1KQSE

The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
172
structure length
172
Chain Sequence
PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title A pre-translocational intermediate in protein synthesis observed in crystals of enzymatically active 50S subunits.
pubmed rcsb
molecule tags Ribosome
total genus 39
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 1kqsE01
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 1kqsE02
5GAGG 1VQNE 3DLLE 3G71E 3OW2E 1VQLE 3PIOE 1YJ9E 1YHQE 3CCVE 3CC4E 1VQ6E 5GAHG 3CC2E 1VQKE 5JVHE 1K8AG 1JJ2E 4U67E 3J7ZG 3CPWE 2QEXE 3CF5E 2ZJPE 3CCME 5HL7E 1K73G 5H1SI 1QVGE 3CC7E 4IO9E 5DM7E 1VQPE 5MLCH 3CCQE 2OTLE 4WFAE 1KD1G 2ZJRE 1VQOE 3CMEE 1VQ4E 4WF9E 3CCEE 1S72E 4WFNE 4WCEE 5GADG 1QVFE 3I56E 1K9MG 5DM6E 4UY8G 3CD6E 1Q86G 1NJIG 2QA4E 3CCUE 5AN9B 1YJNE 1KC8G 1VQ9E 4IOAE 3I55E 3CCRE 1VQ7E 1YIJE 3G6EE 1Q7YG 2CQLA 3CXCE 1YJWE 1KQSE 5GAEG 3CCLE 5JVGE 3PIPE 1N8RG 4IOCE 1VQ5E 1W2BE 1M90G 1Q81G 3CMAE 2ZJQE 3CCJE 1M1KG 1YITE 1Q82G 1VQ8E 1VQME 2OTJE 1YI2E 3G4SE 1RL6A 4WFBE 3CCSE
chains in the Genus database with same CATH superfamily
5GAGG 1VQNE 3DLLE 2FKJA 2FKGA 3G71E 3OW2E 1VQLE 3PIOE 1YJ9E 1YHQE 3CCVE 2OL6O 3CKFA 3CC4E 3CKGA 1VQ6E 1P4PA 1RJLC 5GAHG 3CC2E 1VQKE 5JVHE 1K8AG 1JJ2E 4U67E 3J7ZG 3CPWE 2QEXE 3CF5E 2ZJPE 3CCME 5HL7E 1K73G 5H1SI 1QVGE 3CC7E 4IO9E 5DM7E 3EC5A 5MLCH 1VQPE 3CCQE 2OTLE 1FJ1E 2I5ZO 3IGEA 4WFAE 1KD1G 5B10O 1OSPO 2ZJRE 1VQOE 3IG9A 3CMEE 1VQ4E 4WF9E 3CCEE 1S72E 4WFNE 2OYBO 5B2AO 4WCEE 2AF5A 5GADG 1QVFE 3I56E 1K9MG 5DM6E 4UY8G 3CD6E 1Q86G 1NJIG 2I5VO 2QA4E 3CCUE 2OY1O 5AN9B 1YJNE 1KC8G 2HKDA 2G8CO 1VQ9E 4IOAE 3I55E 2PI3O 3CCRE 1VQ7E 1YIJE 3G6EE 1Q7YG 2CQLA 2OY7A 5B3MO 3CXCE 1YJWE 1KQSE 5GAEG 3CCLE 5JVGE 3PIPE 1N8RG 3AUMO 4IOCE 1VQ5E 1W2BE 1M90G 1Q81G 3CMAE 2ZJQE 3CCJE 2OY8A 1M1KG 1YITE 2OL7A 1Q82G 1VQ8E 1VQME 2OTJE 2OY5O 1YI2E 3G4SE 2OL8O 1RL6A 5B11O 4WFBE 3CCSE
chains in the Genus database with same CATH topology
5GAGG 1VQNE 3DLLE 3G71E 3OW2E 1VQLE 3PIOE 1YJ9E 1YHQE 3CCVE 3CC4E 1VQ6E 5GAHG 3CC2E 1VQKE 5JVHE 1K8AG 1JJ2E 4U67E 3J7ZG 3CPWE 2QEXE 3CF5E 2ZJPE 3CCME 5HL7E 1K73G 5H1SI 1QVGE 3CC7E 4IO9E 5DM7E 1VQPE 5MLCH 3CCQE 2OTLE 4WFAE 1KD1G 2ZJRE 1VQOE 3CMEE 1VQ4E 4WF9E 3CCEE 1S72E 4WFNE 4WCEE 5GADG 1QVFE 3I56E 1K9MG 5DM6E 4UY8G 3CD6E 1Q86G 1NJIG 2QA4E 3CCUE 5AN9B 1YJNE 1KC8G 1VQ9E 4IOAE 3I55E 3CCRE 1VQ7E 1YIJE 3G6EE 1Q7YG 2CQLA 3CXCE 1YJWE 1KQSE 5GAEG 3CCLE 5JVGE 3PIPE 1N8RG 4IOCE 1VQ5E 1W2BE 1M90G 1Q81G 3CMAE 2ZJQE 3CCJE 1M1KG 1YITE 1Q82G 1VQ8E 1VQME 2OTJE 1YI2E 3G4SE 1RL6A 4WFBE 3CCSE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAG G;  1VQN E;  3DLL E;  3G71 E;  3OW2 E;  1VQL E;  3PIO E;  1YJ9 E;  1YHQ E;  3CCV E;  3CC4 E;  1VQ6 E;  5GAH G;  3CC2 E;  1VQK E;  5JVH E;  1K8A G;  1JJ2 E;  4U67 E;  3J7Z G;  3CPW E;  2QEX E;  3CF5 E;  2ZJP E;  3CCM E;  5HL7 E;  1K73 G;  5H1S I;  1QVG E;  3CC7 E;  4IO9 E;  5DM7 E;  1VQP E;  5MLC H;  3CCQ E;  2OTL E;  4WFA E;  1KD1 G;  2ZJR E;  1VQO E;  3CME E;  1VQ4 E;  4WF9 E;  3CCE E;  1S72 E;  4WFN E;  4WCE E;  5GAD G;  1QVF E;  3I56 E;  1K9M G;  5DM6 E;  4UY8 G;  3CD6 E;  1Q86 G;  1NJI G;  2QA4 E;  3CCU E;  5AN9 B;  1YJN E;  1KC8 G;  1VQ9 E;  4IOA E;  3I55 E;  3CCR E;  1VQ7 E;  1YIJ E;  3G6E E;  1Q7Y G;  2CQL A;  3CXC E;  1YJW E;  1KQS E;  5GAE G;  3CCL E;  5JVG E;  3PIP E;  1N8R G;  4IOC E;  1VQ5 E;  1W2B E;  1M90 G;  1Q81 G;  3CMA E;  2ZJQ E;  3CCJ E;  1M1K G;  1YIT E;  1Q82 G;  1VQ8 E;  1VQM E;  2OTJ E;  1YI2 E;  3G4S E;  1RL6 A;  4WFB E;  3CCS E; 
#chains in the Genus database with same CATH topology
 5GAG G;  1VQN E;  3DLL E;  2FKJ A;  2FKG A;  3G71 E;  3OW2 E;  1VQL E;  3PIO E;  1YJ9 E;  1YHQ E;  3CCV E;  2OL6 O;  3CKF A;  3CC4 E;  3CKG A;  1VQ6 E;  1P4P A;  1RJL C;  5GAH G;  3CC2 E;  1VQK E;  5JVH E;  1K8A G;  1JJ2 E;  4U67 E;  3J7Z G;  3CPW E;  2QEX E;  3CF5 E;  2ZJP E;  3CCM E;  5HL7 E;  1K73 G;  5H1S I;  1QVG E;  3CC7 E;  4IO9 E;  5DM7 E;  3EC5 A;  5MLC H;  1VQP E;  3CCQ E;  2OTL E;  1FJ1 E;  2I5Z O;  3IGE A;  4WFA E;  1KD1 G;  5B10 O;  1OSP O;  2ZJR E;  1VQO E;  3IG9 A;  3CME E;  1VQ4 E;  4WF9 E;  3CCE E;  1S72 E;  4WFN E;  2OYB O;  5B2A O;  4WCE E;  2AF5 A;  5GAD G;  1QVF E;  3I56 E;  1K9M G;  5DM6 E;  4UY8 G;  3CD6 E;  1Q86 G;  1NJI G;  2I5V O;  2QA4 E;  3CCU E;  2OY1 O;  5AN9 B;  1YJN E;  1KC8 G;  2HKD A;  2G8C O;  1VQ9 E;  4IOA E;  3I55 E;  2PI3 O;  3CCR E;  1VQ7 E;  1YIJ E;  3G6E E;  1Q7Y G;  2CQL A;  2OY7 A;  5B3M O;  3CXC E;  1YJW E;  1KQS E;  5GAE G;  3CCL E;  5JVG E;  3PIP E;  1N8R G;  3AUM O;  4IOC E;  1VQ5 E;  1W2B E;  1M90 G;  1Q81 G;  3CMA E;  2ZJQ E;  3CCJ E;  2OY8 A;  1M1K G;  1YIT E;  2OL7 A;  1Q82 G;  1VQ8 E;  1VQM E;  2OTJ E;  2OY5 O;  1YI2 E;  3G4S E;  2OL8 O;  1RL6 A;  5B11 O;  4WFB E;  3CCS E; 
#chains in the Genus database with same CATH homology
 5GAG G;  1VQN E;  3DLL E;  3G71 E;  3OW2 E;  1VQL E;  3PIO E;  1YJ9 E;  1YHQ E;  3CCV E;  3CC4 E;  1VQ6 E;  5GAH G;  3CC2 E;  1VQK E;  5JVH E;  1K8A G;  1JJ2 E;  4U67 E;  3J7Z G;  3CPW E;  2QEX E;  3CF5 E;  2ZJP E;  3CCM E;  5HL7 E;  1K73 G;  5H1S I;  1QVG E;  3CC7 E;  4IO9 E;  5DM7 E;  1VQP E;  5MLC H;  3CCQ E;  2OTL E;  4WFA E;  1KD1 G;  2ZJR E;  1VQO E;  3CME E;  1VQ4 E;  4WF9 E;  3CCE E;  1S72 E;  4WFN E;  4WCE E;  5GAD G;  1QVF E;  3I56 E;  1K9M G;  5DM6 E;  4UY8 G;  3CD6 E;  1Q86 G;  1NJI G;  2QA4 E;  3CCU E;  5AN9 B;  1YJN E;  1KC8 G;  1VQ9 E;  4IOA E;  3I55 E;  3CCR E;  1VQ7 E;  1YIJ E;  3G6E E;  1Q7Y G;  2CQL A;  3CXC E;  1YJW E;  1KQS E;  5GAE G;  3CCL E;  5JVG E;  3PIP E;  1N8R G;  4IOC E;  1VQ5 E;  1W2B E;  1M90 G;  1Q81 G;  3CMA E;  2ZJQ E;  3CCJ E;  1M1K G;  1YIT E;  1Q82 G;  1VQ8 E;  1VQM E;  2OTJ E;  1YI2 E;  3G4S E;  1RL6 A;  4WFB E;  3CCS E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...