1KQ5A

C-terminal domain of cyclase associated protein with pro 505 replaced by ser (p505s)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
156
structure length
156
Chain Sequence
MPPRKELVGNKWFIENYENETESLVIDANKDESIFIGKCSQVLVQIKGKVNAISLSETESCSVVLDSSISGMDVIKSNKFGIQVNHSLPQISIDKSDGGNIYLSKESLNTEIYTSCSTAINVNLPIGEDDDYVEFPISEQMKHSFADGKFKSAVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mutant Structures of the Actin-binding Domain of Cyclase Associated Protein (CAP) from Saccharomyces Cerevisiae
rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
molecule keywords Adenylyl cyclase-associated protein
total genus 46
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 1kq5A00
2BX6A 1HF2A 3BH6B 4V02C 1K8FA 1KQ5A 2YUHA 1K4ZA 2B0RA 3BH7B
chains in the Genus database with same CATH superfamily
4U49A 3BH6B 4EW9A 3N6ZA 1JRGA 1O8FA 1QRBA 4URRA 1O8GA 3SZEA 1O88A 2PECA 2XTXA 3SUCA 4OZYA 2QX3A 4XR6A 3T9GA 5JLVC 1OFDA 2O1DA 4C2LA 3PSSA 1QA3A 2NTBA 3VMVA 1OFLA 4PMHA 2NTQA 4OJPA 4XLCA 1LM1A 1QQ1A 3TH0A 1OOCA 1OFEA 1QRCA 2EWEA 2NT6A 4KH3A 4XLFA 2X3HA 2VJIA 2Z8GA 3GQ8A 3ZPPA 1L1IA 2NTPA 4XN3A 2O04A 2O6WA 3H09A 3KRGA 1OGOX 4Z05A 5AMVA 5C1CA 1PE9A 2VBEA 3B90A 4YCQA 4W8RA 1O8LA 2VFQA 4OJOA 1BHEA 1O8IA 2QY1A 1TSPA 3ML3A 3PSZA 3UW0A 4OJ5A 4XN0A 4Z06A 3ZSCA 2VBMA 4I84A 2O0WA 2BSPA 2V5IA 3VSVA 4W8QA 4HWVA 4XNFA 4YDTA 3RIQA 3VSUA 1KCCA 4OZZA 1EA0A 2PYHA 1TYXA 1IA5A 1QJVA 1H80A 4W8SA 3GQAA 1IDKA 4XKWA 5C1EA 3LMWA 1K4ZA 1HG8A 1QCXA 4MR0A 1LLWA 1O8KA 2XTWA 1O8JA 2J8KA 2O17A 2QXZA 3NAWA 2XTYA 2IOUG 4YZAA 4YFOA 4JRAC 1TYUA 4YZXA 4XLAA 1OFMA 2F3LA 4XM3A 3BH7B 4YZ0A 1AIRA 3DU1X 4YEIA 1O8DA 1EZGA 3EQNA 2BX6A 2UVFA 1PLUA 2X6YA 2B0RA 2VFNA 3N90A 4XLEA 3SYJA 1LLZA 3LJYA 3JURA 1K8FA 4NK8A 3GRHA 2NSTA 4W8TA 1GQ8A 2BM7A 2VJJA 3JX8A 2ODLA 1DBGA 4YZQA 1CZFA 3SY2A 1CLWA 1BN8A 3VSTA 1O8EA 2NT9A 3GQ7A 1K5CA 4XONA 2X6XA 2VFPA 1RWRA 4XQFA 1DABA 1DBOA 4XKVA 3B8YA 3AK5A 4OJ6A 1OGMX 2J8IA 1HF2A 2X6WA 2XT2A 4NK6A 4AVZA 2X85A 4XOTA 3EQOA 2G0YA 3B4NA 2UVEA 1XG2A 4OPWA 2XT4A 4OM9A 4XL9A 1IB4A 5JMCB 1EE6A 2IQ7A 1QA2A 2QZAA 4OJLA 2INVA 2BM5A 1X0CA 2NSPA 1QA1A 4YELA 2PYGA 1TYVA 4V02C 2BM4A 3GQ9A 2VFOA 2NZMA 1O8MA 1PXZA 1JTAA 4U4BA 1VBLA 4YEJA 1WXRA 1KCDA 4YC5A 3PETA 1KTWA 3NB2A 4XOPA 1KQ5A 4XMYA 3P4GA 2BM6A 1TYWA 2XC1A 1O8HA 3FY3A 1RMGA 1RU4A 2O0VA 5DNSA 4XORA 3VMWA 2W7ZA 4XLHA 3LYCA 2YUHA 2VFMA 1NHCA 1IDJA 3SQVA 2QYUA 4MXNA 2INUA 2VBKA 4Z03A 3WWGA 1WMRA
chains in the Genus database with same CATH topology
4OM9A 2BX6A 2VFQA 3BH6B 5JMCB 3N6ZA 1QA2A 1QRBA 4OJOA 3ML3A 3N90A 1TSPA 2B0RA 2VFNA 4OJLA 3SZEA 4OJ5A 2BM5A 3SYJA 3LJYA 1QA1A 2V5IA 1TYVA 4V02C 1K8FA 3RIQA 5JLVC 2BM4A 2VFOA 1TYXA 1WXRA 2BM7A 1QA3A 3JX8A 3PETA 4OJPA 1CLWA 1KQ5A 1K4ZA 1QQ1A 2BM6A 1TYWA 2VFPA 2XC1A 3P4GA 1QRCA 3TH0A 4KH3A 1DABA 3AK5A 4OJ6A 2W7ZA 2J8IA 1HF2A 2IOUG 2YUHA 2VFMA 4JRAC 1TYUA 2F3LA 2G0YA 3H09A 3BH7B 3LYCA 4OPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BX6 A;  1HF2 A;  3BH6 B;  4V02 C;  1K8F A;  1KQ5 A;  2YUH A;  1K4Z A;  2B0R A;  3BH7 B; 
#chains in the Genus database with same CATH topology
 4U49 A;  3BH6 B;  4EW9 A;  3N6Z A;  1JRG A;  1O8F A;  1QRB A;  4URR A;  1O8G A;  3SZE A;  1O88 A;  2PEC A;  2XTX A;  3SUC A;  4OZY A;  2QX3 A;  4XR6 A;  3T9G A;  5JLV C;  1OFD A;  2O1D A;  4C2L A;  3PSS A;  1QA3 A;  2NTB A;  3VMV A;  1OFL A;  4PMH A;  2NTQ A;  4OJP A;  4XLC A;  1LM1 A;  1QQ1 A;  3TH0 A;  1OOC A;  1OFE A;  1QRC A;  2EWE A;  2NT6 A;  4KH3 A;  4XLF A;  2X3H A;  2VJI A;  2Z8G A;  3GQ8 A;  3ZPP A;  1L1I A;  2NTP A;  4XN3 A;  2O04 A;  2O6W A;  3H09 A;  3KRG A;  1OGO X;  4Z05 A;  5AMV A;  5C1C A;  1PE9 A;  2VBE A;  3B90 A;  4YCQ A;  4W8R A;  1O8L A;  2VFQ A;  4OJO A;  1BHE A;  1O8I A;  2QY1 A;  1TSP A;  3ML3 A;  3PSZ A;  3UW0 A;  4OJ5 A;  4XN0 A;  4Z06 A;  3ZSC A;  2VBM A;  4I84 A;  2O0W A;  2BSP A;  2V5I A;  3VSV A;  4W8Q A;  4HWV A;  4XNF A;  4YDT A;  3RIQ A;  3VSU A;  1KCC A;  4OZZ A;  1EA0 A;  2PYH A;  1TYX A;  1IA5 A;  1QJV A;  1H80 A;  4W8S A;  3GQA A;  1IDK A;  4XKW A;  5C1E A;  3LMW A;  1K4Z A;  1HG8 A;  1QCX A;  4MR0 A;  1LLW A;  1O8K A;  2XTW A;  1O8J A;  2J8K A;  2O17 A;  2QXZ A;  3NAW A;  2XTY A;  2IOU G;  4YZA A;  4YFO A;  4JRA C;  1TYU A;  4YZX A;  4XLA A;  1OFM A;  2F3L A;  4XM3 A;  3BH7 B;  4YZ0 A;  1AIR A;  3DU1 X;  4YEI A;  1O8D A;  1EZG A;  3EQN A;  2BX6 A;  2UVF A;  1PLU A;  2X6Y A;  2B0R A;  2VFN A;  3N90 A;  4XLE A;  3SYJ A;  1LLZ A;  3LJY A;  3JUR A;  1K8F A;  4NK8 A;  3GRH A;  2NST A;  4W8T A;  1GQ8 A;  2BM7 A;  2VJJ A;  3JX8 A;  2ODL A;  1DBG A;  4YZQ A;  1CZF A;  3SY2 A;  1CLW A;  1BN8 A;  3VST A;  1O8E A;  2NT9 A;  3GQ7 A;  1K5C A;  4XON A;  2X6X A;  2VFP A;  1RWR A;  4XQF A;  1DAB A;  1DBO A;  4XKV A;  3B8Y A;  3AK5 A;  4OJ6 A;  1OGM X;  2J8I A;  1HF2 A;  2X6W A;  2XT2 A;  4NK6 A;  4AVZ A;  2X85 A;  4XOT A;  3EQO A;  2G0Y A;  3B4N A;  2UVE A;  1XG2 A;  4OPW A;  2XT4 A;  4OM9 A;  4XL9 A;  1IB4 A;  5JMC B;  1EE6 A;  2IQ7 A;  1QA2 A;  2QZA A;  4OJL A;  2INV A;  2BM5 A;  1X0C A;  2NSP A;  1QA1 A;  4YEL A;  2PYG A;  1TYV A;  4V02 C;  2BM4 A;  3GQ9 A;  2VFO A;  2NZM A;  1O8M A;  1PXZ A;  1JTA A;  4U4B A;  1VBL A;  4YEJ A;  1WXR A;  1KCD A;  4YC5 A;  3PET A;  1KTW A;  3NB2 A;  4XOP A;  1KQ5 A;  4XMY A;  3P4G A;  2BM6 A;  1TYW A;  2XC1 A;  1O8H A;  3FY3 A;  1RMG A;  1RU4 A;  2O0V A;  5DNS A;  4XOR A;  3VMW A;  2W7Z A;  4XLH A;  3LYC A;  2YUH A;  2VFM A;  1NHC A;  1IDJ A;  3SQV A;  2QYU A;  4MXN A;  2INU A;  2VBK A;  4Z03 A;  3WWG A;  1WMR A; 
#chains in the Genus database with same CATH homology
 4OM9 A;  2BX6 A;  2VFQ A;  3BH6 B;  5JMC B;  3N6Z A;  1QA2 A;  1QRB A;  4OJO A;  3ML3 A;  3N90 A;  1TSP A;  2B0R A;  2VFN A;  4OJL A;  3SZE A;  4OJ5 A;  2BM5 A;  3SYJ A;  3LJY A;  1QA1 A;  2V5I A;  1TYV A;  4V02 C;  1K8F A;  3RIQ A;  5JLV C;  2BM4 A;  2VFO A;  1TYX A;  1WXR A;  2BM7 A;  1QA3 A;  3JX8 A;  3PET A;  4OJP A;  1CLW A;  1KQ5 A;  1K4Z A;  1QQ1 A;  2BM6 A;  1TYW A;  2VFP A;  2XC1 A;  3P4G A;  1QRC A;  3TH0 A;  4KH3 A;  1DAB A;  3AK5 A;  4OJ6 A;  2W7Z A;  2J8I A;  1HF2 A;  2IOU G;  2YUH A;  2VFM A;  4JRA C;  1TYU A;  2F3L A;  2G0Y A;  3H09 A;  3BH7 B;  3LYC A;  4OPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...