1KQXA

Crystal structure of apo-crbp from zebrafish
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
134
structure length
134
Chain Sequence
PADFNGTWEMLSNDNFEDVMKALDIDFATRKIAVHLKQTKVIVQNGDKFETKTLSTFRNYEVNFVIGEEFDEQTKGLDNRTVKTLVKWDGDKLVCVQKGEKENRGWKQWIEGDLLHLEIHCQDKVCHQVFKKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular retinol-binding protein
publication title Identification and structural analysis of a zebrafish apo and holo cellular retinol-binding protein.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transport protein
total genus 34
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1kqxA00
1QFVA 4NLIA 4TQ2A 2G78A 3B2HA 4HPCA 1ZNLA 1U18A 1LNMA 1GT1A 2HNXA 5H9AA 1ERXA 4DQ3A 1KQXA 1FTPA 4AW8A 4HPBA 4A8ZA 1Z24A 3I17A 4YH0A 3WBGA 5EEDA 1X71A 3ZUOA 4R0BA 1BSOA 1LIFA 1BBPA 1XCAA 1BSQA 2HMBA 4ZH9A 1UZ2X 1X8PA 4YDAA 4ZR2A 3NPOA 3WXQA 3BLGA 3UEWA 1HBQA 5H9LA 4TLJA 3UEXA 4NNSA 4IB8A 1X8QA 4HPDA 1B56A 3BU1A 4QZUA 5IO6A 4WFUA 2MJIA 3HWEA 3JSQA 3FMZA 4HPAA 4RUUA 3HWGA 2LKKA 2R73A 3F8AA 3IFBA 3F9DA 2RCTA 1EXSA 2FRSA 5HTEA 1RLBE 2K62A 4Y0SA 1G5WA 1A3YA 2DM5A 4GH7A 3VG2A 3HWDA 4XMEA 1E06A 1CRBA 1YP6A 3BY0A 4XMDA 1JJXA 4UU2A 4LKPA 2Q4NA 4GNWA 4GE1A 2G7BA 1R0UA 2L68A 5HAEA 2GTFX 1LF7A 1FE3A 3BU9A 4RUNA 3C78X 3S26A 3P6DA 3G7XA 4EEJA 3B2IA 5HZQA 1GKAB 1EPBA 3O22A 4DQ4A 5LJGA 1BLRA 4AZMA 3FENA 2ANSA 1QABE 2NNDA 3BRNA 4XMFA 2JOZA 1X8OA 4ZCBA 3STNA 1KOIA 4I3DA 1G74A 3VG3A 3KQ0A 2ASNX 5HZ6A 2POAA 4NNTA 1DC9A 5F7GA 1HMTA 1IFCA 1JV4A 2OVDA 3NX2A 1I06A 3NQ3A 1YWCA 4AYHA 2FTBA 3NP1A 1T68X 1TVQA 2ACPX 3TGBA 3SAOA 1YWBA 3AKMA 4MVLA 4TKJA 3PPTA 2HZRA 5FENA 1QY1A 1TOUA 4QYNA 3WJDA 2AKQA 4OMXA 2X45A 2CZTA 3FA8A 1SY0A 3BS2A 2N93A 1H91A 2OFMX 3BX8A 5LJCA 5KIDA 4TJZA 2A3FX 2RQ0A 2CM9A 1JJJA 3WJBA 5C0NA 2W2AA 2WR6A 4YFQA 1CBIA 2RCQA 2WUTA 2HZQA 5F58A 3U03A 1ZRYA 4I9RA 3K3LA 4OS3A 3AKNA 4NP1A 1IKJA 1EPAA 1QFTA 4O9SA 2AT5X 4UU3A 5HCDC 5BVSA 4Y0PA 1FENA 1OEJA 1KT5A 1X8NA 1KT6A 2ACOA 5L8NA 4NLJA 3P6GA 4OS8A 1JYDA 1MVGA 2JU7A 1AVGI 2MO5A 5CE4A 1I04A 3U9PC 1CBRA 1EIIA 1I05A 2NP1A 3PECA 4BVMA 3P6CA 2Q9SA 4ORRA 4YGZA 1B0OA 1SY1A 2WWPA 1D2UA 4N7CA 5F6BA 1O8VA 2YG2A 4MVIA 3B2KA 3BSZE 1ADLA 4MVKA 1ML7A 4KIIA 1LICA 2W2BA 3FW5A 5JR8A 3ZUIA 1JBHA 1CBSA 1GX8A 5HZ8A 5D48A 3KFFA 4I9SA 1FELA 2LBAA 2L9CA 1KT7A 3APUA 5HWZA 2X46A 4PSQA 5FFHA 2WQAE 1E02A 1GM6A 2R74A 1BRQA 3STKA 2BLGA 2HYSA 1PMPA 3MBTA 2JU3A 1QG5A 4A1YA 4YKOA 1TOWA 1QY0A 2LBVA 4Y0QA 3WJGA 5DPQA 4YGGA 3BX7A 3VG4A 3P6EA 4QGXA 5K06A 4TKBA 3TGCA 1GT4A 4LKTA 1UREA 3PP6A 1IKEA 2WQ9A 1NP4A 4YMYA 3EYCA 1T0VA 2ALLX 1N0SA 3APWA 1X89A 3Q6LA 1A2DA 5HTDA 1KGLA 1X8UA 3RSWA 3FR4A 5B29A 4I3BA 1TW4A 1ICNA 2NNQA 1GKAA 1JYJA 4LZVA 3T1DA 1LKEA 1A57A 2WEWA 1LFOA 4IMNA 5D47A 3U0DA 1ZNEA 3ZQ3A 4BQUA 1TXLA 4ARHA 2Q39A 1GT3A 5F6ZA 1LIEA 4ORYA 4NYRA 3NQ9A 5B27A 4EFGA 4M6SA 1ZNGA 3FIQA 4IAWA 2FS7A 3IA8A 3TGAA 3HK1A 5LJEA 1QY2A 3EBKA 4IB7A 2F73A 1BM5A 2QO6A 4CK4A 3DSZA 2IFBA 5H9KA 5D4AA 5D45A 5BVQA 1P6PA 2CBSA 2RD7C 1OEEA 1D3SA 5LJBA 2E4JA 1EQDA 4ES7A 4YKMA 4M7MA 1B8EA 2FR3A 3CWKA 3ELZA 1BJ7A 1BRPA 1IFBA 1YIVA 5H9NA 2AH7X 4YGHA 2AT8X 3D95A 3P6FA 4AZRA 2LFOA 4YDBA 5DG4A 1DZJA 1PBOA 2FT9A 1E5PA 1OEKA 4ORXA 5L8IA 1ZNDA 4QZTA 2LB6A 4IBAA 5KICA 4AZPA 4I3CA 3FR5A 3B2JA 2XKLA 1S2PA 1BWYA 4XMHA 2QM9A 3ELXA 3O2YA 2K23A 2WSJA 2CM4A 4A60A 2RA6A 2OVAA 3EM0A 1ACDA 5LKEA 3O19A 1AELA 1KT4A 4EXZA 1HMRA 1YWDA 4AZQA 1XKIA 1OPAA 5KHPA 3VG7A 1OBUA 1GX9A 4D6AA 1BEBA 1DZMA 2CZUA 5EEEA 5BVTA 3CQNA 3KFGA 2A2UA 1OBQA 2FR2A 3PH5A 4TNNA 1VPRA 1I4UA 5HA0A 5IO7A 4ZJ0A 3APXA 3B2LA 1LIBA 3CR6A 2PY1A 1HN2A 4WFVA 3CBSA 2W2FA 3CMPA 4ALBA 3MVFA 1EALA 3NX1A 1DV9A 1DF3A 1T8VA 2AL0X 3PH6A 2L67A 2A2GA 1VYFA 1A18A 1AQBA 4ORWA 5H8TA 5D8JA 3P6HA 3QKGA 5HBSA 4K19A 3L4RA 5EDBA 1KZXA 2NNEA 1GGLA 1U17A 1KXOA 4GNYA 4ZGUA 3C76X 1QQSA 2AT3X 5EDCA 5AQ6A 1PM1X 2FLJA 2A13A 4ORUA 1ZNKA 1MUPA 4GETA 4NYQA 5HCCC 2QO5A 5HCEC 5LJDA 5LJHA 3EMMA 1YP7A 3HWFA 1FDQA 4YCHA 3FEKA 4EDEA 1HQPA 4TKHA 1S44A 5IO5A 4QGVA 1NGLA 5EPQA 1SY3A 3D96A 3FW4A 2A0AA 1SY2A 3VG6A 3WJFA 3GAQA 4YFPA 2Q2MA 2OFRX 3KZAA 5LKFA 4GRJA 1MDCA 1SA8A 5FAZA 1HBPA 2GC9A 3TF6A 4IB6A 1BSYA 3KFHA 4N7DA 1DZKA 4OS0A 5EZ2A 3RZYA 1KT3A 3FA6A 5HZ5A 1AB0A 3FA9A 1FEMA 1L6MA 4Y0RA 3JS1A 2CBRA 4ZHCA 3CQRA 1U0XA 1S7DA 5LJKA 1OPBA 3WJCA 2KTDA 2WEXA 4AZNA 1OBPA 2Q2PA 1SXUA 5L8OA 3PEDA 1YWAA 2FWVA 2G79A 4GKCA 4LZUA 4ZFXA 2HLVA 1JZUA 4XMCA 3WJEA 3APVA 1CJ5A 4ZH6A 2QOSC 3C77X 1IW2A 1GT5A 3EBWA 3FELA 3KFIA 1B4MA 3STMX 2OVEA 1ZNHA 1O1VA 1LIDA 3D97A 4A1HA 1HMSA 3CBCA 1EW3A 1GXAA 2O62A 2EU7X 3WVMA 1IIUA 3UEVA 2AT0X 1ICMA 3NR3A 3VG5A 4YFRA 3FLLA 4ZHFA 1EIOA 1CBQA 1EUOA 2XSTA 3FR2A 3FA7A 2R56A 5F1EA 1ERBA 4YCEA 4OMWA 2FS6A 1SXYA 2OZQA 2GJ5A 1QWDA 4D6BA 4QYPA 4ALOA 3DTQA 2QO4A 4ODDA 4IAXA 4AZOA 4XMGA 5HA1A 2KT4B 1YUPA 4BOEA 2JN3A 3UEUA 1KQWA 1VYGA 4ORSA 2L5PA 4ZHDA 1LPJA 4ZHHA 1O1UA 1MX8A 1PEEA 1KZWA 2MM3A 2P8GA 3BDRA 4YBPA 1RBPA 2JU8A 1G7NA 1ALBA 3I0AA 1DFVA 1MX7A 4YBUA 1NP1A 1SXXA 4ZHGA 4IMOA 1SXWA 3TZSA 1DZPA 3OJYC 5HZ9A 4QAEA 3NADA 2AT6X 2AMMX 4IB9A 1E00A 3FEPA 4HFOA 4WBKA 1G85A 4QGWA
chains in the Genus database with same CATH superfamily
1QFVA 4NLIA 4TQ2A 2DJFA 2G78A 3B2HA 4HPCA 1ZNLA 1U18A 1LNMA 1GT1A 2HNXA 4O4OA 1ERXA 2QMIA 5H9AA 4DQ3A 3RKGA 1KQXA 2BT9A 1FTPA 4AW8A 4BX6B 4Z2OA 1JJUA 4HPBA 1Z24A 2RTDB 1SREA 3I17A 4MISA 2FHLA 1VWLB 4IABA 4YH0A 3WBGA 5EEDA 2X56A 1SWSA 1X71A 5FQ8E 3ZUOA 4R0BA 1BSOA 1LIFA 1BBPA 3VU1A 1AVEA 1XCAA 3HOEA 4NW4A 2GH7A 4GGZA 1BSQA 2G8CO 1JQPA 2HMBA 4ZH9A 1UZ2X 1X8PA 2VFCA 4YDAA 3ZW1B 4ZR2A 3NPOA 2G5LA 3WXQA 1HQQA 3BLGA 4GGTA 3UEWA 5BYPA 1HBQA 1Y53X 3RY2A 5H9LA 4ZGFA 4TLJA 3UEXA 4NNSA 4IB8A 1I9HA 1X8QA 2RTFB 4HPDA 1B56A 3BU1A 4QZUA 5IO6A 4WFUA 1N4JA 2MJIA 3HWEA 3JSQA 3V8UA 2X8TA 3PQUA 3FMZA 4HPAA 2OL8O 4RUUA 3HWGA 1KL4A 2LKKA 2R73A 3F8AA 3IFBA 3F9DA 2RCTA 1EXSA 2BHVA 2FRSA 5HTEA 1I78A 1RLBE 2K62A 2VFBA 4Y0SA 4CDEA 5FQ6E 2KTSA 4CSBA 1N9MA 1G5WA 1A3YA 2DM5A 4GH7A 3VG2A 1SWKA 3HWDA 4XMEA 1LDOA 1E06A 1CRBA 1W4TA 3KVNA 1YP6A 3BY0A 4GUZA 2RTCB 4XMDA 1JJXA 4UU2A 4ON1A 4LKPA 3FDCA 1SRHA 2Q4NA 2OFBA 3MG5A 4GE1A 4GNWA 2G7BA 1R0UA 2L68A 1UYNX 5HAEA 2GTFX 1LF7A 1FE3A 3BU9A 4RUNA 1RXKA 3C78X 3RDOA 3S26A 3P6DA 3G7XA 4EEJA 3B2IA 5HZQA 1GKAB 5AEOA 1EPBA 3O22A 4DQ4A 4EKVA 3Q34A 2CAMA 5LJGA 4GJSA 1BLRA 3ZW2A 4AZMA 3FENA 1VWHB 2ANSA 1QABE 1JMZA 2NNDA 3BRNA 4WHIA 4XMFA 2JOZA 1X8OA 4MVEA 4ZCBA 2QOMA 1KOIA 3STNA 4I3DA 3OBLA 1G74A 3VG3A 1LDQA 3KQ0A 2X34A 2ASNX 5HZ6A 1W6FA 2POAA 4KH8A 1DC9A 4NNTA 3VPJE 3WYQA 3VGWA 5F7GA 1HMTA 1RSUB 1IFCA 1JV4A 2OVDA 3NX2A 1E2TA 1I06A 3NQ3A 1YWCA 4AYHA 1AVDA 2FTBA 2OVSA 1UYOX 3NP1A 1T68X 3EW1A 1SWGA 1TVQA 1WBIA 2ACPX 2IZEB 3P02A 5AJCA 4BX5B 3SAOA 1YWBA 3AKMA 4MVLA 4TKJA 1VWDB 3PPTA 2HZRA 5FENA 2BC3A 1QY1A 1TOUA 4QYNA 1STSB 2MHDA 2AKQA 3WJDA 4OMXA 1VWPB 2CZTA 2X45A 3FA8A 3WZPA 4JNJA 1SY0A 3BS2A 2N93A 1H91A 1SWOA 2OFMX 5B5FA 3BX8A 1NC9A 4BGFA 5LJCA 5KIDA 2VDFA 3T2WA 4TJZA 2ZSCA 2A3FX 1Y9LA 2RQ0A 2CM9A 1JJJA 3WJBA 4CDDA 1SWBA 5C0NA 2W2AA 2WR6A 4YFQA 1CBIA 2RCQA 2WUTA 1N9YA 2HZQA 4QNIA 5F58A 4BJ8A 3SLOA 3U03A 5IRUA 1ZRYA 4I9RA 3S5XA 4CPEA 4L3RA 3K3LA 4OS3A 3AKNA 1IJ8A 4NP1A 1IKJA 1EPAA 2FHNX 4KC7A 1QFTA 1RXHA 2X32A 2AT5X 4O9SA 4OELA 4UU3A 5HCDC 5BVSA 4Y0PA 1FENA 1OEJA 1KT5A 1X8NA 4O49A 1KT6A 2ACOA 2IZIA 4FBRA 5L8NA 4FGIB 5CHKA 4NLJA 3AEHA 3P6GA 4DNEA 2RTBB 4OS8A 1JYDA 1MVGA 2JU7A 4COTA 3MM0A 1AVGI 2M4LA 2MO5A 5CE4A 1I04A 3U9PC 4Z6JA 1CBRA 1NDJA 4GZVA 1EIIA 5B10O 1I05A 4GK9A 2NP1A 3PECA 2X4MA 2OFAA 4BVMA 1VWQB 5CSEA 3P6CA 2Q9SA 1VWRB 4ORRA 4YGZA 3FYFA 1B0OA 1SY1A 2WWPA 1D2UA 1GX3A 3CKFA 4N7CA 5F6BA 1O8VA 1VWGB 2YG2A 2BS5A 4MVIA 4BX6A 3B2KA 1SWDA 2ZAGA 3BSZE 2IZCB 1ADLA 4MVKA 1ML7A 4KIIA 1LICA 2W2BA 3VHMA 3FW5A 5JR8A 3ZUIA 1VWKB 4U8UO 1CBSA 1JBHA 1GX8A 1SWAA 5HZ8A 5D48A 1Y52X 3RDQA 3KFFA 1VWMB 1HY2A 4I9SA 3ZW1A 1FELA 3VE1A 2LBAA 3N91A 2L9CA 3WZOA 1SLFB 1DF8A 1KT7A 3APUA 5HWZA 2X46A 4PSQA 4O4UA 5FFHA 2MF6A 2WQAE 4FBOA 4O4XA 1E02A 1GM6A 1N7YA 2R74A 1BRQA 1SMPI 2IZAA 3STKA 2FGSA 2BLGA 2HYSA 3X00A 1PMPA 3MBTA 2JU3A 1QG5A 4Z2VA 3MX7A 4A1YA 2RTQB 2I5VO 1STPA 1RSTB 4QRLA 4YKOA 1EI5A 1STRB 1QY0A 1TOWA 2A5CA 3PK2A 4Y0QA 5DPQA 4YGGA 2LBVA 3UAQA 3WJGA 4CPHB 1SWUA 4EQAC 4YVBA 3BX7A 3VG4A 2IZLB 1RAVA 3P6EA 1SLDB 3AUMO 4QGXA 4TKBA 5K06A 3TGCA 1GT4A 4LKTA 1UREA 3PP6A 1IKEA 2WQ9A 1KFFA 1VYOA 1NP4A 4YMYA 3EYCA 1T0VA 4O3WA 4U9CA 5EDBA 2OY5O 2ALLX 1N0SA 3APWA 1X89A 3CKGA 5JD2A 2OL6O 1JMXA 2C1QA 3Q6LA 3T6FA 1A2DA 3NQKA 3OE3A 3P24A 5HTDA 1KGLA 1SWPA 1X8UA 2X55A 3SOTA 3RSWA 4CPHA 3FR4A 5B29A 1LUQA 2Y32A 4I3BA 1TW4A 1ICNA 2NNQA 5F2BA 3RE5A 3PDFA 1GKAA 1JYJA 4LZVA 3T1DA 2RTRB 1LKEA 1VWOB 1A57A 1NQNA 2WEWA 4O4SA 1LFOA 1SRIA 4IMNA 2RTPB 5D47A 4CPFA 3T6LA 3U0DA 1ZNEA 3ZQ3A 4HWMA 4BX7B 4BQUA 2AF5A 1TXLA 4ARHA 2F09A 5K67A 2Q39A 1GT3A 1VWAB 5F6ZA 1LIEA 1SWLA 4ORYA 3ZW0B 1SWTA 4NYRA 3NQ9A 5B27A 1PBYA 4EFGA 1LELA 2RTGB 4M6SA 4MEEA 1ZNGA 2RTIB 2KD2A 3FIQA 2Y3EA 5B2AO 3RDSA 4IAWA 2FS7A 3IA8A 4Y5DA 3TGAA 3HK1A 4FBVA 5LJEA 1QY2A 2Z4HA 3EBKA 4BX5A 1K3BA 4IB7A 2F73A 1BM5A 3RZYA 2QO6A 3RDMA 3DSZA 4KT5A 3WZQA 2IFBA 2IZBA 4JGLA 4CK4A 5H9KA 4KC8A 2GTLM 3LV4A 5D4AA 5D45A 5BVQA 1P6PA 1KL3A 2CBSA 2RD7C 1OEEA 4U46A 4ML7B 1D3SA 3QQ2A 3SLTA 5LJBA 2E4JA 1EQDA 4ES7A 4YKMA 4PJ2A 2UYWA 4M7MA 1B8EA 2FR3A 3CWKA 2JGSA 3ELZA 1BJ7A 1VWCB 3ZZVA 1VWBB 4Y59A 1BRPA 1IFBA 1Y9TA 1YIVA 2RTOB 2OL7A 1VWIB 2FKGA 5H9NA 2AH7X 4YGHA 2RTNB 2AT8X 3D95A 3P6FA 3VHIA 2LFOA 4YDBA 2OY7A 2QCBA 5DG4A 3VHHA 4AZRA 1DZJA 1MM9A 1PBOA 3WYPA 2FT9A 1E5PA 1OEKA 4ORXA 5L8IA 1ZNDA 1PTSA 4U8UM 4QZTA 4NV8A 2LB6A 4NV7A 1KZXA 1OSPO 4IBAA 2UZ2A 5KICA 1Y0GA 4Z2PA 4AZPA 3HPEA 3FR5A 4I3CA 5CYBA 3B2JA 2RTJA 2XKLA 1S2PA 4BBOA 4I95A 2QM9A 3ELXA 4XMHA 1BWYA 3SZJA 3O2YA 1N43A 4OKAA 2K23A 2WSJA 2A8GA 2CM4A 2GTLO 4A60A 2RA6A 2OVAA 3F6ZB 1SWFA 3EM0A 1ACDA 5LKEA 3O19A 1MEPA 1AELA 4CV7A 2RN4A 1KT4A 3S60A 4JO6A 3VE2A 4EXZA 1HMRA 1NQMA 1YWDA 4AZQA 1XKIA 1OPAA 5KHPA 3VG7A 1OBUA 2C1SA 1GX9A 2YMSA 4D6AA 1BEBA 4DCBA 1DZMA 2CZUA 2RTEB 5EEEA 5BVTA 3CQNA 3KFGA 4U3QA 2A2UA 3LTWA 1OBQA 1SWCA 2FR2A 1K24A 3PH5A 4TNNA 4ZFXA 1VPRA 1I4UA 5HA0A 1W5RA 5IO7A 2AVIA 4OEMA 4ZJ0A 3APXA 3B2LA 1LIBA 3CR6A 5B5GA 2OF8A 1HN2A 2PY1A 4WFVA 3CBSA 2W2FA 3CMPA 2C4IA 4FQBB 4I6SA 3H3IA 3MVFA 5IRAA 4ALBA 4Z27A 3NX1A 1B4MA 4GDAA 1DV9A 3WOVA 1EALA 2MWHA 1DF3A 1T8VA 2AL0X 3HOLA 1SRFA 3PH6A 1VWNB 2L67A 1SWJA 2A2GA 1VYFA 1A18A 1AQBA 2F01A 1LCZA 4ORWA 1LCVA 5D8JA 5H8TA 3P6HA 3QKGA 5HBSA 1SWEA 3L4RA 4GU8A 3GE2A 4K19A 1HXLA 2GTLN 1FJ1E 2NNEA 1GGLA 1U17A 1KXOA 3NBXX 4GNYA 5K68A 2RTLA 1QQSA 2AT3X 3C76X 5EDCA 5AQ6A 1PM1X 2FLJA 4ZGUA 2A13A 4GGRA 5AJBA 4ORUA 3RE6A 1SRGA 1ZNKA 3SZIA 1MUPA 4GETA 4NYQA 5HCCC 2QO5A 5HCEC 3WZNA 5LJDA 5LJHA 3EMMA 1YP7A 3HWFA 1FDQA 4YCHA 1Y55X 3FEKA 4GJVA 3ZWEA 4EDEA 1HQPA 4TKHA 1S44A 5IO5A 2RTHB 4QGVA 1NGLA 5EPQA 4I60A 1SY3A 3PQSA 3D96A 3FW4A 4CDCA 1MK5A 2A0AA 2IZHB 3JQOA 4C5PA 1SY2A 1VWJB 3VG6A 5IXGA 4U8UN 3WJFA 2FKJA 3GAQA 4YFPA 2Q2MA 4ID2A 2OFRX 4CDFA 3KZAA 5LKFA 4LQZA 4GRJA 1MDCA 1SA8A 5FAZA 1HBPA 4JHQA 2GC9A 3TF6A 4IB6A 1BSYA 3KFHA 4GDZA 1DZKA 4N7DA 4OS0A 5EZ2A 1KT3A 3FA6A 4A8ZA 5HZ5A 1AB0A 1MOYA 1SLGB 4BX7A 3FA9A 2IZDB 1FEMA 1L6MA 1SRJA 2DJGA 3EW2A 3JS1A 1KL5A 2CBRA 4Y0RA 4ZHCA 2HKDA 3CQRA 1U0XA 1S7DA 3ZW0A 4O3YA 5LJKA 2IZKA 1OPBA 1SWHA 2LA7A 3RWXA 2RTKA 4CPIA 4INNA 3WJCA 4Z28A 2KW1A 3RDUA 2KTDA 2WEXA 4AZNA 1OBPA 2Q2PA 2IZFB 1SWNA 2IZJA 1SXUA 1VWEB 2JW1A 5B3MO 5L8OA 3PEDA 1YWAA 2FWVA 2G79A 3LHNA 4GKCA 2Y3FA 2HLVA 2ZAIA 4LZUA 4QQ1A 5FQ7E 1JZUA 4XMCA 3SLJA 3WJEA 3APVA 1CJ5A 4ZH6A 2QOSC 3C77X 1IW2A 1GT5A 1VWFB 2X8SA 3EBWA 3FELA 3KFIA 3RBYA 5L3YA 1RXJA 2OY8A 2OVEA 1ZNHA 1O1VA 1LIDA 3D97A 2BSZA 3HTYA 3STMX 4A1HA 1HMSA 2OYBO 3CBCA 5IRWA 1EW3A 1GXAA 2O62A 2EU7X 3WVMA 1IIUA 3UEVA 2AT0X 1ICMA 3NR3A 1WUBA 3EC5A 2OF9A 3E3CA 3VG5A 1NBXA 3FLLA 4YFRA 4ZHFA 1CBQA 1EUOA 2XSTA 3FR2A 1EIOA 3FA7A 2R56A 5F1EA 1ERBA 4YCEA 4OMWA 2FS6A 5B11O 1SXYA 2OZQA 3D4RA 3RY1A 2GJ5A 4MIRA 3S5VA 2Z4IA 1LCWA 1QWDA 4D6BA 1HXZA 2RTAA 4QYPA 4ALOA 2RTMA 3DTQA 3T2XA 2QO4A 4ODDA 4IAXA 2OY1O 4AZOA 3ZI8A 3FIDA 4XMGA 5HA1A 2BS6A 2KT4B 1YUPA 4BOEA 2JN3A 3UEUA 1KQWA 1VYGA 4ORSA 2L5PA 4ZHDA 2JMBA 1LPJA 4L1NA 4ZHHA 1O1UA 1MX8A 4IRWA 1PEEA 2I5ZO 2MM3A 2P8GA 3BDRA 4YBPA 1KZWA 1RBPA 2JU8A 1G7NA 4GD9A 2A5BA 1ALBA 3I0AA 4BCSA 1DFVA 1JIWI 3D9WA 1MX7A 4YBUA 2X8FA 1NP1A 1SXXA 4ZHGA 4IMOA 1SXWA 3TZSA 3TGBA 2WPUA 4B55A 1DZPA 3OJYC 5HZ9A 3OD9A 1SWQA 3RDXA 4QAEA 4KCAA 3NADA 2AT6X 2AMMX 2PI3O 4IB9A 1E00A 3SZHA 3FEPA 4HFOA 4WBKA 1SWRA 2IZGB 1G85A 4O3ZA 4O3XB 1SLEB 4QGWA
chains in the Genus database with same CATH topology
1QFVA 4NLIA 4TQ2A 2G78A 3B2HA 4HPCA 1ZNLA 1U18A 1LNMA 1GT1A 2HNXA 4O4OA 1ERXA 2QMIA 5H9AA 4DQ3A 3RKGA 1KQXA 2BT9A 1FTPA 4AW8A 4HPBA 4A8ZA 1Z24A 3I17A 4MISA 4YH0A 4IABA 3WBGA 5EEDA 1X71A 5FQ8E 3ZUOA 4R0BA 1BSOA 1LIFA 1BBPA 3VU1A 3HOEA 1XCAA 4NW4A 1BSQA 2HMBA 4ZH9A 1UZ2X 1X8PA 4YDAA 3ZW1B 4ZR2A 3NPOA 3WXQA 3BLGA 3UEWA 5BYPA 1HBQA 5H9LA 4ZGFA 4TLJA 3UEXA 4NNSA 4IB8A 1X8QA 4HPDA 1B56A 3BU1A 4QZUA 5IO6A 4WFUA 2MJIA 3HWEA 3JSQA 3V8UA 2X8TA 3PQUA 3FMZA 4HPAA 4RUUA 3HWGA 2LKKA 2R73A 3F8AA 3IFBA 3F9DA 2RCTA 1EXSA 2BHVA 2FRSA 5HTEA 1RLBE 2K62A 4CSBA 4Y0SA 5FQ6E 2KTSA 1G5WA 1A3YA 2DM5A 4GH7A 3VG2A 3HWDA 4XMEA 1E06A 1CRBA 1YP6A 3BY0A 4XMDA 1JJXA 4UU2A 4ON1A 4LKPA 2Q4NA 4GNWA 4GE1A 2G7BA 1R0UA 2L68A 5HAEA 2GTFX 1LF7A 1FE3A 3BU9A 4RUNA 3C78X 3S26A 3P6DA 3G7XA 4EEJA 3B2IA 5HZQA 1GKAB 5AEOA 1EPBA 3O22A 4DQ4A 5LJGA 1BLRA 3ZW2A 4AZMA 3FENA 2ANSA 1QABE 2NNDA 3BRNA 4XMFA 2JOZA 1X8OA 4MVEA 4ZCBA 3STNA 1KOIA 4I3DA 3OBLA 1G74A 3VG3A 3KQ0A 2ASNX 5HZ6A 2POAA 4NNTA 4KH8A 1DC9A 3VPJE 5F7GA 1HMTA 1IFCA 1JV4A 2OVDA 3NX2A 1I06A 3NQ3A 1YWCA 4AYHA 2FTBA 2OVSA 3NP1A 1T68X 1TVQA 2ACPX 3TGBA 3P02A 5AJCA 3SAOA 1YWBA 3AKMA 4MVLA 4TKJA 3PPTA 2HZRA 5FENA 1QY1A 1TOUA 4QYNA 2MHDA 2AKQA 3WJDA 4OMXA 2X45A 2CZTA 3FA8A 1SY0A 3BS2A 2N93A 1H91A 2OFMX 3BX8A 5LJCA 5KIDA 4TJZA 2A3FX 1Y9LA 2RQ0A 2CM9A 1JJJA 3WJBA 5C0NA 2W2AA 2WR6A 4YFQA 1CBIA 2RCQA 2WUTA 2HZQA 4QNIA 5F58A 3U03A 1ZRYA 4I9RA 3S5XA 4L3RA 3K3LA 4OS3A 3AKNA 4NP1A 1IKJA 1EPAA 4KC7A 1QFTA 4O9SA 2AT5X 4UU3A 5HCDC 5BVSA 4Y0PA 1FENA 1OEJA 1KT5A 1X8NA 4O49A 1KT6A 2ACOA 4FBRA 5L8NA 4FGIB 4NLJA 3P6GA 4OS8A 1JYDA 1MVGA 2JU7A 4COTA 1AVGI 2M4LA 2MO5A 5CE4A 1I04A 3U9PC 1CBRA 4GZVA 1EIIA 1I05A 4GK9A 2NP1A 3PECA 4BVMA 3P6CA 2Q9SA 4ORRA 4YGZA 3FYFA 1B0OA 1SY1A 2WWPA 1D2UA 4N7CA 5F6BA 1O8VA 2YG2A 2BS5A 4MVIA 3B2KA 2ZAGA 3BSZE 1ADLA 4MVKA 1ML7A 4KIIA 1LICA 2W2BA 3FW5A 5JR8A 3ZUIA 4U8UO 1CBSA 1JBHA 1GX8A 5HZ8A 5D48A 3KFFA 4I9SA 3ZW1A 1FELA 3VE1A 2LBAA 3N91A 2L9CA 1KT7A 3APUA 5HWZA 2X46A 4PSQA 4O4UA 5FFHA 2WQAE 4FBOA 4O4XA 1E02A 1GM6A 2R74A 1BRQA 1SMPI 3STKA 2BLGA 2HYSA 1PMPA 3MBTA 2JU3A 1QG5A 3MX7A 4A1YA 4QRLA 4YKOA 1EI5A 1TOWA 1QY0A 2LBVA 3UAQA 4Y0QA 3WJGA 5DPQA 4YGGA 4EQAC 3BX7A 3VG4A 3P6EA 4QGXA 5K06A 4TKBA 3TGCA 1GT4A 4LKTA 1UREA 3PP6A 1IKEA 2WQ9A 1NP4A 4YMYA 3EYCA 1T0VA 4O3WA 4U9CA 2ALLX 1N0SA 3APWA 1X89A 3Q6LA 1A2DA 3NQKA 3OE3A 3P24A 5HTDA 1KGLA 1X8UA 3SOTA 3RSWA 3FR4A 5B29A 4I3BA 1TW4A 1ICNA 2NNQA 1GKAA 1JYJA 4LZVA 3T1DA 1LKEA 1A57A 4O4SA 2WEWA 1LFOA 4IMNA 5D47A 3U0DA 1ZNEA 3ZQ3A 4HWMA 4BQUA 1TXLA 4ARHA 2F09A 2Q39A 1GT3A 5F6ZA 1LIEA 4ORYA 3ZW0B 4NYRA 3NQ9A 5B27A 4EFGA 4M6SA 1ZNGA 2KD2A 3FIQA 4IAWA 2FS7A 3IA8A 3TGAA 3HK1A 4FBVA 5LJEA 1QY2A 2Z4HA 3EBKA 4IB7A 2F73A 1BM5A 3RZYA 2QO6A 4CK4A 3DSZA 4KT5A 2IFBA 4JGLA 5H9KA 4KC8A 2GTLM 3LV4A 5D4AA 5D45A 5BVQA 1P6PA 2CBSA 2RD7C 1OEEA 4ML7B 1D3SA 5LJBA 2E4JA 1EQDA 4ES7A 4YKMA 4PJ2A 4M7MA 1B8EA 2FR3A 3CWKA 3ELZA 1BJ7A 3ZZVA 1BRPA 1IFBA 1Y9TA 1YIVA 5H9NA 2AH7X 4YGHA 2AT8X 3D95A 3P6FA 4AZRA 2LFOA 4YDBA 5DG4A 1DZJA 1PBOA 2FT9A 1E5PA 1OEKA 4ORXA 5L8IA 1ZNDA 4U8UM 4QZTA 2LB6A 1KZXA 4IBAA 5KICA 4AZPA 4I3CA 3FR5A 5CYBA 3B2JA 2XKLA 1S2PA 1BWYA 4I95A 2QM9A 3ELXA 4XMHA 3O2YA 2K23A 2WSJA 2CM4A 2GTLO 4A60A 2RA6A 2OVAA 3F6ZB 3EM0A 1ACDA 5LKEA 3O19A 1AELA 4CV7A 2RN4A 1KT4A 3S60A 3VE2A 4EXZA 1HMRA 1YWDA 4AZQA 1XKIA 1OPAA 5KHPA 3VG7A 1OBUA 1GX9A 2YMSA 4D6AA 1BEBA 1DZMA 2CZUA 5EEEA 5BVTA 3CQNA 3KFGA 4U3QA 2A2UA 1OBQA 2FR2A 3PH5A 4ZFXA 4TNNA 1VPRA 1I4UA 5HA0A 5IO7A 4ZJ0A 3APXA 3B2LA 1LIBA 3CR6A 2PY1A 1HN2A 4WFVA 3CBSA 2W2FA 3CMPA 4FQBB 4I6SA 4ALBA 3H3IA 3MVFA 1EALA 3NX1A 1DV9A 3WOVA 2MWHA 1DF3A 1T8VA 2AL0X 3HOLA 3PH6A 2L67A 2A2GA 1VYFA 1A18A 1AQBA 4ORWA 5H8TA 5D8JA 3P6HA 3QKGA 5HBSA 4K19A 3L4RA 4GU8A 3GE2A 4WHIA 5EDBA 2GTLN 2NNEA 3ZWEA 1GGLA 1U17A 1KXOA 3NBXX 4GNYA 4ZGUA 3C76X 1QQSA 2AT3X 5EDCA 5AQ6A 1PM1X 2FLJA 2A13A 5AJBA 4ORUA 1ZNKA 1MUPA 4GETA 4NYQA 5HCCC 2QO5A 5HCEC 5LJDA 5LJHA 3EMMA 1YP7A 3HWFA 1FDQA 4YCHA 3FEKA 4EDEA 1HQPA 4TKHA 1S44A 5IO5A 4QGVA 1NGLA 5EPQA 1SY3A 3PQSA 3D96A 3FW4A 2A0AA 3JQOA 1SY2A 3VG6A 4U8UN 3WJFA 3GAQA 4YFPA 2Q2MA 4ID2A 2OFRX 3KZAA 5LKFA 4LQZA 4GRJA 1MDCA 1SA8A 5FAZA 1HBPA 2GC9A 3TF6A 4IB6A 1BSYA 3KFHA 4GDZA 1DZKA 4N7DA 4OS0A 5EZ2A 1KT3A 3FA6A 5HZ5A 1AB0A 3FA9A 1FEMA 1L6MA 4Y0RA 3JS1A 2CBRA 4ZHCA 3CQRA 1U0XA 1S7DA 3ZW0A 4O3YA 5LJKA 1OPBA 2LA7A 3RWXA 4INNA 3WJCA 2KW1A 2KTDA 2WEXA 4AZNA 1OBPA 2Q2PA 2JW1A 1SXUA 5L8OA 3PEDA 1YWAA 2FWVA 2G79A 3LHNA 4GKCA 2ZAIA 2HLVA 4LZUA 4QQ1A 5FQ7E 1JZUA 4XMCA 3WJEA 3APVA 1CJ5A 4ZH6A 2QOSC 3C77X 1IW2A 1GT5A 2X8SA 3EBWA 3FELA 3KFIA 3RBYA 1B4MA 3STMX 2OVEA 1ZNHA 1O1VA 1LIDA 3D97A 3HTYA 4A1HA 1HMSA 3CBCA 1EW3A 1GXAA 2O62A 2EU7X 3WVMA 1IIUA 3UEVA 2AT0X 1ICMA 3NR3A 3E3CA 3VG5A 4YFRA 3FLLA 4ZHFA 1EIOA 1CBQA 1EUOA 2XSTA 3FR2A 3FA7A 2R56A 5F1EA 1ERBA 4YCEA 4OMWA 2FS6A 1SXYA 2OZQA 3D4RA 2GJ5A 4MIRA 3S5VA 2Z4IA 1QWDA 4D6BA 4QYPA 4ALOA 3DTQA 2QO4A 4ODDA 4IAXA 4AZOA 3ZI8A 4XMGA 5HA1A 2BS6A 2KT4B 1YUPA 4BOEA 2JN3A 3UEUA 1KQWA 1VYGA 4ORSA 2L5PA 4ZHDA 2JMBA 1LPJA 4L1NA 4ZHHA 1O1UA 1MX8A 1PEEA 1KZWA 2MM3A 2P8GA 3BDRA 4YBPA 1RBPA 2JU8A 1G7NA 1ALBA 3I0AA 1DFVA 1JIWI 1MX7A 4YBUA 2X8FA 1NP1A 1SXXA 4ZHGA 4IMOA 1SXWA 3TZSA 1DZPA 3OJYC 5HZ9A 3OD9A 4QAEA 4KCAA 3NADA 2AT6X 2AMMX 4IB9A 1E00A 3FEPA 4HFOA 4WBKA 1G85A 4O3ZA 4O3XB 4QGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QFV A;  4NLI A;  4TQ2 A;  2G78 A;  3B2H A;  4HPC A;  1ZNL A;  1U18 A;  1LNM A;  1GT1 A;  2HNX A;  5H9A A;  1ERX A;  4DQ3 A;  1KQX A;  1FTP A;  4AW8 A;  4HPB A;  4A8Z A;  1Z24 A;  3I17 A;  4YH0 A;  3WBG A;  5EED A;  1X71 A;  3ZUO A;  4R0B A;  1BSO A;  1LIF A;  1BBP A;  1XCA A;  1BSQ A;  2HMB A;  4ZH9 A;  1UZ2 X;  1X8P A;  4YDA A;  4ZR2 A;  3NPO A;  3WXQ A;  3BLG A;  3UEW A;  1HBQ A;  5H9L A;  4TLJ A;  3UEX A;  4NNS A;  4IB8 A;  1X8Q A;  4HPD A;  1B56 A;  3BU1 A;  4QZU A;  5IO6 A;  4WFU A;  2MJI A;  3HWE A;  3JSQ A;  3FMZ A;  4HPA A;  4RUU A;  3HWG A;  2LKK A;  2R73 A;  3F8A A;  3IFB A;  3F9D A;  2RCT A;  1EXS A;  2FRS A;  5HTE A;  1RLB E;  2K62 A;  4Y0S A;  1G5W A;  1A3Y A;  2DM5 A;  4GH7 A;  3VG2 A;  3HWD A;  4XME A;  1E06 A;  1CRB A;  1YP6 A;  3BY0 A;  4XMD A;  1JJX A;  4UU2 A;  4LKP A;  2Q4N A;  4GNW A;  4GE1 A;  2G7B A;  1R0U A;  2L68 A;  5HAE A;  2GTF X;  1LF7 A;  1FE3 A;  3BU9 A;  4RUN A;  3C78 X;  3S26 A;  3P6D A;  3G7X A;  4EEJ A;  3B2I A;  5HZQ A;  1GKA B;  1EPB A;  3O22 A;  4DQ4 A;  5LJG A;  1BLR A;  4AZM A;  3FEN A;  2ANS A;  1QAB E;  2NND A;  3BRN A;  4XMF A;  2JOZ A;  1X8O A;  4ZCB A;  3STN A;  1KOI A;  4I3D A;  1G74 A;  3VG3 A;  3KQ0 A;  2ASN X;  5HZ6 A;  2POA A;  4NNT A;  1DC9 A;  5F7G A;  1HMT A;  1IFC A;  1JV4 A;  2OVD A;  3NX2 A;  1I06 A;  3NQ3 A;  1YWC A;  4AYH A;  2FTB A;  3NP1 A;  1T68 X;  1TVQ A;  2ACP X;  3TGB A;  3SAO A;  1YWB A;  3AKM A;  4MVL A;  4TKJ A;  3PPT A;  2HZR A;  5FEN A;  1QY1 A;  1TOU A;  4QYN A;  3WJD A;  2AKQ A;  4OMX A;  2X45 A;  2CZT A;  3FA8 A;  1SY0 A;  3BS2 A;  2N93 A;  1H91 A;  2OFM X;  3BX8 A;  5LJC A;  5KID A;  4TJZ A;  2A3F X;  2RQ0 A;  2CM9 A;  1JJJ A;  3WJB A;  5C0N A;  2W2A A;  2WR6 A;  4YFQ A;  1CBI A;  2RCQ A;  2WUT A;  2HZQ A;  5F58 A;  3U03 A;  1ZRY A;  4I9R A;  3K3L A;  4OS3 A;  3AKN A;  4NP1 A;  1IKJ A;  1EPA A;  1QFT A;  4O9S A;  2AT5 X;  4UU3 A;  5HCD C;  5BVS A;  4Y0P A;  1FEN A;  1OEJ A;  1KT5 A;  1X8N A;  1KT6 A;  2ACO A;  5L8N A;  4NLJ A;  3P6G A;  4OS8 A;  1JYD A;  1MVG A;  2JU7 A;  1AVG I;  2MO5 A;  5CE4 A;  1I04 A;  3U9P C;  1CBR A;  1EII A;  1I05 A;  2NP1 A;  3PEC A;  4BVM A;  3P6C A;  2Q9S A;  4ORR A;  4YGZ A;  1B0O A;  1SY1 A;  2WWP A;  1D2U A;  4N7C A;  5F6B A;  1O8V A;  2YG2 A;  4MVI A;  3B2K A;  3BSZ E;  1ADL A;  4MVK A;  1ML7 A;  4KII A;  1LIC A;  2W2B A;  3FW5 A;  5JR8 A;  3ZUI A;  1JBH A;  1CBS A;  1GX8 A;  5HZ8 A;  5D48 A;  3KFF A;  4I9S A;  1FEL A;  2LBA A;  2L9C A;  1KT7 A;  3APU A;  5HWZ A;  2X46 A;  4PSQ A;  5FFH A;  2WQA E;  1E02 A;  1GM6 A;  2R74 A;  1BRQ A;  3STK A;  2BLG A;  2HYS A;  1PMP A;  3MBT A;  2JU3 A;  1QG5 A;  4A1Y A;  4YKO A;  1TOW A;  1QY0 A;  2LBV A;  4Y0Q A;  3WJG A;  5DPQ A;  4YGG A;  3BX7 A;  3VG4 A;  3P6E A;  4QGX A;  5K06 A;  4TKB A;  3TGC A;  1GT4 A;  4LKT A;  1URE A;  3PP6 A;  1IKE A;  2WQ9 A;  1NP4 A;  4YMY A;  3EYC A;  1T0V A;  2ALL X;  1N0S A;  3APW A;  1X89 A;  3Q6L A;  1A2D A;  5HTD A;  1KGL A;  1X8U A;  3RSW A;  3FR4 A;  5B29 A;  4I3B A;  1TW4 A;  1ICN A;  2NNQ A;  1GKA A;  1JYJ A;  4LZV A;  3T1D A;  1LKE A;  1A57 A;  2WEW A;  1LFO A;  4IMN A;  5D47 A;  3U0D A;  1ZNE A;  3ZQ3 A;  4BQU A;  1TXL A;  4ARH A;  2Q39 A;  1GT3 A;  5F6Z A;  1LIE A;  4ORY A;  4NYR A;  3NQ9 A;  5B27 A;  4EFG A;  4M6S A;  1ZNG A;  3FIQ A;  4IAW A;  2FS7 A;  3IA8 A;  3TGA A;  3HK1 A;  5LJE A;  1QY2 A;  3EBK A;  4IB7 A;  2F73 A;  1BM5 A;  2QO6 A;  4CK4 A;  3DSZ A;  2IFB A;  5H9K A;  5D4A A;  5D45 A;  5BVQ A;  1P6P A;  2CBS A;  2RD7 C;  1OEE A;  1D3S A;  5LJB A;  2E4J A;  1EQD A;  4ES7 A;  4YKM A;  4M7M A;  1B8E A;  2FR3 A;  3CWK A;  3ELZ A;  1BJ7 A;  1BRP A;  1IFB A;  1YIV A;  5H9N A;  2AH7 X;  4YGH A;  2AT8 X;  3D95 A;  3P6F A;  4AZR A;  2LFO A;  4YDB A;  5DG4 A;  1DZJ A;  1PBO A;  2FT9 A;  1E5P A;  1OEK A;  4ORX A;  5L8I A;  1ZND A;  4QZT A;  2LB6 A;  4IBA A;  5KIC A;  4AZP A;  4I3C A;  3FR5 A;  3B2J A;  2XKL A;  1S2P A;  1BWY A;  4XMH A;  2QM9 A;  3ELX A;  3O2Y A;  2K23 A;  2WSJ A;  2CM4 A;  4A60 A;  2RA6 A;  2OVA A;  3EM0 A;  1ACD A;  5LKE A;  3O19 A;  1AEL A;  1KT4 A;  4EXZ A;  1HMR A;  1YWD A;  4AZQ A;  1XKI A;  1OPA A;  5KHP A;  3VG7 A;  1OBU A;  1GX9 A;  4D6A A;  1BEB A;  1DZM A;  2CZU A;  5EEE A;  5BVT A;  3CQN A;  3KFG A;  2A2U A;  1OBQ A;  2FR2 A;  3PH5 A;  4TNN A;  1VPR A;  1I4U A;  5HA0 A;  5IO7 A;  4ZJ0 A;  3APX A;  3B2L A;  1LIB A;  3CR6 A;  2PY1 A;  1HN2 A;  4WFV A;  3CBS A;  2W2F A;  3CMP A;  4ALB A;  3MVF A;  1EAL A;  3NX1 A;  1DV9 A;  1DF3 A;  1T8V A;  2AL0 X;  3PH6 A;  2L67 A;  2A2G A;  1VYF A;  1A18 A;  1AQB A;  4ORW A;  5H8T A;  5D8J A;  3P6H A;  3QKG A;  5HBS A;  4K19 A;  3L4R A;  5EDB A;  1KZX A;  2NNE A;  1GGL A;  1U17 A;  1KXO A;  4GNY A;  4ZGU A;  3C76 X;  1QQS A;  2AT3 X;  5EDC A;  5AQ6 A;  1PM1 X;  2FLJ A;  2A13 A;  4ORU A;  1ZNK A;  1MUP A;  4GET A;  4NYQ A;  5HCC C;  2QO5 A;  5HCE C;  5LJD A;  5LJH A;  3EMM A;  1YP7 A;  3HWF A;  1FDQ A;  4YCH A;  3FEK A;  4EDE A;  1HQP A;  4TKH A;  1S44 A;  5IO5 A;  4QGV A;  1NGL A;  5EPQ A;  1SY3 A;  3D96 A;  3FW4 A;  2A0A A;  1SY2 A;  3VG6 A;  3WJF A;  3GAQ A;  4YFP A;  2Q2M A;  2OFR X;  3KZA A;  5LKF A;  4GRJ A;  1MDC A;  1SA8 A;  5FAZ A;  1HBP A;  2GC9 A;  3TF6 A;  4IB6 A;  1BSY A;  3KFH A;  4N7D A;  1DZK A;  4OS0 A;  5EZ2 A;  3RZY A;  1KT3 A;  3FA6 A;  5HZ5 A;  1AB0 A;  3FA9 A;  1FEM A;  1L6M A;  4Y0R A;  3JS1 A;  2CBR A;  4ZHC A;  3CQR A;  1U0X A;  1S7D A;  5LJK A;  1OPB A;  3WJC A;  2KTD A;  2WEX A;  4AZN A;  1OBP A;  2Q2P A;  1SXU A;  5L8O A;  3PED A;  1YWA A;  2FWV A;  2G79 A;  4GKC A;  4LZU A;  4ZFX A;  2HLV A;  1JZU A;  4XMC A;  3WJE A;  3APV A;  1CJ5 A;  4ZH6 A;  2QOS C;  3C77 X;  1IW2 A;  1GT5 A;  3EBW A;  3FEL A;  3KFI A;  1B4M A;  3STM X;  2OVE A;  1ZNH A;  1O1V A;  1LID A;  3D97 A;  4A1H A;  1HMS A;  3CBC A;  1EW3 A;  1GXA A;  2O62 A;  2EU7 X;  3WVM A;  1IIU A;  3UEV A;  2AT0 X;  1ICM A;  3NR3 A;  3VG5 A;  4YFR A;  3FLL A;  4ZHF A;  1EIO A;  1CBQ A;  1EUO A;  2XST A;  3FR2 A;  3FA7 A;  2R56 A;  5F1E A;  1ERB A;  4YCE A;  4OMW A;  2FS6 A;  1SXY A;  2OZQ A;  2GJ5 A;  1QWD A;  4D6B A;  4QYP A;  4ALO A;  3DTQ A;  2QO4 A;  4ODD A;  4IAX A;  4AZO A;  4XMG A;  5HA1 A;  2KT4 B;  1YUP A;  4BOE A;  2JN3 A;  3UEU A;  1KQW A;  1VYG A;  4ORS A;  2L5P A;  4ZHD A;  1LPJ A;  4ZHH A;  1O1U A;  1MX8 A;  1PEE A;  1KZW A;  2MM3 A;  2P8G A;  3BDR A;  4YBP A;  1RBP A;  2JU8 A;  1G7N A;  1ALB A;  3I0A A;  1DFV A;  1MX7 A;  4YBU A;  1NP1 A;  1SXX A;  4ZHG A;  4IMO A;  1SXW A;  3TZS A;  1DZP A;  3OJY C;  5HZ9 A;  4QAE A;  3NAD A;  2AT6 X;  2AMM X;  4IB9 A;  1E00 A;  3FEP A;  4HFO A;  4WBK A;  1G85 A;  4QGW A; 
#chains in the Genus database with same CATH topology
 1QFV A;  4NLI A;  4TQ2 A;  2DJF A;  2G78 A;  3B2H A;  4HPC A;  1ZNL A;  1U18 A;  1LNM A;  1GT1 A;  2HNX A;  4O4O A;  1ERX A;  2QMI A;  5H9A A;  4DQ3 A;  3RKG A;  1KQX A;  2BT9 A;  1FTP A;  4AW8 A;  4BX6 B;  4Z2O A;  1JJU A;  4HPB A;  1Z24 A;  2RTD B;  1SRE A;  3I17 A;  4MIS A;  2FHL A;  1VWL B;  4IAB A;  4YH0 A;  3WBG A;  5EED A;  2X56 A;  1SWS A;  1X71 A;  5FQ8 E;  3ZUO A;  4R0B A;  1BSO A;  1LIF A;  1BBP A;  3VU1 A;  1AVE A;  1XCA A;  3HOE A;  4NW4 A;  2GH7 A;  4GGZ A;  1BSQ A;  2G8C O;  1JQP A;  2HMB A;  4ZH9 A;  1UZ2 X;  1X8P A;  2VFC A;  4YDA A;  3ZW1 B;  4ZR2 A;  3NPO A;  2G5L A;  3WXQ A;  1HQQ A;  3BLG A;  4GGT A;  3UEW A;  5BYP A;  1HBQ A;  1Y53 X;  3RY2 A;  5H9L A;  4ZGF A;  4TLJ A;  3UEX A;  4NNS A;  4IB8 A;  1I9H A;  1X8Q A;  2RTF B;  4HPD A;  1B56 A;  3BU1 A;  4QZU A;  5IO6 A;  4WFU A;  1N4J A;  2MJI A;  3HWE A;  3JSQ A;  3V8U A;  2X8T A;  3PQU A;  3FMZ A;  4HPA A;  2OL8 O;  4RUU A;  3HWG A;  1KL4 A;  2LKK A;  2R73 A;  3F8A A;  3IFB A;  3F9D A;  2RCT A;  1EXS A;  2BHV A;  2FRS A;  5HTE A;  1I78 A;  1RLB E;  2K62 A;  2VFB A;  4Y0S A;  4CDE A;  5FQ6 E;  2KTS A;  4CSB A;  1N9M A;  1G5W A;  1A3Y A;  2DM5 A;  4GH7 A;  3VG2 A;  1SWK A;  3HWD A;  4XME A;  1LDO A;  1E06 A;  1CRB A;  1W4T A;  3KVN A;  1YP6 A;  3BY0 A;  4GUZ A;  2RTC B;  4XMD A;  1JJX A;  4UU2 A;  4ON1 A;  4LKP A;  3FDC A;  1SRH A;  2Q4N A;  2OFB A;  3MG5 A;  4GE1 A;  4GNW A;  2G7B A;  1R0U A;  2L68 A;  1UYN X;  5HAE A;  2GTF X;  1LF7 A;  1FE3 A;  3BU9 A;  4RUN A;  1RXK A;  3C78 X;  3RDO A;  3S26 A;  3P6D A;  3G7X A;  4EEJ A;  3B2I A;  5HZQ A;  1GKA B;  5AEO A;  1EPB A;  3O22 A;  4DQ4 A;  4EKV A;  3Q34 A;  2CAM A;  5LJG A;  4GJS A;  1BLR A;  3ZW2 A;  4AZM A;  3FEN A;  1VWH B;  2ANS A;  1QAB E;  1JMZ A;  2NND A;  3BRN A;  4WHI A;  4XMF A;  2JOZ A;  1X8O A;  4MVE A;  4ZCB A;  2QOM A;  1KOI A;  3STN A;  4I3D A;  3OBL A;  1G74 A;  3VG3 A;  1LDQ A;  3KQ0 A;  2X34 A;  2ASN X;  5HZ6 A;  1W6F A;  2POA A;  4KH8 A;  1DC9 A;  4NNT A;  3VPJ E;  3WYQ A;  3VGW A;  5F7G A;  1HMT A;  1RSU B;  1IFC A;  1JV4 A;  2OVD A;  3NX2 A;  1E2T A;  1I06 A;  3NQ3 A;  1YWC A;  4AYH A;  1AVD A;  2FTB A;  2OVS A;  1UYO X;  3NP1 A;  1T68 X;  3EW1 A;  1SWG A;  1TVQ A;  1WBI A;  2ACP X;  2IZE B;  3P02 A;  5AJC A;  4BX5 B;  3SAO A;  1YWB A;  3AKM A;  4MVL A;  4TKJ A;  1VWD B;  3PPT A;  2HZR A;  5FEN A;  2BC3 A;  1QY1 A;  1TOU A;  4QYN A;  1STS B;  2MHD A;  2AKQ A;  3WJD A;  4OMX A;  1VWP B;  2CZT A;  2X45 A;  3FA8 A;  3WZP A;  4JNJ A;  1SY0 A;  3BS2 A;  2N93 A;  1H91 A;  1SWO A;  2OFM X;  5B5F A;  3BX8 A;  1NC9 A;  4BGF A;  5LJC A;  5KID A;  2VDF A;  3T2W A;  4TJZ A;  2ZSC A;  2A3F X;  1Y9L A;  2RQ0 A;  2CM9 A;  1JJJ A;  3WJB A;  4CDD A;  1SWB A;  5C0N A;  2W2A A;  2WR6 A;  4YFQ A;  1CBI A;  2RCQ A;  2WUT A;  1N9Y A;  2HZQ A;  4QNI A;  5F58 A;  4BJ8 A;  3SLO A;  3U03 A;  5IRU A;  1ZRY A;  4I9R A;  3S5X A;  4CPE A;  4L3R A;  3K3L A;  4OS3 A;  3AKN A;  1IJ8 A;  4NP1 A;  1IKJ A;  1EPA A;  2FHN X;  4KC7 A;  1QFT A;  1RXH A;  2X32 A;  2AT5 X;  4O9S A;  4OEL A;  4UU3 A;  5HCD C;  5BVS A;  4Y0P A;  1FEN A;  1OEJ A;  1KT5 A;  1X8N A;  4O49 A;  1KT6 A;  2ACO A;  2IZI A;  4FBR A;  5L8N A;  4FGI B;  5CHK A;  4NLJ A;  3AEH A;  3P6G A;  4DNE A;  2RTB B;  4OS8 A;  1JYD A;  1MVG A;  2JU7 A;  4COT A;  3MM0 A;  1AVG I;  2M4L A;  2MO5 A;  5CE4 A;  1I04 A;  3U9P C;  4Z6J A;  1CBR A;  1NDJ A;  4GZV A;  1EII A;  5B10 O;  1I05 A;  4GK9 A;  2NP1 A;  3PEC A;  2X4M A;  2OFA A;  4BVM A;  1VWQ B;  5CSE A;  3P6C A;  2Q9S A;  1VWR B;  4ORR A;  4YGZ A;  3FYF A;  1B0O A;  1SY1 A;  2WWP A;  1D2U A;  1GX3 A;  3CKF A;  4N7C A;  5F6B A;  1O8V A;  1VWG B;  2YG2 A;  2BS5 A;  4MVI A;  4BX6 A;  3B2K A;  1SWD A;  2ZAG A;  3BSZ E;  2IZC B;  1ADL A;  4MVK A;  1ML7 A;  4KII A;  1LIC A;  2W2B A;  3VHM A;  3FW5 A;  5JR8 A;  3ZUI A;  1VWK B;  4U8U O;  1CBS A;  1JBH A;  1GX8 A;  1SWA A;  5HZ8 A;  5D48 A;  1Y52 X;  3RDQ A;  3KFF A;  1VWM B;  1HY2 A;  4I9S A;  3ZW1 A;  1FEL A;  3VE1 A;  2LBA A;  3N91 A;  2L9C A;  3WZO A;  1SLF B;  1DF8 A;  1KT7 A;  3APU A;  5HWZ A;  2X46 A;  4PSQ A;  4O4U A;  5FFH A;  2MF6 A;  2WQA E;  4FBO A;  4O4X A;  1E02 A;  1GM6 A;  1N7Y A;  2R74 A;  1BRQ A;  1SMP I;  2IZA A;  3STK A;  2FGS A;  2BLG A;  2HYS A;  3X00 A;  1PMP A;  3MBT A;  2JU3 A;  1QG5 A;  4Z2V A;  3MX7 A;  4A1Y A;  2RTQ B;  2I5V O;  1STP A;  1RST B;  4QRL A;  4YKO A;  1EI5 A;  1STR B;  1QY0 A;  1TOW A;  2A5C A;  3PK2 A;  4Y0Q A;  5DPQ A;  4YGG A;  2LBV A;  3UAQ A;  3WJG A;  4CPH B;  1SWU A;  4EQA C;  4YVB A;  3BX7 A;  3VG4 A;  2IZL B;  1RAV A;  3P6E A;  1SLD B;  3AUM O;  4QGX A;  4TKB A;  5K06 A;  3TGC A;  1GT4 A;  4LKT A;  1URE A;  3PP6 A;  1IKE A;  2WQ9 A;  1KFF A;  1VYO A;  1NP4 A;  4YMY A;  3EYC A;  1T0V A;  4O3W A;  4U9C A;  5EDB A;  2OY5 O;  2ALL X;  1N0S A;  3APW A;  1X89 A;  3CKG A;  5JD2 A;  2OL6 O;  1JMX A;  2C1Q A;  3Q6L A;  3T6F A;  1A2D A;  3NQK A;  3OE3 A;  3P24 A;  5HTD A;  1KGL A;  1SWP A;  1X8U A;  2X55 A;  3SOT A;  3RSW A;  4CPH A;  3FR4 A;  5B29 A;  1LUQ A;  2Y32 A;  4I3B A;  1TW4 A;  1ICN A;  2NNQ A;  5F2B A;  3RE5 A;  3PDF A;  1GKA A;  1JYJ A;  4LZV A;  3T1D A;  2RTR B;  1LKE A;  1VWO B;  1A57 A;  1NQN A;  2WEW A;  4O4S A;  1LFO A;  1SRI A;  4IMN A;  2RTP B;  5D47 A;  4CPF A;  3T6L A;  3U0D A;  1ZNE A;  3ZQ3 A;  4HWM A;  4BX7 B;  4BQU A;  2AF5 A;  1TXL A;  4ARH A;  2F09 A;  5K67 A;  2Q39 A;  1GT3 A;  1VWA B;  5F6Z A;  1LIE A;  1SWL A;  4ORY A;  3ZW0 B;  1SWT A;  4NYR A;  3NQ9 A;  5B27 A;  1PBY A;  4EFG A;  1LEL A;  2RTG B;  4M6S A;  4MEE A;  1ZNG A;  2RTI B;  2KD2 A;  3FIQ A;  2Y3E A;  5B2A O;  3RDS A;  4IAW A;  2FS7 A;  3IA8 A;  4Y5D A;  3TGA A;  3HK1 A;  4FBV A;  5LJE A;  1QY2 A;  2Z4H A;  3EBK A;  4BX5 A;  1K3B A;  4IB7 A;  2F73 A;  1BM5 A;  3RZY A;  2QO6 A;  3RDM A;  3DSZ A;  4KT5 A;  3WZQ A;  2IFB A;  2IZB A;  4JGL A;  4CK4 A;  5H9K A;  4KC8 A;  2GTL M;  3LV4 A;  5D4A A;  5D45 A;  5BVQ A;  1P6P A;  1KL3 A;  2CBS A;  2RD7 C;  1OEE A;  4U46 A;  4ML7 B;  1D3S A;  3QQ2 A;  3SLT A;  5LJB A;  2E4J A;  1EQD A;  4ES7 A;  4YKM A;  4PJ2 A;  2UYW A;  4M7M A;  1B8E A;  2FR3 A;  3CWK A;  2JGS A;  3ELZ A;  1BJ7 A;  1VWC B;  3ZZV A;  1VWB B;  4Y59 A;  1BRP A;  1IFB A;  1Y9T A;  1YIV A;  2RTO B;  2OL7 A;  1VWI B;  2FKG A;  5H9N A;  2AH7 X;  4YGH A;  2RTN B;  2AT8 X;  3D95 A;  3P6F A;  3VHI A;  2LFO A;  4YDB A;  2OY7 A;  2QCB A;  5DG4 A;  3VHH A;  4AZR A;  1DZJ A;  1MM9 A;  1PBO A;  3WYP A;  2FT9 A;  1E5P A;  1OEK A;  4ORX A;  5L8I A;  1ZND A;  1PTS A;  4U8U M;  4QZT A;  4NV8 A;  2LB6 A;  4NV7 A;  1KZX A;  1OSP O;  4IBA A;  2UZ2 A;  5KIC A;  1Y0G A;  4Z2P A;  4AZP A;  3HPE A;  3FR5 A;  4I3C A;  5CYB A;  3B2J A;  2RTJ A;  2XKL A;  1S2P A;  4BBO A;  4I95 A;  2QM9 A;  3ELX A;  4XMH A;  1BWY A;  3SZJ A;  3O2Y A;  1N43 A;  4OKA A;  2K23 A;  2WSJ A;  2A8G A;  2CM4 A;  2GTL O;  4A60 A;  2RA6 A;  2OVA A;  3F6Z B;  1SWF A;  3EM0 A;  1ACD A;  5LKE A;  3O19 A;  1MEP A;  1AEL A;  4CV7 A;  2RN4 A;  1KT4 A;  3S60 A;  4JO6 A;  3VE2 A;  4EXZ A;  1HMR A;  1NQM A;  1YWD A;  4AZQ A;  1XKI A;  1OPA A;  5KHP A;  3VG7 A;  1OBU A;  2C1S A;  1GX9 A;  2YMS A;  4D6A A;  1BEB A;  4DCB A;  1DZM A;  2CZU A;  2RTE B;  5EEE A;  5BVT A;  3CQN A;  3KFG A;  4U3Q A;  2A2U A;  3LTW A;  1OBQ A;  1SWC A;  2FR2 A;  1K24 A;  3PH5 A;  4TNN A;  4ZFX A;  1VPR A;  1I4U A;  5HA0 A;  1W5R A;  5IO7 A;  2AVI A;  4OEM A;  4ZJ0 A;  3APX A;  3B2L A;  1LIB A;  3CR6 A;  5B5G A;  2OF8 A;  1HN2 A;  2PY1 A;  4WFV A;  3CBS A;  2W2F A;  3CMP A;  2C4I A;  4FQB B;  4I6S A;  3H3I A;  3MVF A;  5IRA A;  4ALB A;  4Z27 A;  3NX1 A;  1B4M A;  4GDA A;  1DV9 A;  3WOV A;  1EAL A;  2MWH A;  1DF3 A;  1T8V A;  2AL0 X;  3HOL A;  1SRF A;  3PH6 A;  1VWN B;  2L67 A;  1SWJ A;  2A2G A;  1VYF A;  1A18 A;  1AQB A;  2F01 A;  1LCZ A;  4ORW A;  1LCV A;  5D8J A;  5H8T A;  3P6H A;  3QKG A;  5HBS A;  1SWE A;  3L4R A;  4GU8 A;  3GE2 A;  4K19 A;  1HXL A;  2GTL N;  1FJ1 E;  2NNE A;  1GGL A;  1U17 A;  1KXO A;  3NBX X;  4GNY A;  5K68 A;  2RTL A;  1QQS A;  2AT3 X;  3C76 X;  5EDC A;  5AQ6 A;  1PM1 X;  2FLJ A;  4ZGU A;  2A13 A;  4GGR A;  5AJB A;  4ORU A;  3RE6 A;  1SRG A;  1ZNK A;  3SZI A;  1MUP A;  4GET A;  4NYQ A;  5HCC C;  2QO5 A;  5HCE C;  3WZN A;  5LJD A;  5LJH A;  3EMM A;  1YP7 A;  3HWF A;  1FDQ A;  4YCH A;  1Y55 X;  3FEK A;  4GJV A;  3ZWE A;  4EDE A;  1HQP A;  4TKH A;  1S44 A;  5IO5 A;  2RTH B;  4QGV A;  1NGL A;  5EPQ A;  4I60 A;  1SY3 A;  3PQS A;  3D96 A;  3FW4 A;  4CDC A;  1MK5 A;  2A0A A;  2IZH B;  3JQO A;  4C5P A;  1SY2 A;  1VWJ B;  3VG6 A;  5IXG A;  4U8U N;  3WJF A;  2FKJ A;  3GAQ A;  4YFP A;  2Q2M A;  4ID2 A;  2OFR X;  4CDF A;  3KZA A;  5LKF A;  4LQZ A;  4GRJ A;  1MDC A;  1SA8 A;  5FAZ A;  1HBP A;  4JHQ A;  2GC9 A;  3TF6 A;  4IB6 A;  1BSY A;  3KFH A;  4GDZ A;  1DZK A;  4N7D A;  4OS0 A;  5EZ2 A;  1KT3 A;  3FA6 A;  4A8Z A;  5HZ5 A;  1AB0 A;  1MOY A;  1SLG B;  4BX7 A;  3FA9 A;  2IZD B;  1FEM A;  1L6M A;  1SRJ A;  2DJG A;  3EW2 A;  3JS1 A;  1KL5 A;  2CBR A;  4Y0R A;  4ZHC A;  2HKD A;  3CQR A;  1U0X A;  1S7D A;  3ZW0 A;  4O3Y A;  5LJK A;  2IZK A;  1OPB A;  1SWH A;  2LA7 A;  3RWX A;  2RTK A;  4CPI A;  4INN A;  3WJC A;  4Z28 A;  2KW1 A;  3RDU A;  2KTD A;  2WEX A;  4AZN A;  1OBP A;  2Q2P A;  2IZF B;  1SWN A;  2IZJ A;  1SXU A;  1VWE B;  2JW1 A;  5B3M O;  5L8O A;  3PED A;  1YWA A;  2FWV A;  2G79 A;  3LHN A;  4GKC A;  2Y3F A;  2HLV A;  2ZAI A;  4LZU A;  4QQ1 A;  5FQ7 E;  1JZU A;  4XMC A;  3SLJ A;  3WJE A;  3APV A;  1CJ5 A;  4ZH6 A;  2QOS C;  3C77 X;  1IW2 A;  1GT5 A;  1VWF B;  2X8S A;  3EBW A;  3FEL A;  3KFI A;  3RBY A;  5L3Y A;  1RXJ A;  2OY8 A;  2OVE A;  1ZNH A;  1O1V A;  1LID A;  3D97 A;  2BSZ A;  3HTY A;  3STM X;  4A1H A;  1HMS A;  2OYB O;  3CBC A;  5IRW A;  1EW3 A;  1GXA A;  2O62 A;  2EU7 X;  3WVM A;  1IIU A;  3UEV A;  2AT0 X;  1ICM A;  3NR3 A;  1WUB A;  3EC5 A;  2OF9 A;  3E3C A;  3VG5 A;  1NBX A;  3FLL A;  4YFR A;  4ZHF A;  1CBQ A;  1EUO A;  2XST A;  3FR2 A;  1EIO A;  3FA7 A;  2R56 A;  5F1E A;  1ERB A;  4YCE A;  4OMW A;  2FS6 A;  5B11 O;  1SXY A;  2OZQ A;  3D4R A;  3RY1 A;  2GJ5 A;  4MIR A;  3S5V A;  2Z4I A;  1LCW A;  1QWD A;  4D6B A;  1HXZ A;  2RTA A;  4QYP A;  4ALO A;  2RTM A;  3DTQ A;  3T2X A;  2QO4 A;  4ODD A;  4IAX A;  2OY1 O;  4AZO A;  3ZI8 A;  3FID A;  4XMG A;  5HA1 A;  2BS6 A;  2KT4 B;  1YUP A;  4BOE A;  2JN3 A;  3UEU A;  1KQW A;  1VYG A;  4ORS A;  2L5P A;  4ZHD A;  2JMB A;  1LPJ A;  4L1N A;  4ZHH A;  1O1U A;  1MX8 A;  4IRW A;  1PEE A;  2I5Z O;  2MM3 A;  2P8G A;  3BDR A;  4YBP A;  1KZW A;  1RBP A;  2JU8 A;  1G7N A;  4GD9 A;  2A5B A;  1ALB A;  3I0A A;  4BCS A;  1DFV A;  1JIW I;  3D9W A;  1MX7 A;  4YBU A;  2X8F A;  1NP1 A;  1SXX A;  4ZHG A;  4IMO A;  1SXW A;  3TZS A;  3TGB A;  2WPU A;  4B55 A;  1DZP A;  3OJY C;  5HZ9 A;  3OD9 A;  1SWQ A;  3RDX A;  4QAE A;  4KCA A;  3NAD A;  2AT6 X;  2AMM X;  2PI3 O;  4IB9 A;  1E00 A;  3SZH A;  3FEP A;  4HFO A;  4WBK A;  1SWR A;  2IZG B;  1G85 A;  4O3Z A;  4O3X B;  1SLE B;  4QGW A; 
#chains in the Genus database with same CATH homology
 1QFV A;  4NLI A;  4TQ2 A;  2G78 A;  3B2H A;  4HPC A;  1ZNL A;  1U18 A;  1LNM A;  1GT1 A;  2HNX A;  4O4O A;  1ERX A;  2QMI A;  5H9A A;  4DQ3 A;  3RKG A;  1KQX A;  2BT9 A;  1FTP A;  4AW8 A;  4HPB A;  4A8Z A;  1Z24 A;  3I17 A;  4MIS A;  4YH0 A;  4IAB A;  3WBG A;  5EED A;  1X71 A;  5FQ8 E;  3ZUO A;  4R0B A;  1BSO A;  1LIF A;  1BBP A;  3VU1 A;  3HOE A;  1XCA A;  4NW4 A;  1BSQ A;  2HMB A;  4ZH9 A;  1UZ2 X;  1X8P A;  4YDA A;  3ZW1 B;  4ZR2 A;  3NPO A;  3WXQ A;  3BLG A;  3UEW A;  5BYP A;  1HBQ A;  5H9L A;  4ZGF A;  4TLJ A;  3UEX A;  4NNS A;  4IB8 A;  1X8Q A;  4HPD A;  1B56 A;  3BU1 A;  4QZU A;  5IO6 A;  4WFU A;  2MJI A;  3HWE A;  3JSQ A;  3V8U A;  2X8T A;  3PQU A;  3FMZ A;  4HPA A;  4RUU A;  3HWG A;  2LKK A;  2R73 A;  3F8A A;  3IFB A;  3F9D A;  2RCT A;  1EXS A;  2BHV A;  2FRS A;  5HTE A;  1RLB E;  2K62 A;  4CSB A;  4Y0S A;  5FQ6 E;  2KTS A;  1G5W A;  1A3Y A;  2DM5 A;  4GH7 A;  3VG2 A;  3HWD A;  4XME A;  1E06 A;  1CRB A;  1YP6 A;  3BY0 A;  4XMD A;  1JJX A;  4UU2 A;  4ON1 A;  4LKP A;  2Q4N A;  4GNW A;  4GE1 A;  2G7B A;  1R0U A;  2L68 A;  5HAE A;  2GTF X;  1LF7 A;  1FE3 A;  3BU9 A;  4RUN A;  3C78 X;  3S26 A;  3P6D A;  3G7X A;  4EEJ A;  3B2I A;  5HZQ A;  1GKA B;  5AEO A;  1EPB A;  3O22 A;  4DQ4 A;  5LJG A;  1BLR A;  3ZW2 A;  4AZM A;  3FEN A;  2ANS A;  1QAB E;  2NND A;  3BRN A;  4XMF A;  2JOZ A;  1X8O A;  4MVE A;  4ZCB A;  3STN A;  1KOI A;  4I3D A;  3OBL A;  1G74 A;  3VG3 A;  3KQ0 A;  2ASN X;  5HZ6 A;  2POA A;  4NNT A;  4KH8 A;  1DC9 A;  3VPJ E;  5F7G A;  1HMT A;  1IFC A;  1JV4 A;  2OVD A;  3NX2 A;  1I06 A;  3NQ3 A;  1YWC A;  4AYH A;  2FTB A;  2OVS A;  3NP1 A;  1T68 X;  1TVQ A;  2ACP X;  3TGB A;  3P02 A;  5AJC A;  3SAO A;  1YWB A;  3AKM A;  4MVL A;  4TKJ A;  3PPT A;  2HZR A;  5FEN A;  1QY1 A;  1TOU A;  4QYN A;  2MHD A;  2AKQ A;  3WJD A;  4OMX A;  2X45 A;  2CZT A;  3FA8 A;  1SY0 A;  3BS2 A;  2N93 A;  1H91 A;  2OFM X;  3BX8 A;  5LJC A;  5KID A;  4TJZ A;  2A3F X;  1Y9L A;  2RQ0 A;  2CM9 A;  1JJJ A;  3WJB A;  5C0N A;  2W2A A;  2WR6 A;  4YFQ A;  1CBI A;  2RCQ A;  2WUT A;  2HZQ A;  4QNI A;  5F58 A;  3U03 A;  1ZRY A;  4I9R A;  3S5X A;  4L3R A;  3K3L A;  4OS3 A;  3AKN A;  4NP1 A;  1IKJ A;  1EPA A;  4KC7 A;  1QFT A;  4O9S A;  2AT5 X;  4UU3 A;  5HCD C;  5BVS A;  4Y0P A;  1FEN A;  1OEJ A;  1KT5 A;  1X8N A;  4O49 A;  1KT6 A;  2ACO A;  4FBR A;  5L8N A;  4FGI B;  4NLJ A;  3P6G A;  4OS8 A;  1JYD A;  1MVG A;  2JU7 A;  4COT A;  1AVG I;  2M4L A;  2MO5 A;  5CE4 A;  1I04 A;  3U9P C;  1CBR A;  4GZV A;  1EII A;  1I05 A;  4GK9 A;  2NP1 A;  3PEC A;  4BVM A;  3P6C A;  2Q9S A;  4ORR A;  4YGZ A;  3FYF A;  1B0O A;  1SY1 A;  2WWP A;  1D2U A;  4N7C A;  5F6B A;  1O8V A;  2YG2 A;  2BS5 A;  4MVI A;  3B2K A;  2ZAG A;  3BSZ E;  1ADL A;  4MVK A;  1ML7 A;  4KII A;  1LIC A;  2W2B A;  3FW5 A;  5JR8 A;  3ZUI A;  4U8U O;  1CBS A;  1JBH A;  1GX8 A;  5HZ8 A;  5D48 A;  3KFF A;  4I9S A;  3ZW1 A;  1FEL A;  3VE1 A;  2LBA A;  3N91 A;  2L9C A;  1KT7 A;  3APU A;  5HWZ A;  2X46 A;  4PSQ A;  4O4U A;  5FFH A;  2WQA E;  4FBO A;  4O4X A;  1E02 A;  1GM6 A;  2R74 A;  1BRQ A;  1SMP I;  3STK A;  2BLG A;  2HYS A;  1PMP A;  3MBT A;  2JU3 A;  1QG5 A;  3MX7 A;  4A1Y A;  4QRL A;  4YKO A;  1EI5 A;  1TOW A;  1QY0 A;  2LBV A;  3UAQ A;  4Y0Q A;  3WJG A;  5DPQ A;  4YGG A;  4EQA C;  3BX7 A;  3VG4 A;  3P6E A;  4QGX A;  5K06 A;  4TKB A;  3TGC A;  1GT4 A;  4LKT A;  1URE A;  3PP6 A;  1IKE A;  2WQ9 A;  1NP4 A;  4YMY A;  3EYC A;  1T0V A;  4O3W A;  4U9C A;  2ALL X;  1N0S A;  3APW A;  1X89 A;  3Q6L A;  1A2D A;  3NQK A;  3OE3 A;  3P24 A;  5HTD A;  1KGL A;  1X8U A;  3SOT A;  3RSW A;  3FR4 A;  5B29 A;  4I3B A;  1TW4 A;  1ICN A;  2NNQ A;  1GKA A;  1JYJ A;  4LZV A;  3T1D A;  1LKE A;  1A57 A;  4O4S A;  2WEW A;  1LFO A;  4IMN A;  5D47 A;  3U0D A;  1ZNE A;  3ZQ3 A;  4HWM A;  4BQU A;  1TXL A;  4ARH A;  2F09 A;  2Q39 A;  1GT3 A;  5F6Z A;  1LIE A;  4ORY A;  3ZW0 B;  4NYR A;  3NQ9 A;  5B27 A;  4EFG A;  4M6S A;  1ZNG A;  2KD2 A;  3FIQ A;  4IAW A;  2FS7 A;  3IA8 A;  3TGA A;  3HK1 A;  4FBV A;  5LJE A;  1QY2 A;  2Z4H A;  3EBK A;  4IB7 A;  2F73 A;  1BM5 A;  3RZY A;  2QO6 A;  4CK4 A;  3DSZ A;  4KT5 A;  2IFB A;  4JGL A;  5H9K A;  4KC8 A;  2GTL M;  3LV4 A;  5D4A A;  5D45 A;  5BVQ A;  1P6P A;  2CBS A;  2RD7 C;  1OEE A;  4ML7 B;  1D3S A;  5LJB A;  2E4J A;  1EQD A;  4ES7 A;  4YKM A;  4PJ2 A;  4M7M A;  1B8E A;  2FR3 A;  3CWK A;  3ELZ A;  1BJ7 A;  3ZZV A;  1BRP A;  1IFB A;  1Y9T A;  1YIV A;  5H9N A;  2AH7 X;  4YGH A;  2AT8 X;  3D95 A;  3P6F A;  4AZR A;  2LFO A;  4YDB A;  5DG4 A;  1DZJ A;  1PBO A;  2FT9 A;  1E5P A;  1OEK A;  4ORX A;  5L8I A;  1ZND A;  4U8U M;  4QZT A;  2LB6 A;  1KZX A;  4IBA A;  5KIC A;  4AZP A;  4I3C A;  3FR5 A;  5CYB A;  3B2J A;  2XKL A;  1S2P A;  1BWY A;  4I95 A;  2QM9 A;  3ELX A;  4XMH A;  3O2Y A;  2K23 A;  2WSJ A;  2CM4 A;  2GTL O;  4A60 A;  2RA6 A;  2OVA A;  3F6Z B;  3EM0 A;  1ACD A;  5LKE A;  3O19 A;  1AEL A;  4CV7 A;  2RN4 A;  1KT4 A;  3S60 A;  3VE2 A;  4EXZ A;  1HMR A;  1YWD A;  4AZQ A;  1XKI A;  1OPA A;  5KHP A;  3VG7 A;  1OBU A;  1GX9 A;  2YMS A;  4D6A A;  1BEB A;  1DZM A;  2CZU A;  5EEE A;  5BVT A;  3CQN A;  3KFG A;  4U3Q A;  2A2U A;  1OBQ A;  2FR2 A;  3PH5 A;  4ZFX A;  4TNN A;  1VPR A;  1I4U A;  5HA0 A;  5IO7 A;  4ZJ0 A;  3APX A;  3B2L A;  1LIB A;  3CR6 A;  2PY1 A;  1HN2 A;  4WFV A;  3CBS A;  2W2F A;  3CMP A;  4FQB B;  4I6S A;  4ALB A;  3H3I A;  3MVF A;  1EAL A;  3NX1 A;  1DV9 A;  3WOV A;  2MWH A;  1DF3 A;  1T8V A;  2AL0 X;  3HOL A;  3PH6 A;  2L67 A;  2A2G A;  1VYF A;  1A18 A;  1AQB A;  4ORW A;  5H8T A;  5D8J A;  3P6H A;  3QKG A;  5HBS A;  4K19 A;  3L4R A;  4GU8 A;  3GE2 A;  4WHI A;  5EDB A;  2GTL N;  2NNE A;  3ZWE A;  1GGL A;  1U17 A;  1KXO A;  3NBX X;  4GNY A;  4ZGU A;  3C76 X;  1QQS A;  2AT3 X;  5EDC A;  5AQ6 A;  1PM1 X;  2FLJ A;  2A13 A;  5AJB A;  4ORU A;  1ZNK A;  1MUP A;  4GET A;  4NYQ A;  5HCC C;  2QO5 A;  5HCE C;  5LJD A;  5LJH A;  3EMM A;  1YP7 A;  3HWF A;  1FDQ A;  4YCH A;  3FEK A;  4EDE A;  1HQP A;  4TKH A;  1S44 A;  5IO5 A;  4QGV A;  1NGL A;  5EPQ A;  1SY3 A;  3PQS A;  3D96 A;  3FW4 A;  2A0A A;  3JQO A;  1SY2 A;  3VG6 A;  4U8U N;  3WJF A;  3GAQ A;  4YFP A;  2Q2M A;  4ID2 A;  2OFR X;  3KZA A;  5LKF A;  4LQZ A;  4GRJ A;  1MDC A;  1SA8 A;  5FAZ A;  1HBP A;  2GC9 A;  3TF6 A;  4IB6 A;  1BSY A;  3KFH A;  4GDZ A;  1DZK A;  4N7D A;  4OS0 A;  5EZ2 A;  1KT3 A;  3FA6 A;  5HZ5 A;  1AB0 A;  3FA9 A;  1FEM A;  1L6M A;  4Y0R A;  3JS1 A;  2CBR A;  4ZHC A;  3CQR A;  1U0X A;  1S7D A;  3ZW0 A;  4O3Y A;  5LJK A;  1OPB A;  2LA7 A;  3RWX A;  4INN A;  3WJC A;  2KW1 A;  2KTD A;  2WEX A;  4AZN A;  1OBP A;  2Q2P A;  2JW1 A;  1SXU A;  5L8O A;  3PED A;  1YWA A;  2FWV A;  2G79 A;  3LHN A;  4GKC A;  2ZAI A;  2HLV A;  4LZU A;  4QQ1 A;  5FQ7 E;  1JZU A;  4XMC A;  3WJE A;  3APV A;  1CJ5 A;  4ZH6 A;  2QOS C;  3C77 X;  1IW2 A;  1GT5 A;  2X8S A;  3EBW A;  3FEL A;  3KFI A;  3RBY A;  1B4M A;  3STM X;  2OVE A;  1ZNH A;  1O1V A;  1LID A;  3D97 A;  3HTY A;  4A1H A;  1HMS A;  3CBC A;  1EW3 A;  1GXA A;  2O62 A;  2EU7 X;  3WVM A;  1IIU A;  3UEV A;  2AT0 X;  1ICM A;  3NR3 A;  3E3C A;  3VG5 A;  4YFR A;  3FLL A;  4ZHF A;  1EIO A;  1CBQ A;  1EUO A;  2XST A;  3FR2 A;  3FA7 A;  2R56 A;  5F1E A;  1ERB A;  4YCE A;  4OMW A;  2FS6 A;  1SXY A;  2OZQ A;  3D4R A;  2GJ5 A;  4MIR A;  3S5V A;  2Z4I A;  1QWD A;  4D6B A;  4QYP A;  4ALO A;  3DTQ A;  2QO4 A;  4ODD A;  4IAX A;  4AZO A;  3ZI8 A;  4XMG A;  5HA1 A;  2BS6 A;  2KT4 B;  1YUP A;  4BOE A;  2JN3 A;  3UEU A;  1KQW A;  1VYG A;  4ORS A;  2L5P A;  4ZHD A;  2JMB A;  1LPJ A;  4L1N A;  4ZHH A;  1O1U A;  1MX8 A;  1PEE A;  1KZW A;  2MM3 A;  2P8G A;  3BDR A;  4YBP A;  1RBP A;  2JU8 A;  1G7N A;  1ALB A;  3I0A A;  1DFV A;  1JIW I;  1MX7 A;  4YBU A;  2X8F A;  1NP1 A;  1SXX A;  4ZHG A;  4IMO A;  1SXW A;  3TZS A;  1DZP A;  3OJY C;  5HZ9 A;  3OD9 A;  4QAE A;  4KCA A;  3NAD A;  2AT6 X;  2AMM X;  4IB9 A;  1E00 A;  3FEP A;  4HFO A;  4WBK A;  1G85 A;  4O3Z A;  4O3X B;  4QGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...