1KQ5A

C-terminal domain of cyclase associated protein with pro 505 replaced by ser (p505s)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
156
structure length
156
Chain Sequence
MPPRKELVGNKWFIENYENETESLVIDANKDESIFIGKCSQVLVQIKGKVNAISLSETESCSVVLDSSISGMDVIKSNKFGIQVNHSLPQISIDKSDGGNIYLSKESLNTEIYTSCSTAINVNLPIGEDDDYVEFPISEQMKHSFADGKFKSAVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Adenylyl cyclase-associated protein
publication title Mutant Structures of the Actin-binding Domain of Cyclase Associated Protein (CAP) from Saccharomyces Cerevisiae
rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 46
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 1kq5A00
3BH6B 1K8FA 1KQ5A 2B0RA 3BH7B 4V02C 1HF2A 2YUHA 2BX6A 1K4ZA
chains in the Genus database with same CATH superfamily
3BH6B 4OJPA 3UW0A 1LLZA 1KQ5A 4NK8A 4XM3A 2VFNA 2VBEA 4YZAA 1O88A 1PLUA 1OGMX 1OFMA 2V5IA 2X6YA 1RMGA 2Z8GA 4XKVA 2O6WA 3KRGA 2VJJA 4OM9A 4Z03A 1IB4A 2B0RA 4XOTA 4YEIA 1PXZA 2XT4A 5C1CA 3PETA 5JMCB 3LYCA 2QX3A 1CLWA 4V02C 2BSPA 3FY3A 2BM4A 3H09A 4XKWA 5AMVA 1WXRA 2QXZA 4XLFA 3B90A 3P4GA 4YFOA 3VMVA 4YZ0A 4XN0A 1IDJA 3LMWA 4JRAC 4XR6A 1O8KA 2BM7A 1OOCA 4NK6A 1LLWA 2QYUA 2YUHA 2NSPA 3LJYA 4MXNA 2O0WA 3VSVA 2O0VA 2J8IA 2O1DA 2INVA 4MR0A 2VBMA 2QZAA 1KTWA 1O8HA 4YEJA 4XOPA 4XNFA 5DNSA 3B8YA 1CZFA 4XMYA 4HWVA 1TYXA 3EQNA 4W8RA 1OGOX 2VBKA 1RU4A 3EQOA 1LM1A 3GRHA 4XQFA 2NT6A 4OJ6A 1K4ZA 4URRA 5JLVC 3N90A 1IA5A 4OZZA 4OJOA 2X6WA 4YZXA 3ZSCA 4W8SA 3GQ7A 1KCCA 4OZYA 2VJIA 4XLEA 1OFDA 2NSTA 2XT2A 5C1EA 3SUCA 1K8FA 2QY1A 3NB2A 3SQVA 1BN8A 1O8MA 4U49A 4I84A 3AK5A 1GQ8A 2NT9A 2VFPA 4XLCA 1JRGA 4XLHA 4YCQA 3NAWA 2XTWA 3TH0A 3JURA 1O8GA 4OJLA 1WMRA 3VSTA 2XTYA 4XLAA 3SYJA 1IDKA 2BM5A 2W7ZA 4AVZA 2O04A 2UVEA 2G0YA 1QA2A 1XG2A 3VMWA 1DBOA 2NTPA 2X85A 1HG8A 2INUA 1HF2A 1QJVA 4PMHA 3SZEA 4YELA 1PE9A 3N6ZA 4OPWA 2EWEA 1DBGA 3T9GA 1DABA 4XONA 1O8IA 1TYUA 2J8KA 1RWRA 1QRBA 3DU1X 2UVFA 1O8LA 1K5CA 1OFLA 2IOUG 1TSPA 1H80A 1TYVA 2X3HA 3PSSA 4YC5A 4YDTA 1L1IA 3ML3A 4W8TA 3VSUA 1QCXA 2XTXA 3GQ9A 1O8FA 3ZPPA 3GQ8A 4XORA 3PSZA 4EW9A 4Z05A 1BHEA 1TYWA 2IQ7A 2NZMA 2ODLA 1KCDA 3WWGA 2BM6A 2NTQA 3B4NA 3GQAA 1NHCA 1EZGA 2PECA 2PYHA 2O17A 4XL9A 2XC1A 2VFOA 1QQ1A 4KH3A 1EE6A 2PYGA 1O8DA 2VFQA 3RIQA 1EA0A 4U4BA 1QA1A 1JTAA 1AIRA 3BH7B 1QA3A 4OJ5A 2VFMA 2NTBA 1O8JA 4Z06A 3SY2A 1OFEA 1QRCA 3JX8A 2F3LA 1O8EA 1X0CA 4W8QA 1VBLA 4C2LA 4XN3A 4YZQA 2BX6A 2X6XA
chains in the Genus database with same CATH topology
2J8IA 3BH6B 4OJPA 3TH0A 4OJLA 1TYWA 1KQ5A 3SYJA 2BM6A 2BM5A 2VFNA 2W7ZA 2G0YA 2V5IA 3LJYA 1QA2A 4OM9A 1TYXA 2XC1A 2VFOA 2B0RA 1QQ1A 4KH3A 1HF2A 2VFQA 3RIQA 3SZEA 4OJ6A 3N6ZA 4OPWA 1QA1A 1K4ZA 3PETA 5JLVC 5JMCB 3LYCA 3N90A 4OJOA 1QA3A 3BH7B 1CLWA 4V02C 1DABA 4OJ5A 2VFMA 2BM4A 3H09A 1TYUA 1WXRA 1QRBA 1QRCA 3JX8A 2IOUG 1TSPA 1TYVA 3P4GA 1K8FA 3ML3A 2F3LA 4JRAC 2BM7A 3AK5A 2VFPA 2YUHA 2BX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BH6 B;  1K8F A;  1KQ5 A;  2B0R A;  3BH7 B;  4V02 C;  1HF2 A;  2YUH A;  2BX6 A;  1K4Z A; 
#chains in the Genus database with same CATH topology
 3BH6 B;  4OJP A;  3UW0 A;  1LLZ A;  1KQ5 A;  4NK8 A;  4XM3 A;  2VFN A;  2VBE A;  4YZA A;  1O88 A;  1PLU A;  1OGM X;  1OFM A;  2V5I A;  2X6Y A;  1RMG A;  2Z8G A;  4XKV A;  2O6W A;  3KRG A;  2VJJ A;  4OM9 A;  4Z03 A;  1IB4 A;  2B0R A;  4XOT A;  4YEI A;  1PXZ A;  2XT4 A;  5C1C A;  3PET A;  5JMC B;  3LYC A;  2QX3 A;  1CLW A;  4V02 C;  2BSP A;  3FY3 A;  2BM4 A;  3H09 A;  4XKW A;  5AMV A;  1WXR A;  2QXZ A;  4XLF A;  3B90 A;  3P4G A;  4YFO A;  3VMV A;  4YZ0 A;  4XN0 A;  1IDJ A;  3LMW A;  4JRA C;  4XR6 A;  1O8K A;  2BM7 A;  1OOC A;  4NK6 A;  1LLW A;  2QYU A;  2YUH A;  2NSP A;  3LJY A;  4MXN A;  2O0W A;  3VSV A;  2O0V A;  2J8I A;  2O1D A;  2INV A;  4MR0 A;  2VBM A;  2QZA A;  1KTW A;  1O8H A;  4YEJ A;  4XOP A;  4XNF A;  5DNS A;  3B8Y A;  1CZF A;  4XMY A;  4HWV A;  1TYX A;  3EQN A;  4W8R A;  1OGO X;  2VBK A;  1RU4 A;  3EQO A;  1LM1 A;  3GRH A;  4XQF A;  2NT6 A;  4OJ6 A;  1K4Z A;  4URR A;  5JLV C;  3N90 A;  1IA5 A;  4OZZ A;  4OJO A;  2X6W A;  4YZX A;  3ZSC A;  4W8S A;  3GQ7 A;  1KCC A;  4OZY A;  2VJI A;  4XLE A;  1OFD A;  2NST A;  2XT2 A;  5C1E A;  3SUC A;  1K8F A;  2QY1 A;  3NB2 A;  3SQV A;  1BN8 A;  1O8M A;  4U49 A;  4I84 A;  3AK5 A;  1GQ8 A;  2NT9 A;  2VFP A;  4XLC A;  1JRG A;  4XLH A;  4YCQ A;  3NAW A;  2XTW A;  3TH0 A;  3JUR A;  1O8G A;  4OJL A;  1WMR A;  3VST A;  2XTY A;  4XLA A;  3SYJ A;  1IDK A;  2BM5 A;  2W7Z A;  4AVZ A;  2O04 A;  2UVE A;  2G0Y A;  1QA2 A;  1XG2 A;  3VMW A;  1DBO A;  2NTP A;  2X85 A;  1HG8 A;  2INU A;  1HF2 A;  1QJV A;  4PMH A;  3SZE A;  4YEL A;  1PE9 A;  3N6Z A;  4OPW A;  2EWE A;  1DBG A;  3T9G A;  1DAB A;  4XON A;  1O8I A;  1TYU A;  2J8K A;  1RWR A;  1QRB A;  3DU1 X;  2UVF A;  1O8L A;  1K5C A;  1OFL A;  2IOU G;  1TSP A;  1H80 A;  1TYV A;  2X3H A;  3PSS A;  4YC5 A;  4YDT A;  1L1I A;  3ML3 A;  4W8T A;  3VSU A;  1QCX A;  2XTX A;  3GQ9 A;  1O8F A;  3ZPP A;  3GQ8 A;  4XOR A;  3PSZ A;  4EW9 A;  4Z05 A;  1BHE A;  1TYW A;  2IQ7 A;  2NZM A;  2ODL A;  1KCD A;  3WWG A;  2BM6 A;  2NTQ A;  3B4N A;  3GQA A;  1NHC A;  1EZG A;  2PEC A;  2PYH A;  2O17 A;  4XL9 A;  2XC1 A;  2VFO A;  1QQ1 A;  4KH3 A;  1EE6 A;  2PYG A;  1O8D A;  2VFQ A;  3RIQ A;  1EA0 A;  4U4B A;  1QA1 A;  1JTA A;  1AIR A;  3BH7 B;  1QA3 A;  4OJ5 A;  2VFM A;  2NTB A;  1O8J A;  4Z06 A;  3SY2 A;  1OFE A;  1QRC A;  3JX8 A;  2F3L A;  1O8E A;  1X0C A;  4W8Q A;  1VBL A;  4C2L A;  4XN3 A;  4YZQ A;  2BX6 A;  2X6X A; 
#chains in the Genus database with same CATH homology
 2J8I A;  3BH6 B;  4OJP A;  3TH0 A;  4OJL A;  1TYW A;  1KQ5 A;  3SYJ A;  2BM6 A;  2BM5 A;  2VFN A;  2W7Z A;  2G0Y A;  2V5I A;  3LJY A;  1QA2 A;  4OM9 A;  1TYX A;  2XC1 A;  2VFO A;  2B0R A;  1QQ1 A;  4KH3 A;  1HF2 A;  2VFQ A;  3RIQ A;  3SZE A;  4OJ6 A;  3N6Z A;  4OPW A;  1QA1 A;  1K4Z A;  3PET A;  5JLV C;  5JMC B;  3LYC A;  3N90 A;  4OJO A;  1QA3 A;  3BH7 B;  1CLW A;  4V02 C;  1DAB A;  4OJ5 A;  2VFM A;  2BM4 A;  3H09 A;  1TYU A;  1WXR A;  1QRB A;  1QRC A;  3JX8 A;  2IOU G;  1TSP A;  1TYV A;  3P4G A;  1K8F A;  3ML3 A;  2F3L A;  4JRA C;  2BM7 A;  3AK5 A;  2VFP A;  2YUH A;  2BX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...