1KPIA

Crystal structure of mycolic acid cyclopropane synthase cmaa2 complexed with sah and dddmab
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
291
structure length
291
Chain Sequence
b'QLKPPVEAVRSHYDKSNEFFKLWLDPSMTYSCAYFERPDMTLEEAQYAKRKLALDKLNLEPGMTLLDIGCGWGSTMRHAVAEYDVNVIGLTLSENQYAHDKAMFDEVDSPRRKEVRIQGWEEFDEPVDRIVSLGAFEHFADGAGDAGFERYDTFFKKFYNLTPDDGRMLLHTITIPDKEEAQELGLTSPMSLLRFIKFILTEIFPGGRLPRISQVDYYSSNAGWKVERYHRIGANYVPTLNAWADALQAHKDEAIALKGQETCDIYMHYLRGCSDLFRDKYTDVCQFTLVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLOPROPANE-FATTY-ACYL-PHOSPHOLIPID SYNTHASE 2
publication title Crystal structures of mycolic acid cyclopropane synthases from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 114
structure length 291
sequence length 291
ec nomenclature ec 2.1.1.79: Cyclopropane-fatty-acyl-phospholipid synthase.
pdb deposition date 2001-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02353 CMAS Mycolic acid cyclopropane synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1kpiA00
3K0BA 5F2KA 5FCDA 1NBHA 3CJRA 5DXAA 2ERCA 1X1BA 5ICFA 5DTRA 3SXJA 2DULA 3KQSA 4BLWA 4E70A 3FRIA 5CVEA 3KR1A 2G8NA 5E1BA 2AVDA 3E8SA 3KQWA 2AN5A 5HIIA 3AY0A 1AQIA 5E2AA 2CMGA 3SR4A 2JHAA 4P58A 4R05A 4Y2HA 5C0OE 3PVCA 1ZHFA 5LQRA 4RWZA 5KQRA 2P7IA 3LX6A 3O31A 3UA3A 4KW7A 3AXSA 4R8SA 3R24A 3OZSA 5CM2Z 2AOTB 3IYLW 4AZWA 5K0BA 1N7JA 2WA1A 3TOSA 2PX5A 2FK8A 2P40A 1EJ0A 4C07A 2GA9A 2AOUB 4PYQA 4PGGA 4E2WA 3PX2A 2IH2A 2QM3A 2IH4A 2Y1WA 5LQJA 5BW5A 4EKGA 3A26A 2GH1A 2P3OA 3FUUA 5D1HA 2ADMA 5E9JA 3SMQA 4DKJA 3HTXA 2PVCA 1DL5A 2NYUA 4YUXA 3OZTA 5M5BA 3EGVA 2BR4A 5DRTA 2XYQA 5FWAA 2ONZA 3GO4A 1EAMA 2XVMA 3LCCA 3ELYA 9MHTA 4EQZA 2PT6A 2R3SA 5GIOE 4K6MA 3RODA 4YUVA 5HIMA 3M33A 1WS6A 3GCZA 1G8AA 3GWZA 1O9GA 2IDJA 3CGGA 1F38A 3R9XB 5IH3A 3G88A 2PWPA 4BLUA 1D2HA 2QRVB 3M6VA 4PYLA 2PT9A 2OZVA 3UZUA 4GUAA 3QV2A 5EGSA 1QAMA 3CJTA 2UZ4A 4DM3A 3PLAE 3M70A 2GLUA 2OXTA 2Z6UA 2O06A 3DOUA 4FS8A 4H0NA 4QDKA 1IY9A 4IWNA 5FADA 4CWAA 4PNEA 3MGGA 2OB1A 1D2GA 1VPTA 4OBWA 4R6XA 4ZTBA 4DZRA 3E7PA 3G89A 1VL5A 2P7HA 3GRRA 2H00A 3BXOA 3KQQA 5EHGA 5HILA 1DUSA 5FA8A 4BP1A 2PX2A 3FUXA 4IKPA 4YMHA 1DCTA 2PLWA 3KPWA 3P9NA 4KDRA 4R8RA 1OR8A 2BM9A 5DX0A 2HWKA 4FT4A 1RJGA 5CIYA 2VDUE 2YXEA 5DM2A 3JWJA 3FPEA 3TPZA 3BKXA 3K6RA 1Q0SA 1SUIA 1WZNA 1EG2A 1KPGA 2NXCA 1QZZA 3JWIA 5D1NA 3TQSA 3T7SA 4ER6A 1JQEA 2PKWA 1SQFA 4GC5A 5K0CA 2OPBA 3ME5A 5DSXA 4HH4A 5C1IA 2B3TA 3A25A 4DCGA 3DULA 5E8JA 3G2PA 3SSOA 2B78A 1NV9A 4LWPA 4YV2A 4OBXA 2Z6QA 4RVGA 1I4WA 4CTJA 2ZTHA 1R8XA 3GIWA 2G72A 3NWBA 3TKAA 4AX8A 5EMJA 5ICCA 2E5WA 1XTPA 3BT7A 2OKCA 1NKVA 2WK1A 3AWIA 3VYWA 1M0EA 1HNNA 3KR0A 5K0FA 2P1DA 2R6ZA 1B42A 4WVLA 1JR4A 4RV9A 5CVUA 5DTQA 5EVJA 5EZSA 3T7TA 2ONYA 5HOQA 5LQNA 1X19A 2EJUA 1RJDA 5T64A 5LQAA 2YVLA 1JQDA 1ZG3A 1TW2A 3FUVA 2PXAA 2AS0A 4CKEA 4KWCA 5DXJA 3GU3A 1R8YA 1RI4A 3BWMA 3GRZA 3ELUA 1VE3A 3KQMA 2BH2A 3FZGA 2YUIA 1RJEA 5DM4A 5K0EA 3TLJA 3LCUA 1P39A 4PONA 3C3YA 2PJDA 5FQNA 3FPJA 5FUBA 3ER8A 3DMFA 2FHPA 2FYTA 2JHPA 4P7GA 5F2NA 5KYGA 4BY9E 1ZGAA 1PJZA 5B1SA 3RW9A 2DPMA 2HMYB 3OCJA 3MTEA 1KHHA 2JG3A 3BWYA 2ESRA 1EJ6A 5GINE 4KVZA 3EVEA 5EEGA 3UBTA 1YFLA 5K01A 2PBFA 5K09A 2BZGA 3B5IA 3NDJA 1L3BA 4QVKA 3Q87B 1X1AA 4M37A 2NP7A 2ZWAA 1VP3A 3CBGA 3WSTA 4PYKA 1PRYA 1ZKDA 3QOXA 1Q0TA 1TW3A 1JG4A 3SM3A 4GC9A 4GOND 1M6YA 5HEKA 3REOA 1FBNA 4PWYA 3UJDA 1G60A 1NW7A 2I62A 3ELDA 1G6Q1 3FTDA 3KKZA 2ZZKA 4G56A 5EMKA 3B3JA 4XUEA 5K05A 3H2BA 4F86A 1RI5A 5ICGA 3C0KA 3EMBA 5H02A 5HFJA 4M36A 4RTMA 4RTPA 3OE4A 1R18A 3O7WA 5FA5A 3UA4A 5E1MA 5E8RA 4CKCA 3KPYA 1G8SA 2HV9A 1T43A 3EMDA 3G5LA 2ZIGA 3LDFA 4FSXA 3A27A 5EZQA 5K0NA 1YFJA 4RX1A 2JJQA 3KPVA 4C4AA 3BKWA 4E31A 3ER9A 2YTZA 5MHTA 3LKZA 3NDIA 1NE2A 3MAGA 1P91A 5DRYA 5DT2A 3KPUA 5FTWA 1YZ3A 1AQJA 5CCBA 3GRYA 2PV0A 3HCDA 5EKXA 2ZULA 3EVBA 3VC1A 4F84A 3HVIA 5DWQA 5FQOA 5P8WA 2AOUA 2XYRA 5EPEA 4C04A 5IKMA 2B9EA 3R6TA 3I5UA 3OE5A 3THSA 5HIJA 2AN3A 3DUWA 4P7JA 4QPNA 2UYQA 1ORHA 1KYWA 2EX4A 2XYVA 3BZBA 4E32A 4PYJA 3PTAA 3ERCA 3M6WA 1BHJA 4LECA 2NNWB 2G70A 3R0QA 5G02A 5K0JA 3FTEA 4QDJA 2CL5A 1VP9A 3UJBA 2I6GA 4Z2YA 5EG5A 2CWWA 1D2CA 2OO3A 4HGYA 4XUCA 1NBIA 4QQKA 4MIKA 4A6DA 4RTNA 3RIEA 2ZBRA 1NW3A 3CCFA 2VP3A 4X61A 3L8DA 5GOZA 3FYCA 1XDUA 3GNLA 2YQZA 2O05A 2PGXA 2V7EA 5EMMA 5U4XA 4XCXA 5FHQA 4AZVA 5EIWA 3G7UA 4OQDA 1QANA 1SUSA 2VS1A 5GM2A 2JHCA 1KYZA 1FPQA 2GPYA 1AF7A 3B7PA 4FSDA 5LQKA 4EVIA 3D2LA 4RTLA 1QAOA 4RVFA 3BGVA 3UFBA 5DTMA 3VSEA 3ELWA 2IGTA 4IV8A 1EIZA 2QE6A 4OQEA 3GDHA 5E9WA 4FT2A 3EEYA 1R00A 4B17A 1UFKA 1NW6A 2AR0A 3FPHA 5DM1A 3VC2A 3HCCA 2KW5A 3OU7A 2VZ9A 3TM4A 4ER7A 1VIDA 3OFKA 3V8VA 3P2EA 4LG1A 1JSXA 4RTRA 2C7QA 3KQPA 4KIFA 3TM5A 1JQ3A 4C05A 5FWDA 4RVHA 3MHTA 3A7DA 3SVZA 3FUTA 2FCAA 2IDKA 4E33A 1JSZA 1U2ZA 3KR2A 3O4FA 2IIPA 3P71T 3HA7A 2PY6A 3GXOA 1VLMA 3PT9A 2AN4A 3G8AA 3MTIA 1JG3A 4EK9A 1YB2A 1I9GA 3MERA 3UJ7A 3KU1A 4KDCA 3TR6A 8MHTA 5F2OA 1XCLA 3SSNA 4FP9A 4CTKA 1KP9A 3KHKA 3X0DA 3T0IA 4RTOA 2O57A 4X60A 3AXTA 4GQBA 4MHTA 2LD4A 2P3QA 4O29A 2ZWVA 2HTEA 1XJ5A 1G55A 1N7IA 2ZIFA 2HR1A 3P8ZA 1UIRA 4GEKA 3PFHA 3I53A 4M7RA 2ZZMA 1NV8A 3NJRA 3GRVA 3ANXA 4L7VA 5JR3A 2UYOA 3DLIA 3T7RA 3EGIA 3IV6A 5EMLA 5LQCA 3FRHA 4YV0A 3LDGA 3P9IA 1INLA 1IM8A 3HCAA 3GRUA 3I58A 4V0QA 4YUWA 1F3LA 3G8BA 3LCVB 2WA2A 3PS9A 3HNRA 4NECA 3B3GA 3ORHA 5CVJA 3G2OA 4QTUB 3EPPA 2ZZNA 3DXXA 3DXYA 5GWXA 3HEMA 4PINA 2FRXA 3BWBA 2AOXA 4GOMD 3DP7A 4AZSA 4OX9Y 4RTKA 3IHTA 1KXZA 1VBFA 2NXEA 2OY0A 4QQNA 3EVZA 3PB3A 4LWOA 5BW4A 2ZIEA 1FJXA 2IH5A 5DX1A 3NVMB 4BLVA 1V39A 1WXXA 4P7FA 1RJFA 3I9FA 1ZQ9A 1WY7A 5DPMA 5GM1A 4DMGA 2NXNA 4ER0A 5HIKA 1R74A 3OZRA 4XUDA 5E1OA 2QYOA 1UWVA 2BR3A 4PCAA 1L1EA 3BGIA 1N2XA 3E23A 1KPHA 1SQGA 5DM0A 1X1CA 4ER3A 3SGLA 3CJQA 3OU6A 4HTFA 5CVDA 4DQ0A 3LDUA 5CUQA 4PYNA 5GIPE 4X1OA 1M6EX 2JH9A 3DH0A 4DA4A 1G38A 5EKUA 4RTSA 3G2MA 4X63A 5EC8A 3LPMA 3EVCA 2CMHA 3EVFA 3G2QA 3HCEA 3MQ2A 4GF5A 4X41A 3C6MA 3E05A 1WXWA 3EVAA 4POOA 3HM2A 3UWPA 4YUZA 3KQVA 2AVNA 3LBFA 2OB2A 1SKMA 4E2ZA 2XBMA 3C6KA 4RTJA 1AV6A 1FP2A 2GAFA 4U7TB 3SX0A 2G71A 2YXLA 3NW9A 4GOOD 5E9QA 4CKBA 1ZGJA 3IEIA 2VDVE 2I7CA 5DLYA 2B25A 2OYRA 2UYHA 5K8VA 2BM8A 1I1NA 1SG9A 2AOTA 2H1RA 2P35A 3UJ9A 1Y8CA 1RI2A 2C7PA 5GP1A 3U81A 4HSGA 2C7OA 3NTVA 2AZTA 2Y1XA 3GJYA 5DX8A 4PYIA 1X1DA 2PWYA 5DSTA 4ATNA 3DTNA 4PIMA 5K0GA 5LR6A 1P1BA 4OA8A 4Y30A 4WXHA 2OBFA 3MB5A 2FK7A 2ORED 3S68A 1VQ1A 2V74B 3SSMA 1KPIA 1R6AA 3HP7A 5K0LA 5C9ZA 3HVJA 3P2IA 4PIPA 4RTQA 1NW8A 2GB4A 3DMHA 2PSSA 2Z6AA 1WG8A 4U7PB 2IBSA 3A4TA 3JWGA 5EIFA 2IBTA 3V97A 1YF3A 2P3LA 5ICEA 3KQOA 5LQUA 4BP3A 2G1PA 4EMSA 4P7KA 2ZFUA 1TPYA 3C3PA 3EGEA 1RI3A 2P41A 5HZMA 3KR9A 1RI1A 3M4XA 3ID6C 1YZHA 4FZVA 1H1DA 2NXJA 2QRVA 4C03A 4IV0A 2ZBQA 4RVDA 1BOOA 3UJAA 1BC5A 1L9KA 3CC8A 1FP1D 4MWZA 4KRGA 3TKYA 1XDSA 3Q7EA 3EVDA 1JG1A 2QY6A 5FHRA 3TRKA 3HVKA 2YX1A 3TMAA 1NT2A 4E2XA 3MCTA 4HRAA 1YUBA 4AZTA 3G5TA 5KS2A 3HVHA 3LGAA 4QTTB 2NP6A 3TFWA 3HA5A 3LSTA 1EQAA 2ZLBA 3DXZA 5FULA 4PYMA 3AJDA 3GGDA 1QYRA 3R3HA 3M6UA 4QVGA 2ZSUA 3EVGA 4HG2A 3KQTA 5EOVA 5K03A 1JG2A 1XVAA 3BUSA 4ISCA 4V0RA 3UJCA 3LKDA 4GBED 2VDWA 2C7RA 5CCXA 1L3IA 2AOVA 3CVOA 4E2YA 2ZBPA 3FPFA 3P9KA 3NMUF 4PGHA 4KIGA 1P1CA 1IXKA 3OPNA 2PXCA 3OFJA 3BGDA 10MHA 2PX4A 5EHIA 5LSAA 3P2KA 3NVKI 2HNKA 3P9CA 1JTFA 2H11A 5BXYA 1Z3CA 3B89A 3I64A 4PCLA 4FR0A 3THRA 5JUWA 3QOWA 4RYLA 3M6XA 5ERGB 5EEHA 3FPGA 1O9HA 2ZVJA 4MTLA 3A7EA 3FTCA 3LECA 4R6WA 4RSRA 7MHTA 2YXDA 3P97A 2B2CA 3KPJA 1XCJA 2AOWA 4F85A 2ZCJA 2A14A 2BR5A 4YUYA 4M38A 2FPOA 5EQJB 5E2BA 3B3FA 3JWHA 1ORIA 5KQSA 5T67A 4PYOA 2GS9A 1HMYA 4GOLD 4MQ4A 2O0LA 1KR5A 2PXXA 5CVVA 5E1DA 5KVAA 2ZW9A 5CD1A 4AUKA 2UYCA 3LL7A 2EJTA 3HA3A 3UJ6A 1XDZA 3CKKA 4FGZA 1SVUA 3DR5A 4QPPA 4HGZA 2K4MA 4DCMA 3F4KA 4E30A 4ER5A 4UOEA 4YV1A 5BP7A 3EEOA 4C06A 3HCFA 2XVAA 3BWCA 3PX3A 5T6BA 1MHTA 2F8LA 4HC4A 3FUWA 1L3CA 2IP2A 2IPXA 3PFGA 1NW5A 3UJ8A 3KQYA 1MJFA 2O07A 4C08A 1KIAA 2YR0A 1BKYA 2IFTA 2Q41A 1XXLA 1JTEA 4YMGA 3DMGA 2EG5A 3MCZA 2JH8A 2EFJA 4A6EA 4HTFB 1O54A 3HCBA 3LBYA 1QAQA 4JXJA 3DLCA 2CKDA 4DF3A 2I9KA 4OA5A 4EKIA 3NWEA 3OU2A 3LHDA 2PX8A 3FTFA 3FYDA 2P8JA 2N47A 4CXMA
chains in the Genus database with same CATH superfamily
5LP1A 1ENYA 2YHAA 3K0BA 3KL4A 1T3ZA 3WGLA 2JFQA 2PU7A 1R4AA 1NHWA 1WVGA 2BEJA 3JATB 3EUEA 5HJ7A 2JAQA 2UUCB 1CETA 4R7ZA 5HQJA 3FPLA 2G8NA 4O4IA 1RRCA 2GXAA 2E6KA 3JQ8B 5JASA 1AQIA 3C5HA 3K4PA 3P0IA 4IDBA 3F8WA 4RIGA 3PVCA 3MTGA 1FFDA 1NVUQ 3H4MA 3R5KA 4CL2A 3T3HA 1EFDN 1JLHA 1RVV1 5EQTA 5AW6A 5JADA 4LGCA 2IQ5A 3UA3A 3VAYA 2WHPB 1G63A 3CCBA 4TRJA 1BO6A 3KYDB 5F4ZA 1CUGA 1X7YA 1ZOLA 2WA1A 1WE2A 2O48X 2X9QA 3IQWA 4HPWA 4QOSA 4CQJA 1TM5E 5JCJA 4D4IA 2J0SA 2IEYA 3ADDA 4IXDA 4PHTA 4UMEA 2BBWA 2G17A 3S29A 5IANA 3HBMA 3SMQA 2PEYA 2Y4NA 2ADMA 1CQXA 4JJ6A 4BZXA 4D1YA 4DMKA 3SLGA 1XRSB 5TQ0B 2IYTA 2A0YA 4CR8A 3UCFA 3CRW1 4UUNA 3AF0A 4CBVA 4OFZA 3AMVA 1ZD5A 3SIWA 3ZDAA 2WJ4A 4EYQA 3FB4A 2IL1A 1FUEA 3QKRA 1WSBA 3A4MA 4G5QA 1ISJA 1FJHA 1SK8A 1I1QB 1NLZA 1WRBA 1FZTA 4I08A 2J31A 4DZTA 5A1TA 2JNWA 2KBFA 5EP1A 4PAOA 1WS6A 3C5WP 5ENDA 5AM4A 2CMKA 5FXMA 4XIJA 1N2CE 2C9BA 1KEUA 2EFGA 3WK6A 1BWRA 4Z4CA 1GPNA 2N75A 1LFAA 2WKQA 4QYIA 5IVIA 3M0EA 3VDRA 1T36B 3EOBI 1YDMA 4YMWA 1I2AA 2ZAMA 4IUCS 1QAMA 5EGSA 4DREA 5CFRA 2OXTA 5WRFA 4FS8A 1CIJA 2A86A 2VWHA 2YNMA 4HZIA 1RMQA 4XR9A 5DBOA 4OBWA 2Q5LA 2Z09A 1VL5A 2VHZA 3AVVA 3THXB 2I7VA 1I80A 3H0KA 4KDRA 1IHPA 3FWNA 5AOCA 2WWFA 4KLAA 4LV5B 2YXEA 2GT1A 3IAAA 1DIOB 4RY2A 2E3JA 2SNIE 3CN9A 4GP9A 3S28A 2MINB 4D8VA 1EG2A 1YQXA 4KWIA 2R6AA 2EFYA 1PSDA 5KC9A 5I51A 2GWRA 3ODPA 5JXHA 1T6NA 1N1GA 2DCUA 1FXWF 2YDYA 4QNMA 4RK4A 1Y4ZA 1TA9A 4U8GA 2NZ8A 5CH5A 4UFPA 2P6UA 4MUIA 2HADA 2QB5A 1M7HA 1CZUA 4U7WA 3E61A 5H3HA 3NQ41 1U8TA 1RPZA 2CMDA 3SBEA 1VL6A 1V4VA 2VEDA 4X3OA 1OBFO 4ZVOA 3RHZA 3SBOA 4RK7A 1UM9A 1U0SY 3BBPA 4CV3A 3NHWA 3SYTA 3V4VB 2LV8A 2QT9A 2BCGY 1I0LA 4CCAA 1PKXA 4ZAYA 2IC5A 2OKCA 2A5DA 5JDCC 2WICA 1N9KA 1R6TA 3E81A 2O6LA 2FN7A 4RK5A 5JSQA 5A5EA 3CT6A 4M8NE 4HCJA 4MW2A 1L6IA 5EZYA 5GV8A 1U3VA 1IH8A 2VRCA 2Y1FA 1Z2OX 2R1VA 5EAIA 2PFSA 1GNQA 3AHJA 2J3QA 1JLLA 3TZLA 3RANA 1C0KA 3ESBA 4O4HB 3W7AA 4DBLE 5KTNA 4NMLA 3WLFA 1ZM7A 3K1ZA 2EGGA 2KMLA 4RZ3A 1XZHA 2FGJA 3AO0B 3W3AA 4N0MA 2YVUA 5HG0A 1KORA 2V45A 3C3YA 2IOFA 5JI2E 2RGEA 1KH3A 4AK9A 4TL8A 1RABA 1JSLA 1QFXA 1PZFA 2RARA 3EEQA 4P7GA 4QREA 4ZCSA 4CLOA 5DMHA 5KOIA 1TI7A 1R5JA 4LX0A 4MHSA 4EBBA 1Z8NA 1LLQA 5LZ2A 2CLOB 4FFDA 3I4LA 1SR8A 1DB3A 2NTVA 4QDXA 5E38A 3PEEA 3T7AA 4Z7NB 2I2AA 3B5EA 4GM0A 4HAVA 4MH0R 2VP0A 4E7PA 4F3YA 2QRQA 1FBTA 1GWNA 1K7YA 2CHFA 2HXGA 1C7JA 5JANA 4WKCA 1CVRA 1SZPA 3OPYB 1SG0A 3B1VA 4F91B 1M0SA 2JRCA 1JYFA 3GXBA 4GQAA 2GVZC 1WY5A 3H17A 3PKIA 4X62B 2GERA 2J46A 2ZT6A 1LI4A 1HWYA 2YJ5A 1ICIA 2RH9B 3K4QA 3ND9A 1SBIA 2VT3A 4GOND 3VU1A 4G1CA 1LFDB 2GF0A 4X8HA 3QE0A 4K9NA 5TPZD 1SPBS 1A72A 4PWYA 1IDOA 4L8FA 1WUYA 4RD6A 4J0EA 4XDYA 5EGNA 4GLBA 2XCUA 2QD2A 1TK2A 5A4DA 2A8YA 3AR6A 2QN3A 3NETA 3SFTA 3SOZA 3SQMA 3N0WA 2C77A 2H2GA 4UU8A 1L5KA 1H2YA 1P9WA 4B4WA 5E8RA 3AP3A 1Y7PA 3KPYA 3AL3A 5DBHX 4WADA 5IDYA 1BN6A 3FDJA 2GTIA 2PTGA 2YW2A 3BA1A 4PR3A 1PL7A 1X7YB 3BGOS 1U1CA 5IUNC 4FW8A 3BICA 5MHTA 3TL2A 4YXWD 1E4OA 5DRYA 3RREA 5B57C 1QCCA 4J0KA 3GOQA 3UBMA 2Q9BA 4OU4A 3LYHA 1D0IA 3GFSA 3VC1A 4AUNA 4CLDA 4BL5A 2UXBB 1DZIA 4HNVA 3EWIA 3OE5A 2WMYA 4RK1A 1KSFX 1CCWA 4NMMA 2JDIA 2OECA 4QRHA 2P90A 2VBGA 3PTAA 5IVPA 4W8HA 3GD7A 3VISA 5FPTA 5JW6A 3A1FA 2G70A 3QKRB 4QDTA 2NU8B 4AJ9A 1SKBA 4ZTUB 4EEKA 2RGYA 3UMVA 1CIPA 1BXZA 3NHYA 4QTZA 1FIUA 1XQ1A 4CM7A 5ALKA 3IAXA 4H16A 1WU8A 4RTNA 3GN1A 1IY2A 2X5NA 2QQFA 4QYIB 4Q1AA 3C6QA 2VSNA 2FE4A 1NUUA 1CBUA 3D8UA 3K31A 2CLKB 4KKVA 2ZREA 2JLAA 5JNVA 4QODA 3PJGA 5FHQA 1Q0QA 1KFCB 1TYDE 3PFIA 3FE2A 5JS1A 4LHZA 3L8FA 3WMEA 5AT1A 2QX8A 5A04A 2H4HA 1XYYA 3M5CA 2NZVG 3EIFA 3W9YA 1BX0A 2C3OA 3UFBA 2RD2A 5AJXA 3K6KA 2DXIA 2A57A 1ONSA 1AO0A 1NUHA 1LQTA 3IGFA 1OIVA 2WZCA 3EBOA 4QU9A 2QTMA 3WWEA 3NHUA 2VKQA 2CN1A 4HBGA 1YVUA 1OTHA 4NYMQ 4RA6A 5IAJA 4EHIA 2CUNA 5AW3A 3TXYA 1G21A 3AEYA 3BH6A 1E1QD 1RKQA 3FVRA 1NN5A 1EMDA 1C5KA 1LSSA 1VLLA 3HSYA 1PGPA 1Q7RA 4B83A 1W5SA 2PGJA 3ZKWA 4PG8A 2I54A 1NW4A 3AETA 3FLMA 3E0QA 1GKLA 3ZQ4A 1GPWB 3BAZA 3H87A 5ELLA 3EIXA 3G8AA 3GFVA 4I1IA 4C4TA 4LYJA 2VYNA 4BX0A 3AEUA 1XJCA 2C4VA 5JS7A 2XQVA 3DVSX 1UM9B 2BFDA 4YECA 2R4QA 1D2NA 4XYEA 1AIPA 4HHEA 1OQAA 2I6SA 4DMFA 1DO8A 5EQDA 1P7PA 4EUSA 2FSPA 3HXPA 2H8GA 3F78A 2ZWVA 1TRHA 1N7IA 1M2KA 1UXOA 1SBTA 5EZYB 2PKEA 3H0EA 1XNHA 3OCZA 3Q3IA 2DMRA 2K7ZA 2JFYA 3LUHA 4M7RA 2VPPA 5IK2A 2R1VB 4MMXB 1GZUA 3K6JA 3WMGA 5JR3A 3UANA 3L0ZA 1Y8ZA 5C53B 3AZOA 1JLLB 2J9ZB 4NY1A 1BFUA 2GKGA 4XPIA 2PMBA 1O6GA 2QI9F 3AH8A 4J2HA 4M1KA 3L9WA 4YUWA 1TYEB 1A04A 4Q19A 3LCVB 1XF1A 1ORVA 4ZJUA 3G2OA 4WQMA 4C7VA 3HDTA 3HEMA 3MPOA 4XA8A 1XXHA 2H16A 5CH8A 5DNUA 3EWNA 1KQOA 1UUFA 4ITVA 5LCXA 4CLOB 2RGCA 4JXKA 5HUHA 2NUAA 2OT3B 4LWZA 4F12A 1TO1E 2I67A 4D0NA 3R8FA 2P62A 1XRMA 3TQOA 1VOTA 3I9FA 4AY2A 1HFEL 4YFYA 4D3SA 2VF4X 2HIHA 2PX3A 4Z5XA 3C97A 3GT4A 4KQGA 3KZMA 1OFUA 1J1ZA 1TCAA 1NN0A 5KYUA 4MEJA 4H59A 5FPHA 5CUQA 4YAEA 5EUMA 1FTNA 2JH9A 5A5FA 2Q3CA 4QDUA 5HJ5A 2JZNA 4PO3X 2PS3A 3MF4A 3EZYA 1QH1B 1A9SA 1DV2A 3H97A 1I10A 1TEXA 3VR4D 4QHYA 2VDJA 1FFSA 1NVVQ 1UODA 4BEWA 3THWA 2EF1A 2Z8YA 3NYRA 2AG8A 3OZUA 4ND8A 3CF6R 4FI3C 2C8LA 4PY2A 1CJCA 1LDYA 3ZE8A 2G76A 2NGRA 3CH4B 4Y0AA 3T8YA 3N2ZB 4IIXA 1DJQA 1JDSA 2M6RA 2MDTA 1YU6A 3H9JA 3TJZA 3JAMA 2VCEA 4HQKA 1HLGA 1SPXA 3ZTTA 2I33A 2R87A 3D4IA 3KXIA 4HLNA 4XD7A 4DL9A 1JHRA 1Z7WA 3M2PA 2I7CA 2XB2A 3LT2A 3AIKA 4DM7A 1NSTA 2GUWA 3O3OB 4B3CA 2VT7A 1M7BA 3N2GA 2B30A 3DKVA 2J45A 3PUWA 2FV8A 5FJJA 2AZTA 2BD0A 3V32A 2BGTA 2P9JA 1P4GA 3DJYA 2XRFA 3SZ3A 4ZVNA 1ILWA 4HQOA 5EE9A 5B6PA 2JLRA 1NIPA 3ETLA 3OQ1A 3QOFA 1LD3A 1JWAB 4F9TA 1CQJA 3JQBC 5CDUA 4J7XA 4Y30A 5J1TB 3RS7A 3ZCPA 5C34B 2ZQ5A 3SSMA 2FUG6 3CUTA 4WKNA 5E2IA 3V00A 1SCUA 5NULA 3NRJA 4G5OA 2Z6AA 3K30A 5JDCA 2VYQA 2FWIA 2X22A 1KWKA 3T3EA 3GUZA 1RYFA 2LNDA 1U2PA 3CR3C 5ICEA 5I9NA 1PQ4A 5LQUA 1HL7A 1VM6A 2G0NA 2HMWA 3BWDD 3PFFA 2HZBA 3EBPA 1OGJA 1DPGA 1RI3A 3AR8A 1ZBDA 2O23A 3OT4A 5J59A 3V7UA 3PI6A 3WO0A 1H85A 5HZMA 3FTNA 3CLSD 1DX9A 1HDZA 4NULA 3TTWA 1DWUA 2IE8A 1P60A 1XZDA 2J3EA 3MGCA 4UUAA 2EKQA 4D3XA 4KE6A 2ECQA 3CPJB 5AP9A 2IYVA 3B38A 1XAIA 1I5EA 2ZYWX 1P2SA 3QWHA 5DHAA 3PNQA 4DS3A 1FFGA 3OPYI 3NXKA 4R83A 2OD2A 2QY6A 4JI0B 2GJAA 4IDDA 4QGFA 4P8RA 3PWTA 1HFWA 4C30A 3AVPA 3I1YA 2XZPA 5ALNA 4BZPA 2XITA 4M0UA 1H05A 4CODB 4E2XA 2Q28A 3LGAA 4HWTA 4EZEA 5IN5A 5K8IA 3ZLUA 2AKEA 3D0KA 1XZNA 3LFTA 1YB1A 4C7OA 4A8TA 3Q6NA 1HTTA 3QEJA 2EDCA 2G8LA 3AR9A 2R6CA 3G85A 4QVGA 1H0HA 3O7MA 5CLQA 2WYUA 2QRGA 1E2LA 1W47A 3LUBA 5JC1A 4RA6B 3AF5A 4V2IA 1B26A 2O8FA 4IZ6A 4EA8A 1AHPA 4K1XA 1B7GO 1YL5A 1G21B 1PYGA 1VG0B 4NR0A 1KEWA 1P1CA 4A7PA 4MPRA 2PXCA 2C2WA 1MPXA 1ZK0A 2WAMA 2HJWA 1TL7C 2C2OA 3OEWA 4BV9A 4YMSA 4EQ6A 1JVBA 2GZ1A 3VSAA 3ZBQA 1K5DA 3ZKWB 5IU6A 3AETB 1IOWA 4IJUA 5C8YF 2CJWA 3QOWA 3BJMA 2Q8QA 2IOQA 3R1IA 4R5HA 3TIXB 2VNIA 3MJ4A 3RO7A 1FS4A 3AEUB 1K7EB 1TU4A 3MYRA 4MYTA 5LDGA 2OFPA 3LECA 2BFDB 1L4YA 1V1JA 2W2VA 4R6WA 4TZTA 5FWYA 5JYDA 2YXDA 4Q4HA 1GUAA 3R8XA 1JLMA 1XCJA 2Z4SA 3P96A 3PPVA 2VG8A 4JI1B 2NO7A 2FPOA 3D8RA 4IEIA 4X6XA 2DFTA 3N8DA 5EJGA 1QO0A 2H2IA 4BNVA 1RLJA 2P78A 1UADA 4DV1B 4AKHA 2AQKA 2OK7A 4Q6WA 1W59A 3B1ZA 3V1YA 1H23A 4JOBA 4UMFA 1IFXA 2QD1A 4MQ4A 5CVVA 3DVRX 1DTWA 3TB4A 5EE1A 1QFZA 2EJWA 3VTKA 4PTZA 2IUSA 4XPIB 4F7WA 4CM4A 4ZC1A 1PTJC 1Y7LA 2Q3LA 2O3TA 3RI3A 1PQUA 2Q4RA 1IAVA 1RXEA 3C3XA 1E8DA 1QM5A 5AVKA 3OECA 3UNXA 5JAOA 5KO2A 1RBZA 3PHBE 2R7AA 4Q21A 2LCFA 4YJ2F 2HSJA 5TEWA 1TAQA 1AMOA 1XXHB 2LKDA 1A69A 3IAM1 5C7IO 1G16A 2NUAB 5SYAA 3S3TA 4IEFB 5UKDA 4CFZA 2OBMA 4Q3AA 1VA4A 2NZJA 4Q0MA 1UPBA 2TYSB 1YDHA 1IN5A 3B1JA 1Y42X 3JQ6A 2WHYA 4UXHA 3QVXA 1AU9A 2XLBA 4L8WB 1AC5A 3BZWA 3F6YA 2ZRNA 3FNGA 3EISA 2IZ6A 5CNJA 1DBPA 5KYUB 3G0IA 1BDJA 1FNDA 1R0YA 3R3WA 4FX2A 2XT9A 2WUVA 3SQXA 1KZHA 3VVMA 4C7KA 3OZWA 4OI2A 2H2WA 3CPHA 3FYDA 1I5OA 3ODGA 2J7PD 3QQ5A 5EXDA 1A0OA 1WM1A 3P4XA 4LZOA 4BLTA 4BEJA 5LZ4A 3THWB 2DR2A 1UPXA 3VSCA 3ZS8A 5JBNA 3V48A 4ND8B 2HH9A 3KR1A 4MZXA 3NGLA 1EX1A 4LMPA 3SE7A 4OP1A 3KQWA 1CQPA 3NT4A 5FPYA 2OAEA 3R0VA 1N3LA 1T2DA 5ALXA 3KCQA 3W5VA 2IIBA 4E6EA 1LBSA 4Y2HA 3RYFA 3WOHA 4U5XA 3EVTA 4DLPA 1G21E 2V54A 2VP6A 5ALRA 4YV7A 3OWOA 5LC1A 5KQRA 3TOCA 2AE2A 3K1JA 2Q7XA 3WVNA 3L6UA 5FTJA 3UC9A 1N7JA 3CX8A 3N2GB 4DNXA 2LDBA 4WEOA 2OXEA 1W0JD 5P21A 5AVRA 2GA9A 2ID7A 4ZXPA 1EVLA 4I4LA 3VX4A 1QHXA 5DM60 5FLYA 1QH9A 3MOSA 5L6MB 4QPDA 1PSWA 1CQJB 2IOYA 2AUTA 3ROTA 3A32A 5CW1A 4UEQA 1TVCA 3KALA 4YDHB 4P53A 5DNWA 1SCUB 1RACA 1IQ0A 1E1DA 2FB9A 3I39X 3MXTA 2XYQA 2HA7A 3KTAA 2YXNA 1R64A 4ZXFA 2PQMA 3IPYA 3LCCA 4U2FA 5MN6A 1PG5A 5AOVA 1N2BA 4HJXA 3V2UA 3W5IA 4B87A 1FFXA 1ZS9A 3IQFA 1Z45A 1EFPB 1RJ9A 4K6MA 4O4JA 4IFIA 4LDZA 3PTLA 2Y27A 4P4SA 3EAGA 3IMFA 1N2IA 5IH3A 2WDPA 3UTCA 3RVDA 2PD6A 1GARA 3ZPXA 3DOIA 2HLNA 4PG5A 3EQ8A 2FWRA 4AX4A 4DC0A 4DDUA 3F7OA 2JARA 4XVQA 1DI0A 4H1UA 4IQ0A 3UO8B 1XXHE 1JQLB 4YQYA 4Y0NA 2J9GA 4GI7A 4IRMA 4H0NA 1HEIA 4PNEA 3L7YA 4GKJB 4EGJA 4EEXA 3HXOA 1RQLA 4DZRA 3AHDA 1O08A 2O5EA 4EMSA 2BSXA 1F8YA 3FAKA 3MFQA 2NMVA 3OOEA 1RHRA 1T5SA 1DCTA 3NIDB 1XEWX 1ACJA 3BHIA 4C7OB 3TRIA 4CL3A 4CLXA 1GCGA 4FT4A 3TPZA 1Z15A 1JI3A 2CLCX 1T24A 1TJPB 3BKXA 3GY0A 3I6QA 3QUQA 4FQ8A 1PJBA 2GFQA 3L04A 1VCMA 2YJ6A 4JLKA 4RABA 4X91A 2FZ5A 3U7QA 2GZ2A 5CR9A 3CZPA 1EXVA 2VAWA 4HH4A 3F9IA 2IHZA 3A25A 4EQ6B 1O3YA 2I66A 3IEXA 4OHUA 5IJZA 1P61B 1QWSA 2QUIA 1Y1RA 1Q44A 5JMTA 2CJWB 3OC6A 1WEKA 1MVOA 3T61A 1A8UA 2SKDA 1DCKA 1T6XA 2H7XA 4BP9A 2J6CA 3H8VA 1KK1A 4U02A 4DQXA 3FOWA 5FWYB 4ZMSA 4Q4HB 1S2DA 5FI1B 1KZYC 4HNAA 3CLVA 4DCUA 3AWIA 5ALFA 1NJGA 1SCAA 2VXBA 2W00A 3E8XA 3FETA 1DC3A 4NBSA 1NMSA 4J76A 4QAQA 4D8TA 1JQJC 1U02A 2G40A 4Y6PA 4JR2A 5CVUA 2REBA 4H60A 2H1LA 3AZQA 4HFMA 4MUXA 1JIVA 2JIZD 4H9GA 3QU4A 1GA4A 4Q4AA 4I55A 1ZICA 4PC2A 4R2JA 1DTWB 5I8PA 4I9NA 3KJZA 4Q93A 4RZXA 1FFYA 1JHDA 4W63A 3ELUA 2ZWOA 5H1YA 4NYIR 5CXQA 3EZ2A 3JQBA 1D3AA 4CM4B 4JI4B 3JWPA 3OQJA 1YB7A 2ZS7A 1JR3A 3CF0A 3TTVA 4LJYA 4Q7JB 2PJDA 5JEDA 1QF9A 1APBA 2A94A 2VBCA 4FOPA 1Y3CE 9GPBA 1KRXA 4YALA 5ITWA 4BU1A 4X64B 2Q3BA 1N34B 1XWFA 2BGIA 2I91A 4TVSA 1KHHA 4YUAA 3M1IA 2JG3A 4KQXA 5GINE 3D64A 4KXXA 5EEGA 1MX1A 2FPXA 4TWBA 2PBFA 5K09A 2V55B 4QUJA 2I4RA 2ZSIA 4G4IA 2D1FA 1W85A 3F8TA 1T2AA 3VTFA 4M37A 3BGSA 1PUIA 4TWRA 1FSPA 3GA0A 1YVEI 3NKLA 4Y98A 4NMXB 1MOPA 2J4DA 2AJBA 5FO0A 3ZY2A 1JPJA 5LLSA 3O6VA 3UMMA 1I3LA 4KXFB 2D7DA 4I1RA 4DLBA 4RD2A 1DKOA 3KOXA 3WRYC 5KSWB 2OQIA 2P9EA 2Z98A 4J9UE 5FFNA 5GONF 3G9ZA 4KUEA 4U2EA 4P32A 4XJTA 4PC7A 5K05A 3F97A 3H2BA 3RYFB 4OHCA 4Z3OA 1V5EA 3M8KA 5AW9A 4U7DA 2PUFA 4GKAA 1R18A 3KVNA 5FA5A 3D3KA 4K6KA 3K96A 7GPBA 5IDWA 1JGTA 1Z39A 2ZYTX 3TG8A 2EXXA 3TCXB 5HUJA 1SUBA 2N42A 1EVKA 4MVJA 4ZMBA 5B4UA 3PFNA 3FVQA 4JB3A 1L5WA 2YTZA 3ER9A 5AESA 3FHTA 2ZP1A 1W49A 1J39A 2CXUA 1L7BA 1OD6A 2HC9A 2ZSFA 3I1FA 4PX3A 2NTEA 1UAYA 3NRCA 1O0CA 4EGSA 1RIIA 1JILA 2VPWA 3G17A 4AZ3A 4XH9B 4GDFA 2XYRA 3OJXA 4P83A 2DHEA 3P19A 3HNPA 1WAMA 2XMCA 3BK7A 3MJDA 1DG1G 2V96A 2PKRA 3L0PA 4TM8A 1AUVA 4TZKA 3KTAB 4ARSA 5KQGA 1TTPB 1TTHA 3L6EA 1FFXB 4YMVA 4RANA 1UKBA 1RJ9B 1G2IA 4O4JB 4UQOA 4B3DA 5JFGA 2BF4A 1T8WA 5AMXA 1NBIA 3K53A 3LX5A 4P4SB 3QTBA 3A6FA 4A6DA 3TB6A 2PGAA 3K9NA 4OMDA 3ET4A 1MAHA 4JCOA 4BUZA 3GNLA 1PTJA 2FKNA 3GWGA 2BC9A 3CSUA 4RPIA 2UZIR 1UOQA 2MSDB 3HUEA 2WJAA 1I6LA 4J2OA 5J4KA 3I45A 2F59A 3IODA 4RO0A 5K6TA 4WPGA 3C5CA 2XGGA 2HL6A 3QU5A 2EZTA 1NZDA 2C00A 2HK9A 1G5IA 2BHLA 3PUVA 4GNKA 3UUEA 4BWVA 3F74A 1N25A 1S8FA 4AJPA 2G06A 4D97A 2QE6A 3GUHA 3DMYA 5CCDA 2OE2A 3VH2A 4PPFA 5JATA 1QTRA 1R00A 4B17A 2PU5A 4B6FA 3EA4A 1EFHA 1T91A 3DL0A 4IHJA 1GG5A 3RK1A 2Q1TA 2RK3A 3FPHA 3KLBA 2GD0A 3B6JA 2I9PA 4G07A 3OCUA 3NWJA 1R0CA 3I9V1 2GA8A 3IDFA 4KACA 3RUFA 3U7QB 2JAUA 2AEFA 3LWDA 4GXNA 3VSBA 3BB1A 1JQ3A 2RBKA 4NOMA 4B1FA 4IJ5A 5KNBD 4GLFA 1XMVA 3OEHD 2Y66A 1A9OA 1QG0A 4KIWA 1CPYA 3WMWA 4BV3A 4CIWA 2CJYA 2WFAA 1ISSA 4S2EA 4EW1A 2F1IA 4Z0HO 4KOAA 2WQ6A 4P0PB 3AL0C 2JJMA 2X8AA 2Q6OA 4ZQHA 5CEJA 2GSWA 2XOEA 1XCLA 4A03A 5LD2B 4LF6B 1CUZA 1LY1A 4Z9XA 4Y2PA 1K7CA 4JI5B 4UVHA 4AROA 2AFVA 1VCOA 2QMQA 3AXTA 3CRMA 3R3JA 3KELA 4HNAB 3E0XA 1ZNXA 5JLAA 1QB7A 3PA6A 1B15A 1V96A 2VPTA 2H0RA 4FFMA 2O6HA 4KO8A 3UV7A 1G6KA 2GAOA 1UBSB 1II9A 5CK5A 4MRNA 1M72A 3IDAA 5GVRA 4Q4AB 4I55B 5BN1A 2GO1A 2QG9A 3DLIA 1CC1S 3TN7A 3IV6A 2XKKA 2PYIA 5IAEA 2VT6A 1FRFS 4KB5A 2Q2NA 1DEAA 3QVJA 4GG1A 4XQGA 5E4JA 2PR2A 1OXKB 3CLSC 3GRUA 4B4UA 1F3LA 4JI8B 3VZPA 1Y1PA 3GROA 3PE4A 4MR7A 2ZZNA 3EPPA 2Y2VA 1RRGA 3ZHTA 3RWBA 3T9DA 2DUUA 1N6IA 2MU1A 4OHPA 2A2ZA 4EW2A 5HTKA 4QQNA 1E9CA 2GHRA 4R9NA 3W4KA 1P75A 1E18A 3SIXA 3U3KA 5JXJA 4JX9A 5I7UA 1OVGA 1QIMA 2CF6A 2YZ2A 3V8QA 4B74A 1KL7A 3TG2A 3FPSA 5TF0A 1Y3DE 2FFJA 1UWVA 1WO8A 2YY6A 3M6IA 4GPD1 1QP8A 4HX2A 1N2XA 1CUUA 2E4XA 3EF0A 1KPHA 2HCTA 5AI6A 1Z35A 4M1ZA 4MYCA 2FXIA 2BFAA 3SGLA 3LA6A 2GCPA 3CBQA 3CWZA 1YC2A 4Y2GA 3L7NA 1SB8A 2Q6KA 3KZCA 2J3KA 4CU5A 4M9CA 3DL4A 1YA4A 3WSVA 5KTKA 1IVYA 2R1TA 4P33A 4MI3A 2ZSKA 3N86A 4G84A 1T6YA 2FEXA 3OF3A 3SQLA 4GF5A 3ZCXA 3WHLA 4NMWA 3FYSA 2CDAA 3NXSA 3OT1A 1HETA 1U80A 2IODA 5EJIA 4DXHA 5TPZA 2ZUSA 3KQVA 3LBFA 5EJFA 4BVAA 4RMIA 4O4IF 3QTTA 3C6KA 4O0LA 2BPOA 1SEPA 3DKPA 4URHA 5DLQC 2G9ZA 4U7TB 4TT3A 1X7DA 3QA9A 2FG6C 2A58A 3EODA 1ZGJA 2WI8A 3LE8A 3ZU4A 4QLOA 1Q20A 3CF4A 3ILXA 4OL0A 5LMZA 1OYOA 2D2VA 5LQSA 1G8PA 1RW4A 3Q0TA 5C4IA 1TMOA 3HPQA 4Q5IA 1IONA 4G1BA 4HSGA 5JS6A 5FIUA 2CFTA 2PDAA 4O1MA 4NLLA 4UM9D 3UHAA 2G28A 2O2HA 1A2BA 2M98A 3FNBA 2VUIB 4ATNA 4BE7B 4NENA 2XCLA 4YXWA 5GGXA 5BOVA 2WTEA 4B9AA 1AE1A 2DKNA 4AZ3B 3GEBA 1HX7A 1BE6A 3U17A 1ND6A 1LDMA 5CVTA 3S68A 3RGGA 3JARA 5CU7A 4OGLA 5AM2A 4M86A 4RTQA 1EH5A 3GK3A 4Z4GA 2AUMA 2OHXA 2R7LA 5EP2A 2V0GA 2P4UA 1QKKA 1V16A 2CYAA 2FN9A 4JA0A 5MFZA 3V97A 1YF3A 1XNRB 1AK1A 3DQQA 3ZOZA 4PLCA 1RRVA 3ZDEA 4CLEA 5JAHA 3GRFA 3OI7A 3UXHA 1F1JA 3BSFA 4JZKA 4JJAA 3PRYA 3JD0A 1IHUA 3SBXA 1OH7A 3NOOA 3OVMA 3VZCA 3LK7A 2E89A 2CGEA 4RVDA 3NHSA 4AYXA 1BC5A 2QYHA 2RGAA 1FP1D 3TRHA 4FKBA 1Z0KA 2PUVA 3L06A 4QOHA 3EQ6A 5AI8A 3COYA 1HOXA 1N6RA 4JMLA 3BMNA 4DQKA 4ZP1A 4XX1A 5A0TA 4HN4B 5G4LA 4MUFA 2JCSA 2X8LA 2IHVA 1YUBA 1EBFA 2V5UA 4WESA 4R3WA 3UK2A 3SLRA 2IUEA 4IPTA 4JYCA 4ABTA 2G9VA 3CMCO 1UBMS 2JGDA 3QVSA 2OM2A 2BV3A 3ZWNA 5JWOA 5FULA 4WXPA 1DC8A 2O7QA 2GRJA 2PCJA 2VK8A 2P4HX 1U9YA 1YFZA 3NHKA 2ZSUA 4WY5A 2DB3A 4DNOA 5D6NA 3WL5A 1N1MA 3MWYW 4ISCA 4IHJB 4TXHA 2O2ZA 4YVFA 2I29A 2VDWA 1E1NA 1E2JA 3GLTA 1W4RA 4Q3OA 1Q84A 2VWGA 1FFWA 4FYHA 2HU5A 4LBVA 4LOAA 5EWLA 3OPNA 1VKOA 1IQRA 4DB2A 3N3BC 3EGXA 2F1HA 2QY9A 1TQHA 3II6X 4YR7A 2PUDA 3CX7A 3DZCA 5BXYA 1E1QA 4NI5A 3B89A 1B1AA 1VKHA 4WT7A 5G1OA 2Z2YA 2VOJA 3THRA 4BBAA 4LYFA 2ZUTA 4AJEA 1A8PA 4ZKEA 1ULAA 3B2QA 3QIAA 1BWPA 1WX1A 5B30A 3OWXA 3WQSB 4UTPA 1BEZA 1GUYA 3C3EA 1KY5A 4MVJE 5FDFA 5KNDH 3CNLA 3B3FA 1I5RA 1GTG1 3FSRA 2Q3HA 4ETNA 1AG9A 1SZDA 1ZZEA 3ETGA 5D8DA 1G18A 2NZWA 1Q1EA 1T9GS 1G9TA 4M9UA 3ZCUA 1C9KA 3F71A 4GICA 3TVYA 4Z4HA 2ZKIA 4F6RA 1JDPA 1DCMA 1ZOPA 1RPJA 2EBWA 2FQ1A 3EIHA 3Q6MA 2A0KA 3K73O 5J5AA 3S1AA 2Q0XA 2Z83A 1GLGA 5J23A 1K08A 3Q7RA 3OZGA 3LT1A 5ANRB 1JAZA 2AFHA 3K8ZA 4N01A 5ICMA 4MR7B 1HO3A 3VJKA 4RSHA 4Q3DA 3DLHA 1FDVA 4A8JC 5JPIA 5K6RA 3IEMA 2CNKA 1VGQA 1CV2A 3MCVA 4XRRA 4DCSA 1CY2A 1TMYA 2XQFA 2GK7A 4GPIB 4NZYA 4C08A 2OHVA 3OJOA 1IZZA 3OAAD 4CG2A 1W25A 3N87A 2JCGA 3ZZNA 3RAJA 4QHSA 1GZHB 4DSAA 4D4HA 5CH3A 3L84A 5C7OO 3IUBA 3IO3A 2OR3A 4A6EA 3RU9A 4ESHA 4XCVA 4OHOA 3UQZA 2CKDA 1L4LA 3KWJA 1K66A 1OAOC 3JYNA 4GI5A 3SS7X 2DVMA 1HBJA 2NO1A 5BPFA 2N47A 2R1TB 5G0UA 3RFXA 3EXHC 2FEAA 5ICFA 3CEJA 5DCYA 3I2YX 3VPFA 3UUGA 2Z4TA 3OO0A 3VR4A 3OT1B 4BHTA 2B1JA 4PPGA 3QELA 4C5BA 2PZAA 3D3WA 4P58A 4C7BA 2COUA 3DM9B 4F2DA 1EIWA 5LQRA 4RWZA 1PDOA 1GGFA 3QU7A 2HDOA 5AKZA 5I9BA 1AF4A 1VLJA 3TOSA 3AJEA 5HS4A 1EJ0A 2GKOA 4I3FA 5G1PA 3VKHA 5CFOA 3OIUA 1IIRA 2BWJA 4GFDA 2IH2A 2EWMA 4NFHA 4LV8B 5DNEA 3SR0A 2AX4A 4TKMA 4NENB 4OSOA 4MUNA 3ETHA 4HQLA 3VUFA 3L18A 4L75A 3L49A 3ZWMA 4RHYA 3VJRA 5CFMA 4P34A 4CETA 1YT5A 2WSSD 3JARB 4JS0A 1PQPA 3VNVA 1SVOA 4WCDA 5H82A 1QRSA 4LSGA 1GA1A 3IUPA 4FYMA 4QOJA 3KIPA 5K8UA 1V16B 3Q0IA 3R77A 1GQOA 1WKCA 4CM8A 2VYCA 3DOEA 5B4TA 1Y4UA 3HCPA 4Y9RA 4BBPA 1WF6A 1MX5A 2FU5C 4PLVA 4RZQA 4YHHB 1MF7A 3M33A 3KK0A 4OUDA 2FW9A 4KR0A 5JWHA 1GGNA 3G2IA 3D3EA 2XT6A 1PR2A 1X94A 1SUWA 2R7KA 3EMKA 4EPXA 1D2HA 3ESAA 3L1IA 3ZDQA 1YL6A 2FEOA 2PT9A 3KEQA 1QR2A 5LLDA 4TMYA 1G64A 3RLIA 3RVJA 1RYHA 3F5SA 3CJTA 3FMGA 4KQFA 4J0IA 3N7AA 5DYNA 2O7RA 4ZA2A 1PEKE 3BMNB 3DHWC 3BTUA 3KLMX 3BMCA 3WA7A 4D6XA 4X6YA 4EIWA 2OO5C 4EYEA 3AYZB 1TPZA 3QE3A 3G89A 4MW9A 4WZBA 4WESB 4BAUA 2ZJZA 1VE9A 4JKOA 2WINI 1O03A 4L08A 4BLRA 5F1KA 2O8NA 3FOEC 2YHIA 2JGDB 3U4QA 4I1YA 4YP1A 3P2YA 1C7IA 3I6ZA 3QV1A 4N0DA 2CD9A 4XIGS 3RC8A 4I9FA 5CDSA 1GRQA 2CXXA 3AJRA 3BRSA 3RC1A 2BM0A 1HDGO 3UATA 1HT0A 1Q0SA 1V8DA 1JEOA 2VDWB 2OD7A 3FPKA 3LC2O 4FDVA 1SBHA 1Z0DA 2VL7A 3OTHA 3I76A 4PZLA 1XCBA 5AJHA 1HDYA 2W37A 3QW4B 1SCBA 5EWLB 5LUAA 1WMFA 4JLAA 2HQSA 3TJRA 2BFPA 3EGXB 3ORSA 1PT6A 2X58A 1UKCA 2EC5A 3G2PA 3H7IA 2A1IA 4MVJI 2WUFA 1T9KA 4RKYA 3B7GA 4U8HA 3VR5D 5IC4A 4NEQA 3BE6A 5LM3A 4Z0NA 4FBGA 1NNI1 1TJYA 4QYMA 4BMYA 4DLYA 1ZU5A 4RVGA 1FX0B 4CTJA 1ZCFA 2FEKA 1XAHA 5LXTA 1MX9A 4J07A 1MOQA 1Z4JA 1WTAA 4Q7EA 2WT4A 4Q3BA 3BT7A 3BTSA 3LC7O 2J8ZA 1QPBA 2G1KA 3A1NA 3B85A 4TWAA 1FQKA 1WXHA 5TQVA 4OREX 1KFJB 2HSWA 3OURA 1V9LA 2Z9CA 2A3NA 2ILTA 3QTLA 2DRIA 3QFHA 4IR7A 4Q9DA 4ZKDA 2OUIA 1XL0A 4BNIA 4YIHA 1DSSG 1QUEA 3D7KA 4H7HA 5COBA 1FYXA 1GD1O 3LRTA 4F6RB 3S1AB 1CUBA 2C82A 1HQDA 1UC9A 1VE3A 1Z2DA 5IVKA 1OAAA 3AIMA 2RGWA 1NJ6A 3DYIA 1GZ6A 2GBCA 1KP3A 1MIHA 1S7CA 4BMVA 5F7ZA 2XGJA 2AFHB 2COKA 4Z4IA 4HL6A 4WDRA 3PKJA 4ECAA 3ER8A 2FHPA 2FYTA 2QJFA 3G49A 4IH4A 5F2NA 5KSYA 2R11A 2CHVA 3TDMA 2HMYB 3SG0A 3F96A 5K7SA 3L6BA 3PVZA 2ODAA 4PFKA 1FYWA 5HQTA 3LBIA 1IRIA 4J1NA 2NM0A 3L5KA 2C9CA 4JYPA 1Z0ZA 3I8XA 2E4UA 4TXMA 2WIGA 4DUGA 5K01A 4JEMA 3L05A 3AINA 4EJSA 1K97A 3D2CA 2XKBA 3LSYA 1X1AA 3Q87B 4HGPA 5IW8A 3OLVA 3JWEA 1HK7A 2W0MA 4JXXA 3CEHA 4ASUA 5HCIA 4I66A 3X1ZA 3C3MA 2QJOA 3AR3A 3CMMA 3W77A 5IT9A 2D2EA 3T4XA 2MIIA 1F17A 1X1EA 3LQYA 1B93A 3ESCA 2Q4DA 4OQNA 1N7GA 3QKSA 5HMMA 3KEMA 3B1XA 1PGQA 5FB3A 3R0JA 2CLHB 2PAAA 1MO2A 2ZK7A 1BAPA 1DHTA 1E0DA 5HKBA 3QZUA 4WACA 2AJTA 3ZGZA 1CDOA 4RVUA 4YJ3F 1ENPA 1OILA 2BFNA 3QELB 1BE0A 3H5AA 4XUEA 3D3WB 5KAMA 2VDPB 3QKUA 4JUFA 5G41A 1GILA 3O03A 3PGJA 1OGIA 1Z07A 3KZKA 4L3WA 3RT9A 2YWBA 1CR2A 1VMAA 1NC1A 4DDTA 3DBIA 2XEDA 1SKAA 3T38A 3MS7A 2ADFA 1VPDA 2H1HA 5BSGA 4G97A 3VPHA 1YS2X 4AXBA 3K70B 3UFXB 1AM4D 1Y6ZA 4M0EA 4AQDA 1W0JA 2MMGA 3BL6A 5SV2A 4H1TA 3J80A 2ADOA 3G82C 3MJFA 5P8WA 2B4KA 4NH4A 1Q0ZA 3HU2A 1RAHA 3KM0A 1KC3A 1PL8A 2CFCA 2ZSHA 3F3SA 4K0RA 3V4FA 2COEA 1FNBA 2XGOA 2Y0EA 2EX4A 5K9ZA 4E32A 4W9MC 1WBDA 2JF0A 3DPIA 2XRMA 3H6KA 4K6GA 5I7RA 4CM8B 1C1XA 2NNWB 3QHAA 2ZYRA 3PPYA 3PUIA 3AKEA 4LCBA 1X86B 3RVNA 1UWCA 3UK6A 4CUJA 4EMTA 3ZJTA 4DCPA 3QMPA 1DJPA 3JZFA 4L6IA 4OUDB 1D2CA 4MGEA 4LVCA 4HDCA 1DOHA 4H7IA 3TJMA 3O9VA 3FGZA 1EBUA 4QYWA 1JHVA 4Y6QA 1XZFA 3X2FA 2AFHE 4FGKA 5GOZA 2DU8A 1N8SA 2C8VA 1KJJA 1YOVA 3TTTA 2GN6A 2C5AA 1GGHA 1S5PA 2D3WA 2REQA 2NU7A 2GDJA 5J2UF 3OE7D 1L8XA 2XUQA 4A8JA 1FNCA 1GCUA 3B7PA 4XEHA 3QA3E 1T6BY 3BQ9A 3GPBA 3BX1A 4INJA 4WZBB 5THQA 2B8NA 3U7IA 3KRTA 4AN1A 2HIGA 5CFZA 4JU9A 3U4QB 2UKDA 2YHIB 1DRVA 4IV8A 1R5BA 4OQMA 2NPOA 2W70A 3VR6D 1WMBA 1RYMA 1VSBA 4CIAA 5BWBA 3I5YA 4FCWA 5F7XA 4ZYTA 5KHOC 1CUSA 3E3AA 3VRHA 4CUKA 5JD5A 2VZ9A 2H63A 1KSHA 4LG1A 1UBEA 2RHJA 1T5HX 3KQPA 2I4MA 4QU8A 5TDHA 3TM5A 1OAOA 1SIWA 3AVUA 1U3WA 1YU9A 1YBMA 2YMMA 3OM0A 4RU1A 4TT8A 1MGOA 1ZAKA 2H85A 1O95D 1EVZA 1G6OA 2JIMA 2O3RA 2CJXA 4BFTA 1ZK3A 2IYZA 3JVEA 5DWDA 3WGZA 1U1FA 1E2NA 1L4UA 3CWQA 3ADOA 3EG9A 3KOOA 1K7FB 2B1IA 2HXSA 3CNNA 4P5DA 5HF9A 2WWHA 4M2LA 4GT1A 1F2DA 4HOYA 5LXTB 4FP9A 5AWFC 1M2JA 4AMUA 4Q37A 2GJ8A 4D9CA 4OKIA 1MT0A 1GPH1 3JY6A 5A06A 2F1OA 3PI7A 3Q8WA 3M6AA 4UUMA 2HTEA 3L5OA 1KQGA 4AG5A 2XKJE 1ZVJA 4GEKA 5H9VA 3IDOA 3L0BA 2C9YA 3FI0A 3T3IA 3SVTA 1DG9A 4LYGA 2C84A 3PCXA 2AE1A 2VJLA 1YR3A 4KMOA 4OI1A 2I5PO 1E2EA 1JLKA 2HU7A 2I6FA 1YR2A 2WM2A 3C74A 3NBUA 1YCDA 4LRWA 2BBTA 2JIZA 3ICVA 3NI2A 2I7DA 1LX7A 5HGJA 4D44A 4XYLA 3HCAA 4NZZA 5C4MA 3NBXX 3JS5A 1LK7A 1XO1A 1ZC3A 3QJ5A 3DS8A 1MZVA 4KGVA 5IWAB 3DXXA 2V7VA 4R1SA 4GP6A 4PLZA 2J6BA 1VJGA 2NACA 1FRQA 4C0XA 3T4UA 3BIXA 4LWOA 3OPVA 5AHRA 4H7PA 1ZH0A 4EG6A 2XUFA 1FVHA 3GJTA 3RD5A 3SQNA 2ZTVA 2H54A 3E58A 5GZ6A 5IM4A 4AW9A 4UUQA 3PXCX 3QP9A 3SHTA 2GARA 3E23A 3EG5A 3QXGA 2XPCA 2KWIA 4H35A 1SQGA 4EJSB 2WU1A 1TQ2A 4MUHA 3WSWA 2GBIA 1OHHD 1M74A 1N2OA 2WWGA 5CIQA 3D3QA 1U8ZA 2XXBA 1PK9A 5CHYA 4YDSA 1LPNA 1PGNA 1SXGA 2CV1A 1I0IA 3GMSA 4WZBE 1Z4NA 3NP9A 1K2WA 4H3HB 3FBWA 4IJQA 4D81A 1P9RA 2GASA 3MMZA 3QKSB 3AFOA 4K9DA 4B3HA 4COKA 3LC1O 3C6MA 2Q46A 2XHZA 3DDOA 3ENWA 3EVAA 1XKTA 1XP5A 5T4EA 1Z5NA 4KQHA 3WGNA 4X7MA 5ADVA 4DR3B 3SZUA 4LNHA 1E3JA 1UXGA 1NVFA 4S3MA 1E2DA 4JODA 1AV6A 1RXVA 3PNYA 1C81A 3LS2A 5IKXA 4GOOD 1IHDA 1Y1KE 4XIIA 5E9QA 4RLHA 1B2LA 5F1YA 2PQ2A 5K8VA 1FMLA 1SG9A 3WKCA 1Y48E 2I8LA 2LP4Y 3IR5A 3T5DA 1FFAA 1X0VA 4MPJA 1GTVA 3IAM6 1KZ6A 3VI4B 4QJ3A 3IMEA 5CIWA 4GYKA 5SZHB 2OXIA 3RTCA 1QQ7A 1VDZA 1V48A 3CZAA 3Q2KA 4LDAA 4R1UA 1XA3A 5GV7A 4F9GA 3DTVD 2O1WA 4TZ0A 4IOKA 1B3RA 2V4MA 3C8MA 4TL6A 4FNMA 2FWNA 2HK7A 3FCEA 2GCOA 4EOGA 3HP7A 2FN3A 3P2IA 4CMCA 1KDTA 4H3KB 3S7ZA 3OQHA 3DMHA 3I0NA 3O73A 1ETHA 3NUGA 4CIYA 5AQ1A 4KWHA 3ANSA 4IYRA 1WDWB 1Z74A 4H2DA 3URKA 2B4AA 1C1XB 4GMFA 4RPKA 2P5YA 2B8WA 1NPYA 2Y1DA 3IBCA 1FL9A 1QH0A 1AKVA 2GPSA 4UBKA 4XJXA 4ZQEA 1FUKA 4O4JF 3ID6C 3A05A 1KBZA 2W2TA 1GDTA 1Q74A 2OLJA 1TLTA 3MM4A 1WOMA 4LC1A 1USGA 3LKVA 3N2LA 1YOVB 2I2XB 3UJAA 3CC8A 4A0GA 2P9YA 1NNSA 4ZVRA 2REQB 1XDSA 1RPNA 2NU7B 4EG5A 3NNNA 2A9KA 4LGVA 1NWCA 1RWXA 1NY5A 4JLMA 2CUKA 4M0LA 4W5HA 4A8JB 3X44A 4MQUA 4AZTA 4EATA 2NO4A 3H04A 4J16A 3B8HA 5FWXA 3TFWA 1JPNA 1JU4A 3DE4X 4H0FA 3AJDA 2IYRA 5BR1A 1UZUA 4GVXA 3R5HA 1EHCA 5ECWA 3WLPA 5KCZA 2JFVA 5ABPA 1ZMRA 4XB1A 3LA8A 4PS1A 1NY6A 2PX0A 4AF8A 1G19A 1U9ZA 2D1YA 2WZQA 3MG9A 4DDMA 4B7UA 3QEAZ 1D9XA 3F6RA 1OBOA 3NU1A 4IJWA 3LT4A 3IPCA 2DLNA 1OA0A 3BGDA 3ILVA 3S40A 3PSHA 3SYRA 3HKCA 3TW4A 2YOFA 2Q4BA 4OSEA 4EO4A 1I6WA 3EXHB 4ND4A 4BYMA 4ETMA 4O1IA 3QX9A 3ZWKA 5KNBA 3OEHA 2CZQA 3FPGA 1D4AA 3EG9B 1LPPA 2V6MA 3T1OA 4KK4A 2A1TS 3A6KA 1XTBA 3D8TA 2EVWX 1UXJA 2VVTA 4HVAA 2BFCA 3GCDA 4QYTA 1K86A 1H6CA 3ESQA 3PQ5A 1JWLA 1J20A 2P2GA 3UUFA 4IGEA 2VNKA 3KKKA 5EQJB 4HVCA 1FMFA 4KR2A 4NJMA 1MD9A 2J3DA 1QX3A 2JIRA 2MOKA 5JV5A 5FX2A 5HOEA 4WMLA 4EP1A 4DJDC 2O0LA 1KR5A 4BGVA 3TQCA 1GGVA 1BROA 2AYXA 5KHLB 2EFCB 4BGUA 2RB4A 1UEXC 5HXAA 2R2AA 5ADWA 3TIVA 1WVIA 3EDOA 1CHNA 1VKJA 4MMYB 3PCRB 1IBLB 1TTQB 1MHTA 4KRFA 3CUWA 2JIOA 3RU3A 1CUAA 1GDDA 2VHWA 1JKJA 3EYWA 3L77A 6ABPA 5LD2C 3MWLA 1TM1E 3A58B 4HMPA 4CM5A 2Q45A 4KWTA 1IEQA 1E0KA 2JHGA 3W6PA 5AVVA 1CE8A 3KVVA 4TMTA 3BIWA 3EOAI 1NW9B 4XTCS 2WKPA 3HVUA 1GNPA 2ZRMA 4IIYA 2XMRA 3A6PC 1G20E 4EG0A 3G2HA 2A0UA 1B0UA 3KKMA 2E4ZA 1Z25A 2H1IA 1MAUA 3HCBA 5KU1A 1P1HA 4I1UA 2O4CA 3BD7A 5FV7A 4NBNA 4GI2A 5TF4A 3SZMA 5B6JA 2Y68A 1ZLYA 3TQQA 1OBHA 3FTFA 1JLSA 1JA0A 1WSAA 5KVSA 1MVNA 3DSRA 2E48A 3NEYA 1VL1A 2FQWA 2ISQA 2P65A 2C61A 3RKSA 5F1PA 2AK3A 2Q29A 1KJWA 2Y1GA 2ZJ5A 4KFUA 2J9XB 5IMBA 3SJUA 4TWZA 4MUYA 1G2QA 2R9VA 4TXJA 2E1PA 2WPNA 2JHAA 3JV7A 4RIFA 2VZEA 2GDZA 5AK5A 3SEQA 4CLRA 2P91A 2PUEA 1U4NA 4CMAA 3SHWA 2H08A 2G77B 1ABFA 4UAVA 4KLRA 5A4IS 4DJ5X 1YJXA 1SC4A 4LC9A 3TEJA 5BQ3A 3RYCA 4H7FA 3TW0A 3C43A 2XUDA 1R6UA 3O26A 1U98A 2WU0A 1JHUA 4OPMA 4MVJF 2QQ5A 4AG6A 5DBIA 4V1CA 3NH6A 3PX2A 2QV7A 2DERA 1PLKA 2O0HA 3TSAA 4AI6A 1V8PA 1E3QA 3LCJA 2QSUA 2UDPA 3TECE 1R6DA 2GCOB 1LQUA 2QDKA 2RH8A 1FC0A 3HC7A 2X5OA 3PNVA 4OIFA 2D5BA 1B41A 3D7LA 1R9NA 2I99A 2Q5FA 1OZAA 1E96A 3B3QA 3I42A 3N0XA 2FAXA 2HRCA 3I9NA 3RC3A 2XZTA 1KTIA 1ZIPA 4NHEA 5L4SA 1EEHA 2EFEB 3PTZA 1ZW6A 2X19A 4DCCA 4TMWA 4FGUA 4NARA 2IXBA 5DLPA 3FMPB 5KBYA 3X2SA 4DV6B 3LC0A 1ACMA 1E6LA 1R15A 2VYFA 5G0VA 5A71A 4RJLA 1JA1A 1XMSA 4MPPA 4BMOB 2EV9A 3E22A 3KLPX 1ZFNA 3USCS 5H80A 4MROA 1SQ6A 1R16A 3WK9A 2ZJ4A 2RC6A 3G0OA 4UREA 2NO6A 3WGGA 2FUKA 3QOYA 2IS1A 2JA2A 3ZNNA 4IKPA 1SXHA 5FWXB 3IIEA 4MLPA 4C43A 4KN6A 1OFHA 4ZI7F 1FU7A 5KX5F 1RJGA 4XM1A 1RLTA 4EX7A 5TQ2A 3S1LA 4I0WB 5CJPA 3BQMB 4LMBA 3SY8A 4ZOAA 5KNCD 3X1XA 3FAZA 3GLRA 3TLXA 4DCOA 2PYZA 4TL7A 1E1LA 1T0UA 5FTKA 2NQ8A 2W0SA 3DNFA 2W2LD 3D7MA 1SQFA 4B32A 3NHRA 5DSXA 4NF2A 5EE0A 3DHEA 4PHHA 3HKCB 4I4NA 4MQLA 4KAFA 2DBRA 3VGPA 5HQ3A 5EY5B 3DPUA 4LJ7A 1AN9A 2BUAA 2G04A 2NUBA 3MWDA 4ZO6A 2IW3A 4LJAA 1AKUA 3ON5A 1RWPA 4Q1DA 1ABEA 3GJRA 2IF0A 1BDIA 4X3CA 4O2AA 1L8QA 4S0XA 5IYZA 5HW0A 2BFCB 1CJTC 4HJRA 5ICCA 1YA6A 4R1NA 2GN0A 2C4NA 2NPIA 2RHTA 3G02A 3PQ6A 4A8PA 1NKVA 4C6HA 4WXMA 3R4CA 4E21A 2YUTA 4DVJA 3ZIAD 4I4TA 5KYTA 2PE5A 4AKGA 2ZRQA 3SDSA 2W2NA 4NJMB 3ZWOA 3VR3A 4OB6A 4II3A 1VHJA 1VECA 4M60A 5IRCD 4MR9B 4V0OA 5EKSA 1RFLA 3N0TA 3CNHA 5C1OA 3EZGA 5LQAA 1ZG3A 4L8YA 1IJFA 1U7XA 2PRSA 3MOIA 3IEKA 4D3DA 2QN6A 1SOMA 4TVBA 1EUZA 5B3JC 3N7TA 1YQDA 3C4QA 3RQSA 1WHSA 3MT8A 3E9QA 2C3PA 1BDBA 4M1EA 3D31A 4C14A 3IHLA 5JFOA 2B4QA 2PKCA 2G6TA 2BH2A 4GOJA 5DI3A 1SJ9A 5KYVA 4RBNA 4YCNA 3B48A 2IZ1A 2YS6A 2DECA 4M53A 5TVGA 3RBVA 3SP1A 1JKJB 5KYGA 2BTEA 4OD0A 3AEQA 1XD8A 3A6EA 3OLYA 1L7XA 5KCMA 1M7GA 4F06A 4HQNA 3LY7A 4ZARA 3GFFA 3SFZA 4D8WA 1NOKA 4XUGB 3N53A 3OAAA 3NBZC 4FZRA 3NDJA 4F72A 5BMVA 2C57A 4HXYA 4EARA 1B8OA 3PYXA 3WIVA 1TX4B 4AP5A 3A9SA 3B2NA 4AF6A 4FE7A 1PFQA 2J5RA 3WNDA 1ISPA 4W7HA 5EJ7A 2C0PA 4XJVA 2W6ID 2QTHA 1Z6AA 1ZESA 2B69A 4IEEA 3ABZA 1EG7A 3ELDA 4K9QA 1KRWA 2A78A 2H6EA 1O95C 4GVLA 3CS3A 1JEJA 1TO6A 1LRJA 2RKBA 3PJFA 4PNHA 4TROA 3H2IA 4CLRB 4QGHA 2ZJBA 1D6MA 2GUGA 3OTIA 1DXOA 5KI6A 1HY3A 1YTUA 1J99A 1FEZA 4PAGA 3ECAA 2NVWA 3BCHA 2GNOA 4XASA 3FPBA 2EZ4A 3ZHSA 1IXZA 3K9FC 2NO9A 4XQEA 1D6NA 1KJIA 2VAVA 2PUGA 2CF5A 3B1WA 2JZOA 5FYQA 3B7WA 3GLHE 4C6TA 3L82B 2Z8ZA 4R69A 4IUDS 1ZH2A 2VQSA 5BUZA 4V1CB 3C98A 4CL8A 1SHKA 3H2HA 1GTMA 2ODQA 2VLIA 4LJ4A 3WP0A 3PDCA 4F84A 1DKUA 4UM9B 2ON6A 1CR6A 1MEOA 1Z16A 4FWBA 1KF0A 4NBLA 5EPEA 1JECA 4NQRA 4QSMA 1YIDA 1U1EA 2QX6A 2WU8A 1UWKA 3Q41A 5IVHA 2ZJ3A 1W4ZA 1T0PA 3I2JA 4TTIA 1R4MA 2C99A 1YBAA 1MRZA 2WSSA 2HRQA 1FFCA 5C52B 1ISFA 1AB5A 1S4QA 2CLEB 4UCWA 2CL5A 2QF7A 3TLYA 4LF9B 4Z2YA 3DT6A 4MKZA 1XOIA 4S1VA 4IICA 2OGUA 4UM7A 2P77A 2DT8A 2FHSA 3HLYA 1P6UA 2LW7A 1A77A 3NC1C 1II8B 4B82A 1QX4A 5FBWB 3EYAA 1ZUNA 1QGAA 1SFRA 2PGXA 4U0JA 5EMMA 3ZV3A 3O4GA 1O96B 4JI6B 4KAAA 1NFRA 2IXFA 1XJQA 3E22B 4Y1GA 4GPEA 1KYZA 2CNBA 1FPQA 5I01A 1NL3A 3SYLA 5CLHA 1P4HA 1YKSA 3FWHA 3L92A 2A33A 4XGNA 2BISA 4JKIA 5CFNA 3PHCA 4R2XA 2RGGA 2GZSA 3G9XA 2IELA 1G5RA 1ZINA 3ELWA 3SS8A 4C0LA 1KEKA 4FEGA 1E0AA 2PV7A 2TSYB 3KKEA 1QQ5A 1Z5VA 2HCRA 2DX7A 3BDIA 3BFVA 1ISRA 1T2VA 3NOXA 4FT2A 4XYGA 5FOUA 4F2GA 3MWEA 1ZIXA 3KQNA 1KAOA 3PUYA 1F0KA 1U5AA 1P0MA 2JVJA 4UAUA 5TQ2B 1NRWA 2WG0A 3DJFA 4GZ6A 3VC2A 1OTXA 1ZXBA 4LDPA 4ENUA 1SM4A 1QS0B 1V37A 4NS1A 2Z04A 4UZFA 4QBIA 4RVHA 5DVZA 4D9BA 5ILOA 2AMLA 2OV1A 3OM8A 4N9WA 3ILHA 1JSZA 2PO7A 5EIAA 4LJ8A 1QLWA 5HQ3B 3QX3A 2HRBA 1DIBA 3P4YA 1Z06A 4Q6BA 5H70A 3FVTA 5LIPA 1ZJZA 2Z1MA 3N6VA 4EK9A 2PBZA 3MWDB 1YB2A 4HTAA 3DHVA 4TV8F 3VR5A 1UFOA 2J87A 4ZEWA 1T10A 3QVKA 5IYZB 3O84A 4O2AB 1RWNA 3T0IA 1AVTA 4BJ3A 1GNSA 1PR4A 1U4OA 3UXEA 2BEKA 4IY1A 4CKYA 3D6NB 1VIMA 2AMFA 1E1RD 4I4TB 3PT5A 4OJYA 4C3ZA 4R68A 3IEPA 4JVLA 3TZEA 2G1JA 1ADCA 1EXNA 4DILA 3HFSA 2P11A 1XMOB 1WV1A 4TKVA 1Z6PA 3RS4A 4E5UA 4WLFA 3ELBA 4QARA 1R2QA 1HEYA 3T7RA 3AQ4A 3EGIA 1CY8A 1PP4A 2RGDA 3EGOA 4ISBA 1Z47A 3FRHA 4IZHA 3ZI0A 5ARCA 3L46A 4Z3DA 1WHSB 1Q19A 2LWIA 4WXRA 1PJTA 3AX6A 3OQOA 5DI3B 3FWZA 5CMLA 1KVRA 4XKJA 1C0PA 1QGOA 5GWXA 1JNYA 3R5XA 4PINA 4EECA 3RVQA 2OY0A 2PGOA 5AM3A 3BWVA 2ZDHA 3AEQB 4RC9A 3GLIB 2C31A 4M1TA 1KRHA 4OI0A 2AA3A 1W87A 3H83A 3HWRA 5FYDA 4DMUB 1ZQ9A 1GSAA 1WY7A 1SOWA 3OWHA 4PRKA 3EDCA 4OG2A 4NU8X 2FW6A 1EPUA 2A30A 5DNDA 5A3QA 3FOZA 1GR0A 2VXOA 5H4GA 1UC8A 1P9NA 2ZT5A 5BMVB 1GPUA 1Y9EA 4QFMA 4RMGA 1X1CA 1K6EA 4ZN6A 5IXJA 3CA8A 4MW7A 1RMTA 3L1HA 4EYGA 1M1YA 1PNVA 1ENZA 3FN4A 4XJSA 3UF0A 1NN1A 1QXSA 1VB3A 3DH0A 4BO4A 1JAXA 3SI7A 2WZBA 2O1XA 4OXXA 1T9AA 2BBOA 1E5DA 2R1UA 3BTOA 4UNIA 3EIEA 4OF4A 1Z62A 3H9EO 1JZQA 1QKJA 2FX3A 3G2QA 1MXHA 1T9CA 1NYLA 3R41A 1FOEB 2LUOA 4LVNA 1IUNA 3FCAA 2BKXA 1ICEA 1Z5UA 3DV9A 4LRYA 3BXPA 1TVEA 3HCRA 3PQ4A 2BJVA 3QUSA 5FBRB 3W8RA 5BT9A 1IBRA 5G40A 3ASYA 3SX0A 1X74A 2F9LA 3IA7A 3SZOA 4F4HA 1YQWA 3VPCA 1N78A 1P5ZB 3PNSA 4X1YA 2AG1A 3CVYA 1QIGA 1Y1SA 2JGAA 3CW2A 4NNPA 1LA2A 4C6TB 3FPAA 1VZ2A 5DX8A 4Y9UA 3MJRA 4C2TA 4HB4A 1QG6A 3E48A 4L3OA 5EA2A 1P62B 1RU3A 3HJGA 5AVYA 2GBFA 4MW1A 4LS3A 5KWVA 1IN6A 4WY8A 2ZB4A 2ZETA 4HB0A 1ZNWA 2NTYC 1JIKA 2PPVA 2WJGA 3EQ7A 1HFJA 2GBPA 3COVA 5K0LA 5TXGA 4BB0A 1HYEA 1T13A 1KO8A 2E82A 1QRTA 2QVBA 4PEVA 5JVDF 4IDGA 4JP1A 4L0QA 3UYKA 2PBRA 4BASA 4YEDA 2Y4OA 4A82A 4ESVA 5EFZA 1OX5A 1F6BA 3KKNA 4Y2UA 2Q1XA 4W5TA 4WUTA 3K0CC 1V2GA 3I09A 3DKRA 1GCAA 2FVYA 2BRUC 1WV0A 2FF7A 2HBRA 2HCJB 3KBOA 3PDJA 3PG5A 5B3JA 4YH1A 2ZBQA 3W6NA 3EDQA 1ZUNB 3H1FA 3DE6X 2ID8A 3HO8A 1T29A 4WRRA 3Q7EA 4M22A 1SY7A 4MQMA 3K8OE 1ZEJA 3E3OA 2GO7A 1NQ5A 4Q4LA 4FQ7A 2VP4A 1XNJA 4R1LA 5L3QA 3K71B 3W5DA 2AN1A 3RC9A 3IXMA 1C1HA 5F52A 3ND5A 3O90A 2W6JD 1Q92A 2DFDA 1LKZA 3G8DA 2HHHB 3ZJ5A 1N5JA 4PG6A 1Q12A 3T94A 2SBTA 4EG3A 2F64A 5LNK1 2VWPA 4N12A 4QECA 4UUBA 4YONB 3MWEB 3SWWA 3KSBC 1D2AA 1S3IA 4LNUA 4YQEA 1NQWA 2NV2B 2FCRA 3VR6A 3ZY6A 3VO9A 4RELA 1SZJG 5EL0A 5T4BA 5HRUA 3ICWA 1M73E 1AXGA 1DQSA 2ZJFA 3OESA 2FW8A 2QE7D 4GOKA 5ED4A 5BVHA 3B51X 1E7RA 2EL9A 4FONA 5IP5A 2PIAA 2TMGA 5AHOA 4D8YA 2WVAA 1W2WB 3HL0A 1LSJA 2Z3WA 4UNNA 1JXOA 5AKKA 5AXCA 4EJ2A 5TGDA 3WG9A 4K05A 3AM1A 1L7AA 4YX9A 1CUEA 2EP8A 1WCXA 2PZJA 4X94A 3CWCA 1HE8B 5K3DA 1KARA 2V7XA 3P97A 3P9QA 5LXTF 3RSOA 3R3ZA 5A7GA 3ZX5A 3JYOA 1RWQA 5JHGB 3E9MA 3HLTA 1A4RA 2IZZA 1ML4A 4YUYA 1JU3A 3RWMB 5I8ZA 4XWTA 4XOIA 2EKBA 4KXVA 1ZBQA 1ZCBA 1KXJA 3HS3A 1U90A 1JALA 3SNKA 1HT1E 4O5OA 3O1IC 5L4NA 4TKVB 2PXXA 4QWMA 1HE4A 1NVAA 4L9AA 5E1DA 3STYA 3WLAA 3EAFA 3LL7A 4BAGA 1S6YA 4B35A 3VJLA 3OQVA 1J33A 3C85A 1ADFA 3KOUA 4FHEA 3NTQA 4EDHA 4KQ9A 2PNFA 1C4OA 4YS6A 1A9ZA 1VJRA 5FTMA 4RY0A 1RXSA 2X1VA 2R7MA 4OHMA 4C20A 4XM2A 1L3CA 1S01A 1JEYA 4QULA 1EJ2A 2J7KA 2YFYA 2FRVA 1D7OA 2WF8A 3OCXA 1MJFA 3ZCQA 3I3SR 4G8DA 3JQPA 1E1CA 4O6VA 4C29A 4EKYA 3NWOA 3ZUGA 4JJFA 3K6SA 4Q4CA 1Z6TA 4R71A 1YK0A 4P4UA 5FEMA 4HRXA 1LI5A 1HEUA 4C0KA 1YQEA 2X8BA 3DV0A 5IC5A 1NRXA 1YR6A 1AQYA 3DZHA 1M1YB 3KFLA 1P18A 4FK8A 4LZZA 1E7MA 1KSJA 3HKEA 1RRMA 4RENA 4RHUA 4FN5A 3BCSA 5FF9A 2QMYA 3R0ZA 1OHHA 1F9EA 1F2TA 2D8AA 4TLBA 5AXDA 3ZUPA 1I3MA 5BN4A 4M9ZA 1C9JA 3KEOA 3GJ8A 1VG9B 4F7DA 3RSLA 3U7GA 2DULA 1Q16A 3AI7A 2IWHA 4ZU1X 4Q7KA 1YHNA 3I9MA 1HA3A 4PLGA 4MICA 1SHLA 4WNCA 2CMGA 1M34A 1VDMA 1CUIA 2GLXA 2Q9UA 1CUJA 3O94A 4ME6A 1L5GB 1WD5A 3KDPA 3SJCA 2WIKA 4ID3A 2W4MA 4V3BA 4AAYA 4DXAA 5IJ9A 2IU3A 1CULC 3H2JA 2P7IA 2HBZA 3RVOA 4BQFA 3AXSA 3TLAA 1OREA 4QXRA 2XTNA 5KOHA 2ZIXA 1LZKA 4WBSA 4X1YB 1OASA 1BTOA 1U0FA 2P40A 3QWFA 4M0MA 5CITA 3LUPA 5KVQA 1ZLXA 1DEXA 4HQ6A 5CX1A 4KBFA 1NUSA 2SECE 1GFSA 4FGLA 3LVQE 4Y9DA 3NIFB 1C29B 1M2GA 1A82A 1XD2A 1JR6A 1BN7A 2GNAA 4TTAA 2ZQZA 2WM8A 4JSTA 4QPZA 4B7CA 5A3JA 4DLAA 4PZCA 1DQYA 1D1PA 1T3SA 1U7WA 3IBTA 3REQA 2FR0A 3DTVA 3ZHZA 4HVTA 5EN4A 5M5BA 4JXZA 4CG3A 2PYDA 3T99A 3OJEA 5FJIA 4WI1A 4LXHA 4YLEA 4MWCA 1UIMA 1OZHA 2G1AA 3GA5A 3LV8A 2WIFA 3WR5A 4L16A 3QI7A 1P0IA 3AY7A 1DWOA 4I8DA 4LGYA 4AMBA 5CEFA 4JI7B 3DMDA 4UUPA 1E2BA 4LRXA 3GWZA 3BS4A 1XN1A 2DBQA 1P4SA 1P8AA 1HLDA 4ERXA 3IL2A 4KHZA 5CW2A 3IUEA 2CEAA 1GRRA 3H05A 4YCAA 2YVQA 2CW5A 2XMZA 2ZRLA 3LIIA 5IARA 2G1UA 2IYXA 4QA9A 3DWGA 3STWA 4DR2B 3NHBA 2VSQA 3ENQA 5DYIA 4MB2A 4PZUA 1R10A 3MGGA 1WD7A 2G83A 4GBGA 4C2AA 2GJ9A 4QQRA 2IX9A 3SN6A 4JDPA 5L3QB 3TCKA 3OOHA 5FA8A 2PX2A 1H9CA 4FYWA 1I33A 1OPXA 1TM7E 1XZQA 4FINA 1D5CA 1VBNA 4IDQA 4NNJA 1E77A 3G9UA 5LP6A 4QVIA 3NBQA 4E6PA 4URYR 5KJCA 2FPPA 1M1YE 1THGA 2L18A 3I04A 4IYJA 2WHEA 2R7NA 1B0ZA 4LNUB 3CLHA 4TRNA 1LDEA 1SBYA 4PPQA 1KSGA 3Q1LA 3ZVLA 2NXWA 1ND5A 2P2DA 3LG2A 4GC5A 4GXQA 3L4SO 1NUTA 2ZM6B 4NXNB 2I55A 4RMJA 5E3IA 2W98A 1CRLA 4WH0A 3ZWDA 5BVHB 4I8IA 1CB7A 9ABPA 4DCGA 5TSDA 4N41A 1I4OA 2LCIA 1G1MA 1UF9A 3GUCA 4OGFA 4RZ2A 3W4IA 1NV9A 4BU0A 2QUJA 3MYYA 4B8ZA 3DB1A 2NYVA 4LDJA 4Z99A 1IB0A 1XRRA 3S2IA 3CNOA 1J8MF 1RWWA 4RFLA 5TJ9A 3VNQA 3ZEAA 1RWOA 1Q57A 1YZVA 4OLBA 2H29A 4FOSA 1KEVA 3LPCA 2NYAA 4UOQA 2JLUA 4ZT4A 5K0FA 1R7RA 4ZWNA 5HPYB 2F62A 4RV9A 5EVJA 2O7NA 1JBQA 4IIVA 5DYGA 3T7TA 2J4FA 2PT7A 4RAOA 1QDLB 1QU2A 1RJDA 2GK6A 4N3NA 1U2DC 3AEKA 1L9XA 1ORRA 2YN0A 3H99A 3QJYA 4MA0A 4W9NA 3WMRA 3ZJ4A 2BI8A 4GPBA 4CKEA 4HFNA 1O5OA 5LMUB 3IBSA 3GRZA 4A8HA 4CMIB 2C94A 4HADA 3ESYA 5DM4A 1DKQA 3GBSA 4U39A 1GZDA 4YWHA 1Z33A 4K5QA 1GFIA 4AY4A 1MJGM 3KHUA 4AQ7A 1IAQA 1IJEA 1UJMA 2E7ZA 1VSUA 3CZMA 1JEYB 4BY9E 4HDMA 2GN2A 5PGMA 2YRWA 2Y05A 3GF4A 4A5OA