1KQLA

Crystal structure of the c-terminal region of striated muscle alpha-tropomyosin at 2.7 angstrom resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
55
structure length
55
Chain Sequence
b'MDKVEELLSKNYHLENEVARLKKLVDDLEDELYAQKLKYKAISEELDHALNDMTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fusion Protein of and striated muscle alpha-tropomyosin and
molecule tags Contractile protein
source organism Saccharomyces cerevisiae
publication title The crystal structure of the C-terminal fragment of striated-muscle alpha-tropomyosin reveals a key troponin T recognition site.
pubmed doi rcsb
total genus 22
structure length 55
sequence length 55
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1kqlA00
3VMYA 2WT7B 3V4WA 2ZXEB 1DH3A 4AYCA 1GZLA 1G2CB 1X8YA 2WWWA 2Q3IA 1KQLA 1A02J 2QM7A 1OWAA 5AW9B 1JNMA 4B86A 2P2UA 3A2AA 5AW7B 1CSBA 5AVXB 1A02F 3M0DA 3TK1A 5AW3B 1H88A 2H7HA 5AW6B 1J2JB 2W6AA 3M9BA 5APSA 3O8ZA 1GK4A 1SLQA 5AW8B 3LIDA 5AVUB 2R3CA 2R5DA 3M0AA 4XE5B 5AVWB 2Q5UA 2Q7CA 2E42A 3A5TA 4RESB 2Z5HA 4M3LA 2YO3A 3VTPC 3IR9A 3T97A 2VRSA 4HYTB 5AVZB 4C46A 3HE5B 2KP8A 4I6MC 1H89A 3L36A 1HJBA 3NXSA 4AUWA 5APTA 1S9KE 5APXA 1MV8A 3P8MC 4AQRD 1MFZA 3NFQA 1S9KD 4JYCA 1OXZA 3A3YB 5AVSB 2ZFCA 5APQA 3NMDA 1HWTC 2W27A 4LC1A 1FOSE 1CZQA 2QM8A 5AW0B 4DZOA 5APYA 4C7NB 1GU5A 1H8AA 2YNYA 2P7JA 5AVTB 5AVYB 2C9LY 5CMZA 3UIAA 3V4QA 1CI6A 3L35A 3NTNA 2P67A 5AVRB 3KQGA 5AW2B 1NWQA 1T2KD 1GU4A 1CI6B 5AVQB 2C9NY 3MD0A 3VMXA 1HUCA 3OAKA 3MGNA 2WT7A 2E43A 1YYCA 2R5BA 3VYIA 3VN0A 2IPPA 4I2LC 5AW4B 3M91A 3A7OA 3VMZA 2N9BA 1HBWA 3HE4B 3KDPB 4JYBA 5APWA 4C7NA 5APVA 2BASA 3HE4A 3TYYA 3B8EB 3M9HA 3LIEA 1GD2E 2Z5IA 3SWFA 1GK6A 2XV5A 4EOTA 3TNUB 5AW1B 4GKGA 1T2KC 1SP4A 2WPSA 2JJLA 2XU6A 2XZRA 1MUUA 2WPQA 4GT1A 1NAFA 3I5CA 3HTKA 5AVVB 4KHXA 3P7KA 3TNUA 1JUNA 2WPRA 3M06A 3V5BA 2R32A 5APUA 1IO4A 3HE5A 3L37A 2WTYA 1FOSF 1FAVA 2YO2A 1GTWA 3P32A 5AW5B
chains in the Genus database with same CATH superfamily
1QL1A 3L75E 1ZRTD 2E74D 2YMYA 4D6TD 4I1LA 4NPDA 4AYCA 1GU4A 2OTLP 3AEDC 2E75B 1Y8AA 1DX7A 2K9JA 2WWWA 1KILE 2Q3IA 2SPZA 1KQLA 1VQ9P 1L0ND 3L73G 4R4MA 1XTCC 1NTZE 1NU1G 4B86A 2P2UA 2Y9ZA 1OFCX 2CPSA 4H13C 1JNMA 2P58A 3Q5RA 3TK1A 1M1JB 3M9QA 5AW3B 1KQGB 5KLVJ 1WRGA 2HLOA 2ZXXA 1M1JA 3WUUA 3L71G 3HUSB 3TDKA 3MZWB 3O8ZA 5AW8B 3H1JE 3VOPA 4I7ZB 2NPSA 3E7KA 1M1KQ 2HODB 4DOJA 4XE5B 2R5DA 5AVWB 3G6EP 1PPJG 3L72J 1KB9I 2J59M 2R44A 3BASA 2A06D 1Q7YQ 2KNCA 2KI7B 3OW2O 1LTTC 1NTMK 2AEFA 2OYIA 4N6JA 2OARA 2KS1B 4H44C 1BDDA 3SSUA 2QJYB 1GL2A 2YO3A 3F89A 1NTKD 3IR9A 3LW5J 1J1DC 4H13D 4HYTB 1VL2A 2MKVA 2FFDC 1ZW0A 4PJ0H 1SQVE 1HJ0A 1USDA 2YIUB 3CCSP 1D7MA 3HTKB 3L36A 1NTMD 3SWKA 3TGUG 1HJBA 3NXSA 3CWBG 5E79E 1PP9J 2POHA 5KJ7D 5KAIH 1K9MQ 1VQ4P 2JO1A 1JY2N 2ZT9C 4N78D 1LWUB 5CCGA 3H1IJ 3NFQA 1X22A 5CCHD 2OYHA 2B87A 1X0TA 3LW5H 3CMAP 3A3YB 3F5HA 2E76B 3H1HD 1SQPJ 4HKZH 1FZCB 1VQMP 2D2CD 2IDBA 2PAJA 2FYUE 1EZVD 2UWJE 1L0NG 4H44B 3L70J 4OWFA 4LC1A 4YXWH 2XDJA 2PGDA 2V4HA 1GU5A 3BRTB 4UB6E 1BE3J 1QL2A 2HG5D 3MHVA 4H44D 5CCHC 1NAYA 1N73C 1RF1B 2E75C 4UB8H 1BGYD 1K73Q 2P10A 1YJ9P 1L4AD 3D6ZA 1N7SC 2N1TC 1Q81Q 1PGQA 3UIAA 4EI2A 4PD4I 5AVRB 2P67A 5GTHH 3KQGA 3JCUH 4W7ZA 4WY4A 3WMM0 1BCCG 4U3FD 1VQ6P 3WUVA 3L71J 1NU1J 1YTZT 5CCGD 2Q3EA 4BXLA 1NYHA 1U57A 1L0LE 1USEA 1L0LJ 1M56D 3KPEA 4IFMA 5KAFH 2E75D 2E43A 1EZVE 1KV4A 2QJKB 3G71P 1RF0C 4W7YA 1NHLA 1ZR4A 1KYOE 5GTIE 1HBWA 1FJPA 3KXDA 3T97B 4LLHA 1NTMJ 3HD7B 3KDPB 4XFJA 1N8RQ 3RK2C 4IL6X 1JB0J 1URQA 3FX0A 1DEBA 1L2PA 3AE5C 2FYNB 1RE4C 3HE4A 3AE7C 3H1LG 1BE3E 3B8EB 3KHUA 3V2QA 3N7NA 1YI2P 5AW5B 1FDOA 3L72D 4OGQB 3H1HJ 3M9HA 2H88C 1L0NK 4D6TG 3U1CA 2ITAA 1AVYA 2V7QH 2BCCD 1RE3C 2K88A 1EZVG 1VF5B 2HR3A 3L71E 1YJWP 3PLNA 2KB7P 2QJKC 1IFPA 1SQVK 1T2KC 4C7RA 3SFEC 4PJ0E 3EFGA 1NKNA 3RK2D 3AE2C 3GHGB 3MP7B 1NTZG 1SQXD 3BCCE 3Q5PA 5EFWB 3U1AA 1VQ7P 1LT9C 3RL0g 3CCLP 4IOIH 3B5ND 1DD3A 5AVVB 2B89A 1JY2P 3RL0C 3TNUA 1LT1A 1ZR2A 1T8ZA 1KILB 4N3YB 2R32A 1NKZB 3Q2YA 1L0NE 2FXMA 3B71A 4PV1B 4YXDC 3TF5A 1LGHB 4GOFA 1FZCA 1DEEG 2W6BA 2WMMA 1IFDA 1IZNB 4H0LD 1G1IA 1GZLA 1G2CB 1LP1A 1LWUA 1RY3A 2FBWC 2YKQA 3AEFC 3H32B 1IC2A 3CD6P 1KN7A 1L0LK 2QM7A 5AW7B 4KJMA 5KLVD 1R5LA 3M0DA 1OVRA 3MIWA 3TGUJ 1AQ5A 2KK7A 3S4RA 3W68A 3RK2B 1KILC 3L74J 1H88A 2NPSC 3BVHA 2I1JA 1KORA 1SVFA 1KB9H 1ZOYC 1FC2C 1SQPE 2QJPC 4OH8B 1HH0A 2LKMA 2OYIB 1SLQA 1Y47A 1QVFO 2OTJP 4WWIA 3M0AA 5BVZA 1L0NJ 2FYUD 2ZAEB 2M5AB 1PL5A 2PP6A 3GLMA 1EC5A 2CK3H 1BE3G 2Z5HA 4M3LA 5BU8B 3H1HE 2VRSA 1S72P 2WSFH 1OX3A 1VQ5P 4O9BA 1AA0A 5B5EH 2W8ZA 2QG4A 2YIUC 2JWAA 4CPGA 2D2CB 2I8DA 3H1KD 3II6A 1H89A 1PFIA 3CCEP 1AQTA 3V2NA 3A0BH 1KZUB 1L4AC 1NOHA 3CXHD 1MV8A 3N4XA 2QEXP 4Y28J 3B5NC 2NZ2A 1PPJE 2IBZE 1S9KD 2E5YA 1L0LG 1J1EB 3C9IA 4OVNF 1S1CX 1VPCA 4R4LA 1XTGB 1KC8Q 2K37A 5CCGC 2ZFCA 2ZVNB 2JEEA 1KMIZ 1NTKJ 2P1JA 1SQBK 3E1IA 3L71D 5CCHA 3D71A 2IBZI 1W2BO 5DJUB 1SQPD 3CXHE 1FOSE 1G2CA 1LP1B 1LTSC 5DJTB 2WVRA 4DZOA 1PPJD 2O1JA 3GG2A 4Z1MH 1SQBG 1H8AA 5CJ0A 1FDMA 2YNYA 4L73A 1IFJA 1NO4A 2WSSH 4WY4C 5AVYB 5KLVK 2H43A 2C9LY 2IZ1A 2C0XA 2DW3A 5APSA 1JOCA 1JTHB 1NTKG 4IFFA 3EWKA 3L70G 4TLFA 3W67A 3NTNA 5TISH 1URQB 3L75G 1PV3A 2C0WA 1U7JA 1VDFA 3U59A 1NWQA 1CI6B 1NGMB 2KLUA 2FYUG 5TISE 4ZNCA 4U3FJ 1GW3A 1LTJC 1PGPA 1RH5B 1LTBC 2WITA 4MN4C 5BU5A 3R4YA 1KTMA 1ZN5A 3AE4C 4GDOA 3VYIA 5B66E 5AW4B 5KAFE 1Q90D 2M5AA 2N9BA 1IK7A 1S2EA 1SFCC 3O6QA 2GUSA 4K35A 4L76A 5L8RJ 5APWA 3CX5I 3GHGC 1YQ4C 2NPSB 4IL6H 2KXPB 2BASA 5APVA 2WSFJ 4RJTA 1AFOA 1SFCA 3C8VA 3H25A 1SQXE 2ZT9B 1R5SA 1URQC 4ZKUA 4KT0J 3RK3E 1JEKA 1S4XA 5TJHA 2Z5IA 1SQQJ 2OYHB 1GDTA 2WSCJ 3GMAA 4NPEA 2PRRA 3MTUE 4JPZB 4ASWA 1SQPG 3B5NB 1N2DC 2BCCJ 1FDIA 1P84I 2G8YA 1ZLLA 2Y0EA 1SQBD 4ZMDA 1SP4A 5KLVG 3WU2E 2XNXA 3I55P 3CX5H 1NTKK 2A06G 2D2CC 3C1LA 1EDLA 2QE7H 3CI9A 1E5WA 2XZRA 1MUUA 1SQQG 2V7QJ 2WPQA 2HPCA 1HTLC 2E74B 2JP3A 1QVGO 2M0BA 3BCCD 3RL0B 3WUTA 3P7KA 1J1EC 2WPRA 1IJDB 1OVVA 3V5BA 3TGUD 1IO4A 2NPSD 2WSEH 3CWBD 1LTGC 3H1LD 5GTIH 3CXHI 2WTYA 1VQOP 1HF9A 1P84H 1LWUC 3AE8C 1YITP 1GTWA 2ZT9D 3P32A 3AEBC 2O01J 2ZXEB 1UIIA 2WQYC 3IN6A 3VP8A 3HD7C 1OVUA 3H1JD 1NTZK 5C39A 3AE3C 3KYQA 3H1IG 4WY4B 4Y99B 1FU1A 2JKVA 3I56P 1A02J 4L75A 3AECC 2W90A 3L74D 1GMJA 1K05A 3H32A 1M1JC 5AVXB 5CBNA 4YTPC 3L4FA 1SFCD 5CHXA 2HYNA 3TSIA 1NJIQ 2Q9IA 1SQPK 1BGYG 5AW6B 1OIPA 1NTZD 1J2JB 1SQXG 1X9VA 2A45I 2QJPB 2RMZA 2W6AA 2FYZA 3EFFK 4D6TE 1JY2O 1N7SB 1S3JA 1YBKA 2N1TB 4RKUJ 1KQSO 1Q2NA 1SQBJ 2YMKA 4A7PA 3D70A 2R3CA 2J58A 1VQPP 2BEQD 1OMIA 1ZRTE 1SQQK 2YXQB 4L74A 2Q7CA 2E42A 1PZQA 3H6PA 1GL2B 3A5TA 3Q5SA 4QMAA 3G3ZA 2B88A 4YPCA 3L74E 4PV1D 4RESB 2FFDA 1HGVA 3IFMA 2GA1A 1MKMA 2KNCB 3A0HH 4UB8E 5AVZB 2FFDB 3CX5D 1J1DB 1ZV8A 3HE5B 1YHQP 5KAIE 5KLIC 1L4AA 2RKLA 3CPWO 3CXHH 2ZVOB 4GIFA 3CWBJ 3ZDMA 1NTKE 4WVZA 1NVOA 2OYHC 4AUWA 1BGYE 2IBZD 3IAOA 4WY4D 5APTA 5APXA 4AQRD 1S9KE 3H1LE 1R8EA 2YXRB 1ZP0C 1MFZA 2W6JH 2AXTH 4H0LC 4JYCA 3BATA 1N73A 2WSEJ 3AEGC 1LNQA 1W5CE 3IF4A 1FBMA 3AE6C 3H1KE 4PD4D 3OJAB 4RO0A 5APQA 2KSEA 5AVSB 1SQQE 3PP5A 3NMDA 1HWTC 2W27A 3CMEP 2G3AA 2IYPA 3CCQP 1TU3F 1OW8A 4H13B 5APYA 2O01N 1GW4A 3ITKA 1JCDA 1JM0A 3PTZA 4N78E 3V2RA 2IFMA 2KLVA 1H0TB 3A0HE 3OA7A 5KKZB 2ZJSE 1JY3P 2WPVB 1NTME 1JY3O 3KZIH 5CMZA 1LJ2A 1WMKA 5KTBA 3RBZA 3HUSC 2IX7C 2OGUA 1PGOA 3V4QA 3L35A 2AXCA 2O3JA 3CC4P 1KYOD 1K04A 5AW2B 1MZ9A 4W80A 1EZVI 1S5LH 1T2KD 2E76D 1N7SA 1N86A 1OW7A 2B9BA 2FXPA 1RQUA 2M3EA 1JTHA 1M57D 2N1TA 5AVQB 4JBZA 4U3FE 1JMBA 2RH0A 1KB9E 3MD0A 5H2FE 5M1BA 3OAKA 3MGNA 3VP9A 1VF5D 1SQQD 4Y99C 3VMXA 3GF3A 3RK3B 4HH2A 2E5TA 4TT3H 1PP9G 3GHGA 3VN0A 3BCCG 1LTJA 3A7OA 1UIXA 1RE4A 2KOGA 3G4SP 3HE4B 1FZGA 2RN0A 1KFMA 4JYBA 1IFMA 4ZKPA 1OZHA 1K8AQ 1EDIA 1AJYA 3CCMP 1QGKB 3TYYA 1L4AB 5CBOA 1VQKP 3O6QB 4OGQC 3SWYA 1HVVA 3EQ2A 3KZIE 4EDFA 2JWDA 1T3JA 5KLIB 1VQNP 2JDIH 2HPCB 3BCCJ 3S9OA 1KILD 3H1KJ 1VQLP 2L91A 3H1JG 1VF5C 3QWOC 4EOTA 1CW5A 1QEXA 1M8OB 1MFTA 1VQ8P 1JO5A 3RK3C 3QH9A 3L75D 2IZ0A 2JR8A 3L74G 4EIJA 1HGZA 4BWNA 1BGYJ 1QX8A 2J5UA 1LT9A 2Q6QA 2Y9YA 1N73B 2FKWB 3RBXA 1BCCJ 2JJLA 1Q86Q 2OTKE 2XU6A 1LT9B 2ZYDA 2IFNA 1FS0E 1NU1K 3I5CA 1SQVD 3HTKA 1S5LX 4KHXA 1PIXA 3L70E 1JUNA 5KKZC 3M06A 1BSHA 2R3SA 3H1KG 1BCCE 2M3BA 5APUA 3HE5A 3FXEA 3L37A 4GODA 1FOSF 2KYVA 1FAVA 2YO2A 1NH4A 2B87B 2FXOA 3P8CE 4GOEA 1JMMA 4NPFX 3S1KA 1Q82Q 1EXIA 3VMYA 2WT7B 3H1LJ 2A45G 5H2FH 3V4WA 2ZYGA 4DJGA 1DH3A 3JC22 2HFED 1X8YA 3FGAD 1G1JA 2M8RA 1NTMG 1AVOA 1OWAA 2OQQA 3JCUE 5AW9B 1T6AA 3HD7A 3TGUE 3A2AA 1CSBA 1A02F 1NTZJ 1T3UA 3CCVP 5B66H 2KS1A 1FZFA 4JF7A 1LTIC 2H7HA 3USSA 2BCCG 1YQ3C 1KYOI 2FYUK 2ZYAA 3M0DC 3R2PA 3M9BA 1RQVA 1PGJA 2H8PD 1GK4A 1KILA 3L75J 3MUDC 4OGQD 4WB4A 2K9JB 3GF7A 3LIDA 5AVUB 1M90Q 2OYIC 3H1JJ 3GW6A 4H0LB 1OW6A 2Q5UA 2AEMA 2WSCH 1FZBA 2PFXA 3MUDA 1GL2C 5GTHE 2CPBA 1FZEA 1PP9E 1ZXGA 2LXCB 3CCUP 5KLVE 1LTAC 1RHZB 3BRVB 4WBAA 1EXJA 4PD4E 3VTPC 1BDCA 4C46A 3T97A 1SQVG 1EDJA 2QRXA 1SFCB 4DT0A 2KP8A 4LGDE 4I6MC 3B5NA 2A45H 2K3RA 2HODA 3Q1MA 1EDKA 3H1ID 3SFDC 2I1KA 2Z4EA 3L73D 1YIJP 1BSNA 3P8MC 3V6IA 3L72E 1PP9D 2AXTE 4HB1A 4PD4H 1OXZA 1JY3N 1N7LA 2O01H 3PH0A 2YKOA 2E76C 1KFNA 2GUVA 1Z56A 1GL2D 1NU1E 2LR2A 4IL6E 1CZQA 2QM8A 5AW0B 1DIPA 1SQVJ 1SQBE 2QVAA 2YKPA 3H1IE 4BRYB 4C7NB 2IYOA 1YTZI 2KIKA 2OYOA 2P7JA 1FZAA 3HD7D 2H89C 2FY8A 3HUSA 3L73E 1IFNA 2A06E 5AVTB 1M7LA 3AE1C 3FWLA 2QIWA 5KJ7A 3CCRP 1SS1A 1KQFB 3AEEC 3CC2P 1H0TA 3ABVC 1CI6A 3PHLA 2N9YB 1QLED 4U7JA 4DCKA 3V2PA 4EYYQ 5KJ7C 1YJNP 1KB9D 2QSIA 4HJGH 4K3AA 1KD1Q 2FYUJ 1RF0A 2MJZA 2KUBA 3CCJP 1DD4A 1X79B 1U7MA 1HUCA 3P8CD 3RGUA 5CJ4A 5K5GB 1IK9A 1BE3D 1YYCA 2R5BA 3PJSK 4I7ZC 2WT7A 4JQ0D 1WT6A 2IPPA 4I2LC 3M91A 3VMZA 2NRGA 1JCCA 3H1HG 1ZMEC 3FXDA 1URQD 4D6TJ 2C9NY 4BRYA 1FJKA 1SQXK 3CWBE 1S5LE 4C7NA 4XA4A 2FYNC 1NU1D 1Y9BA 1IFIA 3JSVC 4IFDK 1RE3A 2L5GB 1L0LD 1N7SD 2N1TD 3RK3D 2Y0CA 3LIEA 3VMAA 1P84E 1GD2E 3WU2H 3SWFA 1GK6A 2XV5A 2O1KA 3PRJA 4UB6H 3Q3DA 3RL0D 3TNUB 2LXBA 5AW1B 2QJYC 1EQ7A 4GKGA 1BCCD 3AEAC 3E1RA 3FWNA 1SQXJ 4U3FG 2KZJA 3D6YA 3L72G 3CC7P 1E79H 2WPSA 2Q1KA 2W83C 3AE9C 3L73J 2BEZF 2E74C 1RF1A 2GM4A 3CX5E 3L70D 4GT1A 1FE6A 1NAFA 3A0BE 2KZIA 3B4SA 3G9RA 5E79H 1W2EA 2K1AA 2BCCE 3CL3D 3CLQA 2QA4P 2AEJA 1RF1C 2KSJA 1FZCC 1P84D 2K9YA 2XNDH 5B5EE 1LTJB 3K5BA 1KYOH 3HRNA 2XKMA 2IBZG 2Y0DA 4PV1C 4ASVA 2WZ7A 1AV1A
chains in the Genus database with same CATH topology
1QL1A 2YMYA 4I1LA 4AYCA 1DX7A 2WWWA 2Q3IA 1KQLA 1XTCC 1JNMA 4B86A 2P2UA 2CPSA 3TK1A 1M1JB 3M9QA 5AW3B 1WRGA 2HLOA 1M1JA 3HUSB 3O8ZA 5AW8B 3VOPA 2NPSA 2HODB 4DOJA 4XE5B 2R5DA 5AVWB 2J59M 3BASA 2OYIA 1LTTC 1NTMK 4N6JA 2OARA 5CCHD 2YO3A 1GL2A 3IR9A 4HYTB 1J1DC 2FFDC 3HTKB 3L36A 1HJBA 3NXSA 2POHA 5KJ7D 1JY2N 4N78D 1LWUB 5CCGA 3NFQA 2OYHA 3LW5H 3A3YB 1FZCB 2PAJA 4LC1A 2XDJA 1GU5A 3BRTB 1QL2A 2HG5D 5CCHC 1N73C 1RF1B 1L4AD 1N7SC 2N1TC 3UIAA 5AVRB 2P67A 3WMM0 3KQGA 4W7ZA 4WY4A 5CCGD 1YTZT 3KPEA 4IFMA 2E43A 1RF0C 4W7YA 1NHLA 1ZR4A 1HBWA 1FJPA 4LLHA 3HD7B 3KDPB 3RK2C 1URQA 1DEBA 3HE4A 1RE4C 3V2QA 3B8EB 3N7NA 3M9HA 3U1CA 1L0NK 1RE3C 2KB7P 1SQVK 1T2KC 4C7RA 3EFGA 1NKNA 3RK2D 3GHGB 3U1AA 1LT9C 3B5ND 5AVVB 1JY2P 3RL0C 3TNUA 1ZR2A 1T8ZA 1KILB 4N3YB 2R32A 1NKZB 2FXMA 1LGHB 1FZCA 2W6BA 1IFDA 1G1IA 1GZLA 1G2CB 1LWUA 1RY3A 2YKQA 3H32B 1IC2A 1L0LK 2QM7A 5AW7B 3M0DA 3MIWA 1AQ5A 1H88A 3RK2B 1KILC 2NPSC 3BVHA 2I1JA 1SVFA 4OH8B 1HH0A 2LKMA 2OYIB 1SLQA 3M0AA 5BVZA 2PP6A 2Z5HA 4M3LA 5BU8B 2VRSA 2WSFH 4O9BA 3II6A 1H89A 1PFIA 3V2NA 1KZUB 1L4AC 1NOHA 3N4XA 1MV8A 3B5NC 1S9KD 3C9IA 1J1EB 1VPCA 1XTGB 5CCGC 2ZFCA 2JEEA 2P1JA 3E1IA 1SQBK 5CCHA 1FOSE 1G2CA 1LTSC 4DZOA 2O1JA 1H8AA 5CJ0A 1FDMA 2YNYA 1IFJA 1NO4A 5AVYB 4WY4C 5KLVK 2H43A 2C9LY 2C0XA 1N73A 1JOCA 1JTHB 4IFFA 3NTNA 1URQB 2C0WA 1VDFA 3U59A 1NWQA 1CI6B 1GW3A 1LTJC 2WITA 5BU5A 1LTBC 1ZN5A 3VYIA 5AW4B 2N9BA 1SFCC 2GUSA 5APWA 3GHGC 2NPSB 5APVA 2BASA 1AFOA 1SFCA 1URQC 4ZKUA 2Z5IA 2OYHB 1GDTA 3MTUE 3B5NB 1N2DC 1ZLLA 1SP4A 2XNXA 1NTKK 3CI9A 1E5WA 2XZRA 1MUUA 2WPQA 2HPCA 1HTLC 3RL0B 3P7KA 1J1EC 2WPRA 1IJDB 3V5BA 1IO4A 2NPSD 2WSEH 1LTGC 2WTYA 1LWUC 1GTWA 3P32A 2ZXEB 3VP8A 3HD7C 1NTZK 3KYQA 4WY4B 4Y99B 1FU1A 1A02J 5AVXB 3H32A 1M1JC 2Q9IA 3L4FA 1SFCD 5CHXA 2HYNA 3TSIA 1SQPK 5AW6B 1X9VA 1J2JB 2A45I 2W6AA 2FYZA 1JY2O 1N7SB 2N1TB 2R3CA 2J58A 1SQQK 2Q7CA 2E42A 3H6PA 1GL2B 3A5TA 2FFDA 3G3ZA 4RESB 1HGVA 3IFMA 5AVZB 2FFDB 1J1DB 1ZV8A 3HE5B 1L4AA 4GIFA 2OYHC 4AUWA 5APTA 1S9KE 4WY4D 5APXA 4AQRD 1MFZA 4JYCA 3BATA 5AVSB 1FBMA 3OJAB 5APQA 3PP5A 3NMDA 1HWTC 2W27A 5APYA 1GW4A 1JCDA 4N78E 3V2RA 2IFMA 2KLVA 3OA7A 1JY3P 1JY3O 5CMZA 5KTBA 3HUSC 2IX7C 3V4QA 3L35A 5AW2B 1MZ9A 4W80A 1T2KD 1GU4A 1N7SA 1N86A 2N1TA 2Z4EA 4IFDK 5AVQB 1JTHA 3RK3D 2C9NY 3MD0A 3VP9A 3VMXA 3OAKA 3MGNA 4Y99C 3RK3B 4HH2A 3VN0A 3GHGA 1LTJA 3A7OA 2KOGA 1RE4A 1FZGA 3HE4B 1KFMA 4JYBA 1IFMA 4ZKPA 3TYYA 1L4AB 3SWYA 1HVVA 3EQ2A 1T3JA 2HPCB 1KILD 4EOTA 1CW5A 1JO5A 3RK3C 4EIJA 1HGZA 1N73B 1LT9A 2FKWB 2JJLA 2XU6A 1LT9B 2IFNA 1NU1K 3I5CA 3HTKA 4KHXA 1JUNA 3M06A 2M3BA 5APUA 3HE5A 3L37A 1FOSF 2KYVA 1FAVA 2YO2A 1NH4A 3P8CE 1JMMA 3VMYA 2WT7B 2A45G 3V4WA 1DH3A 2HFED 1X8YA 1G1JA 2M8RA 1OWAA 5AW9B 3HD7A 3A2AA 1CSBA 1A02F 1T3UA 1FZFA 4JF7A 1LTIC 2H7HA 2FYUK 3M0DC 3R2PA 3M9BA 2H8PD 4WB4A 5APSA 1GK4A 1KILA 2OYIC 3LIDA 5AVUB 2Q5UA 2WSCH 1FZBA 3MUDA 1GL2C 2CPBA 1FZEA 1LTAC 3BRVB 4WBAA 3VTPC 4C46A 3T97A 1SFCB 2KP8A 4LGDE 4I6MC 3B5NA 2A45H 2HODA 2I1KA 3P8MC 1OXZA 1JY3N 1N7LA 2O01H 2YKOA 1KFNA 2GUVA 1Z56A 1GL2D 1CZQA 2QM8A 5AW0B 2YKPA 4C7NB 1YTZI 2P7JA 3HD7D 3HUSA 1FZAA 5AVTB 1IFNA 1M7LA 5KJ7A 1CI6A 3V2PA 5KJ7C 1RF0A 2MJZA 1X79B 1HUCA 3P8CD 2WT7A 5CJ4A 1IK9A 1YYCA 2R5BA 1WT6A 2IPPA 4I2LC 3M91A 3VMZA 1JCCA 1URQD 4C7NA 1FJKA 1SQXK 4XA4A 1IFIA 1RE3A 2L5GB 1N7SD 2N1TD 3LIEA 1GD2E 3SWFA 1GK6A 2XV5A 2O1KA 3RL0D 3TNUB 5AW1B 1EQ7A 4GKGA 2WPSA 1RF1A 2GM4A 4GT1A 1NAFA 1W2EA 3CLQA 3CL3D 1RF1C 2KSJA 1FZCC 1LTJB 3HRNA 2XKMA 2WZ7A 5AW5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VMY A;  2WT7 B;  3V4W A;  2ZXE B;  1DH3 A;  4AYC A;  1GZL A;  1G2C B;  1X8Y A;  2WWW A;  2Q3I A;  1KQL A;  1A02 J;  2QM7 A;  1OWA A;  5AW9 B;  1JNM A;  4B86 A;  2P2U A;  3A2A A;  5AW7 B;  1CSB A;  5AVX B;  1A02 F;  3M0D A;  3TK1 A;  5AW3 B;  1H88 A;  2H7H A;  5AW6 B;  1J2J B;  2W6A A;  3M9B A;  5APS A;  3O8Z A;  1GK4 A;  1SLQ A;  5AW8 B;  3LID A;  5AVU B;  2R3C A;  2R5D A;  3M0A A;  4XE5 B;  5AVW B;  2Q5U A;  2Q7C A;  2E42 A;  3A5T A;  4RES B;  2Z5H A;  4M3L A;  2YO3 A;  3VTP C;  3IR9 A;  3T97 A;  2VRS A;  4HYT B;  5AVZ B;  4C46 A;  3HE5 B;  2KP8 A;  4I6M C;  1H89 A;  3L36 A;  1HJB A;  3NXS A;  4AUW A;  5APT A;  1S9K E;  5APX A;  1MV8 A;  3P8M C;  4AQR D;  1MFZ A;  3NFQ A;  1S9K D;  4JYC A;  1OXZ A;  3A3Y B;  5AVS B;  2ZFC A;  5APQ A;  3NMD A;  1HWT C;  2W27 A;  4LC1 A;  1FOS E;  1CZQ A;  2QM8 A;  5AW0 B;  4DZO A;  5APY A;  4C7N B;  1GU5 A;  1H8A A;  2YNY A;  2P7J A;  5AVT B;  5AVY B;  2C9L Y;  5CMZ A;  3UIA A;  3V4Q A;  1CI6 A;  3L35 A;  3NTN A;  2P67 A;  5AVR B;  3KQG A;  5AW2 B;  1NWQ A;  1T2K D;  1GU4 A;  1CI6 B;  5AVQ B;  2C9N Y;  3MD0 A;  3VMX A;  1HUC A;  3OAK A;  3MGN A;  2WT7 A;  2E43 A;  1YYC A;  2R5B A;  3VYI A;  3VN0 A;  2IPP A;  4I2L C;  5AW4 B;  3M91 A;  3A7O A;  3VMZ A;  2N9B A;  1HBW A;  3HE4 B;  3KDP B;  4JYB A;  5APW A;  4C7N A;  5APV A;  2BAS A;  3HE4 A;  3TYY A;  3B8E B;  3M9H A;  3LIE A;  1GD2 E;  2Z5I A;  3SWF A;  1GK6 A;  2XV5 A;  4EOT A;  3TNU B;  5AW1 B;  4GKG A;  1T2K C;  1SP4 A;  2WPS A;  2JJL A;  2XU6 A;  2XZR A;  1MUU A;  2WPQ A;  4GT1 A;  1NAF A;  3I5C A;  3HTK A;  5AVV B;  4KHX A;  3P7K A;  3TNU A;  1JUN A;  2WPR A;  3M06 A;  3V5B A;  2R32 A;  5APU A;  1IO4 A;  3HE5 A;  3L37 A;  2WTY A;  1FOS F;  1FAV A;  2YO2 A;  1GTW A;  3P32 A;  5AW5 B; 
#chains in the Genus database with same CATH topology
 1QL1 A;  3L75 E;  1ZRT D;  2E74 D;  2YMY A;  4D6T D;  4I1L A;  4NPD A;  4AYC A;  1GU4 A;  2OTL P;  3AED C;  2E75 B;  1Y8A A;  1DX7 A;  2K9J A;  2WWW A;  1KIL E;  2Q3I A;  2SPZ A;  1KQL A;  1VQ9 P;  1L0N D;  3L73 G;  4R4M A;  1XTC C;  1NTZ E;  1NU1 G;  4B86 A;  2P2U A;  2Y9Z A;  1OFC X;  2CPS A;  4H13 C;  1JNM A;  2P58 A;  3Q5R A;  3TK1 A;  1M1J B;  3M9Q A;  5AW3 B;  1KQG B;  5KLV J;  1WRG A;  2HLO A;  2ZXX A;  1M1J A;  3WUU A;  3L71 G;  3HUS B;  3TDK A;  3MZW B;  3O8Z A;  5AW8 B;  3H1J E;  3VOP A;  4I7Z B;  2NPS A;  3E7K A;  1M1K Q;  2HOD B;  4DOJ A;  4XE5 B;  2R5D A;  5AVW B;  3G6E P;  1PPJ G;  3L72 J;  1KB9 I;  2J59 M;  2R44 A;  3BAS A;  2A06 D;  1Q7Y Q;  2KNC A;  2KI7 B;  3OW2 O;  1LTT C;  1NTM K;  2AEF A;  2OYI A;  4N6J A;  2OAR A;  2KS1 B;  4H44 C;  1BDD A;  3SSU A;  2QJY B;  1GL2 A;  2YO3 A;  3F89 A;  1NTK D;  3IR9 A;  3LW5 J;  1J1D C;  4H13 D;  4HYT B;  1VL2 A;  2MKV A;  2FFD C;  1ZW0 A;  4PJ0 H;  1SQV E;  1HJ0 A;  1USD A;  2YIU B;  3CCS P;  1D7M A;  3HTK B;  3L36 A;  1NTM D;  3SWK A;  3TGU G;  1HJB A;  3NXS A;  3CWB G;  5E79 E;  1PP9 J;  2POH A;  5KJ7 D;  5KAI H;  1K9M Q;  1VQ4 P;  2JO1 A;  1JY2 N;  2ZT9 C;  4N78 D;  1LWU B;  5CCG A;  3H1I J;  3NFQ A;  1X22 A;  5CCH D;  2OYH A;  2B87 A;  1X0T A;  3LW5 H;  3CMA P;  3A3Y B;  3F5H A;  2E76 B;  3H1H D;  1SQP J;  4HKZ H;  1FZC B;  1VQM P;  2D2C D;  2IDB A;  2PAJ A;  2FYU E;  1EZV D;  2UWJ E;  1L0N G;  4H44 B;  3L70 J;  4OWF A;  4LC1 A;  4YXW H;  2XDJ A;  2PGD A;  2V4H A;  1GU5 A;  3BRT B;  4UB6 E;  1BE3 J;  1QL2 A;  2HG5 D;  3MHV A;  4H44 D;  5CCH C;  1NAY A;  1N73 C;  1RF1 B;  2E75 C;  4UB8 H;  1BGY D;  1K73 Q;  2P10 A;  1YJ9 P;  1L4A D;  3D6Z A;  1N7S C;  2N1T C;  1Q81 Q;  1PGQ A;  3UIA A;  4EI2 A;  4PD4 I;  5AVR B;  2P67 A;  5GTH H;  3KQG A;  3JCU H;  4W7Z A;  4WY4 A;  3WMM 0;  1BCC G;  4U3F D;  1VQ6 P;  3WUV A;  3L71 J;  1NU1 J;  1YTZ T;  5CCG D;  2Q3E A;  4BXL A;  1NYH A;  1U57 A;  1L0L E;  1USE A;  1L0L J;  1M56 D;  3KPE A;  4IFM A;  5KAF H;  2E75 D;  2E43 A;  1EZV E;  1KV4 A;  2QJK B;  3G71 P;  1RF0 C;  4W7Y A;  1NHL A;  1ZR4 A;  1KYO E;  5GTI E;  1HBW A;  1FJP A;  3KXD A;  3T97 B;  4LLH A;  1NTM J;  3HD7 B;  3KDP B;  4XFJ A;  1N8R Q;  3RK2 C;  4IL6 X;  1JB0 J;  1URQ A;  3FX0 A;  1DEB A;  1L2P A;  3AE5 C;  2FYN B;  1RE4 C;  3HE4 A;  3AE7 C;  3H1L G;  1BE3 E;  3B8E B;  3KHU A;  3V2Q A;  3N7N A;  1YI2 P;  5AW5 B;  1FDO A;  3L72 D;  4OGQ B;  3H1H J;  3M9H A;  2H88 C;  1L0N K;  4D6T G;  3U1C A;  2ITA A;  1AVY A;  2V7Q H;  2BCC D;  1RE3 C;  2K88 A;  1EZV G;  1VF5 B;  2HR3 A;  3L71 E;  1YJW P;  3PLN A;  2KB7 P;  2QJK C;  1IFP A;  1SQV K;  1T2K C;  4C7R A;  3SFE C;  4PJ0 E;  3EFG A;  1NKN A;  3RK2 D;  3AE2 C;  3GHG B;  3MP7 B;  1NTZ G;  1SQX D;  3BCC E;  3Q5P A;  5EFW B;  3U1A A;  1VQ7 P;  1LT9 C;  3RL0 g;  3CCL P;  4IOI H;  3B5N D;  1DD3 A;  5AVV B;  2B89 A;  1JY2 P;  3RL0 C;  3TNU A;  1LT1 A;  1ZR2 A;  1T8Z A;  1KIL B;  4N3Y B;  2R32 A;  1NKZ B;  3Q2Y A;  1L0N E;  2FXM A;  3B71 A;  4PV1 B;  4YXD C;  3TF5 A;  1LGH B;  4GOF A;  1FZC A;  1DEE G;  2W6B A;  2WMM A;  1IFD A;  1IZN B;  4H0L D;  1G1I A;  1GZL A;  1G2C B;  1LP1 A;  1LWU A;  1RY3 A;  2FBW C;  2YKQ A;  3AEF C;  3H32 B;  1IC2 A;  3CD6 P;  1KN7 A;  1L0L K;  2QM7 A;  5AW7 B;  4KJM A;  5KLV D;  1R5L A;  3M0D A;  1OVR A;  3MIW A;  3TGU J;  1AQ5 A;  2KK7 A;  3S4R A;  3W68 A;  3RK2 B;  1KIL C;  3L74 J;  1H88 A;  2NPS C;  3BVH A;  2I1J A;  1KOR A;  1SVF A;  1KB9 H;  1ZOY C;  1FC2 C;  1SQP E;  2QJP C;  4OH8 B;  1HH0 A;  2LKM A;  2OYI B;  1SLQ A;  1Y47 A;  1QVF O;  2OTJ P;  4WWI A;  3M0A A;  5BVZ A;  1L0N J;  2FYU D;  2ZAE B;  2M5A B;  1PL5 A;  2PP6 A;  3GLM A;  1EC5 A;  2CK3 H;  1BE3 G;  2Z5H A;  4M3L A;  5BU8 B;  3H1H E;  2VRS A;  1S72 P;  2WSF H;  1OX3 A;  1VQ5 P;  4O9B A;  1AA0 A;  5B5E H;  2W8Z A;  2QG4 A;  2YIU C;  2JWA A;  4CPG A;  2D2C B;  2I8D A;  3H1K D;  3II6 A;  1H89 A;  1PFI A;  3CCE P;  1AQT A;  3V2N A;  3A0B H;  1KZU B;  1L4A C;  1NOH A;  3CXH D;  1MV8 A;  3N4X A;  2QEX P;  4Y28 J;  3B5N C;  2NZ2 A;  1PPJ E;  2IBZ E;  1S9K D;  2E5Y A;  1L0L G;  1J1E B;  3C9I A;  4OVN F;  1S1C X;  1VPC A;  4R4L A;  1XTG B;  1KC8 Q;  2K37 A;  5CCG C;  2ZFC A;  2ZVN B;  2JEE A;  1KMI Z;  1NTK J;  2P1J A;  1SQB K;  3E1I A;  3L71 D;  5CCH A;  3D71 A;  2IBZ I;  1W2B O;  5DJU B;  1SQP D;  3CXH E;  1FOS E;  1G2C A;  1LP1 B;  1LTS C;  5DJT B;  2WVR A;  4DZO A;  1PPJ D;  2O1J A;  3GG2 A;  4Z1M H;  1SQB G;  1H8A A;  5CJ0 A;  1FDM A;  2YNY A;  4L73 A;  1IFJ A;  1NO4 A;  2WSS H;  4WY4 C;  5AVY B;  5KLV K;  2H43 A;  2C9L Y;  2IZ1 A;  2C0X A;  2DW3 A;  5APS A;  1JOC A;  1JTH B;  1NTK G;  4IFF A;  3EWK A;  3L70 G;  4TLF A;  3W67 A;  3NTN A;  5TIS H;  1URQ B;  3L75 G;  1PV3 A;  2C0W A;  1U7J A;  1VDF A;  3U59 A;  1NWQ A;  1CI6 B;  1NGM B;  2KLU A;  2FYU G;  5TIS E;  4ZNC A;  4U3F J;  1GW3 A;  1LTJ C;  1PGP A;  1RH5 B;  1LTB C;  2WIT A;  4MN4 C;  5BU5 A;  3R4Y A;  1KTM A;  1ZN5 A;  3AE4 C;  4GDO A;  3VYI A;  5B66 E;  5AW4 B;  5KAF E;  1Q90 D;  2M5A A;  2N9B A;  1IK7 A;  1S2E A;  1SFC C;  3O6Q A;  2GUS A;  4K35 A;  4L76 A;  5L8R J;  5APW A;  3CX5 I;  3GHG C;  1YQ4 C;  2NPS B;  4IL6 H;  2KXP B;  2BAS A;  5APV A;  2WSF J;  4RJT A;  1AFO A;  1SFC A;  3C8V A;  3H25 A;  1SQX E;  2ZT9 B;  1R5S A;  1URQ C;  4ZKU A;  4KT0 J;  3RK3 E;  1JEK A;  1S4X A;  5TJH A;  2Z5I A;  1SQQ J;  2OYH B;  1GDT A;  2WSC J;  3GMA A;  4NPE A;  2PRR A;  3MTU E;  4JPZ B;  4ASW A;  1SQP G;  3B5N B;  1N2D C;  2BCC J;  1FDI A;  1P84 I;  2G8Y A;  1ZLL A;  2Y0E A;  1SQB D;  4ZMD A;  1SP4 A;  5KLV G;  3WU2 E;  2XNX A;  3I55 P;  3CX5 H;  1NTK K;  2A06 G;  2D2C C;  3C1L A;  1EDL A;  2QE7 H;  3CI9 A;  1E5W A;  2XZR A;  1MUU A;  1SQQ G;  2V7Q J;  2WPQ A;  2HPC A;  1HTL C;  2E74 B;  2JP3 A;  1QVG O;  2M0B A;  3BCC D;  3RL0 B;  3WUT A;  3P7K A;  1J1E C;  2WPR A;  1IJD B;  1OVV A;  3V5B A;  3TGU D;  1IO4 A;  2NPS D;  2WSE H;  3CWB D;  1LTG C;  3H1L D;  5GTI H;  3CXH I;  2WTY A;  1VQO P;  1HF9 A;  1P84 H;  1LWU C;  3AE8 C;  1YIT P;  1GTW A;  2ZT9 D;  3P32 A;  3AEB C;  2O01 J;  2ZXE B;  1UII A;  2WQY C;  3IN6 A;  3VP8 A;  3HD7 C;  1OVU A;  3H1J D;  1NTZ K;  5C39 A;  3AE3 C;  3KYQ A;  3H1I G;  4WY4 B;  4Y99 B;  1FU1 A;  2JKV A;  3I56 P;  1A02 J;  4L75 A;  3AEC C;  2W90 A;  3L74 D;  1GMJ A;  1K05 A;  3H32 A;  1M1J C;  5AVX B;  5CBN A;  4YTP C;  3L4F A;  1SFC D;  5CHX A;  2HYN A;  3TSI A;  1NJI Q;  2Q9I A;  1SQP K;  1BGY G;  5AW6 B;  1OIP A;  1NTZ D;  1J2J B;  1SQX G;  1X9V A;  2A45 I;  2QJP B;  2RMZ A;  2W6A A;  2FYZ A;  3EFF K;  4D6T E;  1JY2 O;  1N7S B;  1S3J A;  1YBK A;  2N1T B;  4RKU J;  1KQS O;  1Q2N A;  1SQB J;  2YMK A;  4A7P A;  3D70 A;  2R3C A;  2J58 A;  1VQP P;  2BEQ D;  1OMI A;  1ZRT E;  1SQQ K;  2YXQ B;  4L74 A;  2Q7C A;  2E42 A;  1PZQ A;  3H6P A;  1GL2 B;  3A5T A;  3Q5S A;  4QMA A;  3G3Z A;  2B88 A;  4YPC A;  3L74 E;  4PV1 D;  4RES B;  2FFD A;  1HGV A;  3IFM A;  2GA1 A;  1MKM A;  2KNC B;  3A0H H;  4UB8 E;  5AVZ B;  2FFD B;  3CX5 D;  1J1D B;  1ZV8 A;  3HE5 B;  1YHQ P;  5KAI E;  5KLI C;  1L4A A;  2RKL A;  3CPW O;  3CXH H;  2ZVO B;  4GIF A;  3CWB J;  3ZDM A;  1NTK E;  4WVZ A;  1NVO A;  2OYH C;  4AUW A;  1BGY E;  2IBZ D;  3IAO A;  4WY4 D;  5APT A;  5APX A;  4AQR D;  1S9K E;  3H1L E;  1R8E A;  2YXR B;  1ZP0 C;  1MFZ A;  2W6J H;  2AXT H;  4H0L C;  4JYC A;  3BAT A;  1N73 A;  2WSE J;  3AEG C;  1LNQ A;  1W5C E;  3IF4 A;  1FBM A;  3AE6 C;  3H1K E;  4PD4 D;  3OJA B;  4RO0 A;  5APQ A;  2KSE A;  5AVS B;  1SQQ E;  3PP5 A;  3NMD A;  1HWT C;  2W27 A;  3CME P;  2G3A A;  2IYP A;  3CCQ P;  1TU3 F;  1OW8 A;  4H13 B;  5APY A;  2O01 N;  1GW4 A;  3ITK A;  1JCD A;  1JM0 A;  3PTZ A;  4N78 E;  3V2R A;  2IFM A;  2KLV A;  1H0T B;  3A0H E;  3OA7 A;  5KKZ B;  2ZJS E;  1JY3 P;  2WPV B;  1NTM E;  1JY3 O;  3KZI H;  5CMZ A;  1LJ2 A;  1WMK A;  5KTB A;  3RBZ A;  3HUS C;  2IX7 C;  2OGU A;  1PGO A;  3V4Q A;  3L35 A;  2AXC A;  2O3J A;  3CC4 P;  1KYO D;  1K04 A;  5AW2 B;  1MZ9 A;  4W80 A;  1EZV I;  1S5L H;  1T2K D;  2E76 D;  1N7S A;  1N86 A;  1OW7 A;  2B9B A;  2FXP A;  1RQU A;  2M3E A;  1JTH A;  1M57 D;  2N1T A;  5AVQ B;  4JBZ A;  4U3F E;  1JMB A;  2RH0 A;  1KB9 E;  3MD0 A;  5H2F E;  5M1B A;  3OAK A;  3MGN A;  3VP9 A;  1VF5 D;  1SQQ D;  4Y99 C;  3VMX A;  3GF3 A;  3RK3 B;  4HH2 A;  2E5T A;  4TT3 H;  1PP9 G;  3GHG A;  3VN0 A;  3BCC G;  1LTJ A;  3A7O A;  1UIX A;  1RE4 A;  2KOG A;  3G4S P;  3HE4 B;  1FZG A;  2RN0 A;  1KFM A;  4JYB A;  1IFM A;  4ZKP A;  1OZH A;  1K8A Q;  1EDI A;  1AJY A;  3CCM P;  1QGK B;  3TYY A;  1L4A B;  5CBO A;  1VQK P;  3O6Q B;  4OGQ C;  3SWY A;  1HVV A;  3EQ2 A;  3KZI E;  4EDF A;  2JWD A;  1T3J A;  5KLI B;  1VQN P;  2JDI H;  2HPC B;  3BCC J;  3S9O A;  1KIL D;  3H1K J;  1VQL P;  2L91 A;  3H1J G;  1VF5 C;  3QWO C;  4EOT A;  1CW5 A;  1QEX A;  1M8O B;  1MFT A;  1VQ8 P;  1JO5 A;  3RK3 C;  3QH9 A;  3L75 D;  2IZ0 A;  2JR8 A;  3L74 G;  4EIJ A;  1HGZ A;  4BWN A;  1BGY J;  1QX8 A;  2J5U A;  1LT9 A;  2Q6Q A;  2Y9Y A;  1N73 B;  2FKW B;  3RBX A;  1BCC J;  2JJL A;  1Q86 Q;  2OTK E;  2XU6 A;  1LT9 B;  2ZYD A;  2IFN A;  1FS0 E;  1NU1 K;  3I5C A;  1SQV D;  3HTK A;  1S5L X;  4KHX A;  1PIX A;  3L70 E;  1JUN A;  5KKZ C;  3M06 A;  1BSH A;  2R3S A;  3H1K G;  1BCC E;  2M3B A;  5APU A;  3HE5 A;  3FXE A;  3L37 A;  4GOD A;  1FOS F;  2KYV A;  1FAV A;  2YO2 A;  1NH4 A;  2B87 B;  2FXO A;  3P8C E;  4GOE A;  1JMM A;  4NPF X;  3S1K A;  1Q82 Q;  1EXI A;  3VMY A;  2WT7 B;  3H1L J;  2A45 G;  5H2F H;  3V4W A;  2ZYG A;  4DJG A;  1DH3 A;  3JC2 2;  2HFE D;  1X8Y A;  3FGA D;  1G1J A;  2M8R A;  1NTM G;  1AVO A;  1OWA A;  2OQQ A;  3JCU E;  5AW9 B;  1T6A A;  3HD7 A;  3TGU E;  3A2A A;  1CSB A;  1A02 F;  1NTZ J;  1T3U A;  3CCV P;  5B66 H;  2KS1 A;  1FZF A;  4JF7 A;  1LTI C;  2H7H A;  3USS A;  2BCC G;  1YQ3 C;  1KYO I;  2FYU K;  2ZYA A;  3M0D C;  3R2P A;  3M9B A;  1RQV A;  1PGJ A;  2H8P D;  1GK4 A;  1KIL A;  3L75 J;  3MUD C;  4OGQ D;  4WB4 A;  2K9J B;  3GF7 A;  3LID A;  5AVU B;  1M90 Q;  2OYI C;  3H1J J;  3GW6 A;  4H0L B;  1OW6 A;  2Q5U A;  2AEM A;  2WSC H;  1FZB A;  2PFX A;  3MUD A;  1GL2 C;  5GTH E;  2CPB A;  1FZE A;  1PP9 E;  1ZXG A;  2LXC B;  3CCU P;  5KLV E;  1LTA C;  1RHZ B;  3BRV B;  4WBA A;  1EXJ A;  4PD4 E;  3VTP C;  1BDC A;  4C46 A;  3T97 A;  1SQV G;  1EDJ A;  2QRX A;  1SFC B;  4DT0 A;  2KP8 A;  4LGD E;  4I6M C;  3B5N A;  2A45 H;  2K3R A;  2HOD A;  3Q1M A;  1EDK A;  3H1I D;  3SFD C;  2I1K A;  2Z4E A;  3L73 D;  1YIJ P;  1BSN A;  3P8M C;  3V6I A;  3L72 E;  1PP9 D;  2AXT E;  4HB1 A;  4PD4 H;  1OXZ A;  1JY3 N;  1N7L A;  2O01 H;  3PH0 A;  2YKO A;  2E76 C;  1KFN A;  2GUV A;  1Z56 A;  1GL2 D;  1NU1 E;  2LR2 A;  4IL6 E;  1CZQ A;  2QM8 A;  5AW0 B;  1DIP A;  1SQV J;  1SQB E;  2QVA A;  2YKP A;  3H1I E;  4BRY B;  4C7N B;  2IYO A;  1YTZ I;  2KIK A;  2OYO A;  2P7J A;  1FZA A;  3HD7 D;  2H89 C;  2FY8 A;  3HUS A;  3L73 E;  1IFN A;  2A06 E;  5AVT B;  1M7L A;  3AE1 C;  3FWL A;  2QIW A;  5KJ7 A;  3CCR P;  1SS1 A;  1KQF B;  3AEE C;  3CC2 P;  1H0T A;  3ABV C;  1CI6 A;  3PHL A;  2N9Y B;  1QLE D;  4U7J A;  4DCK A;  3V2P A;  4EYY Q;  5KJ7 C;  1YJN P;  1KB9 D;  2QSI A;  4HJG H;  4K3A A;  1KD1 Q;  2FYU J;  1RF0 A;  2MJZ A;  2KUB A;  3CCJ P;  1DD4 A;  1X79 B;  1U7M A;  1HUC A;  3P8C D;  3RGU A;  5CJ4 A;  5K5G B;  1IK9 A;  1BE3 D;  1YYC A;  2R5B A;  3PJS K;  4I7Z C;  2WT7 A;  4JQ0 D;  1WT6 A;  2IPP A;  4I2L C;  3M91 A;  3VMZ A;  2NRG A;  1JCC A;  3H1H G;  1ZME C;  3FXD A;  1URQ D;  4D6T J;  2C9N Y;  4BRY A;  1FJK A;  1SQX K;  3CWB E;  1S5L E;  4C7N A;  4XA4 A;  2FYN C;  1NU1 D;  1Y9B A;  1IFI A;  3JSV C;  4IFD K;  1RE3 A;  2L5G B;  1L0L D;  1N7S D;  2N1T D;  3RK3 D;  2Y0C A;  3LIE A;  3VMA A;  1P84 E;  1GD2 E;  3WU2 H;  3SWF A;  1GK6 A;  2XV5 A;  2O1K A;  3PRJ A;  4UB6 H;  3Q3D A;  3RL0 D;  3TNU B;  2LXB A;  5AW1 B;  2QJY C;  1EQ7 A;  4GKG A;  1BCC D;  3AEA C;  3E1R A;  3FWN A;  1SQX J;  4U3F G;  2KZJ A;  3D6Y A;  3L72 G;  3CC7 P;  1E79 H;  2WPS A;  2Q1K A;  2W83 C;  3AE9 C;  3L73 J;  2BEZ F;  2E74 C;  1RF1 A;  2GM4 A;  3CX5 E;  3L70 D;  4GT1 A;  1FE6 A;  1NAF A;  3A0B E;  2KZI A;  3B4S A;  3G9R A;  5E79 H;  1W2E A;  2K1A A;  2BCC E;  3CL3 D;  3CLQ A;  2QA4 P;  2AEJ A;  1RF1 C;  2KSJ A;  1FZC C;  1P84 D;  2K9Y A;  2XND H;  5B5E E;  1LTJ B;  3K5B A;  1KYO H;  3HRN A;  2XKM A;  2IBZ G;  2Y0D A;  4PV1 C;  4ASV A;  2WZ7 A;  1AV1 A; 
#chains in the Genus database with same CATH homology
 1QL1 A;  2YMY A;  4I1L A;  4AYC A;  1DX7 A;  2WWW A;  2Q3I A;  1KQL A;  1XTC C;  1JNM A;  4B86 A;  2P2U A;  2CPS A;  3TK1 A;  1M1J B;  3M9Q A;  5AW3 B;  1WRG A;  2HLO A;  1M1J A;  3HUS B;  3O8Z A;  5AW8 B;  3VOP A;  2NPS A;  2HOD B;  4DOJ A;  4XE5 B;  2R5D A;  5AVW B;  2J59 M;  3BAS A;  2OYI A;  1LTT C;  1NTM K;  4N6J A;  2OAR A;  5CCH D;  2YO3 A;  1GL2 A;  3IR9 A;  4HYT B;  1J1D C;  2FFD C;  3HTK B;  3L36 A;  1HJB A;  3NXS A;  2POH A;  5KJ7 D;  1JY2 N;  4N78 D;  1LWU B;  5CCG A;  3NFQ A;  2OYH A;  3LW5 H;  3A3Y B;  1FZC B;  2PAJ A;  4LC1 A;  2XDJ A;  1GU5 A;  3BRT B;  1QL2 A;  2HG5 D;  5CCH C;  1N73 C;  1RF1 B;  1L4A D;  1N7S C;  2N1T C;  3UIA A;  5AVR B;  2P67 A;  3WMM 0;  3KQG A;  4W7Z A;  4WY4 A;  5CCG D;  1YTZ T;  3KPE A;  4IFM A;  2E43 A;  1RF0 C;  4W7Y A;  1NHL A;  1ZR4 A;  1HBW A;  1FJP A;  4LLH A;  3HD7 B;  3KDP B;  3RK2 C;  1URQ A;  1DEB A;  3HE4 A;  1RE4 C;  3V2Q A;  3B8E B;  3N7N A;  3M9H A;  3U1C A;  1L0N K;  1RE3 C;  2KB7 P;  1SQV K;  1T2K C;  4C7R A;  3EFG A;  1NKN A;  3RK2 D;  3GHG B;  3U1A A;  1LT9 C;  3B5N D;  5AVV B;  1JY2 P;  3RL0 C;  3TNU A;  1ZR2 A;  1T8Z A;  1KIL B;  4N3Y B;  2R32 A;  1NKZ B;  2FXM A;  1LGH B;  1FZC A;  2W6B A;  1IFD A;  1G1I A;  1GZL A;  1G2C B;  1LWU A;  1RY3 A;  2YKQ A;  3H32 B;  1IC2 A;  1L0L K;  2QM7 A;  5AW7 B;  3M0D A;  3MIW A;  1AQ5 A;  1H88 A;  3RK2 B;  1KIL C;  2NPS C;  3BVH A;  2I1J A;  1SVF A;  4OH8 B;  1HH0 A;  2LKM A;  2OYI B;  1SLQ A;  3M0A A;  5BVZ A;  2PP6 A;  2Z5H A;  4M3L A;  5BU8 B;  2VRS A;  2WSF H;  4O9B A;  3II6 A;  1H89 A;  1PFI A;  3V2N A;  1KZU B;  1L4A C;  1NOH A;  3N4X A;  1MV8 A;  3B5N C;  1S9K D;  3C9I A;  1J1E B;  1VPC A;  1XTG B;  5CCG C;  2ZFC A;  2JEE A;  2P1J A;  3E1I A;  1SQB K;  5CCH A;  1FOS E;  1G2C A;  1LTS C;  4DZO A;  2O1J A;  1H8A A;  5CJ0 A;  1FDM A;  2YNY A;  1IFJ A;  1NO4 A;  5AVY B;  4WY4 C;  5KLV K;  2H43 A;  2C9L Y;  2C0X A;  1N73 A;  1JOC A;  1JTH B;  4IFF A;  3NTN A;  1URQ B;  2C0W A;  1VDF A;  3U59 A;  1NWQ A;  1CI6 B;  1GW3 A;  1LTJ C;  2WIT A;  5BU5 A;  1LTB C;  1ZN5 A;  3VYI A;  5AW4 B;  2N9B A;  1SFC C;  2GUS A;  5APW A;  3GHG C;  2NPS B;  5APV A;  2BAS A;  1AFO A;  1SFC A;  1URQ C;  4ZKU A;  2Z5I A;  2OYH B;  1GDT A;  3MTU E;  3B5N B;  1N2D C;  1ZLL A;  1SP4 A;  2XNX A;  1NTK K;  3CI9 A;  1E5W A;  2XZR A;  1MUU A;  2WPQ A;  2HPC A;  1HTL C;  3RL0 B;  3P7K A;  1J1E C;  2WPR A;  1IJD B;  3V5B A;  1IO4 A;  2NPS D;  2WSE H;  1LTG C;  2WTY A;  1LWU C;  1GTW A;  3P32 A;  2ZXE B;  3VP8 A;  3HD7 C;  1NTZ K;  3KYQ A;  4WY4 B;  4Y99 B;  1FU1 A;  1A02 J;  5AVX B;  3H32 A;  1M1J C;  2Q9I A;  3L4F A;  1SFC D;  5CHX A;  2HYN A;  3TSI A;  1SQP K;  5AW6 B;  1X9V A;  1J2J B;  2A45 I;  2W6A A;  2FYZ A;  1JY2 O;  1N7S B;  2N1T B;  2R3C A;  2J58 A;  1SQQ K;  2Q7C A;  2E42 A;  3H6P A;  1GL2 B;  3A5T A;  2FFD A;  3G3Z A;  4RES B;  1HGV A;  3IFM A;  5AVZ B;  2FFD B;  1J1D B;  1ZV8 A;  3HE5 B;  1L4A A;  4GIF A;  2OYH C;  4AUW A;  5APT A;  1S9K E;  4WY4 D;  5APX A;  4AQR D;  1MFZ A;  4JYC A;  3BAT A;  5AVS B;  1FBM A;  3OJA B;  5APQ A;  3PP5 A;  3NMD A;  1HWT C;  2W27 A;  5APY A;  1GW4 A;  1JCD A;  4N78 E;  3V2R A;  2IFM A;  2KLV A;  3OA7 A;  1JY3 P;  1JY3 O;  5CMZ A;  5KTB A;  3HUS C;  2IX7 C;  3V4Q A;  3L35 A;  5AW2 B;  1MZ9 A;  4W80 A;  1T2K D;  1GU4 A;  1N7S A;  1N86 A;  2N1T A;  2Z4E A;  4IFD K;  5AVQ B;  1JTH A;  3RK3 D;  2C9N Y;  3MD0 A;  3VP9 A;  3VMX A;  3OAK A;  3MGN A;  4Y99 C;  3RK3 B;  4HH2 A;  3VN0 A;  3GHG A;  1LTJ A;  3A7O A;  2KOG A;  1RE4 A;  1FZG A;  3HE4 B;  1KFM A;  4JYB A;  1IFM A;  4ZKP A;  3TYY A;  1L4A B;  3SWY A;  1HVV A;  3EQ2 A;  1T3J A;  2HPC B;  1KIL D;  4EOT A;  1CW5 A;  1JO5 A;  3RK3 C;  4EIJ A;  1HGZ A;  1N73 B;  1LT9 A;  2FKW B;  2JJL A;  2XU6 A;  1LT9 B;  2IFN A;  1NU1 K;  3I5C A;  3HTK A;  4KHX A;  1JUN A;  3M06 A;  2M3B A;  5APU A;  3HE5 A;  3L37 A;  1FOS F;  2KYV A;  1FAV A;  2YO2 A;  1NH4 A;  3P8C E;  1JMM A;  3VMY A;  2WT7 B;  2A45 G;  3V4W A;  1DH3 A;  2HFE D;  1X8Y A;  1G1J A;  2M8R A;  1OWA A;  5AW9 B;  3HD7 A;  3A2A A;  1CSB A;  1A02 F;  1T3U A;  1FZF A;  4JF7 A;  1LTI C;  2H7H A;  2FYU K;  3M0D C;  3R2P A;  3M9B A;  2H8P D;  4WB4 A;  5APS A;  1GK4 A;  1KIL A;  2OYI C;  3LID A;  5AVU B;  2Q5U A;  2WSC H;  1FZB A;  3MUD A;  1GL2 C;  2CPB A;  1FZE A;  1LTA C;  3BRV B;  4WBA A;  3VTP C;  4C46 A;  3T97 A;  1SFC B;  2KP8 A;  4LGD E;  4I6M C;  3B5N A;  2A45 H;  2HOD A;  2I1K A;  3P8M C;  1OXZ A;  1JY3 N;  1N7L A;  2O01 H;  2YKO A;  1KFN A;  2GUV A;  1Z56 A;  1GL2 D;  1CZQ A;  2QM8 A;  5AW0 B;  2YKP A;  4C7N B;  1YTZ I;  2P7J A;  3HD7 D;  3HUS A;  1FZA A;  5AVT B;  1IFN A;  1M7L A;  5KJ7 A;  1CI6 A;  3V2P A;  5KJ7 C;  1RF0 A;  2MJZ A;  1X79 B;  1HUC A;  3P8C D;  2WT7 A;  5CJ4 A;  1IK9 A;  1YYC A;  2R5B A;  1WT6 A;  2IPP A;  4I2L C;  3M91 A;  3VMZ A;  1JCC A;  1URQ D;  4C7N A;  1FJK A;  1SQX K;  4XA4 A;  1IFI A;  1RE3 A;  2L5G B;  1N7S D;  2N1T D;  3LIE A;  1GD2 E;  3SWF A;  1GK6 A;  2XV5 A;  2O1K A;  3RL0 D;  3TNU B;  5AW1 B;  1EQ7 A;  4GKG A;  2WPS A;  1RF1 A;  2GM4 A;  4GT1 A;  1NAF A;  1W2E A;  3CLQ A;  3CL3 D;  1RF1 C;  2KSJ A;  1FZC C;  1LTJ B;  3HRN A;  2XKM A;  2WZ7 A;  5AW5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...