1KPVB

High resolution crystal structure of the mhc class i complex h-2kb/sev9
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
QKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title High Resolution Crystal Structure of H-2Kb/VSV8
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2002-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kpvB00
4PJBB 1RZJC 3OKDB 1G9NL 4Z78A 1CD1B 5DFTA 3G6DL 4Z7UE 4PJIE 5DD3H 2IGFL 3ULUF 2H32B 4NNXA 4QCIA 2C3XA 2EH7L 4IRZL 1RVFH 2ICWA 1A47A 3JBG7 1FORH 2NLJB 1I7ZB 3VFRA 4HUMB 4FQ2H 2VDLL 2RBLA 5J11C 2D7PA 3LQAH 1F6FB 2MCG1 3HR6A 1UKSA 5J1AA 3MMEB 1LEGA 2NX5B 1UH3A 5EPMB 4DZ8B 2YD5A 4FNLH 5JXEA 2CIIB 1F8TL 2BDNH 5HHXL 3L6FB 1DL7L 5L9DL 1YA5A 4PJFE 1G9NH 2DQCL 3QNYB 1INDH 3G6DH 2IGFH 3D39E 2J5LC 3MV9D 4HG4K 2EH7H 2GITB 4IRZH 1JPGB 3GMMA 3O81A 2VE6B 1BZ7B 4I5BA 4P5KB 5EIVA 3G6JE 2R23A 2VDLH 4LLDB 3HNSL 4U6HA 2BX5A 5CEZD 1DP0A 4BSWA 1LE5B 4OZGA 1ONQA 2V7NB 5F1NB 4AT6A 3K81A 2ZSWA 1R3LA 1F8TH 3X13A 4QT5A 4BKLB 5HHXH 5KSVA 3DUUA 4QOKD 1YN7B 5L9DH 3N50A 3OGCB 5I1CL 4J3OC 3OKKB 2DQCH 5ANMB 9CGTA 3W82A 1N59B 4HHAB 3UDWA 1M71B 1XGQA 4R4ND 1OD9A 4WVRA 5DDHB 4P23D 1T1WA 2CLRB 1A7RL 5EUOB 1AGEB 5IB1B 1J87A 1IC1A 3H3PL 2P5EE 3MRMA 5JDSB 1T5WA 3HNSH 4MJ5B 3T08A 2F5BL 2OK0L 4ODUB 1Q0YL 2P8LB 3BH8A 1HI6B 4APQD 4N0CC 3LV3B 3MPCA 4OZHF 3I75B 3QDJD 1BBJB 1ZA6B 5FA3B 3KGRA 4GG8B 2JJWA 3MLZL 3U4EB 1PW3A 4UDUA 12E8L 3L3OA 1GC1L 5C09E 5I1CH 2DQIL 4WUUD 3O11B 1DDHB 2DF3A 4OAWB 3OB0H 3BN3B 3PE9A 4OTXL 5HYQA 3KHQA 4PG2C 3G5VA 3QDME 3H3PH 5ID0B 2NY3D 4YXKL 3RY4A 1JHTB 1A6UL 3CFEA 2OK0H 3WIFB 3MGTB 3GJFA 5DRNA 4I3SL 2GT9A 1VENA 4MAYD 3I85A 5HHMB 1UEMA 4BUHA 3ZE1E 4QHNB 1T1ZB 4EI6B 2R9HD 4DVRH 4Z95L 4Y5YC 3MLZH 1YNLL 2VMFA 5FYJD 2DMKA 1WGOA 5I1IH 4GG6A 5F7WC 2DQIH 4JRXB 2R2HB 5ALCH 4JE4B 2R2CA 1YQVL 1XF3B 3D85D 3H42H 3HG1A 4M4RA 5CP7B 3MUHL 2CDFA 4YHLH 2BNRD 4OTXH 3RA7L 4PJXE 4G3YL 1XF4B 4NO0D 4ELMB 2NQCA 4YXKH 4QXTA 1A6UH 4YDVB 4I3SH 4ISVB 3ULUC 1H3PL 4G9FA 5H8DA 5GZOD 2OXGA 5BVJA 1ZGLM 1H8NA 4RFEA 3ZDYF 1TPXC 5JHLL 4EN3D 4Z95H 1IL1A 2MHAB 5CP3A 3S98A 1DEEB 1YNLH 4DOHE 4R8WL 1A9EB 1ES0B 4UBDD 3ZKND 3ARFC 4HKXB 2ZP0T 3X14A 3O3DA 1YQVH 4HH9A 4NZUL 3X11B 2HLAB 5EORL 5DMGC 2C3WA 4MJIE 4Z77B 3DURB 1O5DT 1J1OL 5C6PB 3RA7H 1OT2A 4PJ8D 2OTUA 4A2MA 1JGDA 3HA0A 3JV6B 1FO0L 3IDXH 4RZCA 1IGTA 2EYTB 1QQDA 3B5GA 3UJTL 4RAUB 1MWAH 5HHOE 4NQDE 4YBLB 3EJJX 1I1FA 1H3PH 3QQ3A 3LAFA 2W9EH 1JF5A 5JHLH 2AXGB 2N1KA 4X6BA 4R8WH 3T0ED 1T5XA 3D3VA 1HQRB 3O6FB 5IP4A 3PJSA 2I60L 1MCRA 2G5BB 1W2KT 5EORH 3R06B 2E7LA 3PWPB 4KKCD 1J1OH 4X6DB 1UZ6F 1VGKB 1MCPL 5DFVD 3VW3H 3AMKA 1JGVL 2YPLA 4HLZG 4LVNC 1FO0H 1FAKT 4TUKL 4HCRL 3UTPE 1QP1A 1U2HA 3UJTH 1QKZL 4RRPA 1MCKA 3PG2A 3SGDI 4ENED 4CRPA 5BZDA 5EOCJ 4U6XB 4X98A 4PP1D 2VZ3A 5I75B 1BMGA 1I1CA 3IDYC 1CD0A 2I60H 1AQDB 5J06A 3ILPB 2P1YA 4PJIB 1XEDA 3RHWF 5J1SC 3WO3B 4PUBL 3PHSA 2RAMA 5HVWA 1NEZG 2ITCB 5BRZA 3DSFL 1MCPH 2BSRB 1DTUA 1QA9B 3C08L 4ZFZB 4PJBA 3OKDA 3VI3E 1CD1A 4R0LB 2WWMD 2EE3A 4TUKH 4HCRH 1OM3L 3U2SB 4PG9B 3WXWL 1PQZB 2H32A 1QKZH 2SEBB 3ARDD 3UJJL 5D1XB 3W9EB 4LSTL 5CUSH 3L3DB 4Y5VB 2NLJA 4BH7B 1I7ZA 3C5SB 1P9MC 5F7DB 4G43B 5C0CE 2K3TA 1EGJL 2NXYC 3IXAB 3LDBC 3MMEA 3QAZB 1Q0XL 4PJFB 4KKBD 2NX5A 5EPMA 4DZ8A 1DJSA 5INCB 1K2DB 3D39B 5FYLD 5SX4I 2I24N 4PUBH 2CIIA 1U8JB 4LDOB 3L6FA 5JTWA 1Y6MR 3C08H 4P99A 4JKLA 4BJLA 4U3CA 3QNYA 2JJTC 4M43L 3JWOC 4U1SB 1OM3H 3WXWH 4HZLB 2GITA 5E8PB 1JPGA 3TBTB 4X6CB 2VE6A 1BZ7A 3IKCB 4P5KA 5I74B 4FA8A 2VAJA 5C08D 3HZMB 1OTUD 2AERT 4OIIL 4LLDA 1BPVA 3S5LG 2DQFB 2DIJA 1EGJH 2NY0D 5T1DL 1RZKC 2O26U 1LE5A 4N0UE 4QXGL 3VXUB 2W0FB 4CN1A 1Q0XH 2EIEA 1ACZA 5D5ME 2V7NA 3RVVD 5F1NA 1GRWA 4BKLA 1D9KB 3QWRD 2BNQD 1YN7A 3O6KL 3OGCA 3MV8D 3OKKA 1EEQA 5ANMA 3STZB 2RCSL 2P5EB 3CZJA 3L1OL 1CZ8L 4QRPD 1N59A 4HHAA 5FB8B 1M71A 3DX6B 2HT2D 5I1EL 4GAJH 5DDHA 3MUGB 5F7NC 2Q76B 1CE1L 3IDNB 1N3NB 2CLRA 2UVFA 4UV7L 5EUOA 3VWKB 1AGEA 5HYIA 5IB1A 2W60B 1UB5B 4YNYB 5JDSA 1PY4A 5FXCH 4MJ5A 2Y9RT 4ODUA 4HWZB 5T1DH 2P8LA 1HI6A 3MBED 4NHUB 4QXGH 5C09B 3DROB 4C4KT 3LV3A 4UIMB 2NMSA 3UZVB 4LLWB 3I75A 1FSKB 2XIDA 1BBJA 1ZA6A 3FZUD 4XP9L 5FA3A 4GBXC 4GG8A 4PYGA 4LARH 5D7LB 1FNEB 5GISL 1OAZL 3U4EA 3BE1H 3L5XL 2HWZH 4LSQL 3VXPB 3O6KH 5C70A 1KTKE 3QDMB 3O11A 1DDHA 2RCSH 1KSRA 3L1OH 1CZ8H 4OAWA 5I1EH 3V6ZB 1U8KB 1WF5A 5FHAL 1KIRB 1CE1H 4UV7H 4M3KB 3BRDA 4JQVC 5B39G 5ID0A 5EBGA 1JHTA 5MENB 5IB5B 3HE7D 4KK6C 3ETBF 3WIFA 2NY5L 3FB8B 3MGTA 1KB5B 4AYFA 2E6PA 3GZKA 3S36H 1LHZA 4GXVL 3VRJB 5F9WB 5SV3A 4BK4A 1HCVA 4H20L 4QHNA 4ZQKB 1T1ZA 4EI6A 3VFMB 4XP9H 1CICD 3HRZB 2V17L 4BZ1L 4YHML 5GISH 1OAZH 3L5XH 4PRID 4RISH 1SHMA 4LSQH 3PP4L 4P2OD 1FNLA 4PJXB 4OGAC 5JIIA 4JRXA 2R2HA 4X99B 1XF3A 3EJYC 3P30H 3MOBL 1C1EL 5CP7A 4ZNEE 3QB7C 3U83A 1OGAD 1HXMB 3GIZL 2Z0BA 5JXAL 4NOBA 1XF4A 4ELMA 4KGLA 1F58L 3VRLE 4YDVA 1Z5LB 2NY5H 4DOHB 1FL6B 2Q8BL 4ISVA 5CZXC 4JRWA 2C26A 1JTPA 2X4RB 1LEKB 6FABL 4GXVH 1MCWM 3IU4L 4Q9CA 2V17H 4YHMH 2MHAA 3KLAB 4MJIB 5F6HI 1DEEA 1A9EA 1ES0A 2ZUWA 3PP4H 4HKXA 1MCBA 3P0YL 1PEWA 4JJHA 2J8UE 3X11A 2HLAA 3LHPL 3O4LB 3MOBH 1C1EH 4LMQI 5AG8A 4Z77A 2AXFB 3DURA 4O51B 2B20A 5HHOB 2C9AA 4EIZC 3GIZH 5JXAH 5TF0A 2PTVA 2IANE 1F4YL 1RV6X 5HSFA 1F58H 3JV6A 3ZO0A 3RWDB 2EYTA 1OW0A 2Q8BH 4RAUA 5IFHH 1CK0H 5F9DC 1JZ7A 1G7IB 6FABH 5JOFB 2JF1A 1AO7D 3DX8B 2W91A 3FOMB 2AXGA 5GS2D 2EXYD 3LPFA 5E9DD 1HQRA 3C60C 3O6FA 5GJSH 5F7MC 4HLJA 3RKDC 1G0XA 3P0YH 2G5BA 3LHPH 3R06A 1BBDL 5DVKA 3PWPA 2X1QA 3WN5B 1JF6A 3RPIB 5DFWH 3MXWL 5T3ZL 3ZDZF 4X6DA 1MJUL 1U9KA 1VGKA 4QWWC 1E4XI 2IH1B 4P9MH 1SBSL 1JJUA 1HHIB 3KWWB 4RMSA 5CGYD 3MLPA 4HC1L 5ISZD 1BECA 5E99L 1P6FA 1JTTA 4WFGE 4RMRA 1T66C 3FN3A 2CUMA 4WI4A 4PJDF 3QUML 4OM0L 2Z35B 4U6XA 2DQGL 1MI5B 4UAOC 4OQTA 1SVZA 5C0FB 1AQDA 3ILPA 1DQJB 4X0KB 3MFGB 2VERN 3DMMC 3RTQD 3LRGA 1BBDH 4PJIA 1JMZA 3MXWH 5C0AB 5T3ZH 1NGQL 4F7CB 1AP2B 1MJUH 1R5WB 2ITCA 4AK1A 3DRQB 1B6DA 2BSRA 1KJ3L 1QA9A 3CFIC 3VG9B 4ZFZA 5C0BE 4HUUB 3B9KB 4R0LA 3RUGE 1SBSH 2JE8A 4LMQE 5C0CB 2Y36L 4PG9A 4P2RD 3U2SA 1PQZA 4HC1H 5B3JF 5IM7B 2SEBA 5D1XA 3W9EA 5C0NC 3Q3GB 4XTRD 2YD7A 4RWYL 3L3DA 4Y5VA 3NIDE 1KB9J 5AYQA 4BH7A 4RDQG 3T3PF 3C5SA 5F7DA 1NBVH 3QUMH 4OM0H 4G43A 3GHEL 2DQGH 3MLSL 4LP4A 3IXAA 3EZJB 4PJFA 5F7HA 4JFDB 2A9NL 3VMOA 2WUCL 4V1DD 5INCA 5T1KB 3BPOC 1K2DA 3D39A 1SMAA 3BYTA 1NGQH 1R3HB 1U8JA 2XG4A 3L3HB 1KCUL 2QV2A 1KJ3H 2O93L 3QSKB 1IEHA 3ULUL 1OQXA 1WIOA 4U1SA 3VWJB 2Y36H 1BFVL 4I3RH 4MS8C 2KDGA 4HXBL 4JDTH 2HT3D 4HZLA 5E8PA 3TBTA 4X6CA 4N0UB 5D93C 4P2CG 3IKCA 3BP5B 3F5WB 3HZMA 2VDQL 1K9TA 1ULVA 5D5MB 5DJ8B 3ZDXE 4ZS6D 1MVFA 1UH2A 3GHEH 3LN9A 2DQFA 3MLSH 1A3LL 3P3YA 4NKDB 3VXUA 2W0FA 3T0WA 2A9NH 5MHSD 2F53E 5DEFB 2WUCH 4F33B 4G42B 2Y23A 3D48R 1D9KA 3T2NL 1KCUH 4HMDA 3HNTH 4QEGA 4XVSL 2WW8A 1JWSB 1H3UA 1MH5B 3ULUH 1K8DB 3STZA 5A3IC 4PLJC 3RIFF 2NZ9D 2P5EA 1QEWB 3HAEH 5FB8A 3DX6A 4FTVB 4HXBH 3MUGA 3LN5B 4KK8C 5SWZE 2Q76A 3BGFB 4YDLC 3IDNA 1N3NA 3EOTL 1VSCA 3BVNB 5DC0A 4N1CA 4N8VG 4O58H 3VWKA 1NSNL 3QJFB 2W60A 4QRSB 1UB5A 4YNYA 4ZUSB 4Z7WF 4HWZA 1A3LH 4NHUA 3EHBC 4M48H 5C09A 3DROA 2G75B 4UIMA 1X9QA 3C6LD 5J13B 2E7LC 4LLWA 2JCCF 3HE6D 5D7LA 1FNEA 3KYAA 3MCLL 3LKNB 2D2OA 5LXGL 3VXPA 5AAMA 4F8QA 3B2UC 3QDMA 4MGXA 3OBAA 4X4YB 4HBCL 1CXEA 4KK5C 1F13A 4XBEL 5GGSB 4WU5B 4CJ0A 3V6ZA 3N1QC 1YUHB 1U8KA 2OL3L 2P4AB 2QBWA 1KIRA 3RHWK 3EOTH 3IXTB 1NSNH 2B2XH 1GGIH 2FEDC 3OF6A 4R2GC 5MENA 5IB5A 1DVFC 3FB8A 3K8LA 1IZKA 1KB5A 2VIRB 5HDLA 3VRJA 4ZQKA 3VFMA 4DJMA 3HRZA 2J8HA 3MCLH 5LXGH 4XVTL 3ZHLA 4ELMF 3FRPA 4PJXA 1JZ5A 4X99A 4OD3L 1QHOA 2X2YA 1TQCB 4HBCH 3DV6B 4XBEH 1OL0A 5GGRB 5IMOB 3NCJL 1PFCA 3VFTB 3MR9B 1HXMA 1CL7L 4ZO9A 5B22A 2WAHA 4ODTH 1WLHA 8FABB 1HEZB 1Z5LA 3GHBL 4Y16D 2D7QA 1X5IA 4LAJH 2EDKA 1FL6A 5DVNA 4MX7B 1I75A 4D9RE 4UUJB 4TSBH 4AQ1B 3QHFH 2VLKD 2X4RA 1LEKA 1KFAL 4Y2OA 4MJIA 3KLAA 5EU6D 2CKBB 4XVTH 3JWOL 2A6IB 4Y4KB 3IETB 4QHKJ 2ZUVA 3N85L 4GRLD 4NWTL 4OD3H 5SWSE 5EWIL 4W81A 3RVUC 3ZE2F 3O4LA 4HSQA 2AXFA 4O51A 4X9FA 2NR6C 4IHOB 5HHOA 5FHBL 5CKAA 4UQ2B 3RY5A 1CL7H 1NDMB 1AE6L 1RZKL 2GW5A 4JB9L 1KCLA 4EI5D 3PV7A 3LPGA 5TQ0L 3GHBH 3RWDA 1IGYB 4N68A 3NIFF 1K3IA 4RX4D 3IFNL 5EOCL 2GJZB 1T89A 3C5ZB 4JLRB 2DTML 1G7IA 4F15C 4Y4HD 1KFAH 5IBUG 5JOFA 3ZTNL 3DX8A 4X6DF 1LMKA 3OG4B 3FOMA 4K3HA 1E4KC 2AV7B 3JWOH 4PRDB 4IBLT 3S97C 1CFVL 3N85H 4KTDL 4NWTH 3WV0A 1PVHA 3VMNA 1ROWA 4Y1AB 1I9IL 5GJTH 1EFXB 3WN5A 1RQ5A 3RPIA 4FFWD 5FHBH 1BREA 2EICA 4LBEB 1AE6H 1RZKH 4JB9H 2IH1A 3ESUF 3S88L 1KELL 5J57B 5TQ0H 1HHIA 3KWWA 4KROD 2XOTA 4NZRL 3IFNH 5EOCH 2R0WL 2BFVL 1D6EB 2DTMH 4Z7UF 1JNLL 1XR9B 3ZTNH 5C0RH 2APBA 3T0BA 3ORJA 2Z35A 3P2TA 3UYRL 1MI5A 1LEIB 3GMPB 1NGWB 4IJ3B 4Z5RB 4XAKD 4KTDH 4G8GB 5C0BB 5C0FA 1DQJA 4X0KA 3U0PB 2G60L 1GHFL 1I9IH 1YN6B 4HGMA 4K7PL 2X4NB 1S9XB 5C0AA 4DTGL 4F7CA 3TF7C 1AP2A 1R5WA 3HPLB 4GSDL 3DRQA 1AR2A 4HUUA 3B9KA 1K4CB 3S88H 4XMLH 1KELH 3QEQB 5C0CA 3KYKH 4U0QB 2ZJSL 4PJFF 4NZRH 5IM7A 1I3RB 2D9QB 2BFVH 2HLFD 2WBJD 4KJQD 5JW4R 3Q3GA 3QPXL 1U36A 2WANA 5I71B 4YGVB 2DI7A 2EIBA 3UYRH 1U93B 3KPQB 5FO9B 2NY1B 1PZUB 3G6JF 2XZZA 1Y18B 5I1LB 1CI5A 3MO1B 5C92A 1UH4A 4JFDA 2GK0B 2WMPA 2G60H 1GHFH 5T1KA 5I0DA 3NBNA 3ARGD 4DTGH 2IBGA 3L3HA 1R3HA 1M6OB 3T2QA 4GSDH 2Q87A 2DD8L 1TLKA 3EIFA 4LSDA 4YDJB 4CDGC 4MB3A 1ZV5A 2P5WB 4HXAL 2BJML 1Z9MA 3VWJA 2ZJSH 4N0UA 3TFKD 3BP5A 3F5WA 3QPXH 1B2WL 2F53B 5D5MA 5DJ8A 3KLDA 3VA6A 1CGUA 1FYTD 1KLUB 4NO2B 1G0YR 4NKDA 5F7EH 1KB9K 4QY8B 5HY9B 4P46D 3FL7A 3AB0B 2V5RA 4OLUL 4M9PA 5DEFA 4F33A 3M1BB 4G42A 5JHDE 3G9VA 1HHGB 4JKKA 5GHWL 2YWYA 4UOJA 1JWSA 1MH5A 3Q6GL 3SE4A 1XGUB 1VEOA 4ZXBB 2DYPB 2BJMH 1K8DA 1QEWA 1OW0C 4N90D 4XMPL 4FTVA 4J1UB 2PNDA 2E6QA 3F7YB 4YBLC 1F5WA 3LN5A 4XNXL 1TIUA 1AI1L 3ES6B 3U79A 4LGPB 3BVNA 4F2MB 1E4JA 3QJFA 4HIIB 4QRSA 2XY1A 2EO1A 2VWEC 2C1PB 1ZLSL 2ARJB 4ZUSA 3O6FC 2YKLL 3JVGA 4NKOB 2G75A 3QBTB 4OLUH 1DBKL 5HPOA 4NQCE 5GHWH 2HJKB 3LKNA 3ZE1F 1U8HB 3Q6GH 2RJMA 1YPZE 4IRSB 4QLRA 1OPGH 4X4YA 4XMPH 3UTOA 2EE9A 5GGSA 4WU5A 1YUHA 3MC0A 1QSEE 4PJAF 4XNXH 5EH1A 1AI1H 3IXTA 1ZLUK 1JNNL 4TVPL 5B38G 4PJXF 3D6GA 3FKUS 3TCLB 2VIRA 2YKLH 5FF6B 3LRHA 3GKWH 1VEMA 1P7QB 1DBKH 4ZNEA 3ZT6A 4KVCL 1OARL 1PEZA 4AZ8A 3K46A 4NBYB 2CXGA 1T3FB 1Y0LB 3MA9L 1Z0NA 1A6VL 1NGPL 1CDGA 3DV6A 3WJLC 4V2BA 5D1XC 5GGRA 5IMOA 3VFTA 3S5LB 1G9EA 3MR9A 3LPWA 1A5FH 1AHWB 1BQHG 2ZCKL 4Y5VC 1BVLB 3NABL 1JNNH 2WBWB 4IOFC 5I8CB 2R1YB 1MNUH 1J0KA 5EZLB 4TVPH 1PDKA 8FABA 1HEZA 2V7HB 1T20B 1MCWW 3CFDB 4MX7A 1OAYL 4UUJA 4PLNC 3QAZC 5DRWB 4UOW0 2XRAL 2EC9U 4KMLB 2JB5H 4QRRD 2ESVD 3QHZL 4KAQL 4KVCH 2CKBA 5T5FL 4JRYE 1OARH 4MA8L 3ZT7A 3GJFH 2A6IA 4Y4KA 3IETA 5E5UB 3VD4A 3MYJB 2AVGA 1A6VH 1NGPH 3HMXL 3RI5F 4XXDB 5D7KD 1T1YB 2MQCA 4IHOA 1LO4H 3S4SG 2ZCKH 3AS3A 4N1HB 3X3GL 5I74C 4UQ2A 3NABH 1NDMA 2EH8L 2AJVL 1N5AB 4HUXB 5MP6L 1IGYA 2B0SL 3WHXB 2R0ZL 5D1ZC 1OAYH 4F7TB 2GJZA 3C5ZA 4JLRA 3RIFK 4EOWL 3WBDA 3Q5TA 1CLZL 2XRAH 5F7UA 2F5AL 1HK6A 1FIGL 1DANT 2AV7A 5T1MB 3QHZH 1D9KC 4HEPG 4KAQH 5T5FH 3SJVD 4MA8H 3IDJB 4PRDA 4BFIB 3DHMA 1YDPB 5CD3B 4IEFB 1HYRC 3HMXH 4PJCE 3CU1A 2MSPA 4JCMA 4Y1AA 1EFXA 5EULV 4F8TA 4DUVA 4GKSB 4U6YB 2CRMA 2R0LL 4F37F 3NCCB 3X3GH 4WTXA 4LBEA 5E95B 1YEFL 2DJ4A 2AJVH 4LIQE 1UWGL 2EXWC 5MP6H 5ALBL 3R0MA 1J05B 5DMGD 2B0SH 4OFIA 3HUJE 2R0ZH 3VI3F 1T04B 1D6EA 1EJ6A 1P5VA 3VXMD 1BIIB 1A6AB 1XR9A 4JM2B 1CLZH 3M8OL 4KRPB 3UBXI 2F5AH 3CMOL 4W4OA 1FIGH 2DKMA 2FJHB 1LEIA 3GMPA 1NGWA 4Z5RA 1GGCL 4G8GA 5C0BA 1OWWA 3U0PA 4OCSH 5I9QB 1YN6A 1NBZB 2X4NA 3U46B 1S9XA 4BQBA 3QUXB 3HPLA 2RB8A 2GY7B 3MLWL 1K4CA 3QEQA 3EO9H 2LU3A 5ALBH 2H6PB 4K7PX 4LSSL 2EKSB 3HI6L 4NQUA 3CXHJ 3T04D 4JKPL 1I3RA 5KVEL 4XP4L 1O0VA 1OP3H 1MCEA 1TENA 5F9WC 3M8OH 4YGVA 4OF3A 3WLBB 3CMOH 2KUTA 2IFGA 1U93A 3KPQA 5FO9A 1MIML 1RUAL 4ORGB 4X7EC 5KOVC 3SGEI 1GGCH 1Y18A 4ZS7L 5GGTL 5I1LA 3MO1A 4XPTL 4Q9RL 2GK0A 2HRPL 1BVKB 4PGBB 3X17A 1HSBB 3PABB 5LCVL 5AYUL 1L7IL 5CD5C 3EZ8A 1M6OA 4ZFOB 4UTAL 3O2VL 1PYWB 2D3VA 4PYHA 5I1DB 4XP6L 4YDJA 1HZHL 3MLWH 5A2JH 1S8DB 2X4SB 4JEGB 2P5WA 2WZPD 4LSSH 5DRXB 1U8PB 4I0KA 3ZYIA 5KVEH 5FYKL 1T2XA 4XP4H 1F2QA 3GNML 3H3BC 4IS6B 2VXTL 1MY5A 3FN0L 4PJHE 5I1JH 2IBBA 5HVGB 5GGUB 2F53A 3I9GL 4NJAL 1LP9F 5JHDB 4E5XB 3G9AB 1RUAH 1KLUA 2OI9B 4NO2A 4BFEA 4ZS7H 5GGTH 4XPTH 5DJXB 4QY8A 4Q9RH 5HY9A 2HRPH 4JZJB 1NBQA 1B4RA 4YEEA 5LCVH 3M1BA 5AYUH 1RK1B 1HHGA 2W0PA 4UTAH 1WTLA 1CCZA 2NXYD 3O2VH 1TZGL 2ID5A 3F65A 3I3EA 4XP6H 1YJDH 1XGUA 4NFDA 4ZXBA 2DYPA 4RA3A 1YY9D 4J1UA 2KQMA 3F7YA 1T89C 2VKWA 1QSZA 3ARED 5FYKH 3GNMH 4S1DC 5IW1B 2AXJA 2VXTH 3ES6A 3FN0H 1LE9B 1I8KB 1EERB 3QIUC 4F2MA 4LHUD 3RWJB 4HIIA 1WFOA 3VXTB 4OCYL 4NJAH 4B5EA 2C1PA 2ARJA 4NQCB 1JYWA 4QHLB 5I1KL 4KQ4L 4KRMB 4NKOA 4G7VL 3MRRB 3WN5C 4U0RB 2HRLA 4RBPK 1HQ4B 3N9GL 2HJKA 1TZGH 2FX9L 4P4RB 3QCUL 1QSEB 2X5PA 1U8HA 2DQJH 5BS0D 1TJGH 2DJUA 4IRSA 1KGCD 5CSZB 5FM4A 2VR5A 1UKTA 3CJJA 4WHYG 1MEXL 1BOGB 4LAQL 4YO0B 3R0NA 5ITFB 5DA4A 5AZ2L 3BI9X 2O5XL 1IILE 2YHGA 3TCLA 4G8IB 1PG7L 1T2QL 5I1KH 5DUPL 1DQMH 3VRLF 4KQ4H 5FF6A 1YEKL 1P7QA 2ZUUA 1EEYB 4EXPX 5DJCB 2HVJB 2OQJB 2R1XB 1UZ8B 3GJEB 4Q74A 2RQ8A 3QCUH 3UTSE 3SPVB 3VG9C 3BQUB 1T3FA 3B9KC 1Y0LA 4FQCL 2X09A 2B39A 2NY6B 3QG7L 1DUYB 5MEOB 2ATKB 5T3XH 1UM6L 2J8UF 1MEXH 5HGDB 3S5LA 1GL4B 1AHWA 4UT7L 1BVLA 2EDYA 4LAQH 5I8CA 2R1YA 3EYSL 5AZ2H 5EZLA 2YD2A 3E3QE 2O5XH 1NC4D 2V7HA 1T20A 4JRYB 2R4SL 3CFDA 1T2QH 5DUPH 5DRWA 1F4XL 1YEKH 3CLEL 3RDTB 4EZMA 5DI8B 4IIQB 4KK6D 3P4MB 4K9EH 2X40A 2AQ3A 2DQTL 1MCCA 4M6OL 1YNKL 3MYJA 5E8NB 3ULSB 3VWJC 3QG7H 4XXDA 1T1YA 1UM6H 2CKNA 5J7CC 1FNFA 3BKYH 5KVMC 3MUZ1 4OGAD 3AS2A 4M7ZB 3EYSH 1N5AA 4HUXA 2PXYB 1ZMYA 3C2AH 1CDBA 3WHXA 3LN4B 3R4DA 2R4SH 4D9QE 4F7TA 1F4XH 5D6DA 3CLEH 1DZBA 5T1MA 3OWEA 1L7TL 2MNUA 2VC2L 3IDJA 1TQBB 2DQTH 2XZAH 4BFIA 3P4OB 1YDPA 4M6OH 1YNKH 3SE4C 5ID1B 3OJMB 3EDEA 5CD3A 4R9HA 4Y2DD 1J8KA 3TM6A 1BD2E 5KN5B 3IAGC 3MV01 1FH5L 5JXED 3HUJB 4GKSA 4U6YA 2JJVA 3WEXB 5FFLA 4AEIL 2D7TH 1MHEB 1B6UA 2R29L 3E6HB 4Q9QL 1J05A 4HIJB 1B88A 1G7HB 5JPNB 2ATPB 5DGQA 2HTLC 3RRQA 3JVGC 1XR8B 1T04A 3RUGF 4NBXB 1BIIA 1Q9WB 2NY4B 1A6AA 4JM2A 5J13C 1VFMA 3VFGL 4LK4A 5JMRA 4M62L 5ENWB 1EZVX 1L7TH 2VC2H 3NIDF 2FJHA 2C1OB 1F2XK 5ACLA 2EDLA 2XXCB 1KJ2L 2AI0H 2D7OA 4WHDA 1FH5H 1NBZA 5KS9E 1CGYA 3K4DA 3U46A 3UTTB 3OKYA 3QO1B 3E8UL 4LSVL 1YEEL 2YD1A 3QUXA 2EC8A 4O2CB 3VXSB 3VI4E 1N0XL 3RKDD 2HT4C 4U7SA 3D87B 1CTNA 2R29H 4Q9QH 1X7QB 5LAXB 1CFSB 2H6PA 3ABZA 2EKSA 1NAML 4PGDB 1TTFA 4QWWD 3VFGH 4X5XB 5ICZB 2FYYB 4M62H 3WLBA 5I30L 4LDEB 5DHVH 4ORGA 3ZDXF 1KJ2H 1TQCC 5HHPB 4B41A 2A6JB 1T66D 1BVKA 4PGBA 1HSBA 3PABA 1KIPB 2I5YL 2N56A 3E8UH 4LSVH 1ACYL 4ZFOA 1NCCL 2QADD 1PYWA 4OF6A 2CGRL 2H2PC 3RL2B 3VDAA 4PJHB 5E6IC 1FDLL 5I1DA 4KUCF 1S8DA 2X4SA 2V2XB 5I8KL 3WLWC 4D8PB 3FTGB 4RFNB 5DRXA 1U8PA 4MJ2A 3ARBB 5CILL 1MCLA 1NAMH 4IS6A 4ZAKC 3JZ7A 2FH8A 3INUH 5GGUA 1KIQB 1UKQA 3HAEG 4TQEL 3OJVC 3OX8B 1ZANL 4U1NB 4GJTB 3CXHK 5JHDA 4E5XA 4Y4KC 4WFED 2X1XR 1T0PB 5DJXA 3WKNA 4CW1B 3KPLB 4JZJA 5CS7A 4MAUH 3AFLA 1RK1A 5JOEA 1ACYH 4RMWA 1NCCH 4GOSA 3RWGB 4JHZA 3E6FB 5D1QB 1HDMB 4M1CC 3HG1D 3ZYOA 3C6SB 5I8KH 5CILH 2X7LB 3C5ZC 4S1SL 3ZSSA 3ZLQC 4NT6B 5IW1A 3CH8A 1T80A 1LE9A 4N5ED 1I8KA 4F37K 5JOPD 1X3DA 4TQEH 3RWJA 4BFGA 3VXTA 2B8OT 1RY7B 1ZANH 4OBSA 1CGTA 5C6TH 4NQCA 1HYSC 4G9FD 4QHLA 3GDBA 3MRRA 1LK2B 4LPVA 5DC4B 2DICA 5IIEB 1OAUL 2L7JA 3MROB 1HQ4A 4CDHA 4P4RA 1AIFB 1QSEA 3HC0B 1FVCB 1MRFL 5ESAB 3DI2B 1OP5H 4LVHB 4L9DA 5CINL 5CSZA 3ROLB 1MY7A 4S2SB 2VXUL 1G7JB 4S1SH 3DRTB 1HE7A 1BOGA 4EXKA 4BUGA 4D2NA 3CX2A 4W4OC 4YO0A 1NMCB 4OFVA 5ITFA 3R8QA 5TDOB 4RGNE 5A3ID 5HI5C 4PLJD 4LNVA 4EKXA 1LWRA 4IJ3C 4G8IA 3BAEL 3CX5J 3UTSB 3CDGB 1EEYA 1OAUH 5DJCA 2OQJA 3O2WL 2HVJA 1RZ7L 1UZ8A 2R1XA 1T4KB 1X5GA 3GJEA 3D3VD 4PFEA 1PG7X 5FGBA 3SPVA 4DKFL 3BQUA 1MRFH 1W0VB 5TE7L 3UPRB 5CINH 1DUYA 5MEOA 2ATKA 3QI9B 2VXUH 1WWAX 2CUHA 3PIQB 5HGDA 4C55A 1FC1A 5I71C 5JO5B 2YPLD 2ZUQB 4XCEB 5DQ9B 1ZS8B 4YHZL 2NY1C 4KK5D 4JRYA 4TYUA 3BAEH 4KC3B 4V2CB 2GYSA 2FJFB 4XPGL 3RU8H 2FB4L 3SDXE 2FEDD 4N5UA 3RDTA 4K3DL 4DN3L 1L6ZA 3K8MA 3O2WH 1LO3H 5DI8A 4IIQA 4Q6YA 3P4MA 1OHQA 4QRUB 4DKFH 3QRFM 3IS1X 3BW9B 4I9WD 1D3CA 4UIKL 4BFBD 3FFCE 1IC7L 5E8NA 5GRVL 5TE7H 3ULSA 4MXQD 4OLXL 2X70B 3DBXB 5BRZD 3SDDB 5BVPH 2PTTB 4YR6B 1CIDA 2PXYA 1FPTL 3WFZA 2X4PB 4YHZH 4PRBB 2BY2A 3H9ZA 1FG2B 1S78C 3LN4A 2APFA 1P1ZB 4HK3J 3AB0C 2X1PA 1GGYA 2OR8A 2C4FT 2MTPA 4YDKL 5EU3B 3I6KB 4PY8I 4DN3H 1A64A 4OQ1A 25C8L 4XXCA 3P4OA 1FC2D 2YD8A 5ID1A 2NX5D 4UIKH 1IC7H 4ZXBC 1E6OH 4S0SD 4OLXH 1P84J 4FFZL 5KN5A 4G8EB 1L0XA 3JTTB 5F21B 2RGSA 3HUJA 4JM2F 1TCMA 1OCWH 4FQXD 3WEXA 1QFPA 5DK3A 3IDGB 1MHEA 1QVOB 4LNRB 3E6HA 3WJJA 2HA1A 3RVUD 1FPTH 1UADC 3SKMB 3AVEA 4HIJA 1G7HA 4POZC 5JPNA 1FHGA 1NAKL 2ATPA 2YBRB 3QISA 2NR6D 3SQOL 5IQ9B 1AD0B 1XR8A 2VZ1A 5IFAL 1Q9WA 5I19L 1HKLL 4YDKH 1RZFL 4WU7B 2HKHL 5ENWA 3HFMH 5KS9B 25C8H 2C1OA 4LHQB 3FFDB 4NPYB 4IRSC 1DN2A 1BQHB 3LIZL 1D5MB 3EFFB 3BZDA 3TVMB 3UTTA 3BP7B 3QO1A 4G9DB 1F6LL 1EJOL 4O2CA 3HI1B 3VXSA 2FO4B 2XACC 4PJGE 4MVBC 5E2UL 1X7QA 4P3WA 2BCKB 5LAXA 3QIBB 1CFSA 3RVXC 3VXQB 1NAKH 4MQ7B 1MWAB 4WNQB 3SQOH 1AGDB 4PGDA 5I19H 4O5LL 1HKLH 4X5XA 5ICZA 2FYYA 1RZFH 4L3AA 2HKHH 4K3GA 4OZFG 4EUPH 3MOAL 3MLVH 4L4TD 3BMWA 5E2TH 4XB8A 1UWEH 3OTTA 5JA9A 5HHPA 2A6JA 1CIUA 2PW2B 3LIZH 1XCTB 4WFFE 2LAGB 4Y4FB 1AHWC 3SGKA 1EJOH 4XH2B 3RL2A 4PJHA 5ERWB 2YWZA 2K7QA 4U1IB 2WUBL 1FO0B 2OSLB 2V2XA 1MFNA 2YS4A 5SV4A 4D8PA 3FTGA 4YZFF 2L4OA 1KPRB 4I8DA 3ARBA 4O5LH 1IAII 3MRNB 2AQ1A 1KIQA 3QDGE 3IJYB 3OX8A 2ADJB 4U1NA 1S7QB 3MOAH 4LVEA 4YUEH 3BRGC 1NUNB 4QGTA 1P2CB 3K7UA 5KZCB 2DI8A 4CW1A 3KPLA 2YXFA 2CR3A 2BHYA 3RWGA 4JRXD 3E6FA 5D1QA 1AJ7L 1HDMA 3WNNA 1QFWI 5FAAA 2YD6A 3C6SA 1V3LA 2XTJE 3SO3B 1NFDB 3LCYA 1YPZF 3OV6A 4B50A 2X7LA 4KI5D 1ITCA 1JE6A 4NT6A 3FHQA 5D7SL 3VDBA 3U7AA 2GKIA 1IRAY 5C0DB 3NFSL 4NKMB 1KIUA 3GKZA 3MZTA 4XNMB 4WENB 4RDQF 3VE0B 5I1GL 5FYJU 1LK2A 3KS0H 3SKUD 4JFZL 1C5DB 3A6OA 4HUVB 5IIEA 4Q6IB 3KPSD 3MROA 1MJ7L 2P43B 1O7VA 1AIFA 5CAYB 4KWUA 3HC0A 4UDTB 1AJ7H 5FK9B 1FVCA 1HCFX 4PTUB 5ESAA 1RU9L 4RGNB 2ICEB 3ROLA 3WNKA 4S2SA 2LABA 4MLIA 4G8FB 3GSXB 4H1LH 3DRTA 4PJ5B 5BCAA 5D7SH 4WO4B 5JLZB 4JM2C 4HQQL 4KRPC 4M1GL 4OGXL 1UYWL 1QD0A 5JZ7C 2BHUA 3P0VL 1BWMA 5TDOA 4U31A 3NFSH 4GXUN 3K2UL 3UTSA 1CD8A 5I1GH 3D18B 3CDGA 4PPTA 5I9QC 4JFZH 4XZUB 1ZHNB 1T4KA 3QUXC 5HYFA 2YD4A 3QCVL 1JGEB 3UMTA 1W0VA 1RU9H 1RZ8B 3CVHL 3UPRA 3KXFE 3PWPD 3GMOB 1PZ5B 3QI9A 1L6XA 3L5WB 4NM8H 3PIQA 4RAHA 5BJTB 1G7PB 4OGZA 4HQQH 4M1GH 5JO5A 5EC2B 3LQZB 4OGXH 4XCEA 5DQ9A 3P0VH 3SDXB 1U3HB 2DAVA 1ZS8A 2FGWH 2P47B 4R4FH 3K2UH 3G6AB 2E7BA 1KEMH 2FJFA 2AEPL 4FS0A 2GTZB 3FFCB 1U2CA 3BOVA 1SM3L 1ZLWK 2AJYL 3V95A 2F58H 1KLFA 3CX5K 4XNZB 4LQ1A 4QRUA 5IVXE 3QCVH 3NZHL 3BW9A 4XC1L 2A73B 5M7QA 3CVHH 3QNZB 3FO2B 1QOKA 2X70A 1XF2B 1PY9A 4WCYL 4BK5A 3DBXA 2CKBL 5GQBA 3SDDA 4NUJB 4PJCF 5F9AC 5CEZE 2PTTA 1B0RB 4YR6A 2FZ3B 2VR4A 2X4PA 1KCKA 4EQ2A 4PRBA 1FG2A 3RFZC 2OI9C 5D1XD 2CPCA 5H35B 1P1ZA 4HK0B 2AEPH 2Y72A 2W9DL 4JZJC 2BRQA 3HUJF 4UQ3B 5EU3A 3I6KA 1SM3H 4OZIB 2AJYH 4U1MB 3JV4B 4ZO8A 5F3BB 4RCAA 4RWHA 1A7QL 1K85A 3NZHH 4XC1H 5GRYA 2Y6SC 5KAQG 4J2XA 4P4KB 1YYLL 4G8EA 1WWWX 3JTTA 1RURL 2YXMA 4I0PB 4WCYH 4GT7A 2CKBH 3O0RL 4PV9B 4M1DL 3IDGA 5GS0C 1QVOA 3IYLW 4LNRA 1E28B 3HZVB 5IKCB 3SKMA 3L5JA 3U0WL 1EHLL 1KG0B 4DGVL 4RAVB 3QDJE 5FO8B 1T1XB 2YBRA 2HH0L 5IQ9A 1AD0A 3CGTA 1NMAL 4WI8A 1QHPA 1PSKL 1MREH 3OKEB 4FFYL 4WU7A 4WUUE 5FM8A 3MZGB 3QIWB 3Q0HA 1U41A 5KS9A 3OJDB 4U2ZA 3X12B 1A7QH 3GSNL 4FRWA 4OZHE 3ZSTA 3VXUD 1I7RB 3FFDA 4NPYA 4NN6B 1BQHA 4PJGB 1D5IL 2EDXA 4JKWA 1YYLH 1D5MA 3EFFA 5DO2D 1IVLA 3TVMA 5JW5B 1MCOL 3BP7A 1D9KD 4G9DA 2K1MA 3HI1A 4M1DH 2FO4A 3RQ3A 2E27H 1P84K 3VXQA 2BCKA 3QIBA 1EHLH 3U0WH 2IAMC 1I9RL 4DGVH 4MQ7A 1MWAA 2HH0H 4WNQA 4PB0L 3BRFA 1AGDA 1NMAH 3VWKD 4DGYL 4TN9A 1WAAA 4FFYH 1KJMB 2EXWD 2F54E 3VU2A 5FGBC 3JSSA 3GSNH 5DD0L 3BQUC 4KJWD 5C09D 2BNRE 2J5LB 2BXYA 5CLTA 1D5IH 1T7WA 2PW2A 2GUOB 2QQKL 2J6EL 1XCTA 4Y4FA 1MCOH 5D7LD 5J89A 1N8ZB 4XH2A 1LO2H 1EVUA 1J8HB 3CSBA 5ERWA 3QDMD 2Y25A 1KYOJ 1E4WL 4U1IA 1FO0A 4WI2A 2OSLA 1I9RH 4YWGL 1KPRA 4PB0H 3BPLB 3BESR 1NL0L 4DGYH 3MRNA 3OF6D 3RDTC 5H37H 3IJYA 1E4XL 2ADJA 4IIQC 5MEND 3HC3L 1S7QA 1S9YB 5IW3A 5DD0H 4CN4A 4OSUL 3PWVB 1MAML 1NUDA 1P2CA 1MQ8A 4WEBL 2A0LD 4LRIA 2QQKH 2J6EH 3BJLA 5F8RC 4K94H 3PL6B 2Y5EA 2B1AL 5BXFB 5HGAB 5IR1B 2AV1B 4M7ZC 3GO1L 1M7DB 2XG5A 2PXYC 1E4WH 2UWEE 4HCRA 3IDIB 2GSGB 4YWGH 1NFDA 5CD5D 3FB7B 2LV4A 4NZDA 2VYRE 3T0EE 2DBJA 2GCYB 3VG0L 1SYVB 3BGMB 1E4XH 5C0DA 1MRDL 3QUMB 3HC3H 1R0AL 4XXCC 4NKMA 1J88A 1FCCA 4IOIB 5DLML 4WWID 1MAMH 4XNMA 3RAJL 4POYA 3QUZC 4Z0XB 2MMXA 3VE0A 4FQLL 3OR7B 4WEBH 4K71B 3CFCL 2UUDK 4KI1A 5IK3B 1C5DA 4MJID 4HUVA 1W8NA 4NBZB 4Q6IA 2B1AH 1LD9B 4UDTA 5FK9A 3GO1H 4PTUA 1EHXA 3O4LD 4H26B 2ICEA 2QHRH 4HLZH 5HHOD 4HGKC 4UILL 4G8FA 2EZ0C 3GSXA 2VRAA 4MQXD 4PJ5A 4L4VB 4Y5YB 1XF5B 5JLZA 2NY4C 4WO4A 3VG0H 2DIBA 4LL9A 1UWXK 4WTZA 2ERJC 1MRDH 4JY5H 5DRZB 5CIPB 1EGJA 1TJHL 1V05A 5DLMH 4S1DD 3RAJH 1VPOL 4FQLH 3NIGE 3D18A 3CFCH 1GH7A 3KXFB 4JKMA 4XZUA 1J5OL 2HVKB 1ZHNA 4WV1B 1G6VK 1ZLVK 1T6WA 1JGEA 4OB5L 1RZ8A 2CH8A 3GMOA 1PZ5A 3HAEB 4UILH 3L5WA 3PGDB 4KTYA 5EFIB 1C12B 3WSQL 3TN0D 2OJEB 5E8DL 5BJTA 4JO2L 2N4IA 1G7PA 5EC2A 3LQZA 2JK5B 1S7WB 2DM2A 3RX5A 3H3KA 1U3HA 3SDXA 1F02I 2O5ZL 1FLRL 5FYLE 3G6AA 4WFHE 1VPOH 1RZIB 3T0AA 2GTZA 3FFCA 5F3HB 1FAIL 5F71A 4HFUL 1MI5D 3SGKC 4OCWL 2I25N 3ZZ1A 4OB5H 2A73A 4GAGL 3QNZA 3BH9B 3FO2A 4RFNC 5C0AD 1XF2A 3ARBC 4R26H 1U0QA 3WSQH 5E8DH 4JO2H 4LOUC 4NUJA 1B0RA 3B9KD 5SWQB 2FZ3A 4IM8A 1IFHL 5ACZB 4UU9B 2O5ZH 4E41B 1FLRH 1VADB 5H35A 4HK0A 2VITB 3NZ8B 1A3RL 3U4AA 2BNQE 1YMHB 1FAIH 4UQ3A 2Z8VC 5MERB 4OZIA 3J8F7 4HFUH 3JV4A 4U1MA 5F3BA 4LVNB 4OCWH 1RD6A 3UAJC 4QRPE 1QLEL 5J6GB 5D1QC 3V5DB 4JFDD 3ZT5A 4GAGH 4LCYB 4H25B 5T1KD 4P4KA 4OBRA 4I0PA 3QDJB 1GZPB 3S96B 1AR1D 2VN7A 1QYGL 3FO1B 3PHQB 4PV9A 1JPSL 5KS9F 4M7KL 5I2IB 2N7AA 1IFHH 1V8HA 4WUUB 1E28A 3HZVA 3L5IA 3VWJD 5IKCA 1KG0A 3LQAC 1RUPL 4RAVA 3VI4F 5FO8A 1T1XA 4UNVA 4OZHB 1MCHA 1XZ0B 1A3RH 3W0WB 5EO9B 2XFXB 3OKEA 2HYMA 3QIWA 5K9JL 1T03L 3OJDA 4LCWE 4NC1E 3X12A 5F1SA 1I7RA 3AROA 4KKAC 4NM4L 4PJGA 4MNQE 3GRWL 2X42A 5M95B 5DVLA 1Z9LA 5I66B 4J3TA 5JW5A 4P9HL 1W72L 2XWJB 1QYGH 3UTQB 4HD9A 1JPSH 4FXLA 3NMEA 1NMCC 4O2FB 4M7KH 5DJAB 5IWLC 2F54B 1RUPH 4FTVD 3EYQC 5CJQL 3WFBH 5SX5H 2Z4QB 1KN4L 1KJMA 5K9JH 1T03H 1AC0A 4KTEL 4LPUA 3O45B 3V7AE 3EAKA 4NM4H 3GRWH 1UCTA 4PJ9B 3E3QC 2GUOA 3ARZA 3QI9C 3ULVF 5FM5O 4P48A 3A67L 4P9HH 1W72H 1N8ZA 2QEJA 2OMBA 1J8HA 2ZUQC 4JANB 1CF8L 2XT1B 2VDOL 5C86A 2DQUL 2C3VB 2UUDH 2WLZA 5BV7H 1YNTB 1JHLL 1GOGA 5FGRA 4PJ7F 3P9LB 3FN9A 2ZUSA 1FP5A 3T1FB 1A7PL 5GSVB 3RBGA 1DLFL 1GOFA 1S9YA 3QEHB 1IM9B 4KTEH 5DC9B 1NKOA 3PUCA 2YZ1A 2Z31D 3PWVA 3OZ9L 1JPST 1CQKA 1YMME 4EDXB 5ADOL 4M7JL 2UWEB 3P0GB 1UWXH 3A67H 4P2YA 3PL6A 2A38A 3SDDC 4KPHL 5BXFA 2V9QA 5HGAA 5IR1A 2AV1A 1CXIA 1M7DA 5EZOH 1CF8H 3S34L 2VDOH 3MJ6A 4U1LB 5F96L 3IDIA 2GSGA 4HC1A 3FB7A 1JHLH 2ADFH 1NCDL 4GBXB 1FBIL 3ZL4L 1KXTB 2VDNL 4TSCL 3LRSB 1KYOK 2GCYA 2VDKL 1SYVA 3BGMA 4FABH 4L8SB 4M6NH 3QUMA 4OLYL 4H8WC 4HX1B 4IOIA 5E2VL 1FQ9C 4GUPB 3CUPB 2X1WL 4Z0XA 5CZVL 3W11C 3OR7A 5CEYB 4PG2A 4M7JH 5ADOH 5IK3A 8CGTA 3IB4A 1C08B 1SJEB 5GS0L 3KYOB 4KPHH 5E03A 1JYVA 4Y4KD 2WWKT 5ISZE 5F1OB 1LD9A 1N7ML 3S34H 3UP1A 1X5AA 5JMOC 2MKWA 3ZDZE 2FBOJ 2W59A 4H26A 2JJUA 1SY6L 1RIHL 2CO7B 2VZTA 4OZFB 4L4VA 4Y5YA 1FBIH 1XF5A 3ZL4H 1I4FB 3OB8A 4U3HA 3TESA 4WEUD 4TSCH 4RGOH 4TOYL 4XP1L 5L2KB 2VDKH 4R4BB 5FV2A 2ILLA 4OLYH 5DRZA 5CIPA 3C5ZD 5CZVH 1MCDA 3KXFA 3UYPA 2HVKA 5GS0H 1JZ4A 4WV1A 4P2RE 3SDXF 1HYSD 3FB6B 3SGJC 1N7MH 3WIHH 4Y1AD 1TVHB 3HAEA 1SY6H 1RIHH 2X9XA 2DN7A 3PGDA 1BFSA 5EFIA 1C12A 2OJEA 5IQ7L 4ZFGH 4R7DB 2V2WB 4XP1H 4TOYH 2JK5A 2VZVA 1S7WA 2YUVA 5B3JE 4O4YL 4J23A 4YHYC 3D0VB 1BHGA 4JN1L 1AY1L 4RA0C 3T3PE 1ZE3C 1N2RB 1RPQA 1RZIA 1PKQE 5F3HA 1P5UA 4GMTL 3QR2A 1OP9A 3OAZK 3RVWC 4PGJA 3V79C 4JN2B 4G8GD 1JN6B 3H7BB 4M93B 5CJ8A 2P42B 3BH9A 3A0OA 3BYYA 3Q5YA 4YXHL 3OPZL 3NCEB 5EB9A 4Z8FL 2OS7A 3QEQD 5SWQA 1IAMA 3C60B 4O4YH 3ESVF 5ACZA 4UU9A 5MHSE 3PNWB 4Q7DA 4E41A 1VADA 2XZQL 2X44D 1AY1H 3CXDL 1IQWL 2VITA 3NZ8A 4LRIC 3D0LB 1ZOXA 2MQ0A 5ECJE 1YMHA 3U4BL 3T3ME 2IMNA 1PGRB 5MERA 4GMTH 1I8LA 1JWUB 3I2CL 1UJ3B 1AXTL 5J6GA 3V5DA 2NYYC 4LCYA 4J6RH 4H25A 3SY0B 1TXKA 3SO3C 4YXHH 2EE2A 3OPZH 3QDJA 1MQKL 1GZPA 3S96A 3B8SA 1A0QL 4M4PA 3PHQA 3FO1A 5IB2B 3TH2T 4KY1L 4Z8FH 2P5WD 5I2IA 1EEUA 4OFPA 4WUUA 2IBZY 3DLQR 4LCWB 3TH3T 4LIQL 5T3XE 3DMMB 2P49B 2XZQH 4LASL 4OZHA 3CXDH 2VQTA 1IQWH 1XZ0A 1Y6KR 3W0WA 2W07A 5EO9A 2GHWB 4KQ3L 2XFXA 2F53D 4MNQB 3U4BH 4P2QB 4Z7WE 2KZ1B 1NCWL 4OCLC 4AL8L 4ZOBA 1S78D 5CBEB 1AXTH 2X4UB 2VDPH 4RGNC 4YC2B 2ZUYA 5I66A 1IARB 1MQKH 4OLVL 4WO4C 3MBXL 2Q3ZA 1A0QH 3CPLB 2XWJA 3UTQA 4KY1H 4PRPE 4O2FA 3W2DL 3TP4A 2Z92B 3T8XB 4J4PA 3SE3A 1EVTC 5DJAA 2F54A 3F62A 4LIQH 2AP2A 4LASH 3R8BB 5KTEL 3RWIB 2Z4QA 4KQ3H 5F7LB 1NCWH 1A9BB 2XN9E 4AL8H 1JWMB 1D5ZB 1FGVL 1FFQA 4AY0A 1H3WM 3K3QA 3MCG1 3O45A 4J3WA 3MOQA 1P4LB 1E6JL 5GGQL 2OTWB 5D93B 1N26A 4PJ9A 1A2YB 4YJZL 1PG7W 3FHAA 5E56A 1G9MC 4WWKD 4OLVH 3MBXH 4JFYB 4MA7L 5HYSG 4HMCA 3DXAB 1VACB 2JIXB 4H5SB 4JANA 5CSGA 3W2DH 1JFQL 2ENSA 1J86A 2VLKE 4TNVK 5CLWA 1CTOA 2C3VA 4QYOB 3T4AB 1YNTA 4U6TA 1G7LB 5KTEH 3KJ4B 3P9LA 1IGCL 2N7BA 4ZTPL 1AH1A 1YMMB 4ONOA 3T1FA 1BQLH 2XA8H 5GSVA 3LEVL 3VA2C 3QEHA 3HS0B 4K8RL 4XNZC 1IM9A 3HTLX 4PRAB 4LPCA 4X9GA 2OJZL 5AAWA 1NCBL 5GGQH 1P7QD 4EDXA 1MLBB 2UWEA 3F7QA 1OSZB 5H94B 1E0OB 3LS5H 4MA7H 5F7YC 3QHTC 3NOIA 4U1LA 1I1AB 1U3ZA 4D9RD 1IGML 4W68A 4GBXA 3LRSA 4ZTPH 3SKOB 1N6QH 3ROOB 3MRPB 4L8SA 3WYRA 3LEVH 4HX1A 4K8RH 2H2SD 4JPIB 3LKOB 4GUPA 2OJZH 3CUPA 1NCBH 4P4KC 5CEYA 5AG9A 1C08A 3TH4T 1SJEA 4I1NB 4I0PC 4JFHE 1Z3GH 4JQVA 4OFKA 2DQDL 3LZFL 3KYOA 3LOWA 4R2GB 5A1AA 1KTRL 3SCMB 1OY3B 3KNBB 3LQAL 1DVFB 2D7NA 4NN7B 1MUJB 3FOLB 4LHUG 3ZHDA 5IFJB 1X6LA 3O6LL 4FNLL 4OZFA 4LEXL 3SKNB 1IGMH 1VERA 2AK4B 1I4FA 2EIZB 4A2LA 4KMQA 4P49A 1ED3B 3CIQA 4PJDB 5L2KA 4R4BA 4XAKE 1MFBL 1U6AL 3QIWC 2ZWLT 1G1CA 2PKDA 2DB8A 1INDL 5FOBB 5ESVB 3NFNB 2WINB 4NN6C 2VQUA 3PDGA 3DGGB 4XCNB 1J18A 3RL1B 2Q7NA 4JY6B 2DQDH 3LZFH 2HG5B 2DL2A 4PREB 1OLLA 2EDNA 3FB6A 3SGEH 4JQXA 1F3JB 1TVHA 2CDEB 5IVXF 3O6LH 4LEXH 4LLMB 3E2HC 3UC0L 5D7JB 2A2QT 4R7DA 4BQ6A 2V2WA 1PKQB 1MFBH 1U6AH 4CBPA 3VD5A 4L1DA 2HTKD 3D0VA 5F7FA 1FL5B 2IPKB 1A1MB 3FO9B 5LQBL 4XP5L 3LH2L 3IAQA 1N2RA 2FHFA 4CVXB 1EX0A 1A22B 4DVBB 1OAKL 2CR6A 3JWDC 2G9HB 3TGXA 2ZCHL 5DGRA 4JN2A 1KTDB 4RSVA 1FL3B 1JN6A 3H7BA 1NCAL 1UFUA 4F15B 1D6VL 2MOVA 3KHOA 2EC9T 1F4WH 1UGNA 4KK9C 1IKNA 1FYTE 1NFIB 3BPLC 3UC0H 4MNGE 5JW4N 2C4XA 1CT8B 1SEBB 4W6WB 4WY7L 3C60A 5EU7E 1WZ1L 2UY6A 3PNWA 2H1PH 2VXQL 5LQBH 1MJJB 1ZWIB 4XP5H 3LH2H 4AIOA 4MB5A 3D0LA 1Z9SA 3MUJA 3TZVC 6CGTA 1OAKH 2XTJC 3PL6C 1NQBA 1JWUA 4JZNB 1UJ3A 2WP3O 2ZCHH 5KANI 1OT1A 4X5LA 1NCAH 4RGMC 2E8YA 43CAB 2VLRD 3SY0A 1D6VH 3T0XA 3C6LB 3TIEB 4DVRL 4MD4B 4GLRI 4LPTA 3DETC 2ZSVB 3Q5OA 4H8WL 5GIRB 5IB2A 4WDIB 5I1IL 4WY7H 4Z7WB 4H0GA 5ALCL 1BX2B 1WBYB 1WZ1H 3H42L 4LCWA 2VXQH 3DMMA 3ILQC 4YHLL 4OCNC 5TFSL 1GAFL 2JCCB 1MF2L 4K71C 1T2JA 4MNQA 5DMIL 4KDVA 4P2QA 3P9MB 2OBGA 1ZVSB 1P69B 3I6LE 5CBEA 2G5RA 2VH5L 3GFUA 2X4UA 3H8NA 4PRPB 1S9KC 3FT2B 4JPWL 1WQVT 3CPLA 4H8WH 4DUWA 4ZMAT 3W5NA 5HD8C 3AAZB 2Z92A 3T8XA 2XN9B 3EYOB 4PJAE 5HDBF 3NVQA 2XQYG 4LCUB 4OZ4B 5DZNA 5TFSH 1GAFH 3FQXB 3RWIA 1MF2H 4ZFFB 1ZAGA 1NEUA 5DMIH 5DQDL 3SE8L 1A9BA 4UZGA 3MREB 1JWMA 1D5ZA 4WV1C 4N9OB 5C2UB 3IDXL 2VSDA 2VH5H 4OI7A 5H37G 3WFCL 1MWAL 1P4LA 4XCYB 5K9QG 2OTWA 5FUCE 3HMXA 2VLKB 1A2YA 2W9EL 4O02H 2B1HL 3ARRA 4JPWH 2B4CC 4JFYA 1ERNA 1S5IL 4J3XA 3DXAA 1VACA 2JIXA 3QQNA 4H5SA 1YY8B 2H8PB 4GRLB 4QYOA 3T4AA 4QRRE 1G7LA 2ESVE 2UWEF 1KTLB 3MRHB 4B7IA 1YMMA 2NZIA 5DQDH 3VW3L 3SE8H 5ICYB 1QFUL 4YHKL 3P4NB 2RIKA 1DEDA 3HS0A 4PRAA 4UMGA 2GIYA 3FQRB 3K80A 1QSFE 3WFCH 3ULVL 3KDMB 4JFFD 4Y4HB 1MLBA 3CD4A 1OSZA 3BWAB 5H94A 3BEWB 5CKGA 3TNMB 2B1HH 3BUTA 1S5IH 2XZCL 3BQUD 4U49A 3VFSB 4M9OA 2NY6D 1OTSC 1N64L 1SMOA 5C7XH 3KPRB 1I1AA 4LCCC 1R24B 2BERA 3SJVE 3W81A 4DZBB 5EN2B 1S7VB 3MTRA 3B3IB 3SKOA 4HKZB 1RUML 3M45A 1QFUH 3ROOA 4YHKH 1I8LC 3MRPA 3QFJB 1WISA 5DHVB 3GMQB 4JRYD 1T7YA 2WQ8A 5TJWK 1IQDB 2DIAA 3KPPB 3LKOA 4JPIA 1ETZB 4KROB 4OGYL 4NIKB 4APQC 3ULVH 2HFTA 1KJ2B 4CADB 4RNRB 5CUSL 2EYSB 3RDTD 3NIGF 3ZYZA 2CSPA 3SCMA 2XZCH 3KNBA 5HVHB 1NUGA 1F4HA 1DVFA 3PGCB 4ERSL 1MUJA 2A9ML 3FOLA 4XGZB 1N64H 5IFJA 3BN9C 4Z7UB 1IAIM 3FT4B 3L3KB 3O6MH 3SKNA 1NAMB 2AK4A 2EIZA 1FNGB 4NRZB 5GGVH 1ED3A 4PJDA 2M2DA 1PLGL 3TWCL 1RUMH 2PXYD 3F6LA 1HIML 3IU3B 1NANI 1FFNB 1DE4B 3MQIA 5FOBA 2E9BA 5ESVA 3NFNA 1JYXA 2CDGB 2WINA 2X41A 4Q0XL 4OGYH 4MAYC 5GGTA 4OJFL 1Q38A 2QHLA 3DGGA 3H6JA 4XCNA 3RL1A 1U3YA 1CQYA 1EMTL 2FCBA 2DLFL 3QZWG 4JY6A 1X5FA 2R9HC 1JCKA 2D0GA 2HG5A 4PREA 3AS0A 2Q3AA 3H9SE 1QFWM 3B4NA 4Q2ZB 4ERSH 2A9MH 3L3GB 4NNPL 4NUGL 3ARTA 3MLXH 4J4PC 4MMZC 5HI3D 3SE3C 1F3JA 1X5JA 1EDQA 2CDEA 5CBAB 1QNZL 3PWUB 3ARGB 3QXTA 1UJTA 4LLMA 5D7JA 2UV3A 1PKQA 1PLGH 3TWCH 1HIMH 3RX8A 2X1OA 1SBBA 3G6JB 2J7LA 1FL5A 2IPKA 1A1MA 3FO9A 4Q0XH 4GAJL 2NY4D 2Z91B 4G6KL 4OJFH 1G9ML 4CVXA 5GZOC 4PJ9C 5L8JB 1EMTH 4DVBA 2DLFH 3NFPB 4TTDD 4EN3C 2G9HA 1FYTB 3VGDA 3ZKNC 1KTDA 1FL3A 5MI0C 4NNPH 5D1ZB 4NUGH 4X7TB 4R96B 1QNZH 3B9VA 3UTTD 4OF0A 1U92B 4MZ2A 3N1FC 2W38A 1MHHB 1NFIA 4N0RA 4BQ8A 1E4KA 2Y07L 4LARL 3T2OA 3VXSD 5J0BA 1ZT1B 3BE1L 5JPMB 3ZKXB 1CT8A 1I3VA 3TA3D 2HWZL 1SEBA 2HJLB 4PJ8C 3PHOB 4RMQA 1MJJA 1ZWIA 4LPXA 1TITA 4G6KH 1G9MH 1LP9E 5T1LB 1NBYB 1NGYB 2VO5A 2QQLL 2GTWB 3TO4D 5FDYA 2FX7H 3U30C 4JZNA 3NN8B 3T0EC 2PCPB 1QSVA 2OR7A 3FQUB 2W0KA 3DVFA 3S36L 43CAA 2ZKHL 3C6LA 1FFPB 3TIEA 2D9CA 1WWBX 2R15A 3GK8L 4MD4A 2Y07H 2ZSVA 4GAFB 5GIRA 4RISL 4WDIA 5DFVC 2ZG1A 4LLUB 4Z7WA 2KQNA 4L8SC 5K59E 5HDQL 4BM7A 1BX2A 1WBYA 3IRZA 3P30L 1G1YA 2BSSB 2JCCA 2VZUA 4ETQB 2QQLH 4UNUA 3MJ7B 1OSPL 3P9MA 1MCIA 1WFUA 4ENEC 2BY3A 1GGBL 1KGCE 4Q58C 5IG7B 3W9DB 3EFDL 4PY7B 1JV5B 5I6XB 1F3DJ 4PRPA 2ICWI 3OJ2C 3QRGL 3VMPA 2ZKHH 1NLBL 4PJAB 4JPVL 3FT2A 4IOSD 3GK8H 5GS1C 1UB6B 3K4AA 5D1QD 5J12C 3QQ9C 4WHYH 3AAZA 4KUZL 5IV2B 5HDQH 1CD9B 2WWMC 3I84A 4JHAL 2XN9A 3EYOA 2W92A 5MEPB 4LCUA 4OZ4A 5E24E 3FQXA 4GQ9L 4NGHH 1KPUB 4ZFFA 5I73C 3WHE1 1Q9OB 3MUY1 5D6CB 1TFHA 1OSPH 4B0MM 4G6AD 1M7XA 2DTSA 1GGBH 1X5HA 3RVTD 3MREA 5I1HL 3EFDH 5ETUB 1A4KB 5IFHL 1CK0L 4XCYA 4JQXC 3QRGH 1VFAB 2VLKA 5E6ZA 1NLBH 4JPVH 4WI3A 3ZTJH 1C5CL 4QRRB 2ESVB 1KN2L 5KAQF 4KUZH 1YY8A 2H8PA 3CNKA 5GJSL 4JHAH 4GRLA 2GK2A 1HN1A 4XPFH 3RJQB 1MLCB 5IHLB 4ZDHB 2PO6D 4GQ9H 1QSFB 3JWDL 1SEQH 1KTLA 3MRHA 4NQDB 2CMRH 5EO1B 1T6VN 3LMJL 5ICYA 3D25B 1OTUC 3PWJB 5K9QI 4WI7A 3P4NA 4P9ML 1XIWB 3D69B 5I1HH 4Y5XB 3UTSD 1FGNL 2NY0C 4M93C 3FQRA 2IPUG 3KDMA 4MSWB 4Y4HA 5T5NG 3RVVC 3BWAA 3QIUB 3BEWA 1IKNC 2CQVA 1C5CH 3TNMA 5CFHA 4PRNB 5KSAB 1MFEL 1KN2H 3VFSA 2HMID 5C07D 1UXWB 2NTSP 2FDBP 3QI9D 3KPRA 1KENH 1SJHB 2HT2C 3BP6B 1R24A 2AKRB 3S35L 4DZBA 5EN2A 3JWDH 1S7VA 3B3IA 4LLAA 3BSZL 4HKZA 3AUVA 2WNGA 3LMJH 3B83A 3QFJA 2P24B 1UJ3C 5DHVA 3GMQA 4EUPB 4XI5D 2EKJA 1FGNH 1IQDA 3KPPA 1ETZA 3O8XD 5GZND 3MBEC 2FNBA 5EBWB 1KJ2A 3P4LA 4X4XB 4RNRA 4CADA 2EYSA 5C0JB 3MSPA 1I1YB 1LILA 3FZUC 1NBVL 1F6AB 3WE6B 1MFEH 3LS4L 4X9IA 3PGCA 1AQKL 1BEYL 4XGZA 4R6UA 3T77B 4OF7A 4Z7UA 2Z93B 1YEDB 4NC1C 3JWNC 4FMKA 1KACB 3FT4A 3L3KA 3S35H 1BIHA 1NAMA 3V9FA 1FNGA 5IMMB 4NRZA 5J9PB 1WEJL 2NY2B 3BSZH 3IU3A 5J8OA 1FFNA 1DE4A 3OSKA 3MJGX 1KV3A 1X5ZA 4WI6A 3H9SB 3HE7C 4AQOA 3ZHKA 4I3RL 2CDGA 4JDTL 3WJLA 3HKFA 3ME0A 1IEAB 4LPWA 4NN5B 4YC2C 1W0YT 5CZKA 5BZWB 4Z7NE 3VD9A 4JFPB 3MRQB 5HHNB 5ITBL 3BDBA 3LS4H 2DQEH 4Q2ZA 5E6YA 2UZIH 3LD8B 4P2OC 1AQKH 1BEYH 3L3GA 4NZTL 5E1AB 3W11D 5L7XL 4HUWB 3K1KC 5CBAA 3PWUA 3EOBB 3ARGA 1QO3B 1FVDB 3HNTL 4HF5L 1WEJH 1XGTB 4LF3B 5TDNB 3G6JA 3DI3B 5KSBE 4N0YL 3NA9L 2Z91A 5DUBB 1EHNA 2B4CL 3P40A 2M1KA 1KBGL 1ZXQA 4O58L 1IAIH 3NFPA 5E5MB 5ITBH 1FYTA 1NCUA 3QWQB 4O9HL 5CIPH 3T3MF 4WI9A 3O9WB 4NZTH 5FUOH 1SJXA 5D1ZA 3V4UL 5L7XH 4M48L 4HJ0D 4X7TA 4R96A 4JCLA 3TVMD 1LNUB 1U92A 1MHHA 3AY4C 4H1LB 1LDSA 3KJ4C 3S7GA 1ZT1A 5JPMA 4HF5H 3FQWB 4WFEE 1LP9B 3CSYB 2HJLA 1U8IB 3PHOA 5CEZL 3QIBD 3TIDB 2IC2A 4YBHA 2MQ3A 4MB4A 4N0YH 4XVUD 2BVQB 3NA9H 3RPKA 1BLNB 4JO1H 5T1LA 1NBYA 1NGYA 2B4CH 3IT8D 1KBGH 2GTWA 3DUSB 2B2XL 1GGIL 3UEZA 2P46B 5EBLB 5D2LE 3SQBA 5DMKB 3NN8A 4O9HH 2PCPA 3FQUA 5D72H 4UTBL 2UZYB 3V4UH 2E3VA 1YEHL 2E7MA 1X6NA 2R56L 3BDYL 2WIIB 2Q7YB 4Y4FD 5JOPE 1G6RL 1U42A 1I1AC 2X4TB 1FFPA 4LSPH 4E9LA 4KRLB 3T0VA 5JW4Q 4IRJB 3V4PL 5CEZH 3S36X 4LLUA 2GY5A 4FQJL 2V5MA 4GO6B 4GW5B 5IBLC 4U1GB 3VFUB 3VRIB 2O61B 1LO5B 2BSSA 2NXZB 4ETQA 3MJ7A 1V3KA 4JDZB 5GGVY 5JW4M 3W9DA 5IG7A 4ODTL 2VN4A 3SCMC 4PY7A 3SHSA 4C56E 5FECB 1JV5A 1VESA 4UTBH 2BSTB 4NN7C 4U05A 3RIAK 3GUTB 5KZCD 3SE9L 1YEHH 4CMHC 4TSBL 2R56H 3CVHB 3QHFL 4JM4L 3BDYH 3TPUB 5DQJB 3B9EA 4HS8H 3RTQC 1G6RH 2OP4L 4PJAA 4F9LA 1I7TB 1UACH 4TUOB 4NCDA 5E8EB 5F97E 3CCHB 3T4YB 1UB6A 4MZ3A 4HEME 1P4BL 3GM0A 3V4PH 5C9KA 2NYYD 4GRWE 4XPHH 3OKLB 5IV2A 1LDPL 4FQJH 3GMNB 5MEPA 3AM8C 2Z8SA 1AD9B 4BH8B 1MPAL 3O2DL 3H7LA 3D3VE 1KPUA 4XTRC 1Q9OA 5D6CA 5FYJL 1CGWA 5E6IB 4F7EB 5D7IF 4I2XE 3VFVB 1DQDL 1OTTD 5ETUA 1YJDC 1A4KA 3SE9H 2H26B 2J88H 2UYLB 4CVZB 3PWLB 4JM4H 2C3HA 4ZAKB 1VFAA 2J8UB 4GKOA 2OP4H 3NPSB 3NCBB 5B8CB 1TNMA 3T1WA 1CU4L 4QRRA 5D7JC 3GGWB 2ESVA 1FZJB 1P4BH 1B3JA 3FCTB 4IDJL 4AH2B 5DUML 5F88B 1LDPH 2IANB 5F6IB 1MLCA 4EVNB 3IFLL 5GJTL 2ICCA 4PJ5D 4ZDHA 2HT3C 1MPAH 3O2DH 1QSFA 3BKJL 3OHXB 4JZOB 4NQDA 5EO1A 2FR4B 3CK0H 4I9WE 5FYJH 4ODVH 2F15A 3D25A 3TT3L 3PWJA 2VSCA 2PR4L 1Q9KB 3WS6A 1MHPL 1WZMA 1XIWA 2RR3A 3D69A 3DSNA 4X7CC 4Y5XA 4ZS6C 5GRJH 1DQDH 1Q1JL 3GSVB 1YEGL 5BRZE 2FBJL 1ADQL 4PJBE 3ZE0E 4LKXB 4MSWA 3V2AR 3QIUA 5C0RL 1N5YL 4JFQB 5D8JL 1CU4H 2KKQA 3KJ6L 2LFGA 4PRNA 5KSAA 4QXWA 4IDJH 1YZZA 5CGTA 5DMJB 4HH8A 5DUMH 4QF1B 5D9SB 1UXWA 3LB6C 2VTFA 3UBXG 1J0HA 5JW3L 4W6XB 3GMLB 4Y2DB 3VXRD 2NZ9C 3IFLH 5HGHB 1SJHA 4YHIB 1MIEL 3BP6A 2AKRA 3BKJH 3EJZC 4HKJB 4GW4B 1U3HD 3EKCA 3TT3H 2PR4H 4NNYB 1MHPH 2P24A 5L8KB 4XMLL 1L9MA 4EUPA 3GSNB 1Q1JH 1V5JA 3S35X 1P7KB 1YEGH 2FJGB 3KYKL 4K7FB 3FRPG 5EBWA 2OZ4L 4X4XA 2FBJH 1ADQH 5C0JA 3V8OA 3C6LC 1I1YA 1N5YH 3LKRB 4DKDC 3DECA 4NYLB 5D8JH 3KJ6H 2PTUA 2EEAA 3NH7L 1F6AA 3WE6A 1WCBB 4D0CB 1CXHA 2DOCA 1HNFA 2COQA 4NQEE 2ED7A 5JW3H 2FGZA 3T77A 1QBML 3RUGB 4AM0B 3IS0X 2Z93A 1YEDA 2L0DA 3I02B 1MIEH 5E7BA 5IMMA 5J9PA 2R0KL 4K9EC 1S3KL 3H9SA 4Z18A 2LQRA 2C7UB 1KCSL 2OZ4H 4NKQB 1IEAA 1T1WB 4NQXB 2ED8A 5ANME 5BZWA 1INQB 3QA3B 5K33A 2AAVA 3NH7H 4FQHB 4JFPA 3MRQA 5HHNA 1PJ9A 1A14L 4OM1L 5E1AA 4P4KD 1BOYA 5F7EL 4HUWA 4K07A 5I15L 1QBMH 2V5TA 5KSBB 3EOBA 4WI5A 1QO3A 1QBLL 4ACPA 1FVDA 2QADB 4L4TE 1XGTA 4LF3A 4KGJA 5TDNA 3UX9B 2R0KH 1AXSB 2EEBA 5EG6C 1S3KH 5DJ2B 4MLSA 4Y16C 2A1WH 4HBQA 1KCSH 1Q94B 4OZFH 5DUBA 5FYLL 3HN3A 2OXHA 5FDWB 3WNPA 1IAKB 1LK3L 3O41B 5E5MA 4HS6B 1P7HL 4YEFA 3O9WA 1A14H 2J8OA 4OM1H 1IE5A 4M3JA 2LTQB 2NPLX 1CXFA 4GRLC 5I15H 1OF2B 2YRZA 1DBAL 1LNUA 1A8JH 2H3NB 3ARXA 3F12B 4ETYA 2R8SH 4H1LA 1QBLH 4PGZA 2V9RA 2YN5A 2ZG2A 1JBJA 3FQWA 5SWZB 1LP9A 3CSYA 2ZCLL 4D94A 4YZFE 1U8IA 3QCTL 3TIDA 4KZDL 1GGUA 1BM3L 4YFDB 1OPGL 2BVQA 5D2LB 1MOEA 4DWHA 2EIDA 5FYLH 4XBPB 1BLNA 2FD6H 4Y4HC 3DUSA 4LSRL 5J1TC 4KV5E 3OXRB 1LK3H 5EBLA 1BJ8A 4QRTB 5DMKA 1IC4L 4S1RL 4HV8B 1EAPB 4KI5E 1NEZB 3GKWL 3M17B 5IJKA 2WIIA 3QNXB 2Q7YA 1T21B 2DDQH 1DBAH 2X4TA 3OB0K 1N4XL 4PJEF 2ED9A 4FFWC 4MHHG 2DWEB 1J8HD 4IRJA 1KNOB 2ZCLH 3GSQB 3QCTH 4YHOL 2VJXA 4KZDH 3WUWG 4GW5A 1BM3H 3VFUA 3VRIA 3C5JB 3QZWB 2O61A 4KROC 3V6FB 4C56B 3KPSE 1LO5A 2WBKA 2AQ2A 1A5FL 1GYAA 2C4FU 4LSRH 1RHHB 4JDZA 1MNUL 2BVEA 3FRUB 5KVGL 1UM4L 5FECA 3WS3B 3K4ZA 5HVHC 1IC4H 4S1RH 4FMFA 2BSTA 3GUTA 1X5LA 4R3SB 1C8PA 4Z7QE 5L0QB 3CVHA 4H0IA 3TPUA 5DQJA 5JIHA 3MRDB 5T3ZD 1I7TA 1JMXA 1N4XH 2JB5L 1PAMA 4TUOA 5E8EA 3CCHA 3T4YA 4FN0A 3SDYL 4YHOH 3OKLA 4N0CD 3VGGA 2ZZUT 2V5YA 2X4OB 1LVEA 3GMNA 4I2XB 3V4VH 1AD9A 2VWEE 4BH8A 4NC0B 2HLFC 2WBJC 2YC1B 5F9OL 5L8LB 4NO5B 1LO4L 4DKEL 3BP4B 4LQFL 5K9KB 2EDWA 2F8XC 5E6IA 4F7EA 3PWPE 5KVGH 1UM4H 3ILQD 3VFVA 4JFED 1J10A 4AENB 2H26A 2UYLA 3RP1A 4CVZA 3PWLA 4ZAKA 3ALXA 5SWSB 2J8UA 4ZOEA 3ARGC 5B8CA 1NMBL 2IPTL 2LE9A 3GGWA 1FZJA 3O3UN 3FCTA 4AH2A 3SDYH 5I0ZA 3MRFB 5F88A 3S37L 4RMVA 5FGCE 2IANA 1YEJL 2EDJA 4PLKC 4EVNA 2EEDA 4L4VD 5F9OH 3OHXA 4JZOA 4DKEH 1UXSB 5HD8D 3KLHC 3TFKC 3V5HB 2FR4A 4LQFH 4XAWH 4FXKB 1RJYB 1Q9KA 2DRUA 4UB0L 3GSVA 2XXMB 3L3JB 3O3EB 3I6GB 5EU7C 2BHZA 3KXFD 4P46C 5A40E 4LKXA 3KYMB 1NCNA 1NMBH 4JFQA 3WO4C 2IPTH 2BRRL 3ZKXC 4WGWB 3ULUD 4QF1A 5D9SA 3S37H 2HN7B 1YEJH 1SJVA 3GMLA 4Y2DA 4OCSL 1EBPA 5HGHA 5B39B 4L3EE 4YHIA 1TNNA 4JGUA 2CIKB 1BFOB 5FO7B 3QWOB 3ARFD 4FQXB 2DKUA 4HKJA 4F7PB 2IQ9L 4GW4A 1VKXB 1ZA3B 4NNYA 3EO9L 4NHCL 4UB0H 3NCYP 3QUYB 3GSNA 1P7KA 2FJGA 4K7FA 4M02A 2ZPKL 5F44A 4OT1L 4NQEB 2HJFB 1IMHC 3LKRA 1X4ZA 2QTEA 4NYLA 1C7SA 1W72B 2BRRH 3RNKB 1WCBA 4D0CA 2VR9A 4X6CE 4YXLL 3QEUB 1NH6A 4URTB 5IMLB 4HAGA 2FIKB 3RUGA 4AM0A 5BV7B 3DX7B 3I02A 2W65B 1DL7H 5GS2H 4YBQC 4TUJB 3VCLB 3VXUE 3QEGL 1QBBA 1HH9B 2IQ9H 1L4IA 1QLRB 4BSJA 1OTSD 1R3JB 4KJPC 4E41D 4NHCH 5I6XC 3EDFA 2ZPKH 2C7UA 2FLBT 2D0HA 4OT1H 5GPRA 3O4OB 4NQXA 5I1JL 2J6EA 4F9LC 4JJ5B 1INQA 3QA3A 2P44B 4FQHA 3NCFB 1QRNE 2VL5B 4R90L 2QSTA 1M05B 4X9HA 4YXLH 5HBBA 3IAPA 4L4TB 1II4E 4DUXA 1FRGL 1QUNA 3MX0A 1I8IB 5KSBA 5AD0B 1ZTXL 3JUZA 3C87A 1OAXL 3QEGH 5FUCC 3SDAB 4KKLC 5HVFB 4XPAL 1YJDL 1AXSA 3BN9D 5J6HB 5DJ2A 4P0DA 3V5KB 5D7LE 1GOHA 1AKJB 1NJ9B 3W0WD 1Q94A 3FO0L 1A7RH 5F89B 5DEGB 1JZ8A 1I8MB 5FDWA 3BPNC 2D4DA 1IAKA 3O41A 4HS6A 2F5BH 4R90H 4R97B 1Q0YH 1I85A 4NOFA 3DPBA 7CGTA 3CDCA 3DVIA 1FRGH 5CJXA 1OF2A 1ZLUH 4HUNB 1FV1B 3F12A 2H3NA 2PETA 4QHMB 1ZTXH 1QG3A 1TVBB 5MENE 3L95B 1I3UA 4ODBD 1OAXH 12E8H 3BIKB 1GC1H 5SWZA 3UO1L 2DQJL 3VFPB 1TJGL 4J4PD 4XPAH 1XIWC 3WS6C 4Y5XC 2F54D 3UXFA 5D2LA 3HHRB 3DV4B 5CJOL 5K59F 4XBPA 5I17B 3FO0H 2EECA 1CG9B 4C4KO 5IESL 3OXRA 4ONFL 1NPUA 5KSAC 4QRTA 5DVOA 4HV8A 1EAPA 1SYSB 4F9PC 3Q2CA 4L4JA 1DQML 4PJ9D 1NEZA 3B43A 1MVUB 3M17A 1YPZB 3QNXA 1T21A 3UPCA 2DWEA 3KPSB 4DK6A 1KNOA 3BIAX 3UO1H 3GSQA 3VD7A 3UTZB 1UEYA 3C5JA 3QZWA 3LKPB 3V6FA 4C56A 3PXJA 3UZQA 2GJJA 5CJOH 5T3XL 1J11A 5C9JB 3LKSB 4G3YH 1VCAA 5IESH 3BFOA 1RHHA 2GEEA 1U3JA 1CLYL 4ONFH 3O4LE 4FQIL 3FRUA 4PD4J 1IM9D 4X6FB 3WS3A 1FZOB 2IAMB 1EAJA 4MHHI 1DBJL 4D9LL 3TLRA 4R3SA 4P3DB 2RFXB 5E2WL 2CK0L 3AGVA 2VNCA 3U9PL 3MRDA 2V6HA 2QLVB 4PGCB 4LVOC 1AXIB 4K9EL 2NY2C 4JO3L 4IMLB 3ZTJG 3G04B 2AEQL 5BW7A 4NZUH 1K5NB 2X4OA 3S6CA 1RHFA 4I2XA 3RBSA 4GBXD 5FCSH 2DMBA 5I8EB 2DLTA 2YC1A 4NN5C 5ESQB 4NO5A 3BWUC 3BKYL 3BP4A 3T65B 1W0WB 5K9KA 2YR3A 3WFEL 1CLYH 4FQIH 2I27N 3MV7D 3C2AL 3D5OF 3LD8C 4AENA 1KXVC 1DBJH 4D9LH 3QULB 1MRCL 5E2WH 2CK0H 3U9PH 5FGCB 3RGVB 4I4WB 5SWSA 3MGAA 5DJYB 3THML 1TDQA 1TJIL 3GBLA 2XZAL 4JO3H 3UYOD 3MRFA 2AEQH 5FOJA 1J0YA 2J12B 4N8VB 5HYJD 1GPOL 3RWHB 5HGBB 3V6OE 1MI5E 5L2KD 1UXSA 3QQ9D 3V5HA 3S37X 1JGVH 4BZ2L 4FXKA 1R5IB 1RJYA 5J3HC 2D7TL 3WFEH 3EJYD 1T83A 3WXVL 5KSUB 3O9WC 5C0AE 2E9IA 3L3JA 3C2SA 5KG9B 3O3EA 3I6GA 4S0TD 2KH2B 5KBNC 1MRCH 5FEBA 2M8XA 4MXWL 4KXZH 3EDKA 1TZHB 1H5BB 3KYMA 3L5HA 4PJCB 1DUZB 3BT2L 4L3EB 4JREC 3THMH 1TJIH 1GZQB 2YUXA 5CZXD 2HN7A 4G80B 4F80A 4ODWB 1ZT7B 3QUZB 2AI0L 2ZOKB 1YY9C 3LKQB 1GPOH 5B39A 5IHBA 4WFHD 3AREC 2CIKA 1BFOA 1LQSR 3DSFH 5FO7A 3QWOA 4FQXA 4NCC2 4F7PA 3OL2A 4BZ2H 1VKXA 4JFDE 1ZA3A 3MJ9L 3WMSA 3WDHA 4OZGF 3WXVH 3QUYA 3QXUA 3EDDA 3DX9B 3UJJH 5EUKB 4LSTH 4NQEA 3GRWA 3F58L 5IJKC 4MXWH 2HJFA 1NFKA 3S9DB 1CS6A 1RJCA 4YDIL 1DQLL 2ERJB 1W72A 3BT2H 3RNKA 1KULA 4IRJC 1AGFB 1HWGB 2QQQA 4Z7NF 1J0IA 3QEUA 3ARQA 5IMLA 4MA1C 5F93C 4DKAA 4KJYB 4XNYL 2FIKA 4U1GC 1FLTX 4CKVX 3DX7A 4J7RA 4ZPTB 2W65A 2NXZC 4DW2L 4TUJA 3VCLA 1OB1B 2FECL 1HH9A 3C60D 1REIA 2ICWJ 1QLRA 1R3JA 3MJ9H 3OKNB 4M43H 4YPJA 5GRXG 35C8L 4PS4L 5H2BB 5A16B 1QRNB 4KDWA 3F58H 1IAOB 5KSBF 1BF8A 4PRHE 2LAAA 3INUL 4JJ5A 4YDIH 1DQLH 4OIIH 2BP3A 2DKSA 4OD1L 4FTVE 2VL5A 1M05A 4MQSB 4UNTA 1CVRA 4L4TA 4XNYH 1INEL 3CSPA 1WV7T 1I8IA 5TE4L 5AD0A 2I26N 4MAUL 2NW2B 4N8CL 4MA3B 4DW2H 1M4KA 4TVSa 2XKUA 1H3GA 3SDAA 4TVPD 4LCWD 1WICA 1X5KA 3DMMD 35C8H 4PS4H 5IBUB 5J6HA 2X89A 3V5KA 4CGTA 1Z2KA 1AKJA 1NJ9A 2VLLB 4RBPH 4MNQD 4P2QD 2OR9L 5F89A 5DEGA 1CDHA 3QPQC 3NPSC 1I8MA 5B8CC 3UBXB 4GG6F 5C6TL 3CMGA 4OD1H 1DBBL 2IMMA 3QO0B 1CWVA 3ULVE 5F1IB 4CAGA 5C0ND 4B53A 4NDMB 4LRNL 4GS7B 5D2LF 5F6IC 1INEH 3K1DA 2EYRB 1MFCL 4LU5L 4J8RB 1EK3A 1FV1A 3ISWA 5TE4H 2VISB 4QHMA 1RZJL 1TVBA 2Z9TA <