1KQLA

Crystal structure of the c-terminal region of striated muscle alpha-tropomyosin at 2.7 angstrom resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
55
structure length
55
Chain Sequence
MDKVEELLSKNYHLENEVARLKKLVDDLEDELYAQKLKYKAISEELDHALNDMTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of the C-terminal fragment of striated-muscle alpha-tropomyosin reveals a key troponin T recognition site.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
molecule keywords Fusion Protein of and striated muscle alpha-tropomyosin and
total genus 22
structure length 55
sequence length 55
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1kqlA00
1H89A 2P2UA 5AVSB 3TNUA 3VN0A 3IR9A 5AW1B 4C7NA 2WTYA 2KP8A 3VYIA 1HUCA 3V4WA 3OAKA 4KHXA 2XU6A 3TYYA 3LIEA 4C46A 2C9LY 1A02F 2R32A 2Z5HA 1MV8A 1FOSE 5APVA 1FAVA 1DH3A 3M0AA 5AW4B 2WPRA 1CSBA 4GT1A 2R3CA 5APYA 2Q7CA 3TNUB 2R5BA 1IO4A 1CI6A 2N9BA 1S9KD 5AVUB 4AYCA 1HBWA 3M06A 3L37A 3KQGA 4B86A 3M91A 5AW0B 5AVRB 3L36A 4I6MC 4RESB 2VRSA 3A7OA 5AW8B 5AW5B 3A3YB 2XV5A 2WT7B 1GK6A 1H8AA 4AUWA 5AVXB 2BASA 5APWA 2ZXEB 2WWWA 2JJLA 1OWAA 2QM8A 2YNYA 1X8YA 5AVVB 4JYCA 1GD2E 3HE5B 1CI6B 5APQA 1MUUA 4LC1A 5CMZA 2IPPA 3VMYA 2E43A 1HJBA 4EOTA 2P67A 3B8EB 3L35A 5AVWB 1FOSF 2Q3IA 3M9BA 3MGNA 4JYBA 1T2KD 1YYCA 1GTWA 2WPSA 5AVZB 2R5DA 3TK1A 5AVQB 5AW3B 3VMXA 5AVYB 3I5CA 1T2KC 4XE5B 1NAFA 3MD0A 2C9NY 1JUNA 1SP4A 4C7NB 3HE5A 1H88A 2H7HA 4HYTB 3A5TA 2WPQA 3VTPC 3HE4A 1GZLA 1HWTC 1GU4A 1A02J 2XZRA 5AW2B 3VMZA 3P7KA 3LIDA 2ZFCA 3O8ZA 2Q5UA 2W27A 3P32A 5APUA 2Z5IA 3HE4B 3UIAA 3M0DA 4M3LA 1S9KE 3T97A 1SLQA 5AW7B 5APSA 1KQLA 5APTA 4I2LC 2E42A 3M9HA 3A2AA 3V4QA 2WT7A 1GU5A 2P7JA 3NMDA 2QM7A 2YO3A 5AVTB 1MFZA 3KDPB 3NXSA 4GKGA 4AQRD 3P8MC 1GK4A 3HTKA 1G2CB 1CZQA 3NFQA 5AW6B 4DZOA 1JNMA 5APXA 1OXZA 1NWQA 2W6AA 1J2JB 5AW9B 3NTNA 3V5BA 2YO2A 3SWFA
chains in the Genus database with same CATH superfamily
4MN4C 1L0LE 3Q5PA 2BCCG 1BDDA 1L0LJ 3HUSC 1Q81Q 1WMKA 1NVOA 3PJSK 3RK2C 2FBWC 3A0BE 1PZQA 2PGDA 3AE2C 3L75E 3Q2YA 1NTZE 5AW1B 1RY3A 1K05A 4C7NA 2WTYA 2KP8A 3CCEP 1HUCA 4H0LD 3V4WA 1PV3A 3AE7C 1NTMJ 1BGYJ 2XU6A 2IBZI 3TYYA 4D6TD 2OYHB 1PFIA 4WY4B 1JY3N 1PGPA 3II6A 3R2PA 1LP1B 4O9BA 3H1HJ 3GHGA 2C9LY 1OW7A 3F5HA 2QVAA 2YKOA 1OMIA 2KZIA 2R32A 1FOSE 3PH0A 1RE4A 4PV1D 3AEFC 1DH3A 1NTZG 2KSEA 4OH8B 2YIUC 2KIKA 3CCRP 1NJIQ 1L2PA 5GTIE 2G3AA 3G71P 1IFMA 1HJBA 2IYPA 1KORA 1IK7A 3QWOC 2IBZE 2Q7CA 2B89A 3CC4P 4ZKUA 5AVUB 2FXPA 3RK3C 3C1LA 1S9KD 4WB4A 2WPVB 3BRVB 3V2PA 4H44C 4B86A 3M91A 2JKVA 1X9VA 1FC2C 5AW0B 2A06E 3AE8C 1SQVK 2KS1A 1Y9BA 2O1JA 4I6MC 4NPDA 3RL0C 3Q5RA 3VOPA 1LTTC 2W6BA 4RJTA 3CXHD 3IF4A 2BEQD 2VRSA 1IFPA 1L4AA 3AE6C 3B4SA 4IFMA 2FYNC 3A3YB 1BCCE 3N7NA 1BCCD 2WT7B 1GK6A 1VF5B 1NHLA 3TGUD 4AUWA 1RH5B 1NTME 1N86A 1Q90D 2IBZG 1BGYE 3CX5I 5C39A 3L70E 2ZXEB 1X79B 4EI2A 4EIJA 3BCCD 1J1EB 2WWWA 3AECC 1OWAA 3FX0A 4LGDE 1X8YA 1L0NG 1NKZB 2E75C 2Y9YA 1FZFA 2JO1A 4RO0A 5APQA 3V2NA 3CC7P 2E76C 3H1IJ 3HUSA 1HGVA 2JWDA 2YMYA 3H1IE 3L71E 3B8EB 4PJ0E 3G4SP 2FYNB 1N7LA 2W6JH 3CWBE 4U3FD 3VP8A 1VQ5P 1SQPK 1JCCA 1FOSF 1GL2A 4JYBA 1ZN5A 1T2KD 1DEEG 3RL0B 1M8OB 3OJAB 3IAOA 3HD7B 1JCDA 1FZCA 3H1JJ 3R4YA 3MIWA 5AVQB 3EFFK 4IL6E 5KJ7A 3VMXA 3I5CA 4EDFA 2OYHA 2WMMA 1U7JA 1RE3C 1KMIZ 2P10A 3L75D 4PJ0H 3RK3B 5CBOA 1AV1A 5KLVJ 2QE7H 3FWLA 2FFDC 1QVGO 2QEXP 2AEJA 2B9BA 2XDJA 3L72D 2B87A 1YITP 1H88A 1VQ6P 2YIUB 2O01H 2IX7C 3D71A 2WPQA 1OW8A 3H32B 2KOGA 3BASA 4BRYB 5B66H 3CMAP 4H44D 1EXJA 1YI2P 1A02J 2D2CD 1Q2NA 3I55P 2KK7A 3D6ZA 1G1IA 3PP5A 4WBAA 2FYUJ 1DIPA 4N78D 1ZRTD 2Q5UA 3EFGA 3O8ZA 2J5UA 5APUA 3HE4B 3H1HD 1QEXA 1USEA 2E5YA 1Z56A 3B5ND 3H1HE 1M1JA 3RK3D 4M3LA 3UIAA 1S72P 3FWNA 1LP1A 3T97A 1U7MA 1IFDA 3L4FA 4K3AA 3JCUE 2QSIA 1QX8A 4GODA 3C8VA 3RK2B 3SSUA 1BSHA 2E5TA 1M1JC 1RF1B 1PPJG 2LXBA 1SFCC 4D6TG 2O3JA 2FYUK 3L74D 1BE3E 1SQQJ 1EDLA 4H13B 3CWBD 3CCQP 2YO3A 2L5GB 1MFZA 1ZLLA 1FS0E 4UB6H 5AVTB 2GM4A 3B5NC 1QLED 4N3YB 1AQ5A 1SFCA 1E79H 3GG2A 1PPJD 3CCMP 2IFNA 1KB9E 1GK4A 1Q86Q 2RKLA 2ZAEB 5CBNA 1FDMA 4DZOA 4PV1B 1N7SB 1M1JB 1GL2C 3TF5A 3MUDC 1PGJA 5CCHA 1AVOA 2LKMA 5B5EH 1FDOA 1JY2N 2KLUA 4RKUJ 2GUVA 3AE9C 1KYOD 3AEGC 3CCLP 2IFMA 1NU1K 1PGQA 1EZVD 3BCCJ 1EZVE 3IN6A 2FFDA 3O6QB 1IJDB 1NTKG 2AXTE 3IR9A 4PD4I 3H6PA 4L76A 1SQXK 3CXHI 4OGQC 1TU3F 3AE1C 3G3ZA 1SVFA 2HODB 3GLMA 1BGYD 2PRRA 3VYIA 5CCGA 3W67A 3L73G 5H2FH 4DOJA 3CCJP 1N7SD 1VF5D 5KLVE 2WSEJ 3Q5SA 1AVYA 3BCCG 3HTKB 2AXTH 2KXPB 2CPBA 5CCGC 1A02F 3ABVC 2OTLP 2KSJA 1NO4A 1SQXD 3CX5E 2I1KA 4IFFA 1GW3A 5KKZB 4WY4A 4XFJA 1VQ4P 2E75D 3CCUP 1T6AA 2QJYB 3V2RA 1PP9E 2D2CC 2WPRA 1CSBA 4LLHA 1PP9J 4UB8E 3SWFA 1W2EA 3L72J 1LT9B 2E74C 2XNXA 1SQBG 2R3CA 4Y99B 5APYA 1ZMEC 2R5BA 2K9JA 1FBMA 1SQXG 4Y28J 1NTMG 2N9BA 2Z4EA 1KC8Q 1T8ZA 4AYCA 1LTSC 2B87B 3L37A 1KN7A 3N4XA 1LWUA 3I56P 2WSEH 1FZGA 1JO5A 3CXHE 3WUUA 5KTBA 5BU5A 2OTKE 2YXQB 5B66E 2E75B 1P84I 3B5NA 1ZW0A 1L0LG 1OVUA 1XTCC 1VPCA 1J1EC 2PAJA 2JDIH 2R44A 5DJTB 5AW8B 3RL0g 5AW5B 4EOTA 3KZIH 1N73A 1WRGA 1FZEA 5AVXB 2BASA 2Y0CA 2ITAA 1AA0A 3MUDA 4TT3H 4U3FE 2HFED 1YHQP 1SFCD 1S2EA 3T97B 4N6JA 2JJLA 2QM8A 1GD2E 1PPJE 2QJPC 1J1DC 2YKPA 2WQYC 1KD1Q 2IPPA 2QJKB 1NTMK 3JSVC 3TGUG 4H44B 5BVZA 1BE3J 1SQQE 2V7QJ 1G2CA 2I1JA 4I7ZB 4OVNF 4L75A 3QH9A 5AVWB 3CI9A 4YTPC 3RBXA 2NPSB 2SPZA 3E1RA 2OYIA 3AE4C 1JY2P 2Q3IA 4BWNA 2Y9ZA 1DD3A 1GTWA 3KYQA 4IFDK 3RK2D 1MKMA 1LTGC 3L73E 1K8AQ 1YTZT 3L71G 1DEBA 1OX3A 1KB9H 2IDBA 3B71A 3L75J 4JF7A 5KLVD 3V2QA 1BCCJ 1FU1A 1KILD 1NAFA 2A06D 1LTIC 1NTKE 3E7KA 1RQVA 1IC2A 1HGZA 1FZBA 4HB1A 1RE4C 4R4LA 5TISE 2FY8A 2R3SA 1L0LD 3HE5A 4C7NB 2KZJA 3EQ2A 4WY4C 4NPEA 5B5EE 2OYHC 1AFOA 1M7LA 1GMJA 4GOFA 1XTGB 1R5SA 5CJ0A 3TGUE 2ZYDA 3A5TA 3L75G 4WWIA 1S3JA 5KKZC 2NPSA 3TSIA 2OYIB 1GU4A 5GTHE 2XZRA 4U7JA 5EFWB 3CCVP 3HUSB 2W27A 2Z5IA 4EYYQ 1JTHB 1FZCB 1KILB 3M0DA 2O01J 3H1JE 1S5LX 2ZT9D 4PD4E 1EXIA 1NGMB 2H43A 1VQ9P 1KQLA 5APTA 3D70A 1QVFO 1N73C 2C0WA 1SQBK 2E42A 1KB9D 1W2BO 3H1LG 1GU5A 1HVVA 1RF0A 1SQXE 1WT6A 2QM7A 3CX5D 1BDCA 1OFCX 3KDPB 1KQSO 1HF9A 2Y0DA 5E79E 4YPCA 1LWUB 2NRGA 3C9IA 3H1LE 2W83C 2MKVA 3AE5C 2AEMA 1VQLP 3RGUA 3NFQA 1G2CB 3VMAA 5AW6B 2HLOA 2OYIC 3CCSP 1OXZA 4L73A 5APXA 2KYVA 1J2JB 4WVZA 2HPCB 4KJMA 4YXWH 5H2FE 5KJ7C 1SQVJ 1H89A 1SQBJ 1IK9A 2HODA 1RQUA 3CLQA 3KZIE 3K5BA 5CCHC 2P58A 5CHXA 2P2UA 2A45H 2M0BA 1MZ9A 1P84D 2DW3A 2ZVOB 1S5LH 3VN0A 3BATA 3P8CE 3S4RA 1VDFA 3S1KA 1L0NJ 2L91A 1IZNB 1EZVG 3OAKA 2OQQA 3L74G 4ASWA 1LNQA 3SWYA 3LIEA 2NPSC 4C46A 1ZXGA 3H1JD 2Q1KA 1SQVG 2N1TB 3L73J 1S5LE 3GHGB 1K9MQ 3CC2P 1Q82Q 1JM0A 2QJPB 5APVA 1GL2D 1FAVA 3BRTB 3M0DC 2K88A 2I8DA 2JWAA 3M0AA 2QIWA 1NU1D 1CW5A 1SQQK 4GDOA 3GF7A 3MZWB 2FYUE 2KNCB 3BCCE 3L70G 2HPCA 2KUBA 1E5WA 1FJKA 3TNUB 1RHZB 1IO4A 1CI6A 1LTJA 1HBWA 1JOCA 2BEZF 1BE3G 1Y8AA 1LJ2A 3ITKA 4R4MA 1HH0A 1ZOYC 1L0LK 2AEFA 2O1KA 3KQGA 3L70J 5TJHA 1URQC 3RBZA 2FYZA 2OARA 5AVRB 3L36A 4I1LA 3Q1MA 1KQGB 2N1TA 1NOHA 3FXDA 1L4AD 3LW5J 1LGHB 3G6EP 1S1CX 5KLIB 2QG4A 1VQMP 2YXRB 1VQOP 2JR8A 3H1HG 1H8AA 1RF1A 2N1TC 4DCKA 5APWA 2BCCD 3CMEP 2POHA 2D2CB 2WITA 4W80A 2WZ7A 4PD4H 2W8ZA 4H0LC 4H0LB 1NKNA 5AVVB 4JYCA 1PP9D 3VP9A 2Q9IA 1CI6B 1LTJB 3H1LD 1IFNA 4LC1A 4ZMDA 5KLVK 1K04A 1SS1A 1Q7YQ 2E43A 2WVRA 2LR2A 3L35A 2A45I 3KXDA 1YJNP 3HRNA 2A45G 3M9QA 1NTKD 2KS1B 2M3BA 2ZT9B 5KLIC 3U1AA 5TISH 3M9BA 3MGNA 1PP9G 1H0TB 4D6TE 4UB6E 2WPSA 2HG5D 4BXLA 4CPGA 4D6TJ 1Y47A 1JMBA 2QA4P 1R8EA 1URQB 5AW3B 2E74D 1SQPJ 4OGQB 4YXDC 1SQPE 1NTZD 1IFIA 2K3RA 4XE5B 5GTHH 3MD0A 1SQBD 1SP4A 2RN0A 3H1KJ 1M56D 2H7HA 2IYOA 3LW5H 2IBZD 3JC22 2ZYGA 3G9RA 1HWTC 2WSFH 1L0ND 1N7SC 1U57A 2C0XA 2XNDH 3AE3C 4PV1C 3GHGC 1N2DC 4JQ0D 2IZ1A 3S9OA 2G8YA 1N73B 3P32A 4OGQD 1YJ9P 1VQ8P 2MJZA 1SQXJ 1QL2A 2RMZA 1S4XA 3ZDMA 3AEEC 1S9KE 3FGAD 1SLQA 1K73Q 1HJ0A 5APSA 1EDIA 2H8PD 2OTJP 3AEBC 5E79H 3KHUA 1USDA 1RF1C 4I2LC 1NU1J 2GA1A 3RL0D 3V4QA 2PFXA 3SFEC 1NU1G 4W7YA 1KQFB 2WT7A 1FE6A 3CD6P 1NTKK 5CJ4A 2P7JA 2QRXA 1YJWP 2J59M 4UB8H 1OVVA 3CWBG 3PHLA 2HYNA 3NXSA 2AXCA 5L8RJ 1NTMD 1VQKP 4IL6X 2N1TD 4IL6H 3P8MC 5KAFE 1ZRTE 1NH4A 1PGOA 1YQ3C 2Q3EA 1GDTA 1UIXA 1JTHA 3AEAC 3GF3A 1VL2A 1DX7A 1NWQA 3L71J 1SQVD 3WU2H 2H89C 2FKWB 1LT1A 2FXOA 3NTNA 4HH2A 3V5BA 3CPWO 1JY3O 4W7ZA 3TDKA 1KYOH 3MHVA 3MTUE 2WSCH 3Q3DA 3O6QA 3P8CD 2FFDB 4K35A 5AVSB 5KLVG 3TNUA 4I7ZC 1KTMA 1M1KQ 2K9JB 1AQTA 1M57D 3SWKA 1J1DB 2BCCE 4DJGA 1UIIA 2V4HA 1FZCC 2H88C 4KHXA 1KYOE 2K9YA 2V7QH 3H1KG 1N7SA 2YKQA 1NTZK 1T3UA 1RE3A 2ZYAA 2E76B 1SQPD 1SQQG 2RH0A 2Z5HA 1MV8A 2NPSD 1GW4A 1NTZJ 3H1IG 3PLNA 3USSA 1W5CE 3GMAA 4IOIH 2OYOA 3WUVA 3IFMA 4OWFA 3U1CA 4JBZA 5AW4B 1YBKA 5BU8B 1LTBC 4GT1A 3F89A 1X22A 1VQ7P 4U3FG 1VF5C 1BGYG 2ZT9C 3H1ID 3L74E 3L74J 2M8RA 1ZR4A 2N9YB 3CWBJ 2P1JA 3KPEA 3M06A 3CL3D 4HKZH 1BCCG 4U3FJ 1KB9I 1RF0C 1OW6A 2M5AA 5KJ7D 2E74B 4Y99C 4Z1MH 1PIXA 2CK3H 1LTJC 4RESB 1M90Q 1JMMA 2E76D 4KT0J 1IFJA 1X0TA 3H25A 1URQD 3A7OA 1JY2O 1URQA 3L73D 2XV5A 2OGUA 1EDKA 3WUTA 3D6YA 2UWJE 1KFNA 2NZ2A 5M1BA 2QJKC 2W90A 3FXEA 3WMM0 3H32A 3A0BH 4DT0A 1KV4A 3H1LJ 2FYUG 2YNYA 4BRYA 3OW2O 1NU1E 1NAYA 3HE5B 3PRJA 2XKMA 1EC5A 1MUUA 1SQPG 5CMZA 4XA4A 3VMYA 1NTKJ 1JB0J 1L0NK 2P67A 2ZJSE 4H13D 4ASVA 2B88A 3L70D 1LTAC 3AEDC 1HTLC 1JEKA 1QL1A 1SQVE 2FYUD 2KLVA 1KYOI 2WSSH 3H1KE 3CX5H 1YYCA 5AVZB 3RK3E 2R5DA 4A7PA 3TK1A 1FJPA 1EZVI 1PL5A 4L74A 4C7RA 1QGKB 5K5GB 2ZXXA 3L71D 5AVYB 1KILA 5GTIH 1T2KC 3BVHA 4PD4D 1R5LA 1FZAA 2KNCA 1L0NE 2Y0EA 3H1JG 2C9NY 1VQNP 1JUNA 2PP6A 1LT9C 1BSNA 1KZUB 1MFTA 2GUSA 3V6IA 3U59A 3L72G 3A0HE 3SFDC 1EDJA 2QJYC 4HYTB 1D7MA 3CXHH 3VTPC 2M3EA 2K37A 1OVRA 1JY3P 2J58A 3HE4A 5KAIH 1GZLA 1LT9A 2CPSA 1VQPP 1AJYA 4ZNCA 1SFCB 5AW2B 3VMZA 1YTZI 3P7KA 5DJUB 3LIDA 1L4AB 2KI7B 2JP3A 1ZP0C 2ZFCA 3L72E 1YQ4C 1T3JA 2WSFJ 1ZR2A 1N8RQ 3A0HH 4QMAA 4TLFA 2ZVNB 3GW6A 3HD7D 4N78E 1YIJP 1KILE 4HJGH 5KAIE 1H0TA 3TGUJ 5AW7B 1DD4A 4ZKPA 5KAFH 1KFMA 3M9HA 3A2AA 5CCGD 3H1KD 1P84E 1LWUC 1G1JA 1ZV8A 2Q6QA 3E1IA 3NMDA 1OIPA 3EWKA 1SQQD 3WU2E 1SQBE 5CCHD 1BE3D 4JPZB 2KB7P 3JCUH 1GL2B 2M5AB 3PTZA 2HR3A 4GKGA 4AQRD 1L4AC 3MP7B 3W68A 3HD7A 3HTKA 1CZQA 2JEEA 4GIFA 1JNMA 4GOEA 2YMKA 2WSCJ 1P84H 2A06G 4NPFX 4WY4D 2O01N 2W6AA 3B5NB 2LXCB 2K1AA 1OZHA 2FXMA 5AW9B 1EQ7A 3OA7A 1FDIA 2BCCJ 3HD7C 4H13C 2YO2A 2IZ0A 1KILC 1NYHA
chains in the Genus database with same CATH topology
3HUSC 3RK2C 5AW1B 4C7NA 1RY3A 2WTYA 2KP8A 1HUCA 3V4WA 2XU6A 3TYYA 1PFIA 2OYHB 4WY4B 1JY3N 3R2PA 3II6A 4O9BA 2C9LY 3GHGA 2YKOA 2R32A 1FOSE 1RE4A 1DH3A 4OH8B 1IFMA 2Q7CA 4ZKUA 5AVUB 3RK3C 1S9KD 4WB4A 3BRVB 3V2PA 4B86A 3M91A 1X9VA 5AW0B 1SQVK 2O1JA 4I6MC 3RL0C 3VOPA 1LTTC 2W6BA 2VRSA 1L4AA 4IFMA 3A3YB 3N7NA 2WT7B 1GK6A 4AUWA 1NHLA 1N86A 2ZXEB 1X79B 4EIJA 1J1EB 2WWWA 4LGDE 1OWAA 1X8YA 1NKZB 1FZFA 5APQA 3V2NA 3HUSA 1HGVA 4EOTA 2YMYA 1HJBA 3B8EB 1N7LA 3VP8A 1SQPK 1JCCA 1FOSF 1GL2A 4JYBA 1ZN5A 1T2KD 3RL0B 3OJAB 3HD7B 1JCDA 1FZCA 3MIWA 5AVQB 5KJ7A 3VMXA 3I5CA 2OYHA 3RK3B 1RE3C 2FFDC 1H88A 2XDJA 2O01H 2IX7C 2WPQA 3H32B 2KOGA 3BASA 1A02J 1G1IA 3PP5A 4WBAA 4N78D 3O8ZA 2Q5UA 3EFGA 5APUA 3HE4B 3B5ND 1Z56A 3UIAA 3RK3D 1M1JA 4M3LA 3T97A 1IFDA 3L4FA 3RK2B 1M1JC 1RF1B 1SFCC 2FYUK 2YO3A 2L5GB 1MFZA 1ZLLA 5AVTB 2GM4A 1AQ5A 3B5NC 4N3YB 1SFCA 2IFNA 1GK4A 1FDMA 4DZOA 1N7SB 1M1JB 1GL2C 5CCHA 2LKMA 1JY2N 2GUVA 2IFMA 1NU1K 2FFDA 1IJDB 3IR9A 3H6PA 1SQXK 3G3ZA 1SVFA 2HODB 5CCGA 3VYIA 4DOJA 1N7SD 3HTKB 2CPBA 5CCGC 1A02F 2KSJA 1NO4A 2I1KA 4IFFA 1GW3A 4WY4A 3V2RA 4LLHA 2WPRA 1CSBA 2HPCA 1W2EA 1LT9B 4Y99B 2XNXA 2R3CA 5APYA 2R5BA 1FBMA 2Z4EA 2N9BA 1T8ZA 4AYCA 1LTSC 3L37A 3N4XA 1LWUA 1FZGA 2WSEH 1JO5A 5BU5A 3B5NA 1XTCC 1VPCA 5KTBA 1J1EC 2PAJA 5AW8B 5AW5B 1N73A 1WRGA 1FZEA 5AVXB 2BASA 3MUDA 2HFED 1SFCD 4N6JA 2JJLA 2QM8A 1GD2E 2YKPA 1J1DC 2IPPA 1NTMK 5BVZA 1G2CA 2I1JA 5AVWB 3CI9A 2NPSB 2OYIA 1JY2P 2Q3IA 1GTWA 3KYQA 4IFDK 3RK2D 1LTGC 1YTZT 1DEBA 4JF7A 3V2QA 1KILD 1FU1A 1NAFA 1LTIC 1IC2A 1HGZA 1FZBA 1RE4C 4C7NB 3HE5A 3EQ2A 4WY4C 2OYHC 1AFOA 1M7LA 5CJ0A 1XTGB 3A5TA 2NPSA 3TSIA 2OYIB 1GU4A 2XZRA 3HUSB 2W27A 2Z5IA 1FZCB 1JTHB 1KILB 3M0DA 2H43A 1KQLA 5APTA 1N73C 2C0WA 1SQBK 2E42A 1GU5A 1HVVA 1RF0A 1WT6A 2QM7A 3KDPB 1LWUB 3C9IA 3NFQA 1G2CB 5AW6B 2HLOA 2OYIC 1OXZA 2KYVA 1J2JB 2HPCB 5KJ7C 1H89A 1IK9A 2HODA 3CLQA 5CCHC 5CHXA 2P2UA 2A45H 1MZ9A 3VN0A 3BATA 3P8CE 1VDFA 3OAKA 3SWYA 3LIEA 2NPSC 4C46A 2N1TB 3GHGB 5APVA 1GL2D 1FAVA 3BRTB 3M0DC 3M0AA 1CW5A 1SQQK 1E5WA 1FJKA 3TNUB 1IO4A 1CI6A 1LTJA 1JOCA 1HBWA 1HH0A 2O1KA 1L0LK 3KQGA 1URQC 2FYZA 2OARA 5AVRB 3L36A 4I1LA 2N1TA 1NOHA 1L4AD 1LGHB 1RF1A 1H8AA 2N1TC 5APWA 2POHA 2WITA 4W80A 2WZ7A 3VP9A 5AVVB 1NKNA 4JYCA 2Q9IA 1CI6B 1LTJB 1IFNA 4LC1A 5KLVK 2E43A 3L35A 2A45I 3HRNA 2A45G 3M9QA 2M3BA 3U1AA 3M9BA 3MGNA 2WPSA 2HG5D 1URQB 5AW3B 1IFIA 4XE5B 3MD0A 1SP4A 2H7HA 3LW5H 1HWTC 2WSFH 1N7SC 2C0XA 3GHGC 1N2DC 1N73B 3P32A 2MJZA 1QL2A 1S9KE 1SLQA 5APSA 2H8PD 1RF1C 4I2LC 3RL0D 3V4QA 2WT7A 4W7YA 1NTKK 5CJ4A 2P7JA 2J59M 2HYNA 3NXSA 2N1TD 3P8MC 1NH4A 1GDTA 1JTHA 1DX7A 1NWQA 2FKWB 3NTNA 3V5BA 4HH2A 1JY3O 4W7ZA 3MTUE 2WSCH 3P8CD 2FFDB 5AVSB 3TNUA 1J1DB 1FZCC 4KHXA 1N7SA 2YKQA 1NTZK 1T3UA 1RE3A 2Z5HA 1MV8A 2NPSD 1GW4A 3IFMA 3U1CA 5AW4B 5BU8B 1LTBC 4GT1A 1ZR4A 2M8RA 3KPEA 2P1JA 3M06A 3CL3D 1RF0C 5KJ7D 4Y99C 1LTJC 4RESB 1JMMA 1IFJA 1URQD 3A7OA 1JY2O 1URQA 2XV5A 1KFNA 3WMM0 3H32A 2YNYA 3HE5B 2XKMA 1MUUA 5CMZA 4XA4A 3VMYA 1L0NK 2P67A 1LTAC 1HTLC 1QL1A 2KLVA 1YYCA 5AVZB 2R5DA 1FJPA 3TK1A 4C7RA 5AVYB 1KILA 1T2KC 3BVHA 1FZAA 2C9NY 1JUNA 2PP6A 1LT9C 1KZUB 2GUSA 3U59A 4HYTB 3VTPC 1JY3P 2J58A 3HE4A 1GZLA 1LT9A 2CPSA 1SFCB 5AW2B 3VMZA 1YTZI 3P7KA 3LIDA 1L4AB 2ZFCA 1ZR2A 1T3JA 3HD7D 4N78E 5AW7B 4ZKPA 1KFMA 3M9HA 3A2AA 5CCGD 1LWUC 3NMDA 1G1JA 1ZV8A 3E1IA 5CCHD 2KB7P 1GL2B 4GKGA 4AQRD 1L4AC 3HD7A 3HTKA 1CZQA 2JEEA 4GIFA 1JNMA 5APXA 4WY4D 2W6AA 3B5NB 2FXMA 5AW9B 1EQ7A 3OA7A 3HD7C 2YO2A 3SWFA 1KILC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H89 A;  2P2U A;  5AVS B;  3TNU A;  3VN0 A;  3IR9 A;  5AW1 B;  4C7N A;  2WTY A;  2KP8 A;  3VYI A;  1HUC A;  3V4W A;  3OAK A;  4KHX A;  2XU6 A;  3TYY A;  3LIE A;  4C46 A;  2C9L Y;  1A02 F;  2R32 A;  2Z5H A;  1MV8 A;  1FOS E;  5APV A;  1FAV A;  1DH3 A;  3M0A A;  5AW4 B;  2WPR A;  1CSB A;  4GT1 A;  2R3C A;  5APY A;  2Q7C A;  3TNU B;  2R5B A;  1IO4 A;  1CI6 A;  2N9B A;  1S9K D;  5AVU B;  4AYC A;  1HBW A;  3M06 A;  3L37 A;  3KQG A;  4B86 A;  3M91 A;  5AW0 B;  5AVR B;  3L36 A;  4I6M C;  4RES B;  2VRS A;  3A7O A;  5AW8 B;  5AW5 B;  3A3Y B;  2XV5 A;  2WT7 B;  1GK6 A;  1H8A A;  4AUW A;  5AVX B;  2BAS A;  5APW A;  2ZXE B;  2WWW A;  2JJL A;  1OWA A;  2QM8 A;  2YNY A;  1X8Y A;  5AVV B;  4JYC A;  1GD2 E;  3HE5 B;  1CI6 B;  5APQ A;  1MUU A;  4LC1 A;  5CMZ A;  2IPP A;  3VMY A;  2E43 A;  1HJB A;  4EOT A;  2P67 A;  3B8E B;  3L35 A;  5AVW B;  1FOS F;  2Q3I A;  3M9B A;  3MGN A;  4JYB A;  1T2K D;  1YYC A;  1GTW A;  2WPS A;  5AVZ B;  2R5D A;  3TK1 A;  5AVQ B;  5AW3 B;  3VMX A;  5AVY B;  3I5C A;  1T2K C;  4XE5 B;  1NAF A;  3MD0 A;  2C9N Y;  1JUN A;  1SP4 A;  4C7N B;  3HE5 A;  1H88 A;  2H7H A;  4HYT B;  3A5T A;  2WPQ A;  3VTP C;  3HE4 A;  1GZL A;  1HWT C;  1GU4 A;  1A02 J;  2XZR A;  5AW2 B;  3VMZ A;  3P7K A;  3LID A;  2ZFC A;  3O8Z A;  2Q5U A;  2W27 A;  3P32 A;  5APU A;  2Z5I A;  3HE4 B;  3UIA A;  3M0D A;  4M3L A;  1S9K E;  3T97 A;  1SLQ A;  5AW7 B;  5APS A;  1KQL A;  5APT A;  4I2L C;  2E42 A;  3M9H A;  3A2A A;  3V4Q A;  2WT7 A;  1GU5 A;  2P7J A;  3NMD A;  2QM7 A;  2YO3 A;  5AVT B;  1MFZ A;  3KDP B;  3NXS A;  4GKG A;  4AQR D;  3P8M C;  1GK4 A;  3HTK A;  1G2C B;  1CZQ A;  3NFQ A;  5AW6 B;  4DZO A;  1JNM A;  5APX A;  1OXZ A;  1NWQ A;  2W6A A;  1J2J B;  5AW9 B;  3NTN A;  3V5B A;  2YO2 A;  3SWF A; 
#chains in the Genus database with same CATH topology
 4MN4 C;  1L0L E;  3Q5P A;  2BCC G;  1BDD A;  1L0L J;  3HUS C;  1Q81 Q;  1WMK A;  1NVO A;  3PJS K;  3RK2 C;  2FBW C;  3A0B E;  1PZQ A;  2PGD A;  3AE2 C;  3L75 E;  3Q2Y A;  1NTZ E;  5AW1 B;  1RY3 A;  1K05 A;  4C7N A;  2WTY A;  2KP8 A;  3CCE P;  1HUC A;  4H0L D;  3V4W A;  1PV3 A;  3AE7 C;  1NTM J;  1BGY J;  2XU6 A;  2IBZ I;  3TYY A;  4D6T D;  2OYH B;  1PFI A;  4WY4 B;  1JY3 N;  1PGP A;  3II6 A;  3R2P A;  1LP1 B;  4O9B A;  3H1H J;  3GHG A;  2C9L Y;  1OW7 A;  3F5H A;  2QVA A;  2YKO A;  1OMI A;  2KZI A;  2R32 A;  1FOS E;  3PH0 A;  1RE4 A;  4PV1 D;  3AEF C;  1DH3 A;  1NTZ G;  2KSE A;  4OH8 B;  2YIU C;  2KIK A;  3CCR P;  1NJI Q;  1L2P A;  5GTI E;  2G3A A;  3G71 P;  1IFM A;  1HJB A;  2IYP A;  1KOR A;  1IK7 A;  3QWO C;  2IBZ E;  2Q7C A;  2B89 A;  3CC4 P;  4ZKU A;  5AVU B;  2FXP A;  3RK3 C;  3C1L A;  1S9K D;  4WB4 A;  2WPV B;  3BRV B;  3V2P A;  4H44 C;  4B86 A;  3M91 A;  2JKV A;  1X9V A;  1FC2 C;  5AW0 B;  2A06 E;  3AE8 C;  1SQV K;  2KS1 A;  1Y9B A;  2O1J A;  4I6M C;  4NPD A;  3RL0 C;  3Q5R A;  3VOP A;  1LTT C;  2W6B A;  4RJT A;  3CXH D;  3IF4 A;  2BEQ D;  2VRS A;  1IFP A;  1L4A A;  3AE6 C;  3B4S A;  4IFM A;  2FYN C;  3A3Y B;  1BCC E;  3N7N A;  1BCC D;  2WT7 B;  1GK6 A;  1VF5 B;  1NHL A;  3TGU D;  4AUW A;  1RH5 B;  1NTM E;  1N86 A;  1Q90 D;  2IBZ G;  1BGY E;  3CX5 I;  5C39 A;  3L70 E;  2ZXE B;  1X79 B;  4EI2 A;  4EIJ A;  3BCC D;  1J1E B;  2WWW A;  3AEC C;  1OWA A;  3FX0 A;  4LGD E;  1X8Y A;  1L0N G;  1NKZ B;  2E75 C;  2Y9Y A;  1FZF A;  2JO1 A;  4RO0 A;  5APQ A;  3V2N A;  3CC7 P;  2E76 C;  3H1I J;  3HUS A;  1HGV A;  2JWD A;  2YMY A;  3H1I E;  3L71 E;  3B8E B;  4PJ0 E;  3G4S P;  2FYN B;  1N7L A;  2W6J H;  3CWB E;  4U3F D;  3VP8 A;  1VQ5 P;  1SQP K;  1JCC A;  1FOS F;  1GL2 A;  4JYB A;  1ZN5 A;  1T2K D;  1DEE G;  3RL0 B;  1M8O B;  3OJA B;  3IAO A;  3HD7 B;  1JCD A;  1FZC A;  3H1J J;  3R4Y A;  3MIW A;  5AVQ B;  3EFF K;  4IL6 E;  5KJ7 A;  3VMX A;  3I5C A;  4EDF A;  2OYH A;  2WMM A;  1U7J A;  1RE3 C;  1KMI Z;  2P10 A;  3L75 D;  4PJ0 H;  3RK3 B;  5CBO A;  1AV1 A;  5KLV J;  2QE7 H;  3FWL A;  2FFD C;  1QVG O;  2QEX P;  2AEJ A;  2B9B A;  2XDJ A;  3L72 D;  2B87 A;  1YIT P;  1H88 A;  1VQ6 P;  2YIU B;  2O01 H;  2IX7 C;  3D71 A;  2WPQ A;  1OW8 A;  3H32 B;  2KOG A;  3BAS A;  4BRY B;  5B66 H;  3CMA P;  4H44 D;  1EXJ A;  1YI2 P;  1A02 J;  2D2C D;  1Q2N A;  3I55 P;  2KK7 A;  3D6Z A;  1G1I A;  3PP5 A;  4WBA A;  2FYU J;  1DIP A;  4N78 D;  1ZRT D;  2Q5U A;  3EFG A;  3O8Z A;  2J5U A;  5APU A;  3HE4 B;  3H1H D;  1QEX A;  1USE A;  2E5Y A;  1Z56 A;  3B5N D;  3H1H E;  1M1J A;  3RK3 D;  4M3L A;  3UIA A;  1S72 P;  3FWN A;  1LP1 A;  3T97 A;  1U7M A;  1IFD A;  3L4F A;  4K3A A;  3JCU E;  2QSI A;  1QX8 A;  4GOD A;  3C8V A;  3RK2 B;  3SSU A;  1BSH A;  2E5T A;  1M1J C;  1RF1 B;  1PPJ G;  2LXB A;  1SFC C;  4D6T G;  2O3J A;  2FYU K;  3L74 D;  1BE3 E;  1SQQ J;  1EDL A;  4H13 B;  3CWB D;  3CCQ P;  2YO3 A;  2L5G B;  1MFZ A;  1ZLL A;  1FS0 E;  4UB6 H;  5AVT B;  2GM4 A;  3B5N C;  1QLE D;  4N3Y B;  1AQ5 A;  1SFC A;  1E79 H;  3GG2 A;  1PPJ D;  3CCM P;  2IFN A;  1KB9 E;  1GK4 A;  1Q86 Q;  2RKL A;  2ZAE B;  5CBN A;  1FDM A;  4DZO A;  4PV1 B;  1N7S B;  1M1J B;  1GL2 C;  3TF5 A;  3MUD C;  1PGJ A;  5CCH A;  1AVO A;  2LKM A;  5B5E H;  1FDO A;  1JY2 N;  2KLU A;  4RKU J;  2GUV A;  3AE9 C;  1KYO D;  3AEG C;  3CCL P;  2IFM A;  1NU1 K;  1PGQ A;  1EZV D;  3BCC J;  1EZV E;  3IN6 A;  2FFD A;  3O6Q B;  1IJD B;  1NTK G;  2AXT E;  3IR9 A;  4PD4 I;  3H6P A;  4L76 A;  1SQX K;  3CXH I;  4OGQ C;  1TU3 F;  3AE1 C;  3G3Z A;  1SVF A;  2HOD B;  3GLM A;  1BGY D;  2PRR A;  3VYI A;  5CCG A;  3W67 A;  3L73 G;  5H2F H;  4DOJ A;  3CCJ P;  1N7S D;  1VF5 D;  5KLV E;  2WSE J;  3Q5S A;  1AVY A;  3BCC G;  3HTK B;  2AXT H;  2KXP B;  2CPB A;  5CCG C;  1A02 F;  3ABV C;  2OTL P;  2KSJ A;  1NO4 A;  1SQX D;  3CX5 E;  2I1K A;  4IFF A;  1GW3 A;  5KKZ B;  4WY4 A;  4XFJ A;  1VQ4 P;  2E75 D;  3CCU P;  1T6A A;  2QJY B;  3V2R A;  1PP9 E;  2D2C C;  2WPR A;  1CSB A;  4LLH A;  1PP9 J;  4UB8 E;  3SWF A;  1W2E A;  3L72 J;  1LT9 B;  2E74 C;  2XNX A;  1SQB G;  2R3C A;  4Y99 B;  5APY A;  1ZME C;  2R5B A;  2K9J A;  1FBM A;  1SQX G;  4Y28 J;  1NTM G;  2N9B A;  2Z4E A;  1KC8 Q;  1T8Z A;  4AYC A;  1LTS C;  2B87 B;  3L37 A;  1KN7 A;  3N4X A;  1LWU A;  3I56 P;  2WSE H;  1FZG A;  1JO5 A;  3CXH E;  3WUU A;  5KTB A;  5BU5 A;  2OTK E;  2YXQ B;  5B66 E;  2E75 B;  1P84 I;  3B5N A;  1ZW0 A;  1L0L G;  1OVU A;  1XTC C;  1VPC A;  1J1E C;  2PAJ A;  2JDI H;  2R44 A;  5DJT B;  5AW8 B;  3RL0 g;  5AW5 B;  4EOT A;  3KZI H;  1N73 A;  1WRG A;  1FZE A;  5AVX B;  2BAS A;  2Y0C A;  2ITA A;  1AA0 A;  3MUD A;  4TT3 H;  4U3F E;  2HFE D;  1YHQ P;  1SFC D;  1S2E A;  3T97 B;  4N6J A;  2JJL A;  2QM8 A;  1GD2 E;  1PPJ E;  2QJP C;  1J1D C;  2YKP A;  2WQY C;  1KD1 Q;  2IPP A;  2QJK B;  1NTM K;  3JSV C;  3TGU G;  4H44 B;  5BVZ A;  1BE3 J;  1SQQ E;  2V7Q J;  1G2C A;  2I1J A;  4I7Z B;  4OVN F;  4L75 A;  3QH9 A;  5AVW B;  3CI9 A;  4YTP C;  3RBX A;  2NPS B;  2SPZ A;  3E1R A;  2OYI A;  3AE4 C;  1JY2 P;  2Q3I A;  4BWN A;  2Y9Z A;  1DD3 A;  1GTW A;  3KYQ A;  4IFD K;  3RK2 D;  1MKM A;  1LTG C;  3L73 E;  1K8A Q;  1YTZ T;  3L71 G;  1DEB A;  1OX3 A;  1KB9 H;  2IDB A;  3B71 A;  3L75 J;  4JF7 A;  5KLV D;  3V2Q A;  1BCC J;  1FU1 A;  1KIL D;  1NAF A;  2A06 D;  1LTI C;  1NTK E;  3E7K A;  1RQV A;  1IC2 A;  1HGZ A;  1FZB A;  4HB1 A;  1RE4 C;  4R4L A;  5TIS E;  2FY8 A;  2R3S A;  1L0L D;  3HE5 A;  4C7N B;  2KZJ A;  3EQ2 A;  4WY4 C;  4NPE A;  5B5E E;  2OYH C;  1AFO A;  1M7L A;  1GMJ A;  4GOF A;  1XTG B;  1R5S A;  5CJ0 A;  3TGU E;  2ZYD A;  3A5T A;  3L75 G;  4WWI A;  1S3J A;  5KKZ C;  2NPS A;  3TSI A;  2OYI B;  1GU4 A;  5GTH E;  2XZR A;  4U7J A;  5EFW B;  3CCV P;  3HUS B;  2W27 A;  2Z5I A;  4EYY Q;  1JTH B;  1FZC B;  1KIL B;  3M0D A;  2O01 J;  3H1J E;  1S5L X;  2ZT9 D;  4PD4 E;  1EXI A;  1NGM B;  2H43 A;  1VQ9 P;  1KQL A;  5APT A;  3D70 A;  1QVF O;  1N73 C;  2C0W A;  1SQB K;  2E42 A;  1KB9 D;  1W2B O;  3H1L G;  1GU5 A;  1HVV A;  1RF0 A;  1SQX E;  1WT6 A;  2QM7 A;  3CX5 D;  1BDC A;  1OFC X;  3KDP B;  1KQS O;  1HF9 A;  2Y0D A;  5E79 E;  4YPC A;  1LWU B;  2NRG A;  3C9I A;  3H1L E;  2W83 C;  2MKV A;  3AE5 C;  2AEM A;  1VQL P;  3RGU A;  3NFQ A;  1G2C B;  3VMA A;  5AW6 B;  2HLO A;  2OYI C;  3CCS P;  1OXZ A;  4L73 A;  5APX A;  2KYV A;  1J2J B;  4WVZ A;  2HPC B;  4KJM A;  4YXW H;  5H2F E;  5KJ7 C;  1SQV J;  1H89 A;  1SQB J;  1IK9 A;  2HOD A;  1RQU A;  3CLQ A;  3KZI E;  3K5B A;  5CCH C;  2P58 A;  5CHX A;  2P2U A;  2A45 H;  2M0B A;  1MZ9 A;  1P84 D;  2DW3 A;  2ZVO B;  1S5L H;  3VN0 A;  3BAT A;  3P8C E;  3S4R A;  1VDF A;  3S1K A;  1L0N J;  2L91 A;  1IZN B;  1EZV G;  3OAK A;  2OQQ A;  3L74 G;  4ASW A;  1LNQ A;  3SWY A;  3LIE A;  2NPS C;  4C46 A;  1ZXG A;  3H1J D;  2Q1K A;  1SQV G;  2N1T B;  3L73 J;  1S5L E;  3GHG B;  1K9M Q;  3CC2 P;  1Q82 Q;  1JM0 A;  2QJP B;  5APV A;  1GL2 D;  1FAV A;  3BRT B;  3M0D C;  2K88 A;  2I8D A;  2JWA A;  3M0A A;  2QIW A;  1NU1 D;  1CW5 A;  1SQQ K;  4GDO A;  3GF7 A;  3MZW B;  2FYU E;  2KNC B;  3BCC E;  3L70 G;  2HPC A;  2KUB A;  1E5W A;  1FJK A;  3TNU B;  1RHZ B;  1IO4 A;  1CI6 A;  1LTJ A;  1HBW A;  1JOC A;  2BEZ F;  1BE3 G;  1Y8A A;  1LJ2 A;  3ITK A;  4R4M A;  1HH0 A;  1ZOY C;  1L0L K;  2AEF A;  2O1K A;  3KQG A;  3L70 J;  5TJH A;  1URQ C;  3RBZ A;  2FYZ A;  2OAR A;  5AVR B;  3L36 A;  4I1L A;  3Q1M A;  1KQG B;  2N1T A;  1NOH A;  3FXD A;  1L4A D;  3LW5 J;  1LGH B;  3G6E P;  1S1C X;  5KLI B;  2QG4 A;  1VQM P;  2YXR B;  1VQO P;  2JR8 A;  3H1H G;  1H8A A;  1RF1 A;  2N1T C;  4DCK A;  5APW A;  2BCC D;  3CME P;  2POH A;  2D2C B;  2WIT A;  4W80 A;  2WZ7 A;  4PD4 H;  2W8Z A;  4H0L C;  4H0L B;  1NKN A;  5AVV B;  4JYC A;  1PP9 D;  3VP9 A;  2Q9I A;  1CI6 B;  1LTJ B;  3H1L D;  1IFN A;  4LC1 A;  4ZMD A;  5KLV K;  1K04 A;  1SS1 A;  1Q7Y Q;  2E43 A;  2WVR A;  2LR2 A;  3L35 A;  2A45 I;  3KXD A;  1YJN P;  3HRN A;  2A45 G;  3M9Q A;  1NTK D;  2KS1 B;  2M3B A;  2ZT9 B;  5KLI C;  3U1A A;  5TIS H;  3M9B A;  3MGN A;  1PP9 G;  1H0T B;  4D6T E;  4UB6 E;  2WPS A;  2HG5 D;  4BXL A;  4CPG A;  4D6T J;  1Y47 A;  1JMB A;  2QA4 P;  1R8E A;  1URQ B;  5AW3 B;  2E74 D;  1SQP J;  4OGQ B;  4YXD C;  1SQP E;  1NTZ D;  1IFI A;  2K3R A;  4XE5 B;  5GTH H;  3MD0 A;  1SQB D;  1SP4 A;  2RN0 A;  3H1K J;  1M56 D;  2H7H A;  2IYO A;  3LW5 H;  2IBZ D;  3JC2 2;  2ZYG A;  3G9R A;  1HWT C;  2WSF H;  1L0N D;  1N7S C;  1U57 A;  2C0X A;  2XND H;  3AE3 C;  4PV1 C;  3GHG C;  1N2D C;  4JQ0 D;  2IZ1 A;  3S9O A;  2G8Y A;  1N73 B;  3P32 A;  4OGQ D;  1YJ9 P;  1VQ8 P;  2MJZ A;  1SQX J;  1QL2 A;  2RMZ A;  1S4X A;  3ZDM A;  3AEE C;  1S9K E;  3FGA D;  1SLQ A;  1K73 Q;  1HJ0 A;  5APS A;  1EDI A;  2H8P D;  2OTJ P;  3AEB C;  5E79 H;  3KHU A;  1USD A;  1RF1 C;  4I2L C;  1NU1 J;  2GA1 A;  3RL0 D;  3V4Q A;  2PFX A;  3SFE C;  1NU1 G;  4W7Y A;  1KQF B;  2WT7 A;  1FE6 A;  3CD6 P;  1NTK K;  5CJ4 A;  2P7J A;  2QRX A;  1YJW P;  2J59 M;  4UB8 H;  1OVV A;  3CWB G;  3PHL A;  2HYN A;  3NXS A;  2AXC A;  5L8R J;  1NTM D;  1VQK P;  4IL6 X;  2N1T D;  4IL6 H;  3P8M C;  5KAF E;  1ZRT E;  1NH4 A;  1PGO A;  1YQ3 C;  2Q3E A;  1GDT A;  1UIX A;  1JTH A;  3AEA C;  3GF3 A;  1VL2 A;  1DX7 A;  1NWQ A;  3L71 J;  1SQV D;  3WU2 H;  2H89 C;  2FKW B;  1LT1 A;  2FXO A;  3NTN A;  4HH2 A;  3V5B A;  3CPW O;  1JY3 O;  4W7Z A;  3TDK A;  1KYO H;  3MHV A;  3MTU E;  2WSC H;  3Q3D A;  3O6Q A;  3P8C D;  2FFD B;  4K35 A;  5AVS B;  5KLV G;  3TNU A;  4I7Z C;  1KTM A;  1M1K Q;  2K9J B;  1AQT A;  1M57 D;  3SWK A;  1J1D B;  2BCC E;  4DJG A;  1UII A;  2V4H A;  1FZC C;  2H88 C;  4KHX A;  1KYO E;  2K9Y A;  2V7Q H;  3H1K G;  1N7S A;  2YKQ A;  1NTZ K;  1T3U A;  1RE3 A;  2ZYA A;  2E76 B;  1SQP D;  1SQQ G;  2RH0 A;  2Z5H A;  1MV8 A;  2NPS D;  1GW4 A;  1NTZ J;  3H1I G;  3PLN A;  3USS A;  1W5C E;  3GMA A;  4IOI H;  2OYO A;  3WUV A;  3IFM A;  4OWF A;  3U1C A;  4JBZ A;  5AW4 B;  1YBK A;  5BU8 B;  1LTB C;  4GT1 A;  3F89 A;  1X22 A;  1VQ7 P;  4U3F G;  1VF5 C;  1BGY G;  2ZT9 C;  3H1I D;  3L74 E;  3L74 J;  2M8R A;  1ZR4 A;  2N9Y B;  3CWB J;  2P1J A;  3KPE A;  3M06 A;  3CL3 D;  4HKZ H;  1BCC G;  4U3F J;  1KB9 I;  1RF0 C;  1OW6 A;  2M5A A;  5KJ7 D;  2E74 B;  4Y99 C;  4Z1M H;  1PIX A;  2CK3 H;  1LTJ C;  4RES B;  1M90 Q;  1JMM A;  2E76 D;  4KT0 J;  1IFJ A;  1X0T A;  3H25 A;  1URQ D;  3A7O A;  1JY2 O;  1URQ A;  3L73 D;  2XV5 A;  2OGU A;  1EDK A;  3WUT A;  3D6Y A;  2UWJ E;  1KFN A;  2NZ2 A;  5M1B A;  2QJK C;  2W90 A;  3FXE A;  3WMM 0;  3H32 A;  3A0B H;  4DT0 A;  1KV4 A;  3H1L J;  2FYU G;  2YNY A;  4BRY A;  3OW2 O;  1NU1 E;  1NAY A;  3HE5 B;  3PRJ A;  2XKM A;  1EC5 A;  1MUU A;  1SQP G;  5CMZ A;  4XA4 A;  3VMY A;  1NTK J;  1JB0 J;  1L0N K;  2P67 A;  2ZJS E;  4H13 D;  4ASV A;  2B88 A;  3L70 D;  1LTA C;  3AED C;  1HTL C;  1JEK A;  1QL1 A;  1SQV E;  2FYU D;  2KLV A;  1KYO I;  2WSS H;  3H1K E;  3CX5 H;  1YYC A;  5AVZ B;  3RK3 E;  2R5D A;  4A7P A;  3TK1 A;  1FJP A;  1EZV I;  1PL5 A;  4L74 A;  4C7R A;  1QGK B;  5K5G B;  2ZXX A;  3L71 D;  5AVY B;  1KIL A;  5GTI H;  1T2K C;  3BVH A;  4PD4 D;  1R5L A;  1FZA A;  2KNC A;  1L0N E;  2Y0E A;  3H1J G;  2C9N Y;  1VQN P;  1JUN A;  2PP6 A;  1LT9 C;  1BSN A;  1KZU B;  1MFT A;  2GUS A;  3V6I A;  3U59 A;  3L72 G;  3A0H E;  3SFD C;  1EDJ A;  2QJY C;  4HYT B;  1D7M A;  3CXH H;  3VTP C;  2M3E A;  2K37 A;  1OVR A;  1JY3 P;  2J58 A;  3HE4 A;  5KAI H;  1GZL A;  1LT9 A;  2CPS A;  1VQP P;  1AJY A;  4ZNC A;  1SFC B;  5AW2 B;  3VMZ A;  1YTZ I;  3P7K A;  5DJU B;  3LID A;  1L4A B;  2KI7 B;  2JP3 A;  1ZP0 C;  2ZFC A;  3L72 E;  1YQ4 C;  1T3J A;  2WSF J;  1ZR2 A;  1N8R Q;  3A0H H;  4QMA A;  4TLF A;  2ZVN B;  3GW6 A;  3HD7 D;  4N78 E;  1YIJ P;  1KIL E;  4HJG H;  5KAI E;  1H0T A;  3TGU J;  5AW7 B;  1DD4 A;  4ZKP A;  5KAF H;  1KFM A;  3M9H A;  3A2A A;  5CCG D;  3H1K D;  1P84 E;  1LWU C;  1G1J A;  1ZV8 A;  2Q6Q A;  3E1I A;  3NMD A;  1OIP A;  3EWK A;  1SQQ D;  3WU2 E;  1SQB E;  5CCH D;  1BE3 D;  4JPZ B;  2KB7 P;  3JCU H;  1GL2 B;  2M5A B;  3PTZ A;  2HR3 A;  4GKG A;  4AQR D;  1L4A C;  3MP7 B;  3W68 A;  3HD7 A;  3HTK A;  1CZQ A;  2JEE A;  4GIF A;  1JNM A;  4GOE A;  2YMK A;  2WSC J;  1P84 H;  2A06 G;  4NPF X;  4WY4 D;  2O01 N;  2W6A A;  3B5N B;  2LXC B;  2K1A A;  1OZH A;  2FXM A;  5AW9 B;  1EQ7 A;  3OA7 A;  1FDI A;  2BCC J;  3HD7 C;  4H13 C;  2YO2 A;  2IZ0 A;  1KIL C;  1NYH A; 
#chains in the Genus database with same CATH homology
 3HUS C;  3RK2 C;  5AW1 B;  4C7N A;  1RY3 A;  2WTY A;  2KP8 A;  1HUC A;  3V4W A;  2XU6 A;  3TYY A;  1PFI A;  2OYH B;  4WY4 B;  1JY3 N;  3R2P A;  3II6 A;  4O9B A;  2C9L Y;  3GHG A;  2YKO A;  2R32 A;  1FOS E;  1RE4 A;  1DH3 A;  4OH8 B;  1IFM A;  2Q7C A;  4ZKU A;  5AVU B;  3RK3 C;  1S9K D;  4WB4 A;  3BRV B;  3V2P A;  4B86 A;  3M91 A;  1X9V A;  5AW0 B;  1SQV K;  2O1J A;  4I6M C;  3RL0 C;  3VOP A;  1LTT C;  2W6B A;  2VRS A;  1L4A A;  4IFM A;  3A3Y B;  3N7N A;  2WT7 B;  1GK6 A;  4AUW A;  1NHL A;  1N86 A;  2ZXE B;  1X79 B;  4EIJ A;  1J1E B;  2WWW A;  4LGD E;  1OWA A;  1X8Y A;  1NKZ B;  1FZF A;  5APQ A;  3V2N A;  3HUS A;  1HGV A;  4EOT A;  2YMY A;  1HJB A;  3B8E B;  1N7L A;  3VP8 A;  1SQP K;  1JCC A;  1FOS F;  1GL2 A;  4JYB A;  1ZN5 A;  1T2K D;  3RL0 B;  3OJA B;  3HD7 B;  1JCD A;  1FZC A;  3MIW A;  5AVQ B;  5KJ7 A;  3VMX A;  3I5C A;  2OYH A;  3RK3 B;  1RE3 C;  2FFD C;  1H88 A;  2XDJ A;  2O01 H;  2IX7 C;  2WPQ A;  3H32 B;  2KOG A;  3BAS A;  1A02 J;  1G1I A;  3PP5 A;  4WBA A;  4N78 D;  3O8Z A;  2Q5U A;  3EFG A;  5APU A;  3HE4 B;  3B5N D;  1Z56 A;  3UIA A;  3RK3 D;  1M1J A;  4M3L A;  3T97 A;  1IFD A;  3L4F A;  3RK2 B;  1M1J C;  1RF1 B;  1SFC C;  2FYU K;  2YO3 A;  2L5G B;  1MFZ A;  1ZLL A;  5AVT B;  2GM4 A;  1AQ5 A;  3B5N C;  4N3Y B;  1SFC A;  2IFN A;  1GK4 A;  1FDM A;  4DZO A;  1N7S B;  1M1J B;  1GL2 C;  5CCH A;  2LKM A;  1JY2 N;  2GUV A;  2IFM A;  1NU1 K;  2FFD A;  1IJD B;  3IR9 A;  3H6P A;  1SQX K;  3G3Z A;  1SVF A;  2HOD B;  5CCG A;  3VYI A;  4DOJ A;  1N7S D;  3HTK B;  2CPB A;  5CCG C;  1A02 F;  2KSJ A;  1NO4 A;  2I1K A;  4IFF A;  1GW3 A;  4WY4 A;  3V2R A;  4LLH A;  2WPR A;  1CSB A;  2HPC A;  1W2E A;  1LT9 B;  4Y99 B;  2XNX A;  2R3C A;  5APY A;  2R5B A;  1FBM A;  2Z4E A;  2N9B A;  1T8Z A;  4AYC A;  1LTS C;  3L37 A;  3N4X A;  1LWU A;  1FZG A;  2WSE H;  1JO5 A;  5BU5 A;  3B5N A;  1XTC C;  1VPC A;  5KTB A;  1J1E C;  2PAJ A;  5AW8 B;  5AW5 B;  1N73 A;  1WRG A;  1FZE A;  5AVX B;  2BAS A;  3MUD A;  2HFE D;  1SFC D;  4N6J A;  2JJL A;  2QM8 A;  1GD2 E;  2YKP A;  1J1D C;  2IPP A;  1NTM K;  5BVZ A;  1G2C A;  2I1J A;  5AVW B;  3CI9 A;  2NPS B;  2OYI A;  1JY2 P;  2Q3I A;  1GTW A;  3KYQ A;  4IFD K;  3RK2 D;  1LTG C;  1YTZ T;  1DEB A;  4JF7 A;  3V2Q A;  1KIL D;  1FU1 A;  1NAF A;  1LTI C;  1IC2 A;  1HGZ A;  1FZB A;  1RE4 C;  4C7N B;  3HE5 A;  3EQ2 A;  4WY4 C;  2OYH C;  1AFO A;  1M7L A;  5CJ0 A;  1XTG B;  3A5T A;  2NPS A;  3TSI A;  2OYI B;  1GU4 A;  2XZR A;  3HUS B;  2W27 A;  2Z5I A;  1FZC B;  1JTH B;  1KIL B;  3M0D A;  2H43 A;  1KQL A;  5APT A;  1N73 C;  2C0W A;  1SQB K;  2E42 A;  1GU5 A;  1HVV A;  1RF0 A;  1WT6 A;  2QM7 A;  3KDP B;  1LWU B;  3C9I A;  3NFQ A;  1G2C B;  5AW6 B;  2HLO A;  2OYI C;  1OXZ A;  2KYV A;  1J2J B;  2HPC B;  5KJ7 C;  1H89 A;  1IK9 A;  2HOD A;  3CLQ A;  5CCH C;  5CHX A;  2P2U A;  2A45 H;  1MZ9 A;  3VN0 A;  3BAT A;  3P8C E;  1VDF A;  3OAK A;  3SWY A;  3LIE A;  2NPS C;  4C46 A;  2N1T B;  3GHG B;  5APV A;  1GL2 D;  1FAV A;  3BRT B;  3M0D C;  3M0A A;  1CW5 A;  1SQQ K;  1E5W A;  1FJK A;  3TNU B;  1IO4 A;  1CI6 A;  1LTJ A;  1JOC A;  1HBW A;  1HH0 A;  2O1K A;  1L0L K;  3KQG A;  1URQ C;  2FYZ A;  2OAR A;  5AVR B;  3L36 A;  4I1L A;  2N1T A;  1NOH A;  1L4A D;  1LGH B;  1RF1 A;  1H8A A;  2N1T C;  5APW A;  2POH A;  2WIT A;  4W80 A;  2WZ7 A;  3VP9 A;  5AVV B;  1NKN A;  4JYC A;  2Q9I A;  1CI6 B;  1LTJ B;  1IFN A;  4LC1 A;  5KLV K;  2E43 A;  3L35 A;  2A45 I;  3HRN A;  2A45 G;  3M9Q A;  2M3B A;  3U1A A;  3M9B A;  3MGN A;  2WPS A;  2HG5 D;  1URQ B;  5AW3 B;  1IFI A;  4XE5 B;  3MD0 A;  1SP4 A;  2H7H A;  3LW5 H;  1HWT C;  2WSF H;  1N7S C;  2C0X A;  3GHG C;  1N2D C;  1N73 B;  3P32 A;  2MJZ A;  1QL2 A;  1S9K E;  1SLQ A;  5APS A;  2H8P D;  1RF1 C;  4I2L C;  3RL0 D;  3V4Q A;  2WT7 A;  4W7Y A;  1NTK K;  5CJ4 A;  2P7J A;  2J59 M;  2HYN A;  3NXS A;  2N1T D;  3P8M C;  1NH4 A;  1GDT A;  1JTH A;  1DX7 A;  1NWQ A;  2FKW B;  3NTN A;  3V5B A;  4HH2 A;  1JY3 O;  4W7Z A;  3MTU E;  2WSC H;  3P8C D;  2FFD B;  5AVS B;  3TNU A;  1J1D B;  1FZC C;  4KHX A;  1N7S A;  2YKQ A;  1NTZ K;  1T3U A;  1RE3 A;  2Z5H A;  1MV8 A;  2NPS D;  1GW4 A;  3IFM A;  3U1C A;  5AW4 B;  5BU8 B;  1LTB C;  4GT1 A;  1ZR4 A;  2M8R A;  3KPE A;  2P1J A;  3M06 A;  3CL3 D;  1RF0 C;  5KJ7 D;  4Y99 C;  1LTJ C;  4RES B;  1JMM A;  1IFJ A;  1URQ D;  3A7O A;  1JY2 O;  1URQ A;  2XV5 A;  1KFN A;  3WMM 0;  3H32 A;  2YNY A;  3HE5 B;  2XKM A;  1MUU A;  5CMZ A;  4XA4 A;  3VMY A;  1L0N K;  2P67 A;  1LTA C;  1HTL C;  1QL1 A;  2KLV A;  1YYC A;  5AVZ B;  2R5D A;  1FJP A;  3TK1 A;  4C7R A;  5AVY B;  1KIL A;  1T2K C;  3BVH A;  1FZA A;  2C9N Y;  1JUN A;  2PP6 A;  1LT9 C;  1KZU B;  2GUS A;  3U59 A;  4HYT B;  3VTP C;  1JY3 P;  2J58 A;  3HE4 A;  1GZL A;  1LT9 A;  2CPS A;  1SFC B;  5AW2 B;  3VMZ A;  1YTZ I;  3P7K A;  3LID A;  1L4A B;  2ZFC A;  1ZR2 A;  1T3J A;  3HD7 D;  4N78 E;  5AW7 B;  4ZKP A;  1KFM A;  3M9H A;  3A2A A;  5CCG D;  1LWU C;  3NMD A;  1G1J A;  1ZV8 A;  3E1I A;  5CCH D;  2KB7 P;  1GL2 B;  4GKG A;  4AQR D;  1L4A C;  3HD7 A;  3HTK A;  1CZQ A;  2JEE A;  4GIF A;  1JNM A;  5APX A;  4WY4 D;  2W6A A;  3B5N B;  2FXM A;  5AW9 B;  1EQ7 A;  3OA7 A;  3HD7 C;  2YO2 A;  3SWF A;  1KIL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...