZC 1HSTA 1RZ4A 2QA4G 3M8EA 3R0JA 3WX4A 3RG6A 4G12A 4L9JA 2L9DA 3UNYA 4K0KJ 1WPKA 3FXOA 4USTA 2H3EB 3O6BB 4L9TA 2QA1A 2NS8A 3C3WA 4DWIA 4K0KF 5DG9A 2XMUA 1N33F 2BEOA 3JQJA 3G3ZA 4DJBA 2BKOA 2LMDA 2WB1N 1RT4A 2EK5A 1RTIA 4EM1A 3CF5Q 2XG8A 4PCQA 4L0ZB 3M8YA 3TVKA 4R8UB 2YNFA 2AJ0A 2NS0A 3LGNA 4PG4A 1B4AA 2WAFA 4H4KA 4DG1A 5KFIA 3E2EA 3AFGA 2E9RX 3E51A 4IFYB 2I38A 4QTRA 2GA2A 3GLLA 4ZMMA 5CQEA 4ZC3A 4RS8A 1OYDA 1A9NB 4ZHRA 3D2WA 2L3DA 4WXHA 5DDGA 1WZ2A 1PG5B 4PSXA 3LP1A 3Q8UA 2I9SA 2E7VA 1KOHA 5AE1A 5HQMA 4K4TA 2L7FP 3D0SA 2MJUA 3VEPA 2ZM6J 4HTJA 3H36A 4KYZA 3OHBA 4B9SA 1B6AA 5DETA 2FJWA 4ZLLA 4CO1A 4F36A 5KFWA 3CPWR 4IDKA 1KS2A 2ZDOA 4I7HA 3FCHA 1WKJA 1HPZA 2OPTA 1KLMA 4DR3J 2ZB9A 1JT6A 4BWMA 3CJ8A 5D15A 2VG7B 4AU7A 4GKJJ 5EWEA 2C28A 3BYPA 4HTIA 4ITSA 1RABB 4DYQA 2V4JB 1QNTA 3Q8YA 4LF7F 4QZVB 4MQ9F 3RKYA 4QU6A 2KIMA 4DFKA 2OPRB 2YNGA 2B9WA 4QR1A 4R8UA 3ZRGA 3AG2H 2RH3A 5ILSA 2M0GB 4I6ZA 3LH2S 2VT3A 1E6VA 3S14J 2W9AA 3HHLA 3FBIB 3ZMDA 2YH1A 1NM2A 1MU2B 2H6CA 4BE0A 1V6HA 4X4VA 3EJMA 3MEGA 5I3UB 1MW7A 4P73A 1K4SA 3DI6A 3SYZA 2VD3A 3AODA 4C8LA 5F0FA 1PKUA 5HSPA 1PCAA 1A0OB 1M5OC 2BZ2A 1STZA 2R7VA 1YS6A 1S5ZA 4Q48A 2CPDA 5AE2A 4WZMA 3CCMI 2W7OA 1R4NB 4ZIVA 4RLFA 2CQKA 4DYRA 2TCTA 2MTLA 1HNIB 5HROB 3LA7A 4MO7A 1K44A 2IDEA 2MLZA 3KK1B 1PYVA 2D69A 1Z1ZA 3ESWB 3KHGA 2UXCF 4EEYA 4NLWA 4DR5F 4Q43A 2G4BA 1WJ5A 2Z0GA 1EIYB 3RQIA 2F5GA 1HBXG 5EEGA 1NXIA 1RCOB 4JI7F 3M8PA 1CC7A 4I2QA 2V0NA 1GX5A 2VBWA 1FOKA 3KJQB 3MURP 3G2BA 1IR2A 4JX4A 5J1YA 2BRKA 1MMNA 2E35A 3QIPA 1G3WA 1HL6A 4LRFA 3HUGA 5K8OA 2KJVA 2R4GA 1IBKF 5EWFA 1HYSA 2YU3A 4DPTA 1L5UA 1SC7A 1RA6A 1IBMJ 4UQGA 5JXSA 3BLYA 1U45A 2JWTA 1Y6IA 4OYMA 3F22A 1DPUA 3KG0A 3PQJA 3RPUA 3DEUA 4G6QA 3VGSA 2CJXB 5DRKA 3CD6S 3D54A 2DRDA 3D1NI 4LFUA 3Q2TC 1RETA 2LEPA 5AXKA 1T03B 1OY9A 3D28A 1M5PC 4LT6A 4PYDA 1CJVA 1LWEB 3TANA 1OMIA 4LOCA 3HYIA 4FYYB 5IQQA 4PABA 4ANDA 4JI6F 3UDLA 1WF0A 1H89C 1JKOC 3VSLA 2DK5A 4V19K 2STTA 2QSFA 3K8WA 1Q86T 2J9EA 5E33A 5KFMA 4BWJA 2HQAA 2CO5A 1UG2A 3TVZA 4AVZA 5AONA 5KFQA 2MY7A 3ZR8X 4RW4A 1FRMA 3MPDA 2OIHA 3GJRB 2RF2A 1VC5A 1D8ZA 2K1RB 3KX2A 1ZAVA 2LFBA 5JLWA 4B3OB 4N47A 2POKA 3HBLA 3E0JB 1H6KX 3KLEB 2VOOA 3T1AA 3CMMA 4DR3F 1S9HA 3EETA 4PXDA 1OMSA 3I56I 1LJ9A 1B8IA 2HHVA 1SKSA 2KZMA 4KGMA 1FT8A 3MECB 1D8JA 1WEZA 2HG4A 4DIQA 3MPYA 4NYOA 4EU0A 3KP4A 3H59A 2APOA 5E1XA 1OQ6A 3D66A 2SXLA 4G7HF 2EC0A 4A0XA 4C3KA 4PQUA 1SD4A 4U7UK 5CCLA 1FXRA 1IBKJ 1Q7YT 1MNMC 1AZSB 1JLGA 4U88A 3BKUA 3HKZA 4KHPJ 3LSGA 1LEBA 3IRRA 4HNTA 3CCTA 2DHSA 1SV5A 1RT6A 4X0GA 1WJFA 1QUVA 2WSCC 2IGOA 2HZAA 4D7MA 2HBZB 4KKOA 3M8RA 5HP1B 3BCBA 3F23A 2YWHA 3D0HE 3QJLA 5CJ9A 1DQ9A 3H4DA 2DU9A 3JTGA 3OL6A 1RA7A 5KFYA 3CCQI 5D4RA 1KRPA 4H4KC 2XKOA 3CLOA 3GR0A 3F73A 2MQNA 1SL0A 1HHQA 3SCKE 1SFKA 2GAHC 2MZRA 4DCOB 1X2MA 3HI9A 3EQLF 4B8XA 3W60A 3PUFA 3WTSC 3KP6A 2M70A 4WP3A 3C2PA 4P10A 2OAZA 3IR5B 5GVQA 1VBYA 5HAOA 3FBCA 4QWQA 4LVNP 5HLFB 4RAGA 2QA2A 4OZLA 5C24B 2X1BA 5L9XA 3CJTA 3T41A 5DLGA 1S6QB 4GVLA 1IKWB 2JEFA 1WC1A 1IN4A 4MFEA 5FLVA 3GF2A 2DNYA 4DEZA 1GV5A 2NZ4A 4USVA 5C4XJ 1X9WA 2FVCA 3W1YC 4QWEA 4Z37A 4Q45A 4W1UA 1DLOA 1MLAA 3TAPA 5DGAA 2C22A 2HHUA 1RHKB 6PAXA 2ALYB 2DRBA 4WTYA 2YWFA 4DSLA 2BJ3A 3H5AA 4ESFA 1SJ3P 3L7WA 2L2OA 4EFAC 4ZZLA 1XTZA 3L2RA 3H5NA 4PXEA 3MFIA 1H2TZ 1TTYA 4NLSA 2FHOB 5LT5A 5F8LA 4Q2MA 1FI4A 2CRGA 2A1BA 2I8EA 3WBZA 1XQIA 2VKVA 2L02A 1D09B 1F6TA 4LFCJ 1Y3KA 3TUIC 2ASJA 2OTJS 3LGMA 2KIUA 1VQ7S 2R3VA 1X1PA 3GFJA 2L0KA 2YKPA 4EO8A 3OOUA 1X19A 1TL7A 2HPUA 1ZAWA 3BBFA 4E7HA 3W62A 1KQ8A 4XRMA 2C6YA 2HOTA 4DX7A 1SL2A 3CE8A 3HHNB 2E19A 2EXUA 2KJWA 3WGIA 3AD8C 1TQIA 1LW2B 1ETKA 2XM3A 1A04A 2AEFA 3LW5C 2HFVA 4NNJA 4MTEA 1TWCJ 1MWYA 3G8QA 3JRHA 3A03A 3PIPF 2BJ9A 4I56A 2XYPB 1K47A 1XB4A 2OGUA 3IV5A 2E5LJ 3K5PA 5LRSA 1P8GA 3KEOA 5AXLA 1EV7A 3HM5A 5J6XA 5J2MA 3GYHX 2ME6A 2Z57B 3GO5A 2AXLA 1SFUA 2NYHA 2G0IA 4P52A 3PKMA 3JRBA 3R27A 1D0YA 1N5YB 5L38A 2G9OA 1TKXA 1HW2A 2Z16A 4IHXA 4CLTA 1BC7C 3UD4P 1SUQA 2KYZA 2P5VA 4RB2C 2WV1A 3I3LA 4CLWA 2RRNA 1TKZB 2K3PA 3L2UA 2ZMEA 2AWZA 2AW0A 2D3ZA 1Z9CA 3W8GA 4G6TB 3V4IA 4NYPA 3DLKA 4OZJA 4X4QA 3Q9VA 4JX6A 4QPQA 3P5JA 5LBQA 1V3FA 2CPIA 2YPRA 1H88C 4LLGF 4B9TA 3VR1A 2VJUA 5J3LA 3TOQA 5EEAA 2EFVA 4WF2A 1DPRA 1C1BA 1MZBA 1CS4A 4DUTA 1Y5IB 1U5TA 3TQEA 3OSGA 3MPUB 2UXNA 2IMOA 2DGXA 3CCJS 4CLKA 1W36D 3QOEA 4ASNA 3D6FB 4KSEB 2D1VA 2FF4A 1HNVB 2HVIA 1F4KA 1XSVA 2J5OA 4PUOA 1XR7A 5DDPC 1E6YB 4OMZA 2X85A 3KYLA 2DMQA 3QSYB 3LP2B 3K2ZA 4M5IA 1GLNA 1JJCB 2H27A 2I5JA 3G8TA 4LF2A 3VAIA 1WEYA 4CM0A 3DCAA 4JX5A 1GXTA 1G8XA 2GNKA 1U0JA 3DPUA 3DM2A 1NKCA 5CZVA 3SXLA 5EZGA 2OO4A 3EE3A 4CWBA 1KZHA 1WI8A 1R7IA 1Q81T 2JA8J 2R3SA 1VQ6I 5CVRA 5IT0A 1L3TA 4I1TA 1EETA 1TW2A 1FJGJ 1SI9A 3T1HF 4GVBB 5KFSA 1TWFJ 4NE9C 3CTAA 2CWXA 5F0CA 2Z3YA 4DV7J 1TKDA 3JSYA 3MKYB 4DQQA 1RYRA 1XEZA 2GLOA 2OEKA 3W5XA 2IFXA 4HRIA 3JTNA 1CJUB 4OYXA 2IBKA 1O5JA 3QRQA 4MEYF 4WFBQ 5E8GA 2P7CB 3ISZA 3AL0C 4BEHA 4CH0S 4PWUA 4DV1J 1YDLA 3CCMS 2K9LA 1B99A 2BM1A 4KC5A 4S04A 3ZXSA 1WHVA 3SSQA 3I96A 3M2VA 4WE1A 3H9JA 4ZS6A 3BSCA 2OUGA 3KLHA 4WYLA 2ZD1B 1TTHB 1WOSA 1HLVA 2PEBA 2BY1A 2PMUA 2V8PA 2GS8A 3R97A 2XHKA 2GVZB 5KG1A 3JAMY 2MKYA 3PO2J 1NJZA 1IDYA 2KDZA 1Y5NB 4DDFA 2UVVA 3K4BA 3ONQA 4ANCA 1ON2A 1R1UA 3TVYA 1X4FA 1HMVB 4X64J 1QGPA 2XPWA 2GGPA 2W2QP 3DLJA 2RRAA 4QU7A 2P6TA 1YJWI 4MMOA 2LY9A 4IFVA 3W6JB 3DLLQ 4Y0FA 1SC1B 4ELVA 3BGRA 1W7PD 3M32A 1U2WA 3IR6B 4J9KA 3UVJB 1KA8A 1K78B 1KR4A 5DV5A 3OL4A 4QIWN 1W36C 2KPMA 2HOAA 3GIJA 1GTEA 3T6BA 3M8WA 3CESA 5GTIC 1ROFA 1HNZJ 4U9RA 3DPLC 4DR2J 2HYFA 1VRUB 1U7LA 3MCNA 5AXNA 3FM5A 4PJ0C 1Z67A 4JYAF 4G9YA 2RU9A 4OJGA 5KT4A 3E5XA 1VRQC 3HOSA 5BJRA 3EUKL 4WXCA 2W9BA 1V5VA 2HXOA 3BTIA 3PRDA 4RM2A 3BP8A 3KFWX 4YFNF 2EJRA 1MSFC 1LXJA 1R3NA 2G0CA 4ETXA 1Q1VA 3MD2A 2VN2A 4NEZA 2VJIA 1YLXA 1FWKA 3N6NA 4LFAF 3B02A 1CQMA 2IS1A 4R8HA 5J2QA 3HVAA 1EAYC 2BV3A 1R5GA 4DQRA 1TWAJ 4ZJZA 4FVCA 2CV0A 4OZ5A 5HMYA 3DM2B 1J09A 3KDOA 1VR6A 2IA1A 2QENA 1QVFR 2JFDA 4OHVA 4A12A 1WJDA 2CQ2A 2IYGA 1NTCA 1T0FA 2XB0X 3HJVA 2V63A 2L9RA 4ZVOB 2AP6A 3CJRB 1Q5VA 3C6UB 3TAMB 3VAFA 2LVWA 1J59A 1N36F 2OV7A 3C16A 2O01C 3KHRA 1ITPA 3DTEA 3BV8A 5ETSA 3S93A 3KWMA 3S8PA 4JQFA 1S0OA 1NG7A 4FP9A 2DNRA 3ROUA 4BUPA 3MKWB 1B0PA 4KY3A 4UY8T 1RT3A 2ROGA 4P6QA 3BS9A 1R6VA 3BZQA 4A6EA 2F4FA 3FVYA 3LANA 2V1UA 2IM1A 2ASLA 3P5TL 2RD5C 3DRPA 2DGVA 1N5TA 4C6AA 4I69A 3GTOJ 4P7VA 2AT1B 5BR8J 3FXRA 3CCUI 2IRFG 1ZG5A 1IKYA 1D5VA 1YJNS 2GMJA 2LFVA 2EFPA 4M6XA 2NSBA 4JBCA 1UVLA 1RTIB 1JLCA 3MR2A 1B3TA 2OD5A 4OOIA 1NDPA 2LC2A 2LP0A 2LA4A 3CIZA 2NCKL 2CMPA 5GMDA 3VAGA 3EDPA 5KFCA 3R5JB 3HEFA 1IRZA 3HM9A 3FCVA 2OD6A 1SL1A 1D8YA 1T9UA 1KDNA 3PW5A 4EV0A 3QATA 3DMJB 1ZA2B 3EPZA 2HGCA 4DSJA 3LSRA 2HPIA 4DU8A 4QWAA 2HNYA 3F3XA 1NO8A 3NS5A 4TU7A 2BY3A 2ZWPA 5B0EA 2CJYB 4G1QA 1NB7A 4DL6A 5ED4A 4FYWB 3KIOA 1W5TA 3FZBA 2X6XA 2LR8A 2LF8A 3MCZA 1N33J 1U3EM 3WTYC 3DLLF 3RZOJ 2XHCA 3NOGA 1NBEB 1J5OB 2ATLA 3PEJA 2BXYA 3W61A 4G7ZF 5ICFA 2R5ZA 2XMWA 1T39A 1UJ4A 4ES3A 3U1LA 5A2QZ 2KZZA 3NAIA 4D3HA 4QSHA 5HQ8A 3QO9A 4YOEA 2DNPA 2QUFA 4HX7A 2IJRA 4IOAF 5LJ3Y 2W8KA 4YB7A 3VAJA 4QPOA 2MHNA 3D6TB 4ZVSB 2O66A 4ZJQA 3QAUA 4QWDA 3ZMSA 1JJ4A 3LSMA 3DOKB 1TL1B 2JMWA 2XAJA 1YJWS 2C42A 2NXNB 2DTJA 4HAMA 4PQAA 2C3PA 2N3OA 5K14A 1RT7A 3LOCA 1LKXA 3ZN1A 3GZ5A 2Q8KA 4D0PA 1V9OA 5EEHA 2KT2A 5F1JA 1Y39A 3QGHA 2YX7A 3IS9A 1WGXA 2DQLA 1TUGB 2OTLS 1HDPA 4LBIA 3WHBA 2DYAA 4DCPB 1FSEA 1IGNA 2OPPA 1Q4RA 2JH3A 3CCLI 1RB0A 1FVQA 1N25A 4GO7X 4B47A 1XS9A 2WVFA 2UUAJ 3C16B 3Q5FA 2BBEA 3JQMA 4BNCA 1U2CA 1K8AT 4DQIA 5C25A 2AD9A 5B0CA 4B4CA 1HDDC 4MFBB 3L2QA 1HWUA 4LSZB 2XGEA 3WU1B 5H2FC 3A01A 2WW4A 5JLXA 1GXQA 2DFIA 5C7PA 3IC7A 1D1BA 3IAM9 3H0GJ 3LFKA 2VFRA 1XMQJ 3GTLJ 2KN4A 1SVOA 3Q9SA 1SIWB 5JMNA 1CJKA 3E01B 3W64A 4A3EJ 4GGGA 4LLLA 4IO9F 1I3AA 2EZLA 1ETWA 3ZQLA 1EH7A 3DKYA 2ZH7A 2ALZA 2NQPA 4F67A 2VODA 1F5BA 1GAOA 5GAGJ 1REVB 2HAIA 2R7OA 4BDZA 2XV4S 1RLDA 3RCOA 2V8DA 2F5DA 4QR0A 4C3IJ 2MC3A 5IC6B 3LAPA 2EWHA 2B0LA 3ZQGA 2GJIA 3DRRA 1BHNA 3LSKA 1W0TA 3HT3A 3RI4A 2DH7A 2V9VA 4ZZDA 1OYWA 4K4XA 3R2DJ 5D4SA 3OL8A 1OCRH 2EFWA 1S6LA 2FVPA 5KFUA 1W5SA 4DV6J 1YIJI 1X4GA 4DS4A 2O61A 1GHCA 3CUQA 2ZSIB 3C66A 3MEKA 1ORKA 3CC4I 3T19A 3GBGA 2IT0A 2C2KB 3PJWA 1Z6RA 3V4IB 4I09A 1PBAA 3QQAA 3LPEA 3H3UA 3F56A 2VBYA 3MUTP 1RAEB 1RDRA 2DGUA 4D3GA 3GCXP 3FCWA 3G6XA 3DLHA 2BMBA 3FZ2A 3DBRB 2OSQA 2A6HF 1FRXA 2M30A 2L01A 1L0OC 2IA0A 5HATA 1HNWF 2ZH6A 1OQYA 4E4HA 3CMQA 2LSOA 4Z6YA 4LF8J 5FLXK 2ZH9A 2ZBQA 5IP7J 1E3PA 4XMYA 1VMBA 2DHHA 3O5TB 4ESJA 5KFBA 1PSDA 2O8KA 4I99C 3T1HJ 1FJGF 4XN0A 3WTVC 3NP5A 1RWNB 1S1TA 2KISA 3DOKA 5MLCV 1L3VA 3CQZJ 2F8EX 3IC1A 2AO9A 5CVUA 3SJMA 3CC2S 2QSHX 3CJ4A 5FD1A 3H5YA 1ZTWA 4RUCA 2VQHA 4NLOA 4OV1A 3KG4A 4QOTA 2A69F 3IXQA 2GFFA 4Y52J 3H9QA 4A8YA 1VQYA 4HA8A 4NC7A 2QF7A 4NLQA 4YHHJ 3SSSA 4F4AA 1D0EA 3BR8A 4FPRA 4KITB 5F64A 3ZFVA 4M5HA 2M8GX 1YW8A 3AQPA 1YYVA 3KDNA 3THPA 4LK0F 3ABKH 3PNVA 4DBRA 3RAMA 5T14A 3BR9A 4A47A 2PJRA 2GC8A 3ETMA 4FISA 1Q8IA 3IG1B 2K4BA 1VQ7I 4B17A 1A31A 1F5CA 5DUKA 2QKLB 3T1YF 3T5JA 5C25B 1NK2P 1SB6A 2GIVA 2V34A 2M34A 5C2CA 2Q2EA 3CJQA 2MZ1A 4MEXF 4MFDA 3L3CA 4DU7A 5DD8A 3LWLA 2I5UA 2QLWA 4FYVB 4ZKAA 4JV0A 1KHWA 3RDIA 2JRTA 4G8XA 3OYJA 5EHHA 4A5NA 3MI7X 3MM7A 3C2BA 5LRRA 1HW5A 1QDUB 2NZCA 2M8DB 1K6OA 4F93B 8RUCA 4YQWA 2BXZA 2YS9A 3M1CA 2J7KA 3MAJA 3E01A 1CJKB 1UEKA 2GJFA 1XMOF 2JLEA 2D7SA 4ECTA 1HBNB 3BGLA 5B5EC 3R7SB 4J91A 3BO2A 4OL8A 5IPAA 4DUYF 4IJAA 3K2AA 3IP0A 4ES2A 1PVEA 4PFPA 3BCAA 1YI2S 1OJLA 1ZHFA 2NVQJ 3S1QJ 2QYGA 2DYSH 2F4VJ 3E8OA 3HVTB 3CDHA 4ZITA 3V81A 1REVA 3V6DB 3K70D 2ECCA 4IFVB 3ILLA 4PJMA 3K17A 1KTVA 2HMIB 5HDKA 1W5CC 3FDYA 2KG1A 4A48A 3L2VA 1X2NA 1JHHA 2ZJRQ 1QA6A 4KJZA 2RQ4A 1CF7A 4E0DA 4DSKA 2KFDA 4XSZF 2WOMA 5A2QY 4LFBF 2VKEA 2C2DA 1FDNA 2P0WA 3I82A 4Q44A 1G59A 3MGJA 3ZXWA 1AU7A 4DV5J 1BI0A 1PP8F 2E5LF 1S7EA 4G1PA 2GBYA 1BQNA 1G2EA 4NUBA 1IXSB 4ZYGA 3CSKA 1X31C 4E7KA 2DMNA 2LMIA 3ITHB 4NXNF 4H0EA 4NRTA 4D7NA 2V5HG 1MROB 1H72C 1QZYA 1LEAA 4N5SA 1HF0A 3DEWA 3QGGA 3I4MJ 4ZTFA 1D9AA 2YKMA 2ADBA 1R5ID 2CQ7A 2HRUA 2GZWA 3BC8A 2DH9A 1UVMA 2K7KA 2O6GE 4OV6A 4JP0A 2BV6A 3H35A 1XPXA 3BTLA 2FHKA 2IVFB 4MJKA 3MXHP 2MHEA 2ZJQQ 2IC3A 1OCCH 2K3FA 1UVIA 4M3GA 2J6SA 2JA6J 3CC7I 3REOA 3OYKA 4P2SA 3OYBA 1FTRA 1C0TA 4WIQA 3R7NB 5J1EA 1JKQC 1I5OB 4FNHA 3IBWA 3L9FA 1MBKA 3H5RA 2HKXA 1YJ9S 1SAXA 2P2CB 1NDKA 4ENMA 1MMLA 3F8FA 1MMSA 4ZYDA 2FHJD 2QIFA 3CCYA 1C4CA 4J9LA 2PX9A 2WAEA 4PGGA 3R6LB 3H1CA 4GDFA 2MD0A 4USMA 3JYTA 2VUMJ 4L5JA 4KISA 4P71A 4BKXA 4RB1A 4O3NA 1U1OA 2AX1A 3HK2A 2LLZA 3OFGA 2Q2EB 2EC2A 3PSIA 3V4GA 4ZCLA 1QSLA 3QLHA 3GWZA 2COBA 3CVKA 3HF5A 4CLZA 3BN7A 5DQGA 3VALA 2XZDB 4NCGB 3H2VE 2B56A 4KPYA 3NNAA 4HF0A 2RQCA 2DNMA 3NBPB 1BM9A 4FNIA 3Q8VA 3JR9A 4URSA 1BGXT 3ETOA 4OYAA 1HI0P 2B5JB 1GX6A 2DAOA 4KH1B 3RBZA 3EM1A 3PM1A 1DGRM 2GXBA 1IKXB 1FTTA 3HOYJ 4W90B 2Y1JA 2RNGA 5D0HA 3NCRA 2ZE2A 2ME0A 1W7PB 2R2TA 2YX1A 4M5MA 2VKZG 4OLOA 5D0EA 1SH3A 2EFGA 1LW0B 1LK7A 4EEFG 1N48A 2QQ8A 3QOPA 3FK4A 2CJQA 2HVDA 1Q16B 4DF4A 1OR7A 3I5AA 4I0BA 1VQMS 4CSWA 3RW7A 5KAIC 5ETTA 2DGWA 2YQ0A 4KAIA 1NSQA 3US5A 2HTJA 1T56A 2JT1A 4FKXA 2FX0A 1QHHD 2DDBA 2W2OP 2XSJA 1JQGA 4FBTA 4KH0B 1VQSA 2H1YA 2I0XA 3MM8A 1FWZA 3I32A 1B72B 2VB6A 3JSBA 3IP4B 1OYEA 1XX5A 5M5YJ 3N9UC 2G9WA 4C2TA 1NK6A 2KIFA 2HZDA 2A2CA 5KTQA 1VRTB 4BBSJ 3RYLA 3FXQA 4HHHA 3CD0A 1YX2A 1Y7PA 2R93J 3T5HA 2K06A 1XWLA 2BKPA 3GE9A 2DR9A 2DO0A 3U02A 2FZCB 2CVEA 4OQJA 1AHDP 3BGFA 4XSXF 4NLGA 3BH7B 2FMLA 5J40A 4WCEQ 3KK3A 2HVHA 2L08A 2O5RA 2ZH2A 4NBQA 4FKYA 1QJHA 4DN0A 1QM9A 3OYGA 3IWNC 1S8NA 4IG0A 5ICEA 3I4PA 3PNTA 2LRDA 1A6IA 2DGQA 4IR1A 3I9V9 3GYGA 5CYQB 4OYPA 3EVMA 3LA3A 3DP7A 2R7DA 2BY0A 3FM3A 4YB1P 4CCOA 4M5GA 2F5EA 3TUJC 3VZIA 3M9AA 4DL2A 1IBCB 1WORA 1QBJA 1HR0J 2HZVA 3PFIA 1K78A 1YITS 2KYXA 2VQEJ 4J9NA 4ZCMA 3CXCR 2L7ZA 4IZZA 4X66J 4Y7NJ 3EZ5A 1U1RA 4C48A 3BQYA 4PR6A 2AZ3A 4IRHA 5DZ7A 3HOUJ 3I5BA 3IAS9 3IO1A 3ECOA 2OA4A 2NREA 4RBTA 1JKHB 4ILMA 4FE4A 2DNQA 3HOZJ 3MEDB 3BR2A 1H8AC 1ULYA 2A6EF 2Z30B 4KMFA 5H20A 4YR0A 4Y34A 2M8EA 5THWA 4C97A 5DEQA 5FLXZ 3KLIB 3FK6A 1Q8BA 4A3FJ 2DOAA 4DUZJ 3KCCA 3RSNA 2B6AB 2KVIA 3M05A 1ITYA 3ZTRA 4YIIA 5M5XJ 2UVRA 2XS7A 2RDDA 4USHA 4PUOB 4IYQA 2IVMA 4M5KA 4DLEA 1FRKA 1UPMB 3NS7B 1SVDA 2EKYA 1SQGA 2DA2A 1ZELA 5D0RA 4XAKA 5KT7A 1JE8A 4B09A 1NEEA 1M5KC 1X3ZB 2GO9A 2OQGA 1REGX 4X1EA 1Q8KA 4ECQA 2E7XA 2W24A 5JR3A 5ETKA 4RGXA 4Y65A 3AG4H 4R1HA 2V94A 2FIUA 4ERDA 3TWZA 2BW3A 1G3TA 2KT0A 4X62F 1S0MA 3ZO7A 3ZNUA 1YQHA 1YBAA 2FPHX 3OIOA 2NOGA 1S1XB 1VQNI 4HZFA 2GWRA 1FIAA 1K9MT 3TW7A 2ZC4A 3ADAC 1Y4ZB 3BR3A 2VICA 5DM7F 4BCAA 4ETZA 2CS3A 2P6SA 1TWGJ 2H5EA 2UUBJ 1NKEA 3ZQIA 2ZNZA 3JAMZ 1VQKI 3RJPA 2KT5A 2R7TA 2YNIB 2K4JA 4BQOA 4KE5A 1WJEA 3AB4B 1ETXA 3WGGA 2HIQA 4PRFA 2KI2A 4ELUA 4F4KA 3GIRA 3O8GA 2LD5A 2DIUA 2K1RA 4CO0A 4XLNF 3WE2A 2I2YA 1BA5A 3CCVS 1Y10A 3ZC4A 1ZH5A 1CC8A 1KFDA 1H9GA 3G1OA 4XL9A 1R8CA 5A6WA 3R9LA 3DQVC 4AVPA 3VB2A 5EUHA 2W9CB 1QPMA 2F40A 4F2SA 2PFDA 1M1GA 3BSAA 4L3NA 2XSFA 2D74B 3MMCA 3I9ZA 4J00A 4LF6J 2E5GA 3DLEB 5HNHA 1KU2A 1OSCA 2HBYB 1IKVB 4ZP9A 4ZCIA 2L48A 2QMUB 3O1LA 1MH3A 5EZHA 2DR6A 4MK9A 5CYQA 2NNNA 4RO0A 3DOMA 2CQ0A 2XAGA 1H7XA 3AOAA 1G1XA 2QJ3A 2BJ1A 4YELA 2ASDA 2D3OR 4N8NA 1ELOA 1URRA 2DOFA 3HHLD 3EXCX 1YFHA 2IIHA 2AYGA 4GVBA 2F5CA 3C7JA 1BJZA 2PI0A 1G3SA 2MJNA 1Z4UA 2HBRB 4WWSA 1GNKA 2ZUGA 4CZZA 3NGTA 2H6BA 4WU2A 1VFCA 3W8PA 2MH9A 1KFSA 1JNRB 1Q1KA 4GFBA 3KK1A 1R71A 4EZ9A 4RBVA 1UHSA 3T9ZA 2F4OB 4BXFA 2B7CB 2KM8B 1X4BA 5DD4A 3BF4A 1VC6A 4HX8A 2M3AA 3KLIA 1TL7B 2E9TA 4HQEA 2NVTJ 1U1QA 3BR5A 2XAUA 4LG3A 2PGCA 1V5FA 1K61A 5M5WJ 4DV4J 1H7WA 3MQ0A 3TR5A 4HYKA 1BWVA 3VGTA 2HR3A 4Q7AA 4AYBD 4MHGA 2X1DA 2HHHJ 2ELKA 3FZVA 1FRJA 3HHEA 4J9SA 1SEUA 2R8KA 4O23A 1U1NA 2VPZB 3JS9A 1HMVA 3W3SA 4A46A 2YNFB 2MZTA 3TA0A 3TA2A 2XLKA 3THTA 4RM3A 3ZMUA 5GAHI 5L1LA 3VF0B 3KPHA 4R0EA 1UZCA 4IRGA 1IN5A 1I39A 5ETNA 2BABA 3JAMK 3ECHA 3O3KA 4P1WA 3G96A 2V2VA 3NWTA 1HNWJ 2V8HA 2JEIA 1QTNB 3TO6A 2J0XA 2P9CA 3MECA 2VI6A 3VDXA 2KG0A 4OX9J 4LSNB 1TNSA 3UWTA 1WJBA 1X5PA 3VCDA 3JSPA 3MCSA 3PUBA 4OIXA 3SHFA 1N5VA 2IDLA 1M5SA 2ESHA 2XULA 1FC3A 1FX4A 1IJEB 1VQ5I 3TOAA 2JEGA 4G7OF 3CD7A 4AXJA 3KLFA 3GZ7A 3HIFA 4IOCQ 2RAQA 2ZWOA 1ZM9A 3G2XA 4XLAA 1I5ZA 1S77D 2YSRA 2F1FA 4D1QA 4B3RF 2VKHA 2F5VA 4A8SA 1FCAA 2F9JA 2YWKA 3R5DA 3F8MA 4J01A 4GYGA 2XB2D 4YMEA 2HLUA 2CDRB 4YY3J 4IRIA 2EV5A 2B9YA 3PR4A 2CQQA 4PG8A 3R5BA 5L1JA 1LQ1A 5IT9U 4DQ2A 4ED2A 4U7DA 1GH8A 2XVCA 3KJVB 2VASA 1ERDA 3MFKA 1R49A 2JX2A 4EK2A 3OJUA 5DYMA 2E1MB 3M2RA 3W5ZA 2VBZA 1X4EA 5L1KA 4PWWA 4BHCA 4KGZB 1HBUB 3KP5A 2KL8A 3FEZA 5JHFA 1PYOB 3ZMTA 4RU9A 4IFYA 4C8MA 3P3DA 1D1CA 1RU2A 3OWTA 3ZQCA 1UA1A 1TBXA 3S8SA 4XRSG 4PPDA 4N56A 4R0JA 2LG4A 3D0IE 4ZK7M 2KU7A 3JRDA 3DDIA 2E5ZA 2PI5A 3CJTB 3TEHB 1K4TA 4C98A 1T2KA 2RVCA 4IO1A 2MABA 3CJRA 4DZPA 2OP5A 1ZBTA 2R92J 2B4VA 1X1DA 2CPEA 3M8QA 2ZXJA 3I4NJ 3WZ0A 3LA0A 3OQ2A 3HTSB 1XMOJ 5K7ZA 3Q8SB 3QP5A 1V5GA 1BI1A 2L54A 2LKSA 4ITVA 5IYDJ 4M71A 3SEQA 1WH7A 3SZ2A 5F0UA 5HMZA 6FD1A 1TC3C 1YSJA 4P72A 2HIYA 5LD2C 1V3RA 4OAZA 4LF5J 4C4WA 4EATA 4WIIA 1RWXB 1SC6A 2ROPA 4BEHB 3MZIA 1SVMA 2MC4A 5KFOA 1RK8A 2UZKA 1R23A 1Y11A 3MD1A 3KLOA 3IN5A 3SDEA 5FDLB 2O8XA 4P74A 1RI7A 3VTIA 1GXLA 1S99A 2YKAA 3ZTOA 1HR0F 1WWHA 4LR7A 1S6QA 4OI4A 3CTRA 1GDTA 2MW8A 2QRRA 2GX8A 1FK9B 4OX8A 1OYIA 4IHTA 3IR7B 1UZHA 2XZTB 5E7OB 2M7BA 2GGPB 5E17F 3UR0A 5GAEU 1S72S 5BXIA 3P5BP 2PD1A 1R0BG 5JVTA 4HLXA 2LH9A 2RDPA 5AIPA 3D3BJ 1Q79A 1SJRA 1RWKB 1MNEA 1MIJA 3NRBA 2HRTA 1YGYA 2ZXIA 2CGPA 3TO8A 3AAFA 2UP1A 3GJSB 2UUAF 2OPPB 4OU0A 1PJRA 3M8SA 4UT4A 5B0FA 2QQ9A 4UOCA 1DUXC 3LQVA 2E29A 1QY7A 2C2EA 1O3TA 4ENNA 5AIQA 3Q0WA 1PDNC 1EP4B 4RL1A 1MDMB 4IG3A 4USUA 4XK4A 3P4UB 3JYTB 5KOXA 3RJMB 1T98A 1SIZA 1S1WA 1ZK8A 4UUTA 3Q0AA 1N54B 3PJ9A 3AKZA 1XMQF 2FVRA 2FVQA 4BHPA 4CDIA 1TUWA 2HVZA 2DT7B 3FKJA 3EPIA 4M5DB 4P9SA 2HQNA 3VAKA 1CJVB 3R61A 4AIDA 4O3MA 3ERED 4WE1B 1NB2A 1T38A 3OTEA 2CVIA 1JJ2R 2E60A 1Z7UA 2PT0A 2B4OA 1WC3A 4NZ0A 3FMBA 4GC7A 3ZZYA 2V6AA 5JVGF 5CYMB 2B5JA 2WVDA 2MDAA 3GV7B 4ZYAA 4I7FB 1Q78A 2B7BB 4A6DA 1YJ9I 2Y30A 1KYWA 2DNHA 4V1Ak 3VYRB 4KFBB 4LF4F 4B3MF 1DBDA 4CLSA 3S16J 2DBBA 2XLIA 1FERA 5CCMA 2X6OA 2W25A 5HLGA 1RKIA 1B9MA 3PIOF 1NSAA 1SUQB 1FP2A 4AD6A 3FF5A 3UVJA 1MWQA 1FD8A 1VQLI 1PUEE 2FE3A 4FASD 1JJ8C 2WBRA 4H4MB 5J2NA 1FFGB 2BHZA 3FRYA 4DV5F 4Q5SF 1TR0A 1ZYQA 4Y17A 4IHVA 3GSDA 2VC0A 1SJ4P 2O7OA 4CCMA 3KLNA 5J8FA 3GFIA 1AZSA 1JLGB 2AMCB 3MMAB 2QEXI 3NGSA 2RNEA 5CD4A 1P6TA 3CLQA 2WHOA 1BQMA 4RAFA 4WX9A 3OYFA 1C1BB 4DQPA 1U8BA 1AKHA 1MMGA 2B9EA 2RNJA 2HU9A 1PYSB 2RQKA 3QT7A 1TAQA 2CQBA 3E3XA 2EH3A 1XERA 3WTXC 4KMUX 4RBUA 1JKHA 5F41A 4M5LA 4DFJA 3HO1A 5FLXU 2OF7A 5EF6A 2KQRA 4RB3C 1BY9A 2NVUB 1NUEA 2HNHA 3UW1A 5D0GA 2QEXS 3DYAB 5GADU 4MAKA 3OHAA 2K9QA 4O3RA 4Y2AA 1RBOB 4O4GA 1O7LA 4F4XA 3I0RB 4QWCA 5ITHA 5D5XB 1T6SA 2V9KA 4QBUA 1EJ9A 5LMUF 1N56A 3HUGB 1UW4A 4DBQA 2WBMA 4RKUC 1FA0A 1XDUA