1KQLA

Crystal structure of the c-terminal region of striated muscle alpha-tropomyosin at 2.7 angstrom resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
55
structure length
55
Chain Sequence
MDKVEELLSKNYHLENEVARLKKLVDDLEDELYAQKLKYKAISEELDHALNDMTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of the C-terminal fragment of striated-muscle alpha-tropomyosin reveals a key troponin T recognition site.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
molecule keywords Fusion Protein of and striated muscle alpha-tropomyosin and
total genus 22
structure length 55
sequence length 55
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1kqlA00
1H8AA 3NXSA 2YO3A 2P67A 3V5BA 4AQRD 1HJBA 5APTA 4C46A 3TNUA 2Q3IA 2WWWA 2W27A 1T2KC 2XU6A 2R32A 2QM7A 1CI6B 5AVYB 1T2KD 4AYCA 5APQA 3VMZA 2E42A 1HWTC 1MUUA 1S9KE 1HBWA 1OWAA 4M3LA 4LC1A 3P32A 3HE4B 1KQLA 2C9NY 5AVQB 3LIDA 5AW7B 3UIAA 1DH3A 5APUA 5AW0B 4EOTA 5AW4B 1MV8A 3IR9A 4XE5B 5AW6B 5AVZB 3A5TA 1JNMA 2WT7A 1GU4A 2E43A 2P7JA 2C9LY 2KP8A 5APXA 3VTPC 3I5CA 3A3YB 1NAFA 2Z5HA 5AVXB 3P7KA 1GZLA 2YO2A 1GK4A 3VMYA 3KDPB 4KHXA 5CMZA 4DZOA 3VMXA 3NFQA 2H7HA 3V4QA 2W6AA 2N9BA 3HE5A 5AVTB 5AVWB 3M9HA 3V4WA 3KQGA 3M0AA 1NWQA 2P2UA 5APSA 1MFZA 4B86A 1A02J 5AVUB 5AW9B 1S9KD 1GK6A 3TYYA 2Q7CA 2BASA 2Q5UA 2VRSA 3O8ZA 1GTWA 2XV5A 2WPSA 5APWA 4I2LC 1X8YA 3P8MC 4JYCA 1J2JB 1IO4A 3NMDA 2WTYA 3B8EB 3T97A 1GD2E 1CI6A 3MGNA 5AW1B 4JYBA 3NTNA 1H88A 5AVRB 4RESB 3L35A 2QM8A 3TNUB 1FOSE 3M9BA 5AW3B 4C7NA 3HE5B 1JUNA 3A7OA 2JJLA 1YYCA 3HE4A 5AW5B 4GKGA 3M06A 1HUCA 3M91A 4GT1A 3VN0A 2WPRA 4HYTB 4C7NB 5APYA 1H89A 1GU5A 1A02F 3L37A 5AW2B 3L36A 2IPPA 2R5BA 3A2AA 5AVVB 2R5DA 2YNYA 1CSBA 5AVSB 3VYIA 1G2CB 1FOSF 1FAVA 2ZXEB 3M0DA 4AUWA 4I6MC 3MD0A 1CZQA 2ZFCA 3TK1A 5AW8B 1SP4A 3LIEA 3OAKA 2WT7B 1OXZA 2Z5IA 1SLQA 2R3CA 5APVA 3HTKA 3SWFA 2WPQA 2XZRA
chains in the Genus database with same CATH superfamily
5TISH 4K3AA 3KXDA 1FBMA 3NXSA 3RL0C 2P67A 1HH0A 1QL2A 2IBZI 3RL0B 2FXOA 4D6TD 1P84H 1HJBA 3SSUA 5K5GB 3M9QA 1LTTC 3TNUA 2E5TA 3G3ZA 1L0LD 2I1JA 1KB9E 5CCHC 1Q7YQ 5CCGD 1PP9D 2XU6A 3BRTB 3IF4A 3MIWA 3CD6P 2QM7A 1VQKP 5KLVJ 1WRGA 2WSFJ 3VMZA 3AEAC 3GMAA 3KZIH 1OMIA 5BU8B 2Q9IA 3H1JG 3E1RA 2KNCB 4IFFA 4IOIH 1VL2A 1VQPP 1S9KE 1YHQP 3BCCJ 3CCVP 2G8YA 1SQXK 4M3LA 2NPSC 1NTKJ 2E75C 3HE4B 1J1EB 1KQLA 3CCSP 4PV1B 4H13C 3H6PA 1QVFO 2A06D 3B5ND 2PRRA 1NTZK 1VDFA 2L5GB 3UIAA 2B87A 3F89A 2A45G 3L73G 4H13B 5AW0B 1MV8A 3IR9A 2FFDB 2OQQA 2QG4A 1NKZB 5H2FH 3QH9A 2H89C 4XFJA 5KJ7D 1EXJA 2QEXP 1FDIA 3JCUH 3VOPA 1PFIA 3GG2A 1SQQG 4TLFA 4OH8B 3VTPC 3HD7B 1LTJA 3A3YB 1HVVA 4DJGA 2Y9YA 1EZVD 1PP9E 3P7KA 5AVXB 3M0DC 1IZNB 2V4HA 2OYHC 1QVGO 4EDFA 3L70J 3PRJA 3L73J 4H0LD 4N78D 1KV4A 2H7HA 3C1LA 3RL0g 2AXCA 2RKLA 2N9BA 1L2PA 2JEEA 5AVWB 1YJNP 1Q2NA 2HYNA 2KSEA 4IFMA 3V4WA 1NOHA 2FBWC 3L71D 4XA4A 2CPSA 1EZVG 1YJWP 1M8OB 1L0NG 1SQQD 1AV1A 3CI9A 3L75J 4BRYB 1LJ2A 2M0BA 5TISE 2VRSA 1N7SB 1FJKA 3L72J 1GTWA 1SQBD 3MP7B 2XV5A 2WPSA 3RK2C 3FX0A 1K9MQ 1M1KQ 3AE8C 4JYCA 3E1IA 1JM0A 1BSNA 3B8EB 1GD2E 1CI6A 2IX7C 2K1AA 2KS1A 1LT1A 1SQVK 2AEMA 2O01J 5AW1B 2YKPA 5C39A 2HODB 4JQ0D 3CCMP 2QJKB 3Q1MA 1S72P 1KMIZ 1VQLP 3TNUB 3Q5SA 4JPZB 1FZFA 2KI7B 2RMZA 3H1ID 1URQA 2YMKA 3PP5A 4UB6H 4WWIA 3CPWO 1JMMA 1FC2C 1NKNA 3HE5B 4PJ0E 5CCHA 2HLOA 4H0LC 2N9YB 1HUCA 3H1IJ 2JDIH 2OTLP 1L0LG 3M91A 3L72D 4DT0A 1P84E 2KOGA 3CWBG 4C7NB 3CX5E 1SVFA 5KAFE 1ZR4A 3H1JE 3H1HD 2Z4EA 1GU5A 1KYOH 1QL1A 2D2CD 1KB9H 2MKVA 3EQ2A 1Q90D 2WQYC 3GF7A 2HODA 1IJDB 2FYZA 2MJZA 1XTCC 2IPPA 1RF0C 3SFDC 1KILA 2FXMA 1L4AA 2A06E 2YNYA 2Q6QA 3CXHD 4O9BA 1VQNP 1G2CB 2N1TA 1KB9I 3L74D 1WT6A 1KYOI 2H88C 1NTKG 2Q3EA 2ZXEB 3G9RA 3HD7A 4D6TJ 4PD4I 3CWBE 2E74D 3P8CE 4JF7A 3TK1A 3ABVC 1AJYA 2M8RA 4CPGA 3GLMA 2IBZE 4KJMA 2E75D 1W5CE 2K9JA 2NPSD 3KPEA 3Q5PA 1DIPA 5APVA 2IZ1A 1YIJP 3HTKA 3A0HE 1SQVJ 3E7KA 2XZRA 3CCQP 1H8AA 2K37A 4HKZH 1OW8A 3U1AA 3S4RA 2W6BA 1VF5D 5EFWB 3RK3C 2QJKC 2UWJE 1L4AB 2R3SA 2W6JH 3L75D 1LTJB 1YTZI 1X0TA 1LP1A 2N1TB 3RK3B 2SPZA 2WZ7A 1EQ7A 1SQXE 1FDMA 2P58A 1YTZT 3QWOC 3S1KA 2R32A 1LTJC 1K8AQ 1G1IA 4IL6H 1QGKB 2PGDA 2ZT9B 3RL0D 2XNXA 3V6IA 3H1KE 4AYCA 4OGQC 2HPCB 1EXIA 3WMM0 1OVUA 1RE4C 3WUVA 2OYIA 1HWTC 3D6ZA 2QE7H 1U7JA 3TGUG 1HF9A 3BVHA 3EWKA 1SQQJ 1JMBA 1OWAA 2RH0A 2KB7P 4BWNA 3D70A 2A45I 4H44B 3H1KJ 4QMAA 3R4YA 3A0BE 1JTHB 1M7LA 3LIDA 2H8PD 1N73A 3CCRP 4C7RA 2R44A 3H1KG 4EOTA 3HUSB 5AVZB 1JNMA 1KILB 5GTHE 2O01N 3L70G 1ZRTE 2IBZG 1IFIA 2ZVNB 5M1BA 1MFTA 2ZYGA 3TGUJ 1KYOE 2P1JA 3AE7C 4Y99C 1LTSC 1BGYG 2KP8A 2PAJA 5APXA 2C9LY 2KS1B 1BDDA 1T8ZA 2IBZD 1JB0J 5CHXA 2FYUE 2H43A 3I55P 3CCUP 1NTZJ 1OW7A 2HG5D 1LNQA 1HGZA 3VMAA 1N73C 2AEFA 4KHXA 3V2RA 2KSJA 4R4LA 2OTKE 2WSCJ 3NFQA 2V7QH 4WY4C 4ZMDA 2Q1KA 1LTAC 2L91A 3V4QA 2W6AA 1H0TB 3HE5A 2FYUK 5L8RJ 4D6TE 3HUSA 1N7LA 1N86A 1IK9A 2K9YA 3BATA 4NPEA 4WY4B 5KLVD 1NWQA 5APSA 1MFZA 2N1TC 2E76B 1EZVE 4B86A 1A02J 5AVUB 1LTBC 1S9KD 5KAIH 2ZYAA 2Q7CA 1NTZG 2BASA 2RN0A 2E76C 1OIPA 2ZT9C 2G3AA 3H1HG 3H1JJ 5BVZA 3RBXA 1NJIQ 3CXHI 3VP8A 3SWYA 1X8YA 3MHVA 5KLVG 2NPSA 1KYOD 2DW3A 3NMDA 1RE3C 4U3FJ 2I8DA 3H1IE 3T97A 5B66H 5KTBA 3CXHE 3MGNA 2C0XA 1SQBK 3PHLA 1H88A 1T3JA 2V7QJ 1NTME 5CJ0A 3RGUA 1OVVA 1KQFB 3R2PA 1IFMA 1HJ0A 1NHLA 1EZVI 1EDIA 2FYUJ 4IL6X 2IDBA 3EFFK 1RQUA 2JJLA 1YYCA 2QA4P 1DD4A 1RE3A 2WSEJ 2E74B 3CL3D 3L70D 3M06A 4GKGA 3ITKA 4W7ZA 1YJ9P 1PGPA 2PP6A 3TSIA 3VN0A 1HTLC 1YQ4C 1LTIC 1S5LE 3H1KD 2O1KA 1JY3P 1UIXA 5APYA 1KQGB 1M1JC 1OFCX 4DCKA 5DJUB 5GTHH 1JCDA 3USSA 4I1LA 3OA7A 4H13D 3L75E 3L36A 3A2AA 3L74G 2B89A 1FS0E 1LT9C 2ZVOB 1KILE 3B4SA 4TT3H 2AEJA 1FAVA 1DD3A 3PTZA 3H25A 1T3UA 1LT9B 3M0DA 1SQVG 1FJPA 3N4XA 1R5LA 1QEXA 4WY4D 3V2QA 1L0LK 3V2NA 1S4XA 4W7YA 1SQXJ 5AW8B 1JY2P 3K5BA 3L70E 5CCGC 5CCHD 2WT7B 1OXZA 1K73Q 1USDA 3L75G 1SLQA 3HTKB 2GM4A 5DJTB 1ZW0A 1RF1C 1H0TA 3G71P 5KKZC 1BE3D 4RKUJ 1JO5A 1SQPJ 2WPQA 4ZKPA 3I56P 1LWUC 2Y0DA 3CCJP 1GL2B 1ZN5A 1BE3J 2GUSA 1PPJD 1SQPG 2Y0EA 1NTMD 3V5BA 1PV3A 4AQRD 4YTPC 3G4SP 1FZAA 1AFOA 1IFNA 3AEGC 2Q3IA 2WWWA 2QJPB 3HRNA 3MUDA 5KAFH 5B5EH 1VQ5P 1LTGC 1T2KC 4HB1A 2HPCA 2A06G 3W68A 1OVRA 3LW5H 2E43A 3CXHH 3L72G 1AQTA 3FGAD 5APQA 1NTKD 3CLQA 1T2KD 1NTKE 1L0LJ 2ZJSE 2NPSB 3N7NA 3CMAP 2B87B 4UB8H 1VQ4P 1ZMEC 3BCCE 1DX7A 1SQBG 4I7ZB 1HBWA 1BGYJ 1S2EA 1KB9D 4WY4A 5GTIE 4YXDC 3TF5A 3P32A 1L0NJ 2AXTE 1FU1A 1J1DC 1JTHA 1M1JB 3MTUE 1EDKA 3MZWB 4I7ZC 4WBAA 5KAIE 2IFMA 5KLVE 2FFDC 2E75B 3D6YA 5CBOA 1DH3A 5KLIB 2OYHA 4PD4E 1YBKA 1W2EA 2JKVA 4XE5B 1HGVA 1S5LH 1IFDA 2K9JB 3RK3D 1VF5C 2FY8A 2KIKA 1X9VA 4U3FG 1W2BO 1GU4A 3WUTA 5B66E 1P84D 1YITP 4ZKUA 1VF5B 4WB4A 1LT9A 3H1IG 2JP3A 1BGYE 2KZIA 3C8VA 3FXEA 1G2CA 1NAFA 2Z5HA 4HJGH 1EC5A 3S9OA 2FFDA 1IFPA 3CC2P 3GHGA 1L0LE 1QLED 1GK4A 1GL2A 2WITA 3CX5I 3HD7D 3KDPB 3RBZA 3VMYA 4L73A 1VQMP 3Q5RA 3B5NB 3GF3A 3C9IA 3Q2YA 3II6A 2B9BA 1NAYA 2QRXA 2JWDA 2ZYDA 3AEEC 3GW6A 3M9HA 1RY3A 3TDKA 4EIJA 3G6EP 3L73D 1GW4A 1BE3E 1ZXGA 2A45H 4ZNCA 4N78E 2ZXXA 5AW9B 2QJPC 2XNDH 1GK6A 1Y47A 2NZ2A 3L71J 3O8ZA 2Q5UA 3A0BH 1SQPE 1BCCD 1RE4A 2YMYA 1VQ9P 2OGUA 1JCCA 1OZHA 4I2LC 2HFED 4L76A 1LP1B 5CCGA 1LGHB 3L71G 2W90A 1QX8A 1R5SA 3SFEC 3ZDMA 2WSEH 4D6TG 4YXWH 4IL6E 3RK2B 2GA1A 1PP9G 1FE6A 1J1EC 5B5EE 1PGQA 3L73E 1J1DB 1N2DC 1JY3O 2XDJA 5AVRB 1VQ8P 1L0NE 1N8RQ 2POHA 2QIWA 3OJAB 2YKOA 1PP9J 1Z56A 1NH4A 5AW3B 2KXPB 1RQVA 3FWLA 4UB8E 2J58A 2ZT9D 4H0LB 2E76D 2KLVA 5GTIH 1VQ6P 1NU1J 3HE4A 2M3BA 1L0NK 1U57A 4MN4C 5AW5B 2QJYC 4GDOA 1VQ7P 2I1KA 3HD7C 1KFMA 1SQXD 2WPRA 1ZLLA 2QJYB 4PD4H 2XKMA 1NTMG 1AVYA 2YXQB 3AE1C 4GOFA 2YXRB 2LXCB 3H32B 4L75A 2YIUC 4RJTA 2KZJA 1S3JA 2E5YA 3L37A 3H1LE 2CK3H 3O6QA 5AVVB 2R5BA 4LLHA 3WU2H 3KZIE 1BE3G 2QSIA 1NVOA 3IFMA 4ASVA 3VYIA 1FOSF 1E79H 3H1JD 4H44D 3CC4P 1NTMJ 1XTGB 1SS1A 2KYVA 2P10A 1U7MA 2WSCH 2ZFCA 2WSFH 3L4FA 4HH2A 1OW6A 2LKMA 2M5AB 4U3FD 4U3FE 3SWKA 1SP4A 2WMMA 3LIEA 1SQVD 1N7SC 4K35A 3PJSK 2Z5IA 1AVOA 4A7PA 3AE3C 1S1CX 4DOJA 2R3CA 1RF0A 3AEFC 1N73B 2IFNA 2BCCG 3AEBC 1BDCA 4N6JA 2M5AA 1KTMA 1SQPK 1JY3N 2YO3A 1ZOYC 1Y8AA 2IZ0A 1RHZB 1TU3F 1PGOA 3EFGA 1NTKK 5APTA 3CX5D 3IN6A 1JY2O 1K05A 4C46A 1KQSO 1KORA 2ITAA 2W27A 1GMJA 1NU1K 1USEA 2BEQD 1N7SD 2IYOA 2KLUA 2C0WA 1MZ9A 2FXPA 3L72E 4OGQD 2FYUD 2JR8A 4W80A 5CBNA 1CI6B 5TJHA 1VQOP 5AVYB 5KLVK 1FZCC 2JWAA 2E42A 5CJ4A 3BRVB 1EDJA 1NTZE 1MUUA 1JY2N 1SQBE 1T6AA 2QVAA 1PPJG 1SQPD 1ZRTD 2ZAEB 4H44C 5KJ7A 4IFDK 4KT0J 3AE2C 1AQ5A 4LC1A 4DZOA 2C9NY 2WSSH 4UB6E 5AVQB 3WUUA 4PJ0H 3U1CA 2YIUB 3AE5C 2FYUG 3B5NA 5E79E 3SWFA 1SFCA 1M57D 3V2PA 4EI2A 1BSHA 2CPBA 5AW7B 5APUA 1X79B 3BASA 1NU1D 5AW4B 4BXLA 5AW6B 4NPFX 1RF1B 3VP9A 2WT7A 1G1JA 2OARA 5E79H 1UIIA 2P7JA 3CX5H 1GW3A 3HUSC 1NTZD 2E74C 3MUDC 1BCCE 3PH0A 3T97B 1KILC 1X22A 1NGMB 2O1JA 1S5LX 3I5CA 1SQQE 3GHGB 2BCCE 2O3JA 2Y0CA 3H1HJ 3PLNA 4WVZA 1JOCA 4Y99B 4N3YB 3WU2E 3TGUD 3CWBD 3P8CD 4EYYQ 1GZLA 2LR2A 2YO2A 5BU5A 3AE4C 2YKQA 3CMEP 5CMZA 2BEZF 3O6QB 3KHUA 2W83C 3F5HA 1PZQA 1URQD 4L74A 2FYNC 4NPDA 3VMXA 1ZR2A 1N7SA 1KD1Q 3LW5J 2D2CC 1SQQK 5AVTB 3L74J 2OYOA 2HR3A 1ZV8A 4LGDE 1RF1A 2FYNB 1IFJA 3H1LD 3KQGA 3M0AA 2M3EA 1L4AC 2J5UA 2P2UA 3Q3DA 2OTJP 3FXDA 1JEKA 2AXTH 2J59M 3BCCD 3AECC 1Q86Q 1BGYD 3A0HH 1DEBA 3H1LJ 4OWFA 3TYYA 3BCCG 2Y9ZA 1SQVE 4PV1D 3TGUE 1FZCB 1KN7A 1LWUA 1KC8Q 1OX3A 4OGQB 5APWA 1D7MA 1NO4A 3H1LG 2WPVB 3AE9C 3KYQA 3P8MC 1J2JB 1SQXG 1Y9BA 5H2FE 3RK3E 1IO4A 3L74E 2WTYA 4PD4D 1AA0A 1LWUB 1SFCD 4JYBA 3NTNA 1GL2C 3H32A 1P84I 1IC2A 1Q82Q 1FZGA 1CW5A 1NU1E 2JO1A 4RESB 4U7JA 1FDOA 3L35A 3W67A 1L0ND 2N1TD 2QM8A 1FOSE 1Q81Q 1WMKA 1MKMA 2WVRA 3M9BA 1DEEG 3JC22 1NYHA 4RO0A 3RK2D 1SFCB 2BCCJ 3H1HE 4ASWA 4R4MA 4C7NA 3CC7P 2KUBA 1E5WA 1BCCJ 1JUNA 3A7OA 1GL2D 3FWNA 1SFCC 2O01H 1K04A 4Z1MH 2PFXA 1NTMK 2KK7A 2BCCD 1PL5A 4GT1A 1PIXA 1VPCA 1NU1G 3GHGC 2OYIC 4HYTB 1M90Q 3B71A 1YI2P 1H89A 2K88A 2NRGA 3A5TA 3CCLP 3JCUE 4PV1C 4GODA 2OYIB 1BCCG 1PPJE 2GUVA 1A02F 1YQ3C 5AW2B 1IK7A 2LXBA 2W8ZA 3L71E 4GOEA 4Y28J 5KLIC 2R5DA 2D2CB 1L4AD 3IAOA 1CSBA 2FKWB 1PGJA 3AE6C 2IYPA 1SQBJ 5AVSB 1M56D 3CCEP 1FZCA 3AEDC 2B88A 4AUWA 1KZUB 4I6MC 3MD0A 1CZQA 4OVNF 1URQC 4JBZA 1ZP0C 1KFNA 3U59A 1RH5B 1M1JA 3CWBJ 4GIFA 5KJ7C 2K3RA 3OAKA 4BRYA 3D71A 1R8EA 5KKZB 1URQB 1FZBA 1GDTA 3OW2O 2OYHB 1FZEA 1EDLA 2KNCA 3JSVC 4YPCA 1KILD 3B5NC
chains in the Genus database with same CATH topology
3NXSA 1FBMA 3RL0C 2P67A 1HH0A 1QL2A 3RL0B 1HJBA 3M9QA 1LTTC 3TNUA 3G3ZA 2I1JA 5CCHC 5CCGD 2XU6A 3BRTB 3MIWA 2QM7A 1WRGA 3VMZA 5BU8B 1S9KE 1SQXK 4M3LA 2NPSC 3HE4B 1J1EB 1KQLA 3H6PA 3B5ND 1NTZK 1VDFA 2L5GB 3UIAA 2A45G 5AW0B 1MV8A 3IR9A 2FFDB 1NKZB 5KJ7D 3VOPA 1PFIA 3VTPC 4OH8B 3HD7B 1LTJA 3A3YB 1HVVA 5AVXB 3P7KA 3M0DC 2OYHC 4N78D 2H7HA 2N9BA 5AVWB 2JEEA 2HYNA 4IFMA 3V4WA 1NOHA 4XA4A 2CPSA 3CI9A 2VRSA 1N7SB 1FJKA 1GTWA 2XV5A 2WPSA 3RK2C 4JYCA 3E1IA 3B8EB 1GD2E 1CI6A 2IX7C 5AW1B 2Q9IA 1SQVK 2YKPA 2HODB 3TNUB 1FZFA 3PP5A 1URQA 1JMMA 1NKNA 3HE5B 5CCHA 2HLOA 1HUCA 3M91A 2KOGA 4C7NB 1ZR4A 1SVFA 2Z4EA 1GU5A 1QL1A 3EQ2A 2HODA 1IJDB 2FYZA 2MJZA 1XTCC 2IPPA 1RF0C 1KILA 2FXMA 1L4AA 2YNYA 4O9BA 1G2CB 2N1TA 1WT6A 2ZXEB 3HD7A 3P8CE 4JF7A 3TK1A 2M8RA 2NPSD 3KPEA 5APVA 3HTKA 2XZRA 1H8AA 3U1AA 2W6BA 3RK3C 1L4AB 1LTJB 1YTZI 2N1TB 3RK3B 2WZ7A 1EQ7A 1FDMA 1YTZT 2R32A 1LTJC 1G1IA 3RL0D 2XNXA 2HPCB 4AYCA 3WMM0 2OYIA 1RE4C 1HWTC 3BVHA 1OWAA 2KB7P 2A45I 1JTHB 1M7LA 3LIDA 2H8PD 1N73A 4C7RA 4EOTA 3HUSB 5AVZB 1JNMA 1KILB 1IFIA 3VP8A 1RF1C 2P1JA 4Y99C 1LTSC 2KP8A 2PAJA 5APXA 2C9LY 1T8ZA 5CHXA 2H43A 2HG5D 1HGZA 1N73C 3V2RA 4KHXA 2KSJA 3NFQA 4WY4C 1LTAC 3V4QA 2W6AA 3HE5A 2FYUK 3HUSA 1N7LA 1N86A 1IK9A 3BATA 4WY4B 1NWQA 5APSA 1MFZA 2N1TC 4B86A 1A02J 5AVUB 1LTBC 1S9KD 2Q7CA 2BASA 5BVZA 3SWYA 1X8YA 2NPSA 3NMDA 1RE3C 3T97A 5KTBA 3MGNA 2C0XA 1SQBK 1H88A 1T3JA 5CJ0A 3R2PA 1IFMA 1NHLA 2JJLA 1YYCA 1RE3A 4GKGA 3CL3D 3M06A 4W7ZA 2PP6A 3TSIA 3VN0A 1HTLC 1LTIC 2O1KA 1JY3P 5APYA 1M1JC 1JCDA 4I1LA 3OA7A 3L36A 3A2AA 1LT9C 1FAVA 1T3UA 1LT9B 3M0DA 1FJPA 3N4XA 3V2QA 4WY4D 1L0LK 3V2NA 4W7YA 5AW8B 1JY2P 5CCGC 2WT7B 5CCHD 1OXZA 1SLQA 3HTKB 2GM4A 2WPQA 4ZKPA 1LWUC 1GL2B 1ZN5A 2GUSA 3V5BA 4AQRD 1FZAA 1AFOA 1IFNA 3HRNA 2Q3IA 2WWWA 3MUDA 2HPCA 1LTGC 1T2KC 3LW5H 1T2KD 5APQA 3CLQA 2NPSB 3N7NA 1DX7A 1HBWA 4WY4A 3P32A 1FU1A 1J1DC 1JTHA 1M1JB 3MTUE 4WBAA 2IFMA 2FFDC 1DH3A 2OYHA 4XE5B 1W2EA 3A5TA 1HGVA 1IFDA 3RK3D 1GU4A 2E43A 1X9VA 4ZKUA 4WB4A 1LT9A 1G2CA 1NAFA 2Z5HA 2FFDA 3GHGA 1GK4A 1GL2A 2WITA 3HD7D 3KDPB 3VMYA 3B5NB 3C9IA 3II6A 4EIJA 3M9HA 1RY3A 1GW4A 2A45H 4N78E 5AW9B 1GK6A 3O8ZA 2Q5UA 1RE4A 2YMYA 1JCCA 5CCGA 4I2LC 2HFED 1LGHB 2WSEH 3RK2B 1J1EC 1J1DB 1N2DC 1JY3O 2XDJA 5AVRB 2POHA 3OJAB 2YKOA 1Z56A 1NH4A 5AW3B 2J58A 2KLVA 3HE4A 2M3BA 1L0NK 5AW5B 2I1KA 3HD7C 1KFMA 2WPRA 1ZLLA 2XKMA 3H32B 3L37A 5AVVB 2R5BA 4LLHA 3IFMA 3VYIA 1FOSF 1XTGB 2KYVA 4HH2A 2WSCH 2ZFCA 2WSFH 3L4FA 2LKMA 1SP4A 3LIEA 1N7SC 2Z5IA 4DOJA 2R3CA 1RF0A 1N73B 2IFNA 4N6JA 1SQPK 1JY3N 2YO3A 3EFGA 1NTKK 5APTA 4C46A 1JY2O 2W27A 4IFFA 1NU1K 1N7SD 2C0WA 1MZ9A 4W80A 1FZCC 1CI6B 5AVYB 5KLVK 2E42A 5CJ4A 3BRVB 1MUUA 1JY2N 4IFDK 1JO5A 5KJ7A 1AQ5A 4LC1A 2C9NY 3U1CA 5AVQB 3SWFA 3B5NA 1SFCA 3V2PA 2CPBA 5AW7B 5APUA 1X79B 3BASA 5AW4B 5AW6B 1RF1B 3VP9A 2WT7A 1G1JA 2OARA 2P7JA 1GW3A 3HUSC 1KILC 2O1JA 3I5CA 3GHGB 1JOCA 4Y99B 4N3YB 3P8CD 1GZLA 2YO2A 5BU5A 2YKQA 5CMZA 4DZOA 1ZR2A 3VMXA 1URQD 1N7SA 1SQQK 5AVTB 1ZV8A 4LGDE 1RF1A 1IFJA 3KQGA 3M0AA 1L4AC 2P2UA 2J59M 1DEBA 3TYYA 1FZCB 1LWUA 5APWA 1NO4A 3KYQA 3P8MC 1J2JB 1IO4A 2WTYA 1LWUB 1SFCD 4JYBA 3NTNA 1GL2C 3H32A 1IC2A 1FZGA 1CW5A 4RESB 3L35A 2N1TD 2QM8A 1FOSE 3M9BA 3RK2D 4C7NA 1SFCB 1E5WA 1JUNA 3A7OA 1GL2D 1SFCC 2O01H 1NTMK 4GT1A 1VPCA 3GHGC 2OYIC 4HYTB 1H89A 2OYIB 2GUVA 1A02F 5AW2B 2R5DA 1L4AD 1CSBA 2FKWB 5AVSB 1FZCA 4AUWA 1KZUB 4I6MC 3MD0A 1CZQA 1URQC 3U59A 1KFNA 4GIFA 1M1JA 5KJ7C 3OAKA 1URQB 1FZBA 1GDTA 2OYHB 1FZEA 1KILD 3B5NC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H8A A;  3NXS A;  2YO3 A;  2P67 A;  3V5B A;  4AQR D;  1HJB A;  5APT A;  4C46 A;  3TNU A;  2Q3I A;  2WWW A;  2W27 A;  1T2K C;  2XU6 A;  2R32 A;  2QM7 A;  1CI6 B;  5AVY B;  1T2K D;  4AYC A;  5APQ A;  3VMZ A;  2E42 A;  1HWT C;  1MUU A;  1S9K E;  1HBW A;  1OWA A;  4M3L A;  4LC1 A;  3P32 A;  3HE4 B;  1KQL A;  2C9N Y;  5AVQ B;  3LID A;  5AW7 B;  3UIA A;  1DH3 A;  5APU A;  5AW0 B;  4EOT A;  5AW4 B;  1MV8 A;  3IR9 A;  4XE5 B;  5AW6 B;  5AVZ B;  3A5T A;  1JNM A;  2WT7 A;  1GU4 A;  2E43 A;  2P7J A;  2C9L Y;  2KP8 A;  5APX A;  3VTP C;  3I5C A;  3A3Y B;  1NAF A;  2Z5H A;  5AVX B;  3P7K A;  1GZL A;  2YO2 A;  1GK4 A;  3VMY A;  3KDP B;  4KHX A;  5CMZ A;  4DZO A;  3VMX A;  3NFQ A;  2H7H A;  3V4Q A;  2W6A A;  2N9B A;  3HE5 A;  5AVT B;  5AVW B;  3M9H A;  3V4W A;  3KQG A;  3M0A A;  1NWQ A;  2P2U A;  5APS A;  1MFZ A;  4B86 A;  1A02 J;  5AVU B;  5AW9 B;  1S9K D;  1GK6 A;  3TYY A;  2Q7C A;  2BAS A;  2Q5U A;  2VRS A;  3O8Z A;  1GTW A;  2XV5 A;  2WPS A;  5APW A;  4I2L C;  1X8Y A;  3P8M C;  4JYC A;  1J2J B;  1IO4 A;  3NMD A;  2WTY A;  3B8E B;  3T97 A;  1GD2 E;  1CI6 A;  3MGN A;  5AW1 B;  4JYB A;  3NTN A;  1H88 A;  5AVR B;  4RES B;  3L35 A;  2QM8 A;  3TNU B;  1FOS E;  3M9B A;  5AW3 B;  4C7N A;  3HE5 B;  1JUN A;  3A7O A;  2JJL A;  1YYC A;  3HE4 A;  5AW5 B;  4GKG A;  3M06 A;  1HUC A;  3M91 A;  4GT1 A;  3VN0 A;  2WPR A;  4HYT B;  4C7N B;  5APY A;  1H89 A;  1GU5 A;  1A02 F;  3L37 A;  5AW2 B;  3L36 A;  2IPP A;  2R5B A;  3A2A A;  5AVV B;  2R5D A;  2YNY A;  1CSB A;  5AVS B;  3VYI A;  1G2C B;  1FOS F;  1FAV A;  2ZXE B;  3M0D A;  4AUW A;  4I6M C;  3MD0 A;  1CZQ A;  2ZFC A;  3TK1 A;  5AW8 B;  1SP4 A;  3LIE A;  3OAK A;  2WT7 B;  1OXZ A;  2Z5I A;  1SLQ A;  2R3C A;  5APV A;  3HTK A;  3SWF A;  2WPQ A;  2XZR A; 
#chains in the Genus database with same CATH topology
 5TIS H;  4K3A A;  3KXD A;  1FBM A;  3NXS A;  3RL0 C;  2P67 A;  1HH0 A;  1QL2 A;  2IBZ I;  3RL0 B;  2FXO A;  4D6T D;  1P84 H;  1HJB A;  3SSU A;  5K5G B;  3M9Q A;  1LTT C;  3TNU A;  2E5T A;  3G3Z A;  1L0L D;  2I1J A;  1KB9 E;  5CCH C;  1Q7Y Q;  5CCG D;  1PP9 D;  2XU6 A;  3BRT B;  3IF4 A;  3MIW A;  3CD6 P;  2QM7 A;  1VQK P;  5KLV J;  1WRG A;  2WSF J;  3VMZ A;  3AEA C;  3GMA A;  3KZI H;  1OMI A;  5BU8 B;  2Q9I A;  3H1J G;  3E1R A;  2KNC B;  4IFF A;  4IOI H;  1VL2 A;  1VQP P;  1S9K E;  1YHQ P;  3BCC J;  3CCV P;  2G8Y A;  1SQX K;  4M3L A;  2NPS C;  1NTK J;  2E75 C;  3HE4 B;  1J1E B;  1KQL A;  3CCS P;  4PV1 B;  4H13 C;  3H6P A;  1QVF O;  2A06 D;  3B5N D;  2PRR A;  1NTZ K;  1VDF A;  2L5G B;  3UIA A;  2B87 A;  3F89 A;  2A45 G;  3L73 G;  4H13 B;  5AW0 B;  1MV8 A;  3IR9 A;  2FFD B;  2OQQ A;  2QG4 A;  1NKZ B;  5H2F H;  3QH9 A;  2H89 C;  4XFJ A;  5KJ7 D;  1EXJ A;  2QEX P;  1FDI A;  3JCU H;  3VOP A;  1PFI A;  3GG2 A;  1SQQ G;  4TLF A;  4OH8 B;  3VTP C;  3HD7 B;  1LTJ A;  3A3Y B;  1HVV A;  4DJG A;  2Y9Y A;  1EZV D;  1PP9 E;  3P7K A;  5AVX B;  3M0D C;  1IZN B;  2V4H A;  2OYH C;  1QVG O;  4EDF A;  3L70 J;  3PRJ A;  3L73 J;  4H0L D;  4N78 D;  1KV4 A;  2H7H A;  3C1L A;  3RL0 g;  2AXC A;  2RKL A;  2N9B A;  1L2P A;  2JEE A;  5AVW B;  1YJN P;  1Q2N A;  2HYN A;  2KSE A;  4IFM A;  3V4W A;  1NOH A;  2FBW C;  3L71 D;  4XA4 A;  2CPS A;  1EZV G;  1YJW P;  1M8O B;  1L0N G;  1SQQ D;  1AV1 A;  3CI9 A;  3L75 J;  4BRY B;  1LJ2 A;  2M0B A;  5TIS E;  2VRS A;  1N7S B;  1FJK A;  3L72 J;  1GTW A;  1SQB D;  3MP7 B;  2XV5 A;  2WPS A;  3RK2 C;  3FX0 A;  1K9M Q;  1M1K Q;  3AE8 C;  4JYC A;  3E1I A;  1JM0 A;  1BSN A;  3B8E B;  1GD2 E;  1CI6 A;  2IX7 C;  2K1A A;  2KS1 A;  1LT1 A;  1SQV K;  2AEM A;  2O01 J;  5AW1 B;  2YKP A;  5C39 A;  2HOD B;  4JQ0 D;  3CCM P;  2QJK B;  3Q1M A;  1S72 P;  1KMI Z;  1VQL P;  3TNU B;  3Q5S A;  4JPZ B;  1FZF A;  2KI7 B;  2RMZ A;  3H1I D;  1URQ A;  2YMK A;  3PP5 A;  4UB6 H;  4WWI A;  3CPW O;  1JMM A;  1FC2 C;  1NKN A;  3HE5 B;  4PJ0 E;  5CCH A;  2HLO A;  4H0L C;  2N9Y B;  1HUC A;  3H1I J;  2JDI H;  2OTL P;  1L0L G;  3M91 A;  3L72 D;  4DT0 A;  1P84 E;  2KOG A;  3CWB G;  4C7N B;  3CX5 E;  1SVF A;  5KAF E;  1ZR4 A;  3H1J E;  3H1H D;  2Z4E A;  1GU5 A;  1KYO H;  1QL1 A;  2D2C D;  1KB9 H;  2MKV A;  3EQ2 A;  1Q90 D;  2WQY C;  3GF7 A;  2HOD A;  1IJD B;  2FYZ A;  2MJZ A;  1XTC C;  2IPP A;  1RF0 C;  3SFD C;  1KIL A;  2FXM A;  1L4A A;  2A06 E;  2YNY A;  2Q6Q A;  3CXH D;  4O9B A;  1VQN P;  1G2C B;  2N1T A;  1KB9 I;  3L74 D;  1WT6 A;  1KYO I;  2H88 C;  1NTK G;  2Q3E A;  2ZXE B;  3G9R A;  3HD7 A;  4D6T J;  4PD4 I;  3CWB E;  2E74 D;  3P8C E;  4JF7 A;  3TK1 A;  3ABV C;  1AJY A;  2M8R A;  4CPG A;  3GLM A;  2IBZ E;  4KJM A;  2E75 D;  1W5C E;  2K9J A;  2NPS D;  3KPE A;  3Q5P A;  1DIP A;  5APV A;  2IZ1 A;  1YIJ P;  3HTK A;  3A0H E;  1SQV J;  3E7K A;  2XZR A;  3CCQ P;  1H8A A;  2K37 A;  4HKZ H;  1OW8 A;  3U1A A;  3S4R A;  2W6B A;  1VF5 D;  5EFW B;  3RK3 C;  2QJK C;  2UWJ E;  1L4A B;  2R3S A;  2W6J H;  3L75 D;  1LTJ B;  1YTZ I;  1X0T A;  1LP1 A;  2N1T B;  3RK3 B;  2SPZ A;  2WZ7 A;  1EQ7 A;  1SQX E;  1FDM A;  2P58 A;  1YTZ T;  3QWO C;  3S1K A;  2R32 A;  1LTJ C;  1K8A Q;  1G1I A;  4IL6 H;  1QGK B;  2PGD A;  2ZT9 B;  3RL0 D;  2XNX A;  3V6I A;  3H1K E;  4AYC A;  4OGQ C;  2HPC B;  1EXI A;  3WMM 0;  1OVU A;  1RE4 C;  3WUV A;  2OYI A;  1HWT C;  3D6Z A;  2QE7 H;  1U7J A;  3TGU G;  1HF9 A;  3BVH A;  3EWK A;  1SQQ J;  1JMB A;  1OWA A;  2RH0 A;  2KB7 P;  4BWN A;  3D70 A;  2A45 I;  4H44 B;  3H1K J;  4QMA A;  3R4Y A;  3A0B E;  1JTH B;  1M7L A;  3LID A;  2H8P D;  1N73 A;  3CCR P;  4C7R A;  2R44 A;  3H1K G;  4EOT A;  3HUS B;  5AVZ B;  1JNM A;  1KIL B;  5GTH E;  2O01 N;  3L70 G;  1ZRT E;  2IBZ G;  1IFI A;  2ZVN B;  5M1B A;  1MFT A;  2ZYG A;  3TGU J;  1KYO E;  2P1J A;  3AE7 C;  4Y99 C;  1LTS C;  1BGY G;  2KP8 A;  2PAJ A;  5APX A;  2C9L Y;  2KS1 B;  1BDD A;  1T8Z A;  2IBZ D;  1JB0 J;  5CHX A;  2FYU E;  2H43 A;  3I55 P;  3CCU P;  1NTZ J;  1OW7 A;  2HG5 D;  1LNQ A;  1HGZ A;  3VMA A;  1N73 C;  2AEF A;  4KHX A;  3V2R A;  2KSJ A;  4R4L A;  2OTK E;  2WSC J;  3NFQ A;  2V7Q H;  4WY4 C;  4ZMD A;  2Q1K A;  1LTA C;  2L91 A;  3V4Q A;  2W6A A;  1H0T B;  3HE5 A;  2FYU K;  5L8R J;  4D6T E;  3HUS A;  1N7L A;  1N86 A;  1IK9 A;  2K9Y A;  3BAT A;  4NPE A;  4WY4 B;  5KLV D;  1NWQ A;  5APS A;  1MFZ A;  2N1T C;  2E76 B;  1EZV E;  4B86 A;  1A02 J;  5AVU B;  1LTB C;  1S9K D;  5KAI H;  2ZYA A;  2Q7C A;  1NTZ G;  2BAS A;  2RN0 A;  2E76 C;  1OIP A;  2ZT9 C;  2G3A A;  3H1H G;  3H1J J;  5BVZ A;  3RBX A;  1NJI Q;  3CXH I;  3VP8 A;  3SWY A;  1X8Y A;  3MHV A;  5KLV G;  2NPS A;  1KYO D;  2DW3 A;  3NMD A;  1RE3 C;  4U3F J;  2I8D A;  3H1I E;  3T97 A;  5B66 H;  5KTB A;  3CXH E;  3MGN A;  2C0X A;  1SQB K;  3PHL A;  1H88 A;  1T3J A;  2V7Q J;  1NTM E;  5CJ0 A;  3RGU A;  1OVV A;  1KQF B;  3R2P A;  1IFM A;  1HJ0 A;  1NHL A;  1EZV I;  1EDI A;  2FYU J;  4IL6 X;  2IDB A;  3EFF K;  1RQU A;  2JJL A;  1YYC A;  2QA4 P;  1DD4 A;  1RE3 A;  2WSE J;  2E74 B;  3CL3 D;  3L70 D;  3M06 A;  4GKG A;  3ITK A;  4W7Z A;  1YJ9 P;  1PGP A;  2PP6 A;  3TSI A;  3VN0 A;  1HTL C;  1YQ4 C;  1LTI C;  1S5L E;  3H1K D;  2O1K A;  1JY3 P;  1UIX A;  5APY A;  1KQG B;  1M1J C;  1OFC X;  4DCK A;  5DJU B;  5GTH H;  1JCD A;  3USS A;  4I1L A;  3OA7 A;  4H13 D;  3L75 E;  3L36 A;  3A2A A;  3L74 G;  2B89 A;  1FS0 E;  1LT9 C;  2ZVO B;  1KIL E;  3B4S A;  4TT3 H;  2AEJ A;  1FAV A;  1DD3 A;  3PTZ A;  3H25 A;  1T3U A;  1LT9 B;  3M0D A;  1SQV G;  1FJP A;  3N4X A;  1R5L A;  1QEX A;  4WY4 D;  3V2Q A;  1L0L K;  3V2N A;  1S4X A;  4W7Y A;  1SQX J;  5AW8 B;  1JY2 P;  3K5B A;  3L70 E;  5CCG C;  5CCH D;  2WT7 B;  1OXZ A;  1K73 Q;  1USD A;  3L75 G;  1SLQ A;  3HTK B;  2GM4 A;  5DJT B;  1ZW0 A;  1RF1 C;  1H0T A;  3G71 P;  5KKZ C;  1BE3 D;  4RKU J;  1JO5 A;  1SQP J;  2WPQ A;  4ZKP A;  3I56 P;  1LWU C;  2Y0D A;  3CCJ P;  1GL2 B;  1ZN5 A;  1BE3 J;  2GUS A;  1PPJ D;  1SQP G;  2Y0E A;  1NTM D;  3V5B A;  1PV3 A;  4AQR D;  4YTP C;  3G4S P;  1FZA A;  1AFO A;  1IFN A;  3AEG C;  2Q3I A;  2WWW A;  2QJP B;  3HRN A;  3MUD A;  5KAF H;  5B5E H;  1VQ5 P;  1LTG C;  1T2K C;  4HB1 A;  2HPC A;  2A06 G;  3W68 A;  1OVR A;  3LW5 H;  2E43 A;  3CXH H;  3L72 G;  1AQT A;  3FGA D;  5APQ A;  1NTK D;  3CLQ A;  1T2K D;  1NTK E;  1L0L J;  2ZJS E;  2NPS B;  3N7N A;  3CMA P;  2B87 B;  4UB8 H;  1VQ4 P;  1ZME C;  3BCC E;  1DX7 A;  1SQB G;  4I7Z B;  1HBW A;  1BGY J;  1S2E A;  1KB9 D;  4WY4 A;  5GTI E;  4YXD C;  3TF5 A;  3P32 A;  1L0N J;  2AXT E;  1FU1 A;  1J1D C;  1JTH A;  1M1J B;  3MTU E;  1EDK A;  3MZW B;  4I7Z C;  4WBA A;  5KAI E;  2IFM A;  5KLV E;  2FFD C;  2E75 B;  3D6Y A;  5CBO A;  1DH3 A;  5KLI B;  2OYH A;  4PD4 E;  1YBK A;  1W2E A;  2JKV A;  4XE5 B;  1HGV A;  1S5L H;  1IFD A;  2K9J B;  3RK3 D;  1VF5 C;  2FY8 A;  2KIK A;  1X9V A;  4U3F G;  1W2B O;  1GU4 A;  3WUT A;  5B66 E;  1P84 D;  1YIT P;  4ZKU A;  1VF5 B;  4WB4 A;  1LT9 A;  3H1I G;  2JP3 A;  1BGY E;  2KZI A;  3C8V A;  3FXE A;  1G2C A;  1NAF A;  2Z5H A;  4HJG H;  1EC5 A;  3S9O A;  2FFD A;  1IFP A;  3CC2 P;  3GHG A;  1L0L E;  1QLE D;  1GK4 A;  1GL2 A;  2WIT A;  3CX5 I;  3HD7 D;  3KDP B;  3RBZ A;  3VMY A;  4L73 A;  1VQM P;  3Q5R A;  3B5N B;  3GF3 A;  3C9I A;  3Q2Y A;  3II6 A;  2B9B A;  1NAY A;  2QRX A;  2JWD A;  2ZYD A;  3AEE C;  3GW6 A;  3M9H A;  1RY3 A;  3TDK A;  4EIJ A;  3G6E P;  3L73 D;  1GW4 A;  1BE3 E;  1ZXG A;  2A45 H;  4ZNC A;  4N78 E;  2ZXX A;  5AW9 B;  2QJP C;  2XND H;  1GK6 A;  1Y47 A;  2NZ2 A;  3L71 J;  3O8Z A;  2Q5U A;  3A0B H;  1SQP E;  1BCC D;  1RE4 A;  2YMY A;  1VQ9 P;  2OGU A;  1JCC A;  1OZH A;  4I2L C;  2HFE D;  4L76 A;  1LP1 B;  5CCG A;  1LGH B;  3L71 G;  2W90 A;  1QX8 A;  1R5S A;  3SFE C;  3ZDM A;  2WSE H;  4D6T G;  4YXW H;  4IL6 E;  3RK2 B;  2GA1 A;  1PP9 G;  1FE6 A;  1J1E C;  5B5E E;  1PGQ A;  3L73 E;  1J1D B;  1N2D C;  1JY3 O;  2XDJ A;  5AVR B;  1VQ8 P;  1L0N E;  1N8R Q;  2POH A;  2QIW A;  3OJA B;  2YKO A;  1PP9 J;  1Z56 A;  1NH4 A;  5AW3 B;  2KXP B;  1RQV A;  3FWL A;  4UB8 E;  2J58 A;  2ZT9 D;  4H0L B;  2E76 D;  2KLV A;  5GTI H;  1VQ6 P;  1NU1 J;  3HE4 A;  2M3B A;  1L0N K;  1U57 A;  4MN4 C;  5AW5 B;  2QJY C;  4GDO A;  1VQ7 P;  2I1K A;  3HD7 C;  1KFM A;  1SQX D;  2WPR A;  1ZLL A;  2QJY B;  4PD4 H;  2XKM A;  1NTM G;  1AVY A;  2YXQ B;  3AE1 C;  4GOF A;  2YXR B;  2LXC B;  3H32 B;  4L75 A;  2YIU C;  4RJT A;  2KZJ A;  1S3J A;  2E5Y A;  3L37 A;  3H1L E;  2CK3 H;  3O6Q A;  5AVV B;  2R5B A;  4LLH A;  3WU2 H;  3KZI E;  1BE3 G;  2QSI A;  1NVO A;  3IFM A;  4ASV A;  3VYI A;  1FOS F;  1E79 H;  3H1J D;  4H44 D;  3CC4 P;  1NTM J;  1XTG B;  1SS1 A;  2KYV A;  2P10 A;  1U7M A;  2WSC H;  2ZFC A;  2WSF H;  3L4F A;  4HH2 A;  1OW6 A;  2LKM A;  2M5A B;  4U3F D;  4U3F E;  3SWK A;  1SP4 A;  2WMM A;  3LIE A;  1SQV D;  1N7S C;  4K35 A;  3PJS K;  2Z5I A;  1AVO A;  4A7P A;  3AE3 C;  1S1C X;  4DOJ A;  2R3C A;  1RF0 A;  3AEF C;  1N73 B;  2IFN A;  2BCC G;  3AEB C;  1BDC A;  4N6J A;  2M5A A;  1KTM A;  1SQP K;  1JY3 N;  2YO3 A;  1ZOY C;  1Y8A A;  2IZ0 A;  1RHZ B;  1TU3 F;  1PGO A;  3EFG A;  1NTK K;  5APT A;  3CX5 D;  3IN6 A;  1JY2 O;  1K05 A;  4C46 A;  1KQS O;  1KOR A;  2ITA A;  2W27 A;  1GMJ A;  1NU1 K;  1USE A;  2BEQ D;  1N7S D;  2IYO A;  2KLU A;  2C0W A;  1MZ9 A;  2FXP A;  3L72 E;  4OGQ D;  2FYU D;  2JR8 A;  4W80 A;  5CBN A;  1CI6 B;  5TJH A;  1VQO P;  5AVY B;  5KLV K;  1FZC C;  2JWA A;  2E42 A;  5CJ4 A;  3BRV B;  1EDJ A;  1NTZ E;  1MUU A;  1JY2 N;  1SQB E;  1T6A A;  2QVA A;  1PPJ G;  1SQP D;  1ZRT D;  2ZAE B;  4H44 C;  5KJ7 A;  4IFD K;  4KT0 J;  3AE2 C;  1AQ5 A;  4LC1 A;  4DZO A;  2C9N Y;  2WSS H;  4UB6 E;  5AVQ B;  3WUU A;  4PJ0 H;  3U1C A;  2YIU B;  3AE5 C;  2FYU G;  3B5N A;  5E79 E;  3SWF A;  1SFC A;  1M57 D;  3V2P A;  4EI2 A;  1BSH A;  2CPB A;  5AW7 B;  5APU A;  1X79 B;  3BAS A;  1NU1 D;  5AW4 B;  4BXL A;  5AW6 B;  4NPF X;  1RF1 B;  3VP9 A;  2WT7 A;  1G1J A;  2OAR A;  5E79 H;  1UII A;  2P7J A;  3CX5 H;  1GW3 A;  3HUS C;  1NTZ D;  2E74 C;  3MUD C;  1BCC E;  3PH0 A;  3T97 B;  1KIL C;  1X22 A;  1NGM B;  2O1J A;  1S5L X;  3I5C A;  1SQQ E;  3GHG B;  2BCC E;  2O3J A;  2Y0C A;  3H1H J;  3PLN A;  4WVZ A;  1JOC A;  4Y99 B;  4N3Y B;  3WU2 E;  3TGU D;  3CWB D;  3P8C D;  4EYY Q;  1GZL A;  2LR2 A;  2YO2 A;  5BU5 A;  3AE4 C;  2YKQ A;  3CME P;  5CMZ A;  2BEZ F;  3O6Q B;  3KHU A;  2W83 C;  3F5H A;  1PZQ A;  1URQ D;  4L74 A;  2FYN C;  4NPD A;  3VMX A;  1ZR2 A;  1N7S A;  1KD1 Q;  3LW5 J;  2D2C C;  1SQQ K;  5AVT B;  3L74 J;  2OYO A;  2HR3 A;  1ZV8 A;  4LGD E;  1RF1 A;  2FYN B;  1IFJ A;  3H1L D;  3KQG A;  3M0A A;  2M3E A;  1L4A C;  2J5U A;  2P2U A;  3Q3D A;  2OTJ P;  3FXD A;  1JEK A;  2AXT H;  2J59 M;  3BCC D;  3AEC C;  1Q86 Q;  1BGY D;  3A0H H;  1DEB A;  3H1L J;  4OWF A;  3TYY A;  3BCC G;  2Y9Z A;  1SQV E;  4PV1 D;  3TGU E;  1FZC B;  1KN7 A;  1LWU A;  1KC8 Q;  1OX3 A;  4OGQ B;  5APW A;  1D7M A;  1NO4 A;  3H1L G;  2WPV B;  3AE9 C;  3KYQ A;  3P8M C;  1J2J B;  1SQX G;  1Y9B A;  5H2F E;  3RK3 E;  1IO4 A;  3L74 E;  2WTY A;  4PD4 D;  1AA0 A;  1LWU B;  1SFC D;  4JYB A;  3NTN A;  1GL2 C;  3H32 A;  1P84 I;  1IC2 A;  1Q82 Q;  1FZG A;  1CW5 A;  1NU1 E;  2JO1 A;  4RES B;  4U7J A;  1FDO A;  3L35 A;  3W67 A;  1L0N D;  2N1T D;  2QM8 A;  1FOS E;  1Q81 Q;  1WMK A;  1MKM A;  2WVR A;  3M9B A;  1DEE G;  3JC2 2;  1NYH A;  4RO0 A;  3RK2 D;  1SFC B;  2BCC J;  3H1H E;  4ASW A;  4R4M A;  4C7N A;  3CC7 P;  2KUB A;  1E5W A;  1BCC J;  1JUN A;  3A7O A;  1GL2 D;  3FWN A;  1SFC C;  2O01 H;  1K04 A;  4Z1M H;  2PFX A;  1NTM K;  2KK7 A;  2BCC D;  1PL5 A;  4GT1 A;  1PIX A;  1VPC A;  1NU1 G;  3GHG C;  2OYI C;  4HYT B;  1M90 Q;  3B71 A;  1YI2 P;  1H89 A;  2K88 A;  2NRG A;  3A5T A;  3CCL P;  3JCU E;  4PV1 C;  4GOD A;  2OYI B;  1BCC G;  1PPJ E;  2GUV A;  1A02 F;  1YQ3 C;  5AW2 B;  1IK7 A;  2LXB A;  2W8Z A;  3L71 E;  4GOE A;  4Y28 J;  5KLI C;  2R5D A;  2D2C B;  1L4A D;  3IAO A;  1CSB A;  2FKW B;  1PGJ A;  3AE6 C;  2IYP A;  1SQB J;  5AVS B;  1M56 D;  3CCE P;  1FZC A;  3AED C;  2B88 A;  4AUW A;  1KZU B;  4I6M C;  3MD0 A;  1CZQ A;  4OVN F;  1URQ C;  4JBZ A;  1ZP0 C;  1KFN A;  3U59 A;  1RH5 B;  1M1J A;  3CWB J;  4GIF A;  5KJ7 C;  2K3R A;  3OAK A;  4BRY A;  3D71 A;  1R8E A;  5KKZ B;  1URQ B;  1FZB A;  1GDT A;  3OW2 O;  2OYH B;  1FZE A;  1EDL A;  2KNC A;  3JSV C;  4YPC A;  1KIL D;  3B5N C; 
#chains in the Genus database with same CATH homology
 3NXS A;  1FBM A;  3RL0 C;  2P67 A;  1HH0 A;  1QL2 A;  3RL0 B;  1HJB A;  3M9Q A;  1LTT C;  3TNU A;  3G3Z A;  2I1J A;  5CCH C;  5CCG D;  2XU6 A;  3BRT B;  3MIW A;  2QM7 A;  1WRG A;  3VMZ A;  5BU8 B;  1S9K E;  1SQX K;  4M3L A;  2NPS C;  3HE4 B;  1J1E B;  1KQL A;  3H6P A;  3B5N D;  1NTZ K;  1VDF A;  2L5G B;  3UIA A;  2A45 G;  5AW0 B;  1MV8 A;  3IR9 A;  2FFD B;  1NKZ B;  5KJ7 D;  3VOP A;  1PFI A;  3VTP C;  4OH8 B;  3HD7 B;  1LTJ A;  3A3Y B;  1HVV A;  5AVX B;  3P7K A;  3M0D C;  2OYH C;  4N78 D;  2H7H A;  2N9B A;  5AVW B;  2JEE A;  2HYN A;  4IFM A;  3V4W A;  1NOH A;  4XA4 A;  2CPS A;  3CI9 A;  2VRS A;  1N7S B;  1FJK A;  1GTW A;  2XV5 A;  2WPS A;  3RK2 C;  4JYC A;  3E1I A;  3B8E B;  1GD2 E;  1CI6 A;  2IX7 C;  5AW1 B;  2Q9I A;  1SQV K;  2YKP A;  2HOD B;  3TNU B;  1FZF A;  3PP5 A;  1URQ A;  1JMM A;  1NKN A;  3HE5 B;  5CCH A;  2HLO A;  1HUC A;  3M91 A;  2KOG A;  4C7N B;  1ZR4 A;  1SVF A;  2Z4E A;  1GU5 A;  1QL1 A;  3EQ2 A;  2HOD A;  1IJD B;  2FYZ A;  2MJZ A;  1XTC C;  2IPP A;  1RF0 C;  1KIL A;  2FXM A;  1L4A A;  2YNY A;  4O9B A;  1G2C B;  2N1T A;  1WT6 A;  2ZXE B;  3HD7 A;  3P8C E;  4JF7 A;  3TK1 A;  2M8R A;  2NPS D;  3KPE A;  5APV A;  3HTK A;  2XZR A;  1H8A A;  3U1A A;  2W6B A;  3RK3 C;  1L4A B;  1LTJ B;  1YTZ I;  2N1T B;  3RK3 B;  2WZ7 A;  1EQ7 A;  1FDM A;  1YTZ T;  2R32 A;  1LTJ C;  1G1I A;  3RL0 D;  2XNX A;  2HPC B;  4AYC A;  3WMM 0;  2OYI A;  1RE4 C;  1HWT C;  3BVH A;  1OWA A;  2KB7 P;  2A45 I;  1JTH B;  1M7L A;  3LID A;  2H8P D;  1N73 A;  4C7R A;  4EOT A;  3HUS B;  5AVZ B;  1JNM A;  1KIL B;  1IFI A;  3VP8 A;  1RF1 C;  2P1J A;  4Y99 C;  1LTS C;  2KP8 A;  2PAJ A;  5APX A;  2C9L Y;  1T8Z A;  5CHX A;  2H43 A;  2HG5 D;  1HGZ A;  1N73 C;  3V2R A;  4KHX A;  2KSJ A;  3NFQ A;  4WY4 C;  1LTA C;  3V4Q A;  2W6A A;  3HE5 A;  2FYU K;  3HUS A;  1N7L A;  1N86 A;  1IK9 A;  3BAT A;  4WY4 B;  1NWQ A;  5APS A;  1MFZ A;  2N1T C;  4B86 A;  1A02 J;  5AVU B;  1LTB C;  1S9K D;  2Q7C A;  2BAS A;  5BVZ A;  3SWY A;  1X8Y A;  2NPS A;  3NMD A;  1RE3 C;  3T97 A;  5KTB A;  3MGN A;  2C0X A;  1SQB K;  1H88 A;  1T3J A;  5CJ0 A;  3R2P A;  1IFM A;  1NHL A;  2JJL A;  1YYC A;  1RE3 A;  4GKG A;  3CL3 D;  3M06 A;  4W7Z A;  2PP6 A;  3TSI A;  3VN0 A;  1HTL C;  1LTI C;  2O1K A;  1JY3 P;  5APY A;  1M1J C;  1JCD A;  4I1L A;  3OA7 A;  3L36 A;  3A2A A;  1LT9 C;  1FAV A;  1T3U A;  1LT9 B;  3M0D A;  1FJP A;  3N4X A;  3V2Q A;  4WY4 D;  1L0L K;  3V2N A;  4W7Y A;  5AW8 B;  1JY2 P;  5CCG C;  2WT7 B;  5CCH D;  1OXZ A;  1SLQ A;  3HTK B;  2GM4 A;  2WPQ A;  4ZKP A;  1LWU C;  1GL2 B;  1ZN5 A;  2GUS A;  3V5B A;  4AQR D;  1FZA A;  1AFO A;  1IFN A;  3HRN A;  2Q3I A;  2WWW A;  3MUD A;  2HPC A;  1LTG C;  1T2K C;  3LW5 H;  1T2K D;  5APQ A;  3CLQ A;  2NPS B;  3N7N A;  1DX7 A;  1HBW A;  4WY4 A;  3P32 A;  1FU1 A;  1J1D C;  1JTH A;  1M1J B;  3MTU E;  4WBA A;  2IFM A;  2FFD C;  1DH3 A;  2OYH A;  4XE5 B;  1W2E A;  3A5T A;  1HGV A;  1IFD A;  3RK3 D;  1GU4 A;  2E43 A;  1X9V A;  4ZKU A;  4WB4 A;  1LT9 A;  1G2C A;  1NAF A;  2Z5H A;  2FFD A;  3GHG A;  1GK4 A;  1GL2 A;  2WIT A;  3HD7 D;  3KDP B;  3VMY A;  3B5N B;  3C9I A;  3II6 A;  4EIJ A;  3M9H A;  1RY3 A;  1GW4 A;  2A45 H;  4N78 E;  5AW9 B;  1GK6 A;  3O8Z A;  2Q5U A;  1RE4 A;  2YMY A;  1JCC A;  5CCG A;  4I2L C;  2HFE D;  1LGH B;  2WSE H;  3RK2 B;  1J1E C;  1J1D B;  1N2D C;  1JY3 O;  2XDJ A;  5AVR B;  2POH A;  3OJA B;  2YKO A;  1Z56 A;  1NH4 A;  5AW3 B;  2J58 A;  2KLV A;  3HE4 A;  2M3B A;  1L0N K;  5AW5 B;  2I1K A;  3HD7 C;  1KFM A;  2WPR A;  1ZLL A;  2XKM A;  3H32 B;  3L37 A;  5AVV B;  2R5B A;  4LLH A;  3IFM A;  3VYI A;  1FOS F;  1XTG B;  2KYV A;  4HH2 A;  2WSC H;  2ZFC A;  2WSF H;  3L4F A;  2LKM A;  1SP4 A;  3LIE A;  1N7S C;  2Z5I A;  4DOJ A;  2R3C A;  1RF0 A;  1N73 B;  2IFN A;  4N6J A;  1SQP K;  1JY3 N;  2YO3 A;  3EFG A;  1NTK K;  5APT A;  4C46 A;  1JY2 O;  2W27 A;  4IFF A;  1NU1 K;  1N7S D;  2C0W A;  1MZ9 A;  4W80 A;  1FZC C;  1CI6 B;  5AVY B;  5KLV K;  2E42 A;  5CJ4 A;  3BRV B;  1MUU A;  1JY2 N;  4IFD K;  1JO5 A;  5KJ7 A;  1AQ5 A;  4LC1 A;  2C9N Y;  3U1C A;  5AVQ B;  3SWF A;  3B5N A;  1SFC A;  3V2P A;  2CPB A;  5AW7 B;  5APU A;  1X79 B;  3BAS A;  5AW4 B;  5AW6 B;  1RF1 B;  3VP9 A;  2WT7 A;  1G1J A;  2OAR A;  2P7J A;  1GW3 A;  3HUS C;  1KIL C;  2O1J A;  3I5C A;  3GHG B;  1JOC A;  4Y99 B;  4N3Y B;  3P8C D;  1GZL A;  2YO2 A;  5BU5 A;  2YKQ A;  5CMZ A;  4DZO A;  1ZR2 A;  3VMX A;  1URQ D;  1N7S A;  1SQQ K;  5AVT B;  1ZV8 A;  4LGD E;  1RF1 A;  1IFJ A;  3KQG A;  3M0A A;  1L4A C;  2P2U A;  2J59 M;  1DEB A;  3TYY A;  1FZC B;  1LWU A;  5APW A;  1NO4 A;  3KYQ A;  3P8M C;  1J2J B;  1IO4 A;  2WTY A;  1LWU B;  1SFC D;  4JYB A;  3NTN A;  1GL2 C;  3H32 A;  1IC2 A;  1FZG A;  1CW5 A;  4RES B;  3L35 A;  2N1T D;  2QM8 A;  1FOS E;  3M9B A;  3RK2 D;  4C7N A;  1SFC B;  1E5W A;  1JUN A;  3A7O A;  1GL2 D;  1SFC C;  2O01 H;  1NTM K;  4GT1 A;  1VPC A;  3GHG C;  2OYI C;  4HYT B;  1H89 A;  2OYI B;  2GUV A;  1A02 F;  5AW2 B;  2R5D A;  1L4A D;  1CSB A;  2FKW B;  5AVS B;  1FZC A;  4AUW A;  1KZU B;  4I6M C;  3MD0 A;  1CZQ A;  1URQ C;  3U59 A;  1KFN A;  4GIF A;  1M1J A;  5KJ7 C;  3OAK A;  1URQ B;  1FZB A;  1GDT A;  2OYH B;  1FZE A;  1KIL D;  3B5N C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...