1KR1A

Hevamine mutant d125a/e127a in complex with tetra-nag
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
273
structure length
273
Chain Sequence
b'GGIAIYWGQNGNEGTLTQTCSTRKYSYVNIAFLNKFGNGQTPQINLAGHCNPAAGGCTIVSNGIRSCQIQGIKVMLSLGGGIGSYTLASQADAKNVADYLWNNFLGGKSSSRPLGDAVLDGIDFAIAHGSTLYWDDLARYLSAYSKQGKKVYLTAAPQCPFPDRYLGTALNTGLFDYVWVQFYNNPPCQYSSGNINNIINSWNRWTTSINAGKIFLGLPAAPEAAGSGYVPPDVLISRILPEIKKSPKYGGVMLWSKFYDDKNGYSSSILDSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hevamine A
molecule tags Hydrolase
source organism Hevea brasiliensis
publication title Expression and Characterization of Active Site Mutants of Hevamine, a Chitinase from the Rubber Tree Hevea brasiliensis.
pubmed doi rcsb
total genus 100
structure length 273
sequence length 273
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kr1A00
2BHYA 2QPUA 3WQ5A 1LL6A 2E9LA 4AIEA 4Y7EA 4TVCA 3TTOA 2G41A 1XRVA 1MW0A 2XVLA 3QHOA 1CNVA 1W3LA 2WSPA 4NI3A 4CCDA 1JZ6A 8A3HA 3GM8A 5AYBA 4MB5A 5CJ5A 3M07A 2BVYA 1UZ1A 4OBSA 1OIMA 3POCA 4J7RA 2ZX5A 4AW7A 2VX5A 4AC1X 1OGBA 1W91A 1BYCA 1VRXA 1GUVA 3WQ8A 4E4PA 4WKHA 3ZQ9A 3AS2A 3LPPA 1CXEA 3CZGA 2A3EA 3T0DA 3OLEA 2GK1B 2V3FA 1WAWA 2VCBA 2A3AA 2WAGA 1QHOA 3FNDA 2V3GA 3VIGA 4DUVA 1B9ZA 4QLJA 3MMWA 1GOKA 2YDQA 4TTUA 4RL3A 3ALGA 1GJWA 3S2CA 3W37A 2WMGA 1NWTA 4F79A 2WK2A 5EFFA 3VIOA 1BPLB 5A69A 2Y8KA 1JDCA 2ZICA 4URIA 4DWSB 4GQRA 1HJWA 4YHGA 1EHNA 2GFTA 3ZJ8A 1Z32X 3AIVA 4AY1A 4AZBA 4PRWA 1SR0A 3BSGA 4C7DA 1PBGA 1CWYA 1PX4A 1HN1A 1HF6A 3ARWA 3VGDA 4HU0A 3MANA 2VUYA 4S3KA 1VFUA 3TA9A 1BAGA 2ZUSA 3VMOA 2J8FA 4U31A 3AJ7A 3CIVA 4OIFA 1BFNA 1OGGA 1Y7VA 4CN6A 5LA2A 2V5DA 3PZMA 5HXMA 1EH9A 1KXHA 2D23A 2GSJA 5D4YA 2W62A 1M01A 4FLQA 1GOOA 1MW3A 1CGTA 4W87A 3WN6A 1I75A 4UCFA 4PMZA 2X8RA 5I2UA 4MJ2A 2XGIA 5C71A 4OKDA 3WF4A 1B3YA 2BXYA 5BXPA 4JAWA 4MTVA 4KMQA 1TR1A 1VIWA 1MWOA 2XIIA 4A3YA 2J79A 4OOZA 2D20A 3CMGA 4L4OA 4CGTA 1GOIA 1K9TA 3WF2A 3WUEA 1QBBA 2C0HA 1NP2A 1H11A 1MQPA 1VF8A 4J27A 3N1AA 1R8LA 1CXKA 3NJ3A 2A3CA 3POHA 4PMVA 4AZCB 2PWFA 1E5JA 4JHZA 2VJXA 4IM4A 4AMCA 4B3KA 1IT0A 2IXVA 1JYWA 2F61A 3W82A 3WL1A 4HMCA 5E6YA 2YLLA 3A4XA 4XV0A 1HJQA 2VX6A 3WH5A 3ECQA 2W5FA 3K1DA 4X0NA 1E72M 3VGEA 2QV4A 2UY2A 4F66A 4W93A 1QOXA 1GOQA 1BTCA 3UETA 4MNLA 2PBGA 1BQCA 4J3TA 4EANA 2CKSA 3GTNA 5A95A 1XCWA 1KGXA 2XWDA 4TXEA 3WNMA 3RMEA 2NW0A 1EGZA 1XD0A 4J3XA 3A4AA 4LGXA 4LXFA 3AIWA 2CETA 1JYVA 2BY0A 4HA1A 4XB3A 2CPUA 4DM1A 1CPUA 2DGAA 3WFLA 2OWCA 1VEMA 5A8PA 1E43A 1QNRA 1ITXA 3UCQA 3VX0A 6TAAA 5JBDA 4CCEA 1VEPA 5A6MA 3AROA 2BNJA 3FHQA 5HOSA 5JIPA 3KL0A 3UESA 1D7FA 1KFWA 3OLIA 3ZJKA 5CXPA 3WNPA 4GINA 4AISA 2EPOA 5IHRA 3K4DA 1PPIA 2VQTA 2YJQA 3AHTA 5BXRA 2X0YA 4PCSA 1RPKA 1X6LA 3TTQA 4Z2IA 4S3JA 2YL6A 3ZM8A 4DM2A 4QCFA 3N9KA 3VINA 3AHYA 1GOMA 2UY4A 4AZHA 2CIPA 2O9RA 4HTYA 3SUTA 7A3HA 4D6EA 1W9PA 2WHLA 1NOWA 1JAKA 3AXXA 3CO4A 1JD7A 3W27A 3F5KA 3CLWA 3VIPA 3AFBA 3W0KA 1W1VA 4UFJA 3G6LA 3WDRA 3BXWA 3SCNA 3M6DA 2O9OA 2G3NA 1KGUA 1O7AA 1JZ7A 2WBKA 1EDQA 2VI0A 3AMLA 2IXUA 4W88A 3ZT7A 4U3CA 1LLOA 2G4FA 1H5VA 3GH5A 4PBGA 1EO5A 3VD9A 4EK7A 3WH6A 2X05A 2XHYA 4DUXA 3WNKA 3IJ9A 4DWSA 2DT0A 1X1NA 4YN5A 2XFYA 1E1EA 1EDTA 2Y4SA 5FIPA 3SCOA 3AHVA 4M56A 4OUEA 4Z2LA 2CXGA 1CGYA 2DT2A 3ZJ6A 1QI3A 3SUVA 1ISYA 1W2VA 1W1YA 4WK9A 2G3JA 1WDPA 3CHFA 3FHAA 2E40A 1UKQA 3PN8A 2XVGA 2ZXDA 1R86A 3VGHA 3VIIA 1QW9A 4AZ5A 2XVNA 1U2YA 3ARXA 1WPCA 1C7TA 1E0WA 1U33A 3II1A 4Q7NA 3EDKA 2DDXA 4NSBA 1KCKA 3EDJA 3NSMA 5EB8A 2YLAA 3ZR5A 3OZOA 2XM1A 3GXMA 2TAAA 2WCAA 5CG0A 1J0KA 1G01A 4AD2A 1OD8A 3F4VA 1HL8A 2E4TA 2Y5EA 2QMJA 1O6IA 3VNZA 1QNSA 3GBEA 1E6SM 2UY5A 1TFVA 4AD0A 3OGVA 1UR0A 2WVVA 1V02E 4W8LA 1UA3A 3A47A 3ZJ7A 1V08A 1CLXA 1H1NA 1V03A 3M7SA 4CU6A 5A2CA 4XX6A 1HVQA 4U5KA 5I0DA 1GQKA 4HU8A 4JKLA 4UOZA 1HKMA 2ZXBA 1V6YA 5I23A 4CCCA 1XSKA 5DF0A 1CGUA 1UH4A 3A3HA 3THDA 3T08A 1K9EA 1B3WA 2BXZA 3VTRA 3RO8A 4NZCA 1JF6A 1C91A 2OWXA 1XGZA 4BQ5A 1V3LA 1VENA 4HOXA 1KB3A 4C7FA 1OCQA 1R87A 5FKYA 2BHUA 3WF1A 3RIKA 1J10A 3WUBA 2XVKA 3VDAA 3CHDA 3AZTA 4TX6A 3UG3A 3TONA 2CERA 2F8QA 2PB1A 2DSKA 1ZL1A 4JFVA 4B3LA 1FA2A 4KWUA 4B9ZA 3U57A 4PCTA 1E3ZA 3WEMA 6A3HA 4HOWA 5F7UA 1V3JA 2QLYA 4BS0A 3B9EA 1C93A 4UQCA 3HJEA 1EIBA 3LPFA 2UY3A 2YKKA 3SCTA 3AMKA 2A3HA 2XPKA 1EA9C 2VQUA 2OSYA 2JEQA 3WMBA 1L8NA 1GONA 4OBRA 3IAQA 1R7AA 1JYNA 4AEFA 1GZJA 4WIWA 3ZO9A 1RP9A 4GO8A 4W8BA 2CHNA 5CGTA 4BQ3A 3WIJA 3KE0A 3SCUA 4A3HA 2J74A 1EOMA 5A2AA 1W9DM 1AQMA 2QF8A 4AYSA 5M03A 4PMDA 3L4YA 4N0RA 3U7BA 1HJVA 5I77A 5E70A 1E6XM 2BFGA 2VX4A 2WCSA 1NOFA 4P7QA 1KQYA 1QBAA 3VMNA 1DWFM 3DYPA 4LYPA 1C8XA 3PHAA 1ZJAA 4UFHA 4HPGA 9CGTA 1JZ4A 3QOKA 2WMIA 2WVSA 2EXOA 1MQRA 1VJSA 3NIYA 3DHPA 2WMIB 4JCLA 2DPEA 1WDQA 4U3AA 4W5ZA 1XH1A 1JXJA 1UWIA 1UG6A 3OGSA 3DHUA 3I3EA 3PTMA 3KWXA 5A6SA 3WBEA 4CUCA 1E3XA 3W28A 3CPUA 4UFLA 1V6WA 4AZCA 5DFAA 4JKKA 3BGAA 2PWGA 4RE4A 5I6SA 2VCCA 4V27A 1JXKA 3W4RA 1BGAA 1MQQA 4ATDA 2WLYA 4LYQA 4PYSA 2WLZA 3NUKA 2EPLX 1IZJA 4JHOA 1FP9A 2FH8A 4QFUA 4D6GA 4IPLA 1NWUA 4WKAA 2VT0A 5A6LA 5E6ZA 3VIMA 2GK1A 3OA5A 2VVNA 3SCWA 1GHRA 3AYRA 4YPJA 3UG5A 2ZE0A 2J7GA 2XFFA 2WHJA 1K9FA 4W86A 5C70A 5CSUA 3SURA 4GPNA 1CYGA 1V0KA 1MXDA 4FK9A 4CD4A 2DIJA 2WZEA 4WLCA 1UYQA 1LL4A 1QVBA 3NCOA 4C7GA 3QOMA 1PX3A 5LYRA 2CBUA 2JF7A 2BV9A 1OT1A 1KXQA 2HVMA 4QDMA 1KGWA 4PTVA 1U30A 3MUIA 1C8YA 2C7FA 3GXIA 1TZ7A 4JL1A 1B30A 3CUGA 4MJ4A 1QI4A 3RILA 4F9DA 4CVWA 3AS3A 4V2XA 1W1PA 1MW2A 2ZUMA 1HXJA 1ISVA 4PUDA 5CPTA 3NDYA 1RD6A 1LF1A 1B1YA 1LQ0A 5D9PA 4UR9A 2WC3A 3ARYA 1K6AA 4J3WA 4KGJA 1UKTA 2JALA 1KWGA 3AYSA 3L4ZA 3IANA 4K68A 3PZOA 4BQ2A 4UFIA 4GXPA 2WMHA 1E55A 1JNDA 1JFXA 5M5DA 1E6NA 1H0GA 4MADA 4H2CA 1BVZA 2CEQA 3EDEA 1BGGA 4MAZA 3AIBA 4GI6A 4JKMA 4PTMA 3AZSA 1CXIA 3MUY1 2PWDA 1ISWA 1MFUA 4TVDA 3ZMRA 3SEPA 1V6XA 2EPMX 2MANA 2WMFA 1XH2A 1DP0A 1WO2A 1PZ2A 1OINA 2OWWA 2DSWA 2XVPA 1QHZA 4MPKA 1VFOA 4QAWA 5A1AA 1UZ4A 1UR9A 1Q4NX 1WB0A 1QHPA 3L4UA 1JGIA 4MB1A 4E8DA 5GPRA 4OJYA 4FLSA 3PZQA 2ZWYA 3VNYA 3QGVA 1JFHA 2J7BA 3WQWA 2PC8A 3N13A 2E9MA 3I3BA 2WB5A 2ZOXA 3AICA 2V3DA 2JIWA 2RGLA 3CZKA 1XHGA 4GZJA 4UQBA 1UH2A 2J4GA 4HPHA 2WMJA 5A8NA 1V3HA 2E9BA 4MAVA 5DEZA 3CGTA 3ZT5A 1JAEA 3IK2A 3TP4A 1OWQA 2YDSA 3WDPP 1RP8A 4FF5A 3WD4A 3BLKA 1CLVA 1OT2A 3GH7A 3VDHA 3GXFA 1CTNA 4XUYA 4M1RA 3AS0A 2JE8A 4PMXA 5AY7A 4AZGA 1DTUA 5AC4A 2PWEA 4GZEA 3S6TA 4AEEA 2YL8A 2B31A 1XD1A 2OYLA 2E3ZA 1ISZA 3CTTA 2YDRA 1WNOA 4GI9A 3GNRA 5HPOA 3WDJA 3VUPA 1ZBKA 2IUZA 5E09A 1DWGM 3W6MA 4P8UA 4KRTA 3AIUA 3KL5A 5I3DA 2A3BA 1UHVA 1MYRA 2J7HA 5D8WA 1V6VA 2J25A 2PF0A 1FP8A 1FH7A 3CHEA 1HVXA 2BHZA 1H3GA 1SFSA 3CUIA 2ESCA 4BZYA 3BMVA 5I79A 1G5AA 4OZOA 2VNCA 4UQDA 4D6HA 1VAHA 1AMYA 3HN3A 3SUWA 1Q6EA 1WZAA 2WVUA 1UOKA 1CEOA 1XCXA 1QW8A 3MSGA 3SCRA 2VC9A 1HJUA 1HKJA 5EBAA 4F8XA 1G1YA 1XYFA 1C3FA 3BAKA 1CBGA 3L2MA 3PZUA 3WENA 1E56A 4ACZB 2FHFA 1EQCA 2W61A 2WYSA 3O2LA 3FY1A 5A6BA 3AIQA 5JBEA 2O9TA 1MVYA 5CGMA 4WJXA 2CNCA 5A6KA 2WHMA 2WMKA 1V6UA 2D2OA 3AXIA 4GI8A 2WNWA 1F4HA 4HMEA 3SIMA 3T09A 1RH9A 4UTFA 1R85A 5IXEA 1FFQA 3GNPA 2WSKA 3N12A 1KQZA 2XTKA 1M03A 3N04A 1ODUA 3VD5A 2EQDA 4ZXLA 2YBTA 3VIHA 2UWFA 1E73M 3K46A 4D6CA 3BAYA 3RM8A 2J75A 2Z1KA 5LA0A 1JG9A 2VRKA 2WZIA 1UKPA 1CXFA 1E4IA 4J3UA 3SCPA 3VDBA 3OB8A 3VM7A 1GQLA 3U5UA 2ZUVA 2X09A 4BF7A 4JZ5A 1BYDA 4CU8A 1WZMA 5HNNA 3OLDA 2J7DA 3TTSA 1HX0A 4W8AA 2FDMA 3WMCA 3WFZA 3T0BA 3VILA 1TCMA 2WVVB 2OYMA 1ODZA 4PMRA 1V02A 2CHOA 3G6MA 3WNNA 3CZEA 3VX1A 3DYMA 4JL2A 2CBVA 5D9MA 2X0HA 3PZTA 1N82A 4AIUA 2BS9A 1BVNP 2GJPA 3N15A 3AMCA 4X9YA 4CKQA 3WQ4A 1NARA 2QHAA 5IDIA 1W2PA 2G3IA 2XG9A 3WH7A 4EAMA 5AYIA 4R5EA 5A8OA 1QNOA 5BXSA 1WP6A 2VRJA 5BRQA 2YBUA 5HBFA 2W66A 3UEQA 3GXDA 1JZ3A 1CGWA 1GPFA 4W89A 2VX7A 4NRRA 3BMWA 5BRPA 2Q8XA 5GNZA 4M80A 1JZ5A 3OG2A 5A6AA 5A8MA 1SYTA 3AOFA 1GQIA 2D3NA 3MV01 4V28A 2W91A 4TVUA 3CUFA 3WDQA 5ECUA 2XM2A 2W92A 3A6OA 1W9XA 1KBBA 2Y24A 3PTQA 5BYWA 5CZKA 1JNEA 1H49A 2YL9A 4ATLA 5IHSA 2VZSA 2W4XA 2VZTA 1NM9A 2O9PA 3CZJA 1GCYA 2WANA 3W81A 1M53A 3AQUA 1CXLA 4E8CA 1US3A 1UD2A 4N42A 1WCGA 3ZIZA 3WY1A 1NWRA 1EDGA 4J3SA 4P7NA 1HT6A 1UWRA 2AAAA 4LX4A 1AQHA 2OSWA 2FGZA 4W7UA 1KXVA 3VO0A 2GVYA 3FAXA 1JD9A 1UD8A 2YOCA 2DH3A 1KXTA 1PEZA 1WZLA 1GOWA 2DEPA 1V3IA 4ZE4A 2BY2A 3WD0A 3TTYA 1W9VA 1DWAM 3L2LA 2Y2WA 4GQQA 3W6LA 3QHNA 4PSPA 1GHSA 3VD4A 1UD4A 4D71A 1K9DA 1EOKA 4P7OA 3OLGA 5FD0A 1HKIA 1CGVA 4QLKA 2Y8VA 3CBWA 1MFVA 3QR3A 3RPMA 4HA4A 4Z2JA 4J28A 4BA0A 2ZX6A 2VRQA 3M46A 1J01A 4HA3A 1JI1A 4U2ZA 2D24A 2QPSA 1E71M 3F5JA 3PZIA 1YHTA 1DHKA 3GDBA 3D3AA 3W53A 2BVTA 4UFMA 3WNOA 3U7VA 2GUYA 1HP4A 2VZOA 1S46A 4M24A 3SUSA 3IJ7A 5CLTA 3APGA 1Q6CA 3WF0A 1UA7A 1D2KA 5A2BA 3MUZ1 4XZBA 4PMNA 1PIGA 1UQZA 5A8QA 1NWSA 3AIRA 2YA2A 1BSIA 2VZUA 4H8VA 2J7CA 2D0GA 4B9YA 1LL7A 1MXGA 4FLOA 2J7FA 2YA0A 3RDKA 4EE9A 3AHXA 4ZXOA 5FL1A 1J9YA 4CN1A 5M17A 1LG2A 4P7LA 4QLLA 3AXHA 4ACZA 1PX8A 5CPSA 4ZEPA 1UUQA 2WZHA 4W7WA 2D3LA 1VJZA 1JDAA 3TOPA 3BC9A 1B90A 3ARTA 3PTKA 3WSUA 2WXDM 3WNLA 3VDCA 4CD6A 3UR8A 4CN4A 4IISA 1FH9A 5M3WA 4R27A 3MO4A 1PZ3A 3CUHA 2VR4A 4W84A 5GQBA 1QNQA 1OD0A 1OIFA 3RJXA 2FH6A 1QI0A 3T2OA 3W25A 4DWSC 5ABHA 4UQAA 4UOJA 4F9JA 1Q6DA 4KH2A 2YIHA 1E6ZA 4PEEA 2E8ZA 1DEDA 3VIFA 3B9DA 4ATWA 1AVAA 5CLWA 1JZ2A 1CECA 1E6QM 4U2YA 4X0VA 4UOQA 4ZFMA 1C92A 1JL8A 1NP0A 4HZ6A 5BCAA 8CGTA 4MDPA 3WEZA 5KZ6A 2ZXQA 2XSAA 3O9NA 4GKLA 2CBIA 3I3DA 1WKYA 3KZSA 3BCFA 2XJ7A 4RE3A 1KWKA 1GVYA 2Z1SA 1E9LA 2FHBA 4QP0A 2XYLA 4H04A 1UD6A 3K8KA 4WKFA 3VVGA 2ZX9A 1VEOA 1QNPA 3EMQA 1E4MM 3MKKA 3VKKA 3EMZA 1E5NA 1CZ1A 3VGFA 2D0FA 3AIEA 2NT0A 1UQYA 1DWHM 1HJXA 1TUXA 4WSKA 1ESWA 2F2HA 3CZ8A 3AMGA 5D8ZA 2WM0A 3PZVA 3OZPA 3AS1A 1UWQA 2AMGA 4P7RA 1I1XA 4JFUA 4P8XA 3E1F1 1ZJBA 4Z2GA 4U5IA 4GIAA 4BCEA 1BF2A 4AZIA 2X1IA 1XYZA 4HZ8A 1JIBA 4PMYA 3N17A 2G8ZA 4HP5A 3AZRA 4LQ1A 4D1IA 3KL3A 4BQ4A 5KEZA 5D9NA 4IPNB 3VPLA 3WD2A 2EPNA 5E0FA 3BAWA 1BG9A 1J0HA 4UQEA 4CD8A 1ZU8A 2WC4A 2WWCA 5E0CA 3PZNA 4OOUA 1EXPA 4WF7A 4E2OA 1UR4A 4NF7A 1ITCA 2E0PA 1WZKA 5TD4A 4YHEA 4UNIA 3DECA 1NOUA 3T0AA 5JBFA 1UR1A 4MDOA 4M82A 1PIFA 1H2JA 3GNOA 4AXNA 1IV8A 2JFEX 1AQ0A 3ARSA 2XIBA 1W9BM 3CH9A 3EYPA 3PZGA 1KR1A 3GH4A 3K8MA 3VGBA 3VIKA 4D6IA 3ARRA 2DT3A 3LMYA 3CUJA 2C8NA 5CPQA 1J0ZA 3FXYA 1VB9A 1UWSA 1G94A 3WDHA 2YL5A 1EHAA 3SCSA 3NYDA 2CYGA 5IFTA 3RM9A 2BVDA 2CESA 1LWJA 1XV8A 3CMJA 1FHDA 4U33A 3OIHA 5DT7A 1WE5A 4KRUA 1JZ8A 2DSZA 5A3HA 2J62A 4CU7A 1US2A 3UR7A 1C90A 1WDSA 3CZLA 4AZ6A 2WBGA 1JDDA 3LPOA 3WEOA 1HKKA 2J77A 1TVNA 2NT1A 1UH3A 4MNKA 4EKJA 3RJYA 3EBVA 4TTGA 5JIWA 5I24A 2XGBA 1DWIM 3U5YA 5A6JA 4ACYA 1TE1A 5D9OA 5HDRA 2BY1A 4XZWA 3NDZA 2E8YA 1UKSA 4D72A 4CVUA 1TMQA 1XH0A 1XSJA 3WD1A 1BLIA 1W3KA 1GQJA 4P8VA 3SCQA 5A6BD 1M04A 3FN9A 1TG7A 3O6AA 1UR2A 2D22A 4DUWA 7TAAA 1VBUA 1V3MA 2DQXA 3D5HA 1M7XA 3AISA 5ABFB 2VZVA 4ZE5A 1UD3A 2OSXA 2ZUWA 4B15A 2GJXA 4P8WA 4AD1A 2WCGA 2EBNA 1V0MA 4Q22A 3VIJA 1D3CA 4FLRA 2V38A 4H8HA 3RM4A 5E9AA 2D1ZA 4AD3A 1CXHA 1E0VA 1J11A 1V3KA 3IJ8A 1E15A 1X6NA 2YA1A 2VR5A 1VBRA 3DC0A 3HMCA 1J0IA 4JFTA 3VMPA 2D0HA 4B16A 3BSHA 4DWSD 3F5LA 3AMDA 2XWEA 2G3MA 3VM5A 1EQPA 3W38A 5FCZA 1HL9A 2JIEA 5BXTA 2WHKA 1E6RA 2XFRA 4UZUA 4PMQA 7CGTA 3ARQA 3AHZA 4PN2A 4AD4A 4AWEA 1W3JA 2ZWZA 1C7SA 1SMAA 2HISA 1PAMA 1PJ9A 1WDRA 1JF5A 4JIEA 1ZS2A 6CGTA 3OGRA 3K8LA 5ABGA 3VOCA 1MW1A 4PUEA 4NRSA 2WKLA 3ARUA 4PTXA 1CGXA 4W7VA 1ZBWA 4HZ7A 1H4PA 3MUAA 4PTWA 1E1FA 1G9HA 1OSEA 1OBAA 2FGLA 2J78A 1E4LA 3B9AA 3ZT6A 3DYOA 2CITA 5I78A 4UFKA 5BROA 5DMYA 3UG4A 3OBAA 1UD5A 3WELA 3T2QA 3N18A 3WUGA 3RCNA 2NSXA 1W9UA 5A94A 2VOTA 5I5RA 1QI5A 2ZX7A 3MSDA 2DSUA 5DT5A 5LA1A 5CSYA 1FOBA 3VD3A 3ARVA 2DIEA 4MB3A 1UR8A 3FAWA 4JFWA 2J47A 1BYAA 1E40A 3LPGA 5ABFA 1YQ2A 2WVTA 3WMSA 3IAPA 2CBJA 2VMFA 3K4AA 3UERA 3ZSSA 3CHCA 4CD5A 3ALFA 3B8SA 1GJUA 2W63A 3JUGA 2QMKA 3L4VA 1A47A 3EMCA 2W67A 2GJRA 1W1TA 3SUUA 4TOQA 3J7HA 3VU2A 1ECEA 2AOSA 3VD7A 3PBGA 3W24A 2ZXAA 2OLHA 1UWUA 1F4AA 1GVIA 1EO7A 2VCAA 3QHMA 1KCLA 1CDGA 2VO5A 1R7OA 3WBAA 4D6FA 5GNXA 1B3VA 4LYRA 3NSXA 4H41A 5IFPA 1NQ6A 1TVPA 2CCRA 4ML4A 5EMYA 5ABEA 4W85A 1UKOA 1E4NA 3GZAA 1B0IA 3L4XA 3ZSTA 1J18A 5CQ1A 4QCEA 4GO9A 1BG4A 2GDUA 3BH4A 3GYCA 3HU7A 3NSNA 1LWHA 1TA3A 3N11A 2VVSA 1B3XA 2VTFA 4D1JA 1XC6A 5FOOA 3WF3A 3SCVA 2RGMA 3ARZA 2PWHA 4UZSA 4PMOA 2EEXA 2ZUTA 3W26A 3WDIA 3GBDA 3WL0A 2O92A 2EO7A 1V0LA 3ARPA 2JF6A 4HMDA 5AC5A 2CKRA 1Q6GA 2WPGA 4J3VA 3WUFA 4AIOA 3BCDA 2BY3A 4KGLA 2EPKX 2X2YA 2ZX8A 2WW5A 1GORA 3AI0A 1IZKA 1FHLA 1H0IA 4D6JA 1J0JA 3WH8A 1G0CA 3WH9A 3WQVA 2PBOA 1JI2A 4IUGA 1NH6A 3A4WA 3ZOAA 3W29A 1GW1A 4M81A 4MNJA 4D6DA 1XSIA 4Z2KA 3FW6A 1H09A 1OM0A 1ZBCA 1CIUA 2GDVA 5JUVA 4RE2A 1UWTA 4AD5A 3L4TA 1BYBA 1E70M 4GZIA 1FFRA 1W32A 4H8UA 4MNMA 1DWJM 2XSBA 1V0NA 1B3ZA 1L0PA 2GJXB 3MV11 1BHGA 2JEPA 2EJ1A 4UQ9A 2ZUNA 4TX8A 1HNYA 1ZBVA 1ZB5A 1E0XA 4M29A 1KBKA 5C8BB 4PSRA 1HIZA 1OB0A 4L4PA 4LPCA 1QPKA 1CENA 5BWFA 3MS8A 3L4WA 4JFSA 1J0YA 1JYXA 4Z2HA 4M8UA 3ZR6A 3BAJA 1OGSA 3MMDA 3MU7A 1TA3B 1HJSA 1H41A 2J8GA 2DSVA 2V3EA 4CD7A 1QI2A 1VFMA 3THCA 3BLPX 2WC7A 1FH8A 2ZUUA 3MMUA 3KEHA 2DT1A 4MB4A 1HP5A 1A3HA 4ZENA 1SMDA 1W3HA 1E6PA 4HOZA 1C8QA 1GNXA 5HPCA 3BAXA 4H7VA 5FL0A 3BAIA 4A4AA 4WSJA 4TUFA 3VGGA 3PZ9A 4FMVA 4AZ7A 2XUCA 2DH2A 2ZIDA 2PI6A 1LG1A 4PMUA 3WD3A 1I1WA 1Q6FA 4JCMA 1ISXA 1J12A 1KR0A 1P6WA 4W5UA 2FHCA 1VFFA 1B31A 5GNYA 2OYKA 2VURA 2WKGA 1LJYA 2J7EA 3T2PA 5EFDA 3WQ6A 3EDFA 3WKZA 2WWDA 2VL4A 2V5CA 3EDDA 5DO8A 1B2YA
chains in the Genus database with same CATH superfamily
3HA1A 3PAJA 2XN0A 1FWBC 2E9LA 4PEKA 4AIEA 2VFFA 4MLJA 3G18A 1L6WA 3QHOA 4JN8A 3OQEA 1A49A 1W3LA 4UNLA 4LNYA 1JZ6A 1M41A 4C6KA 2Q09A 4X63A 3GM8A 5CJ5A 3V36A 3E2VA 5T26A 2BVYA 5C2CA 4GY1A 3GNXA 1XDJA 1OIMA 2PP0A 4AW7A 4K37A 4Q8PA 3MSRA 1UOZA 3M9YA 1W91A 1GUVA 4E4PA 4J2MA 3LPPA 3PF3A 4C6LA 2DVXA 2A3EA 2VEKA 3CHVA 2OZ0A 2GK1B 4I5XA 2FFCA 3Q37A 3UPBA 2C1HA 2A3AA 1QHOA 1O5XA 3C6CA 1B9ZA 4QLJA 3BLLA 3S42A 4DPQA 3MMWA 1PUDA 2J9ZA 3OZMA 3W1UA 1WYIA 1DTNA 1CW2A 5FF2A 4F79A 2YFNA 4ZQNA 1XDMA 1BPLB 5FF0A 4RX0A 3MC5A 2ZICA 5D33A 1EHNA 1KO0A 4JTFA 3ZJ8A 1Z32X 4YMZA 5MKGB 3BSGA 1PX4A 5F2GA 3ARWA 4M19A 3TXZA 4HU0A 2PFHA 2X41A 2VUYA 1R3YA 3QFWA 2ZUSA 3VMOA 2J8FA 4U31A 3FYOA 1LLZA 1Y7VA 3ABQA 3G0XA 3WMLA 1XGEA 4IHCA 2FZ9A 1ZAHA 4E3VA 1VR6A 2D23A 4FNUA 2IKHA 4IGHA 4EIVA 2JBMA 1S3HA 3IUDA 1AZ2A 3KRSA 3GVGA 3STGA 3UVAA 4W87A 2ANUA 2HVOA 4PMZA 3XINA 1H7XA 3VKDA 5C71A 1PL9A 2Y70A 4UMBA 2WSQA 5I7GA 2BXYA 5BXPA 6PTDA 4JAWA 4MTVA 2WJZA 3UZZA 5EKYA 2D20A 2Y1HA 2FYMA 2Z29A 1K9TA 5A6TC 4LEFA 4LBRA 1B54A 4B2DA 1M7OA 1R8LA 3M5XA 3NJ3A 1VIZA 3JVAA 4LVDA 4AZCB 4JHZA 3LDVA 1FQ0A 3S5YA 2IXVA 4I9MA 3WLNA 4AXKA 4HMCA 2WJFA 1FWEC 3VGEA 3KDNA 1VGAA 3MI6A 1UCWA 3K13A 1AZ1A 1FKWA 2QCGA 2C19A 1MUWA 3LUTA 5KTLA 2QIIA 2I56A 4IUOA 5K9XA 4S1FA 4LGXA 5F4WA 3E0LA 3W7GA 2CETA 3A13A 1UP3A 2BY0A 4HA1A 2V67A 2BWGA 2R1NA 1VEMA 4NYUA 1DL3A 2HBXA 1E43A 3SN4A 5D04C 3VX0A 4PTNA 5JBDA 1RALA 4CCEA 2HS8A 2YCEA 4H9MA 3P82A 3KL0A 1D7FA 1RA5A 3R10A 3ZJKA 3WNPA 4H7ZA 4AISA 2QYGA 2EPOA 2VQTA 1RPKA 1FVPA 3S1VA 2QDHA 3TTQA 4Z2IA 4DJDC 3TN5A 3ZM8A 1JDFA 4QCFA 4C6MA 1OZQA 2H9AB 2ZZ5A 3I7RA 3VINA 2I1OA 1LT7A 4ZSUA 1TE6A 3GQYA 5HMSA 2FJKA 2W79A 2DZUA 1VZWA 1TX2A 4IQLA 4UFJA 3G6LA 1YNYA 3WDRA 3FDKA 1UBPC 3M6DA 3UXIA 1O1ZA 3K5XA 2J88A 4AC7C 4GCAA 1KGUA 1O7AA 4AF0A 2WBKA 1EDQA 3PJUA 5HMEA 5HR6A 3CH0A 2IXUA 1XLBA 2HDJA 4MIMA 2HPMA 1LLOA 3DIPA 4PBGA 2DZSA 3NGJA 2X05A 3QKZA 2NUWA 2DT0A 1KTBA 4YN5A 1NTHA 1RCOB 4OUIA 2XFYA 3PBMA 3TN4A 4FS9A 1Z44A 5EA9A 3CMFA 2NQJA 3NO1A 1QI3A 4JDBA 4I6KA 4WK9A 1EXBA 3DFHA 1WDPA 3CHFA 5D2VA 3B06A 3FHAA 2E40A 3D46A 1KFKA 3PN8A 1HQTA 3KX6A 3VIIA 3T44A 1QW9A 3WJWA 3ARXA 1C7TA 5J04A 2VFDA 1U33A 3DG6A 5FAGA 5LHFA 4Y9PA 4MGGA 3ZR5A 1UWAA 1FDZA 4HCHA 2TAAA 4DRSA 1SVDA 4MKNA 4NP7A 2YGYA 1J0KA 4I9AA 5CG0A 3B8WA 3WBWA 4KKXA 4A29A 1SJAA 3AC0A 2H9AA 4NUWA 4OWGA 4LC6A 5HWMA 1E6SM 4GGBA 3PUGA 1MXSA 5J5DA 3LHUA 3ZJ7A 4YTRA 1H1NA 1V03A 2Z24A 3GG0A 1Q6LA 2IW0A 3F2DA 3P14A 3AYVA 4U5KA 5I0DA 1GQKA 4GYJA 2WV8A 5LGZA 4GVIA 2ZXBA 1V6YA 1E9YB 2PUZA 2RHGA 4O57A 2XN2A 1RBAA 1UH4A 3T08A 3QV8A 4PUKA 1XBXA 1EGVA 4KESA 3G1YA 4NZCA 2PGEA 3E3HA 3WK3A 3EOSA 4BQ5A 4C6CA 1V3LA 1VENA 1KB3A 4C7FA 1EX1A 1TX0A 4OV4A 4HNTA 3C2VA 3DKLA 3QR1A 3VOJA 4DO6A 1AW2A 3VDAA 4TX6A 3K30A 4ZODA 4E38A 2DW7A 4JFVA 2PLKA 3UJFA 3B05A 3AAMA 4YTSA 1RAKA 4GUGA 4UMCA 5F7UA 4ZVJA 3G0SA 1TMLA 2OGYA 1C93A 4U10A 4TMCA 3DFYA 1JPHA 2UY3A 3QV7A 4ZB0A 3AMKA 2A3HA 3FKKA 4FXJA 2VQUA 3CUXA 3VZXA 4K7VA 4OBRA 3LCWA 5ECVA 3ONBA 4TU1A 4RW5A 3ZO9A 1RP9A 2CHNA 1TCDA 1P0DA 4HZMA 3GKAA 4AWUA 3BVJA 2Y5JA 3KE0A 4LWWA 4R53A 5AZ1A 4GQ0A 2PODA 4PRTA 5DCEA 3L4YA 2PP3A 2DU2A 3JW7A 4G7EA 4N0RA 1LDCA 4JTHA 1HJVA 5I77A 1E6XM 2BLEA 2XIOA 3KDOA 1R9YA 3W00A 1DJYA 4LYPA 4HMNA 3O6YX 3LTYA 3L65A 2WMIB 1IT7A 3QW3A 3H2EA 4JCLA 3QF0A 4QISA 1SM9A 1XH1A 5G4HC 1UG6A 5DXXA 5AECA 4AF0B 3FJLA 1X1ZA 4E4FA 1SZEA 3W73A 3DHUA 5AN7A 3KM8A 3KWXA 5A6SA 3WBEA 5H8MA 3I4EA 3O7UA 4POCA 2O4MA 1E3XA 5AKQA 3UF9A 4B4FA 4UFLA 1V6WA 3W71A 3N4EA 2PWGA 3KOFA 4YNGA 4JTLA 2QAPA 3E38A 4AX7A 2Z2UA 4NAFA 4FX8A 2ALRA 4ATDA 4PYSA 2WLZA 1R9ZA 2EPLX 4JTUA 1FP9A 3PUDA 4K1WA 3FCPA 3SI9A 4WKAA 4FP1A 4D9PA 4BHYA 1X39A 4HHPA 1TRIA 3TJIA 4EF8A 4Z42C 2VVNA 4YPJA 2ZE0A 2GDQA 2XFFA 3TVAA 4HHLA 4NJKA 1MXDA 4CD4A 3TQ0A 4ONVA 3JU2A 1LL4A 4CEXC 3OZYA 2REQB 3URBA 3KTCA 1UUMA 2Y85A 3NQ2A 3VCNA 3V0TA 1H61A 2AMXA 2BV9A 5FA5A 3HV8A 1T5AA 5IDZA 1C8YA 3MUIA 1TZ7A 5CAKA 1ZAIA 3W7EA 3ATYA 4ZOAA 1QI4A 3RITA 4F9DA 1QASA 4JNYA 3BURA 3UR2A 1YTDA 2GPTA 4KPLA 2ZUMA 4LVGA 1HXJA 1ISVA 4KIRA 4Y8EA 2A7PA 3EKZA 3TW6A 3W07A 1Y5XA 1TWZA 1K6AA 3WFAA 1DJQA 5D2WA 1KWGA 1TPFA 1ICQA 1AMKA 2B81A 3Q67A 4NNAA 3QW4B 5BW6A 4UFIA 4HYVA 1JNDA 3A9BA 5M5DA 5AHMA 3TQKA 2BODX 3KZPA 2HSAA 1UPPA 3LLFA 1YPFA 3C0QA 1JPMA 3EA3A 4JKMA 2ZA3A 3GNDA 3CV1A 4MY8A 3PG9A 2PWDA 3RHGA 1MFUA 1NAL1 3ZMRA 1ONRA 3GXTA 1DP0A 4ZOEA 1RY8A 4S3GA 1M9HA 4Q4KA 4A8RA 2I17A 1XIMA 1VFSA 2Z1BA 3CAQA 3QY7A 5AHFA 4UTIA 3IVUA 1YDOA 4E8DA 4FLSA 1TIMA 4GLEA 3PBWA 5HAOA 1S5VA 3QGVA 3AU6A 1AL8A 2PC8A 1Y65A 3TOYA 1M7JA 1N7KA 2ZOXA 3C61A 3R8GA 3TUUA 3TJLA 5CSSA 4RNIA 3W1AA 3AICA 1TSIA 2V3DA 2JIWA 1OFRA 4KEZA 3H22A 4R88A 3DERA 3T4WA 2J4GA 2CLPA 1IR1A 3DHFA 3AWNA 2TRSA 4AVNA 4ROPA 5H8UA 2ZA1A 3ZT5A 3W2KA 4JTEA 1OWQA 2YDSA 3WDPP 1CLVA 4QNEA 3VDHA 4Y6GA 4JEJA 4PMXA 2JE8A 4WGXA 1DTUA 5AC4A 2PWEA 3WLQA 1JUKA 4EWND 2B31A 4EPKA 3CTTA 2YDRA 1WNOA 2C15A 2IKGA 2QVNA 2QCFA 3WDJA 4RPPA 5I3GA 1DWGM 4IFKB 2YPIA 1LLWA 3KL5A 2A3BA 3CWHA 5D8WA 2J25A 3VABA 5T9CE 5L9FA 1SFSA 3S2MA 2ZRVA 4OZOA 1NU5A 4CNSA 1KBLA 3G1AA 1SJBA 3UXKA 1VAHA 3SUWA 3MPGA 3P5ZA 2WVUA 1CEOA 3WQPA 3MSGA 3TSDA 4QBXA 4DJFC 1G1YA 3BAKA 1CBGA 2VYOA 2GZXA 2ZQ0A 2FHFA 1EQCA 3FY1A 3AIQA 4BK9A 4KBXA 3BLFA 4BF9A 4DI8A 2CNCA 2WHMA 3ITLA 2HBVA 3I7QA 3LXBA 5FJUA 1H51A 4GI8A 4DO7A 1F4HA 5I02A 4WSHA 2FLIA 1RH9A 3G8RA 5IXEA 1FFQA 4TV5A 1PZ0A 4GIYA 1KQZA 1S1RA 3HPSA 1M03A 1W3IA 1ODUA 4J2PA 4ZXLA 3UZ5A 4C6JA 5F4XA 2OO6A 2Z1KA 4J4KA 1CXFA 4EPBC 1A50A 4J3UA 3VDBA 3MTWA 2QGYA 3EX1A 1IIGA 3ISIX 3DFSA 1ZHAA 4IGSA 1BWVA 3OLDA 4MYAA 2J7DA 1HX0A 3W1XA 2PLCA 4W8AA 4XKMA 4JEQA 2ZZ2A 3W2LA 4M51A 4FXSA 4C60A 3L23A 1GYNA 4LSBA 2GQ3A 5BMWA 4ICNA 4JL2A 5D9MA 3PZTA 3CWOX 4AIUA 1Y5VA 1BVNP 2GJPA 3BW2A 3S47A 4CKQA 3E5PA 4LFYA 4PZVA 3WLPA 3GLCA 1NARA 1PCWA 2QHAA 1DPMA 5IDIA 1NEYA 2G3IA 3CV6A 3R13A 2XG9A 1TV5A 1JUBA 3IV8A 4IG2B 1YADA 1RCXB 4R5EA 1Q8JA 4O1FA 4NIRA 3SY5A 3GXDA 3OTRA 1KLYA 1GPFA 4W89A 3L0GA 3GS6A 4Q4QA 3LRMA 3B0YA 5BRPA 3GC2A 5A6AA 4GUIA 1SYTA 3AOFA 1GVQA 1GQIA 2Z6JA 4LUSB 2W91A 3TLLA 3IJIA 3BLIA 2IKIA 2FIQA 3OHIA 3A6OA 3MA8A 1FWTA 5C6MA 2OXNA 1VYPX 3GTXA 3KTSA 1MUCA 5J5RA 1E9ZB 3P80A 2VZSA 2VZTA 1NM9A 2O9PA 2WJDA 3CZJA 4NG3A 2WANA 3B0PA 1M53A 1VHCA 3AQUA 1D9EA 3AU2A 3TA6A 3MZ2A 4ZFCA 3VI2A 1MUMA 2A7RA 1KV5A 2RDWA 1UWRA 1AQHA 1RK5A 2F6UA 2V2DA 3QPEA 3G3DA 1KXVA 2WSRA 5DY2A 2YOCA 2DH3A 4UTUA 3PJWA 1V3IA 1OCBA 2BXVA 1W9VA 3TTYA 4WJ8A 4RK8A 4O18A 4OBTA 4GQQA 1ITQA 2Y7DA 3W6LA 1Q66A 3GYEA 1UD4A 4D71A 3EXSA 3V75A 3OLGA 2ZCGA 4ZB2A 3GIYA 4QLKA 2YSWA 4NX0A 3UZYA 3QR3A 4Z2JA 5FSDC 4BA0A 4HA3A 5FJIA 3MVIA 3O6CA 1JPKA 3PZIA 4IFKA 3NL5A 3CYJA 3KLKA 3U7VA 2FZNA 4Z0JA 2OKOA 5TBOA 1S46A 4M24A 1AODA 3B8VA 1Q6CA 3IVSA 2PU0A 3R58A 1Q2SA 2QDGA 1D2KA 1PIGA 1GGOA 4HYWA 1NWSA 3AIRA 3LCHA 5DCDA 3RAOA 4E8GA 5CPMA 4B9YA 4PBEA 1RVGA 1IF2A 2EPHA 2PDNA 3AYTA 3H24A 3RDKA 1QWGA 3HQOA 1Z41A 4GK8A 4QEEA 1J9YA 4CN1A 3RMJA 1OF6A 3C52A 3G3MA 3AXHA 4Q3MA 1PX8A 1SW3A 4M6VA 1O60A 2V82A 4HNCA 4X61A 3U48A 1VYRA 4N6EA 3OU8A 1DJNA 1B90A 4PL2A 2BSLA 2WXDM 1WXZA 1EJWC 3VDCA 4CD6A 1CI1A 4PODA 4H01A 4MPQA 2RAGA 2V6AA 1FH9A 5M3WA 3BW4A 3CUHA 3TFCA 1PTDA 1QNQA 3G2GA 4BI7A 3GHRA 4R7JA 4I5UA 5HJLA 3H23A 3W25A 3B0UX 4YCPA 4F9JA 3ZXWA 4KH2A 2YIHA 5I06A 1UJQA 1JCYA 2E8ZA 2A6NA 2FPVA 1JZ2A 1E6QM 3LCLA 3CT7A 4XIMA 1JL8A 7TIMA 3GB6A 3QGAC 2NXHA 4GKLA 4X9SA 3NQEA 5JXQA 3P61A 2XJ7A 4RE3A 3L0KA 1SSDA 4ASTA 2XYLA 1UD6A 4AHOA 3VVGA 3GXNA 2ZX9A 2NV9A 4AHQA 1J2BA 3VKKA 3W2MA 1SFTA 3T7VA 3TC3A 1XX1A 4GYPC 1UQYA 2A0NA 2G97A 1HJXA 2QCNA 1TUXA 4F0LA 3CZ8A 5B7ZA 2TODA 3HIJA 3NPVA 3OZPA 4MJMA 3AS1A 1YPXA 4EP8C 2AMGA 3NGFA 4BEQA 3NZGA 5I3HA 2FZBA 3DFNA 2OFJA 4BCEA 1V77A 4GYKA 4GH1A 4LC8A 1MNZA 4IJRA 3OODA 1XYZA 1JIBA 4JGDA 3E0WA 2DZAA 4HP5A 3VKCA 4BQ4A 2BX7A 3VPLA 3WD2A 1V4YA 2R1KA 2ZBTA 4UBPC 2G5WA 2EG6A 1J0HA 3M1ZA 1QO2A 1ZU8A 2WC4A 4OOUA 4H9UA 5AVHA 5JH1A 4NF7A 4ALDA 2OVLA 1TR9A 1ZZMA 3LHTA 2VC5A 4GI4A 4GVHA 1QO5A 2QXWA 1OX6A 3QFEA 3BLDA 3LN3A 4OGZA 3GNOA 4AXNA 4KT2A 4XTDA 2JFEX 5M2FX 5HWNA 1W9BM 4OT7A 3PZGA 1KR1A 2R91A 2DT3A 2C8NA 1YDNA 4K36A 1VB9A 3LHYA 4XAFA 3W7OA 3WDHA 3AJXA 4HNLA 1EHAA 4A8NA 2WOQA 3TJ4A 4Y9MA 4RUBA 4BKNA 3RLUA 1QFEA 4TV6A 2OELA 3LCXA 3I68A 1WE5A 3T07A 2DSZA 2P10A 3BK0A 1US2A 4DJFA 5D03A 3LPOA 2XZ9A 5BWAA 4DJFD 2NT1A 1TVNA 3RR1A 3RJYA 3EBVA 4A6GA 4ICMA 3LZ3A 2XGBA 1DWIM 4ACYA 5D9OA 5HDRA 1V6TA 3QEZA 3SN1A 3ZLGA 4XZWA 3OG3A 4XTIA 1FY6A 4PRRA 1UC4A 2QCLA 4Q8MA 1UKSA 1AFSA 4OTKA 1XH0A 1XSJA 4TMBA 1W3KA 3SCQA 4MZYA 3DI0A 5A6BD 2PLJA 3FN9A 4QS5A 4CNPA 2D22A 2PGRA 3GDMA 7TAAA 3D5HA 3KVMA 2VZVA 3OPSA 2OSXA 3T9PA 1XISA 2GJXA 2EBNA 1V0MA 3W7KA 3BSMA 4FLRA 3P93A 4JTTA 1A4LA 5EU9A 4L6HA 4YYFA 1T7LA 4MZ8A 1E0VA 1J11A 3IJ8A 2Z4GA 1PKYA 2OT0A 1SFLA 1VBRA 3TTEA 3S2NA 2ZYFA 3DC0A 2A5HA 3KBWA 1J0IA 3EB3A 3ITVA 3NOEA 4B16A 3S5NA 2GUBA 3AMDA 1VPXA 4QHRA 1HL9A 3USBA 2WHKA 2XFRA 1ZQ5A 3SQMA 3GC4A 3AHZA 3Q58A 4N7QA 4CEUC 4AWEA 1C7SA 4HK6A 1AG1O 1WDRA 1LROA 2HQAA 3INPA 5DRIA 3RNDA 3CIXA 2X7VA 1MW1A 1S3TC 1UR3M 2QIWA 4PUEA 3PVFA 4ECLA 2VEFA 1TJ1A 1PE1A 3BWWA 1N55A 4IMAA 4NILA 1H4PA 4FX6M 2QV5A 4A2SA 4HK7A 1G9HA 3YPIA 1K4HA 3B9AA 1SO6A 2CITA 4UFKA 4JXCA 1JPDX 3HG3A 3GVVA 4JBRA 3MB9A 3WUGA 4O16A 4DYEA 4LT9A 2I7GA 3QV6A 1XLDA 3LU2A 2DSUA 5DT5A 5LA1A 1Q6OA 4IMFA 5CSYA 3ARVA 2DIEA 1YE4A 4NHVA 2X16A 2J47A 1BYAA 4F3HA 1YQ2A 2JK2A 2VFHA 3L9CA 2VMFA 3ZSSA 3ONCA 1DJIA 3ALFA 3NXLA 3SY1A 3VCRA 3L4VA 2GJRA 1W1TA 2E6YA 4CCZA 5DCBA 2AOSA 3VD7A 3W24A 4XZIA 1J96A 3VNDA 1K1DA 1H1YA 2A21A 3A3WA 1CDGA 2VO5A 4AVOA 4WUIA 2HK1A 1B3VA 3GO2A 3EPOA 3BMXA 4QE1A 4ML4A 5EMYA 5TNVA 1UKOA 4EPEC 4F0RA 3GZAA 4XD3A 3ZSTA 4R9OA 4IQEA 3ITGA 1BG4A 1QW7A 2GDUA 3BH4A 3GYCA 3NSNA 3RYSA 3N11A 3LD5A 3LBCA 2PWHA 2EEXA 3W26A 3GBDA 2O92A 4HMDA 1V0LA 5AC5A 2CKRA 1Q6GA 2WPGA 2D2HA 3WUFA 4KGLA 4B90A 1L9WA 3H7UA 2WW5A 3KP0A 1GORA 4R33A 5LNSA 1N8IA 3MI2A 3OVGA 4D6JA 1NDYA 1J0JA 3GWQA 3U2CA 3WH9A 2PBOA 1Q6QA 4DF0A 4IUGA 4LUIA 4X2RA 4Q33A 4GOAA 4M81A 3ORWA 3UCCA 3BCJA 3B0XA 4EX4A 3KLLA 1XSIA 2QGHA 4I7VA 5LZLA 1UP2A 1OM0A 1P5BA 2MUCA 4LVAA 4JTKA 2A79A 1LOLA 1OHLA 2VC7A 3H2FA 1UWTA 3LRLA 5KZMA 1BYBA 1E70M 1RQHA 1W32A 1Q7MA 2V9DA 1DWJM 2XSBA 1L0PA 2W27A 2IPFA 4QROA 1FWAC 5I09A 2EJ1A 1HNYA 5KETA 1ZB5A 3C2OA 4H9YA 3SZ8A 4RXGA 4QNWA 1HIZA 5DANA 3L5MA 3GTFA 8TIMA 1QPKA 4WDUA 3CM4A 1IXPA 3MS8A 3L4WA 4HNVA 4PE8A 1JYXA 4Z2HA 5BOEA 1OGSA 5FEXA 1RK6A 3PBVA 3IIZA 1RZMA 1HJSA 2YXGA 4RNFA 4C6NA 3Q45A 2TSYA 3B9NA 4UUIA 5U4NA 1PZ1A 2QJJA 1QPOA 2DT1A 5HMDA 4MB4A 1A3HA 4ZENA 1TKKA 3L67A 1I2NA 1EWDA 1GNXA 3WLRA 3IGHX 2HEJA 4H7VA 2G0WA 4GX9A 3TEVA 3SGGA 4TUFA 1YNQA 1WV2A 4O0ZA 3N4AA 4FMVA 4QJ3B 4AZ7A 3A12A 3WK1A 1LG1A 4NQ1A 1ZCOA 4JN7A 1Q6FA 2GWNA 5E0KA 2A7NA 1ISXA 1KR0A 2FHCA 1B31A 4QQ3A 4ZQPA 2VURA 1LJYA 3C5QA 1W17A 2ACRA 2WWDA 3SRDA 5FF7A 4NU7A 3GG8A 3SM0A 3GNNA 2J6XA 3W7PA 1BD0A 3F4CA 2QPUA 1LL6A 2YB1A 1Z69A 1EUAA 3B4YA 3CJPA 2ZZ1A 3BICA 3K1GA 4B5UA 4UTTA 3OA3A 3ITCA 1F3TA 4LY8A 1CNVA 4XBSA 4JQ3A 4KFNA 4CCDA 2OLAA 5C9RA 3FSUA 1EUNA 4NZ1A 4ZQRA 5AYBA 3M07A 4ERIA 4GFSA 4KCTA 1EPXA 3B8TA 2QUNA 1UZ1A 4K8HA 1OFQA 3POCA 4J7RA 2TMDA 3NQGA 3V1PA 2VX5A 4Z1BA 1BYCA 1E0TA 4TO8A 3ZWTA 3S2JA 2CLMA 3EB4A 3ZQ9A 2EAWA 3T0DA 1EL3A 3CLMA 1TPDA 4B5SA 2WAGA 3FNDA 2V3GA 1WOBA 4JIIX 3C2EA 3M5VA 5MKGA 4JYFA 1LYXA 2YDQA 3GD6A 1NELA 2LLEA 4IH3A 3ALGA 1GJWA 3S2CA 3IGSA 3ZVHA 4E4UA 4O14A 2WK2A 1U1HA 5EFFA 4GRSA 5A69A 4AMAA 1JDCA 3P7YA 4C5YA 4DWSB 4YHGA 1HJWA 4Z1DA 3AIVA 1S5NA 4DO5A 3M16A 1SR0A 3PK7A 1MNSA 4YU1A 1HF6A 1RLCL 3VGDA 3MANA 5BOOA 1VFUA 1W1ZA 1VP5A 5I3KA 1BAGA 4FB7A 1IR2A 3CIVA 3URAA 3MZNA 4CN6A 1J6PA 2BOGX 2WKJA 3UA4A 3SO7A 2FPYA 5LA2A 3ERPA 2PDUA 1QK2A 3THQA 1W3TA 4GD0A 5FJRA 2V5DA 3HBLA 3T8QA 1LP6A 2GSJA 3G0UA 2W62A 4FLQA 3B0VC 1WKDA 1GOOA 1EYEA 5KZEA 1MW3A 1GOXA 1EP2A 4O12A 3VXGA 3WN6A 1I75A 4UCFA 4DJEA 2X8RA 5I2UA 4MJ2A 4XKYA 3F1QA 3QC3A 3KXQA 5BOFA 1VIWA 2VEPA 3N9SA 4HJWA 2J79A 2Q02A 5FESA 1W8GA 4OOZA 5A5WA 2F6KA 5AZ0A 1I2PA 4CGTA 3WUEA 2C0HA 2V5BA 4L9YA 4QAIA 3C56A 3EOLA 1CXKA 3HFTA 4GJ1A 5LIYX 2RJHA 5XIAA 2VJXA 1KFEA 4IM4A 2V2CA 4B3KA 1IT0A 1GZGA 1JYWA 3W85A 1UP0A 2VX6A 4PB3A 4QSFA 1W6TA 1C29A 1SO5A 2W5FA 4X0NA 3RF9A 3GUWA 1TTIA 5HNTA 4DN1A 4PMJA 2HROA 3UETA 4HBKA 1DORA 3DZ1A 1P7TA 4KQNA 4J3TA 3N34A 3GTNA 4XAPA 4IMDA 4TXEA 4WVXA 3RMEA 1EGZA 1EJ7L 4PBFA 1BQGA 2HRWA 3IRSA 3LG3A 5CC3A 4B5NA 2DGAA 4NL1A 2OWCA 3BANA 3HQPA 3L12A 3UCQA 1S39A 5T9BG 4IFOA 1BF6A 3KBJA 5C9WA 4NJHA 8RUCA 1VEPA 5A6MA 3AROA 2BNJA 3FHQA 5HOSA 5G4WA 5JIPA 3H55A 1KFWA 1QU4A 3OLIA 5CXPA 1F73A 3CL8A 4GINA 3ZZ1A 4JQAA 2P0IA 2YX0A 4GG9A 3CQ0A 4JIQA 1S38A 2ISFA 2V5LA 3N9KA 1J4EA 4H1ZA 4LOCA 5JU6A 3AHYA 3TN3A 2O9RA 4FAMA 4KEUA 1I2RA 3JS3A 3UJRA 4R9XA 4D6EA 4LV4A 2WHLA 1ZUAX 1JAKA 4JQ4A 2Z7KA 4L80A 3GHSA 4ICCX 3W27A 1DJWA 3F5KA 3VYLA 3EPMA 1WOAA 1W1VA 3A24A 3LZ5A 4I7UA 3GK0A 3SCNA 4FIQA 4H9XA 5HATA 2G3NA 1SPQA 1JZ7A 1EJTC 4EOUA 1XFBA 3LA4A 4JYDA 3ZT7A 4U3CA 4LCSA 3G1FA 3M7WA 4HGXA 3FJ6A 5T8GA 2XHYA 4A3RA 3G1RA 3IJ9A 4DWSA 4JX4A 5F2MA 2OR2A 1EJSC 5CAHA 3W2UA 1E1EA 4QS6A 4DYKA 1CGYA 4J5NA 1FWIC 3ZJ6A 3C0JA 4GXWA 1W1YA 2ZVRA 2G3JA 4B2DD 2WNQA 3DFQA 1U2YA 4R85A 3PUEA 3II1A 4S38A 2REQA 3MWAA 3EDJA 1WBHA 2R24A 3HOJA 2YLAA 4Y96A 1BXCA 1WDDA 4W9TA 2XM1A 2WCAA 3KUMA 3S9IA 2OLSA 1OD8A 4K39A 3F4VA 3WZ0E 5KMYA 1HL8A 2E4TA 2Y5EA 4QQUA 4PL1A 4Z1YA 2QMJA 3RN6A 3ZFHA 2Y5SA 2YYTA 1P6CA 1KTNA 3OGVA 1UR0A 2QJMA 1YNPA 4W8LA 1FRBA 1AW5A 1V08A 1CLXA 4OE7A 4CU6A 3M7SA 5A2CA 4K6AA 1A5BA 3I7SA 1YX1A 1O95A 4LY4A 4O19A 3ABRA 2PC4A 1L2QA 5J8LA 4S2CA 1WKEA 1TPUA 4CCCA 1XSKA 4Q8VA 3A3HA 2BXZA 1S2AA 3RO8A 3KAOA 4E6MA 1X97A 1JF6A 1A53A 1XGZA 1OCQA 4RNHA 5C9XA 1L6GA 2ZRXA 1V93A 1GK8A 1LORA 3ZWSA 1XBVA 1HKVA 1XJBA 3OEXA 1J10A 1P0NA 3PR2A 2XVKA 2DZBA 1ENUA 3M0YA 3AZTA 3UG3A 2EG8A 3TONA 4XZHA 4JTDA 2Q8LA 1FA2A 4KWUA 3U57A 4PCTA 3P81A 1OCJA 6A3HA 1DE6A 1KM2A 3TR9A 2CZ5A 3WQFA 2QLYA 3LM7A 1I8JA 4UQCA 3HJEA 1EIBA 2YKKA 3P8IA 3ZLFA 1F3EA 1JEZA 3UZXA 1EA9C 1W1A1 2JEQA 3EWCA 1DIDA 1L8NA 1GONA 2XU2A 3W7RA 1V7AA 1JJKA 3LSBA 1R7AA 2F84A 1JYNA 4AEFA 3JRKA 1FUYA 3LHVA 3NQ8A 4LTSA 4Y9NA 2YW3A 3CU2A 3SB0A 1FHUA 1H1ZA 4KCVA 4PCPA 3SCUA 2WSYA 3QBUA 5A2AA 1AQMA 1NFGA 2QF8A 1DXFA 4KW2A 3U7BA 1D8WA 2WCSA 4P7QA 3PAOA 3MP5A 1KQYA 1QBAA 3VMNA 1IXNA 5C7VA 3DYPA 3BPWA 3M0HA 4HPGA 3TYUA 9XIAA 3HPZA 3QOKA 3NTYA 2I16A 3USZA 5LKYA 5TAOA 1MQRA 1S5TA 2RDXA 2DW6A 2DPEA 1WDQA 4U3AA 4W5ZA 3GVRA 5AVNA 3G5EA 1Q3NA 3MUCA 3OGSA 3PTMA 4KFOA 5AHNA 1P43A 1HO4A 4CUCA 3BG5A 4GUHA 3CPUA 1CX9A 2RKXA 4JKKA 3TR2A 4UWMA 4RE4A 4ZSTA 4V27A 1JXKA 1BGAA 4B91A 4GISA 4R7WA 4F48A 4RKAA 4JHOA 1NWUA 3TJXA 5LXEA 1XI3A 1H7PA 5HANA 4FF7A 4I3GA 3VIMA 4RLIA 1LQAA 4NAFB 2GK1A 3OA5A 2CXEA 4LUJA 1TRDA 1QPRA 1TUFA 2WHJA 1TPVA 2B7NA 1KFCA 1OFEA 2DIJA 4WLCA 4CQDA 4LAKA 5CBBA 1QVBA 3NCOA 3HQNA 2VDGA 4C7GA 1T6MA 1LQ2A 1JCXA 3QOMA 4H4IA 3WK2A 5LYRA 2CBUA 2JF7A 1OT1A 2QJIA 4PTVA 4ZL1A 3HURA 1AJ0A 4GNKB 3QY6A 3V18A 2C6QA 3CUGA 3C0SA 3V5FA 1R2SA 1M6JA 2A3LA 1A5OC 4DZ5A 2Z1XA 1L6YA 1N2VA 1WXJA 2IPGA 3KWSA 3ZLHA 2XZ7A 5CPTA 3EXRA 1PCKA 1LF1A 4BI5A 5REQB 1RY0A 1Z8AA 2WC3A 3ARYA 3NDOA 4J3WA 1UKTA 4DLMA 2JALA 3AYSA 4K68A 4E2BA 3CWNA 1E55A 1GQNA 5K7JA 5DXYA 1H0GA 4MADA 2W9MA 4IPIA 1BVZA 3LY0A 4Z08A 4DIAA 3N14A 4MAZA 3NQ7A 1XXXA 3EWZA 2OEJA 1Q65A 3O15A 3TC6A 1GVFA 4PTMA 3AZSA 3W3OA 4UTHA 3MUY1 3MSYA 1HGYA 3C2RA 4TVDA 3SEPA 1XRFA 2ABBA 2INZA 2WMFA 1TWDA 3EB2A 1WO2A 2IPWA 1XBYA 2PS2A 3TROA 4LVFA 4KCWA 4UB9A 1VFOA 3KOZA 7PTDA 1Q4NX 4MY9A 1QHPA 1JGIA 1PXGA 4MB1A 4RXFA 1UIPA 3IS4A 3WQWA 3N13A 3QKEA 3ABSA 4Z17A 2OMAA 3RLVA 1R38A 3M0LA 6XIMA 1Z89A 3CZKA 4JNMA 1UH2A 1IHIA 1E9IA 3O63A 2E9BA 1GKPA 3VZYA 3MT1A 4IQJA 1J79A 3P2VA 3VA8A 2R6OA 3IK2A 1K7FA 1RP8A 3BLKA 1OT2A 3WQOA 3GH7A 2CLEA 5LIWX 1CTNA 4XQ6A 3W7CA 3AS0A 4FNPA 4NI8A 4AZGA 3SADA 3BZGA 4ZBCA 2QCMA 4J3ZA 4JQ1A 1XD1A 3N2OA 3W72A 2OYLA 3UYCA 1ISZA 1IEWA 3CQHA 2A1YA 3G8EA 4IP4A 3ANUA 3GKFA 2P3ZA 2E1DA 2TPSA 1ZBKA 3W6MA 2GQAA 1TJ0A 1HKWA 1FH7A 1T99A 3IJLA 2BHZA 1P0KA 1V8EA 1I60A 4A35A 1ZALA 2CFFA 1DOSA 4I7WA 1AMYA 2QF7A 5BZAA 1MI3A 3U6WA 2VGGA 1XYFA 3L2MA 3VNJA 5FEPA 3LB0A 5AC6A 1OFAA 1QXLA 2RDUA 3LXAA 1XCFA 5H1WA 5JBEA 1R3WA 2CZDA 1W31A 3M5YA 2WMKA 2ADAA 2D2OA 3SIZA 2XN1A 1DJHA 2WNWA 5CBIA 1X7IA 3OVPA 4H9ZA 4Q6XA 4UTFA 1R85A 3GNPA 2WSKA 1LTDA 3QM3A 4S3CA 3FA3A 4IP5A 3G1DA 5CGQA 2HMCA 4EXBA 3ITTA 2Y89A 1OEPA 2Z1WA 3VIHA 2UWFA 1RCQA 5K9CA 1E73M 3BAYA 3RM8A 3IVTA 3FEMA 1XKJA 2PSNA 4H00A 1UKPA 2IMRA 3LENA 1E4IA 3WLTA 3SCPA 3M44A 5D30A 2OX4A 1QJWA 5DBUA 3N25A 2NX3A 4OHQA 2ZUVA 4DLFA 4GBUA 3P67A 5HNNA 2PRLA 1ZPTA 1IWPA 4L5ZA 1X8CA 4N2YA 2CLLA 3VILA 3JZEA 4C65A 1TCMA 2OYMA 4Q8OA 3M0ZA 3G6MA 2CHOA 3CZEA 1RJRA 1RUSA 3STCA 3P8JA 4WJEA 2X0HA 2ZFAA 2V5KA 4WDTA 5LIXX 2ZKMX 4M6QA 3N19B 4L9ZA 3WQ4A 1KBJA 4NNBA 2AL2A 2NLIA 3RG6A 1RHCA 3SQSA 1U1JA 5D02A 1QNOA 4NZ3A 1KFBA 1WP6A 2VRJA 5HBFA 2W66A 3TWAA 4O8RA 3LMZA 2POZA 2VX7A 3GRIA 3BMWA 4MUPA 3OG2A 4YJ5A 3UWVA 5A8MA 4FOUA 2D3NA 4V28A 4FNTA 4TVUA 4GYPA 2OQHA 1PV8A 4ZTYA 2V69A 1PWLA 2W92A 3M0MA 3DKJA 3QRHA 4XZ9A 1KBBA 2DQWA 1JNEA 3C86A 3GG1A 3VNKA 4L61A 1A5LC 4BEUA 2XIMA 4MWAA 1F7BA 5ENLA 3HO8A 1GCYA 4YYCA 1EB3A 3W81A 1MEIA 3T8LA 1O5RA 1PKNA 3WBYA 3IIPA 4LNCA 4Q4OA 1A80A 4J3SA 2Y7GA 3D0CA 4A22A 3RU8X 1F74A 4W7UA 5JMUA 3BLEA 3FAXA 1JD9A 1AW1A 1Z42A 1PTAA 4IPPA 4GXMA 1KXTA 1PEZA 1F6KA 1GOWA 2DEPA 1AH0A 4B4HA 2BY2A 4ZE4A 3WD0A 1J8VA 4QIUA 3S1XA 2Q3OA 3L2LA 2GGEA 2PWVA 2ZRYA 3RGTA 1TO3A 1LRNA 3W1NA 3VOIA 3LERA 3REQA 3NQBA 3W1LA 3VD4A 1Q7ZA 2BP1A 2HTMA 1JPIA 4PTDA 1K9DA 4IPJA 1EOKA 4P7OA 3LGEA 1B5TA 1CGVA 1RSCA 2KAUC 4HCDA 2NQ5A 3RPMA 4J28A 1ADSA 2Y6ZA 2VRQA 1G7UA 5TQLA 1JI1A 1AL7A 4U2ZA 2Y7EA 2QPSA 3F5JA 3NPUA 3D3AA 4QDPA 3WNOA 1ICPA 1GEHA 1OG6A 2GUYA 4DF1A 3S5SA 2YBVA 1AJZA 2CLHA 3IJ7A 3CXOA 5CLTA 3APGA 4JX6A 3CQKA 4XZBA 4DO4A 5A8QA 4R34A 2YA2A 2F7FA 3E74A 4LBSA 3LNPA 1ZCCA 1LL7A 4FLOA 3G1HA 2ZDRA 1LWIA 2ATSA 1XLLA 4PA8A 4EE9A 3SDOA 3H21A 3M0XA 3W86A 4K7YA 4YTQA 4QLLA 4ACZA 3N3MA 2NV2A 5CPSA 2EF9A 1XG4A 1RXOB 2Q8ZA 4HNNA 5EPDA 3MVTA 4RW3A 3BC9A 4Q8UA 3WSUA 3WNLA 1J93A 4CN4A 2PDHA 5DY3A 2VM8A 1V79A 3N6HA 2HV5A 1OD0A 3T2OA 4DWSC 3QLLA 4LEQA 2PU1A 1KRMA 3CAKA 4UQAA 4UOJA 2I5QA 1Q6DA 4FALA 5AC8A 4X60A 1L8PA 1Q7QA 4M7TA 4JICA 3RXZA 4U2YA 4ZFMA 5E1QA 5K4XA 4HZ6A 3U0HA 1FCUA 8CGTA 2J24A 5A8GA 3WEZA 4H7CA 3O1NA 3R2GA 3I3DA 1WKYA 4H04A 4RDYA 4F2BA 2HK0A 1QDSA 3MKKA 2GVJA 3VKAA 1KD0A 1MRAA 3L68A 4M7SA 3VGFA 3AIEA 3NFUA 1NSJA 2NT0A 3A23A 4GUJA 1GYLA 1O5KA 3UNTA 4CNUA 3AMGA 2DZWA 1RLDA 3EEZA 4IICA 2OGJA 1UWQA 2E09A 5KSWA 4L64A 4C6OA 3FK4A 4DX3A 3NQAA 1ADDA 3E1F1 1FCBA 1ZJBA 1DKWA 4KWSA 4U5IA 2X1IA 4HZ8A 3WBXA 5HJXA 3N17A 3NWRA 4LQ1A 3CC1A 4O53A 5D9NA 4UQEA 4NNCA 4CD8A 2BDQA 1EXPA 2P76A 4WF7A 3GR7A 2PMQA 3UVIA 4JTIA 5D32A 4YHEA 3B97A 2GGIA 5GJNA 2XIQA 3T4CA 3DECA 5JBFA 1UR1A 3HGRA 2VWSA 1H2JA 1SUXA 3WJZA 2XIBA 3RRXA 3EYPA 1FDYA 1B4KA 3D3FA 2P50A 5CPQA 1J0ZA 3GAKA 3QJAA 2OCZA 4GBDA 2PE4A 5HNRA 2NQZA 3RM9A 2BVDA 2Z28A 4GCXA 3CMJA 3UBPC 4U33A 3OIHA 5HUOA 8XIAA 1F6PA 5A3HA 2J62A 4CU7A 4ORMA 3U8GA 3UR7A 1C90A 1UPMB 3CZLA 1X1OA 4AZ6A 2WBGA 3WEOA 3VKJA 3QSRA 6REQB 4EKJA 1KA9F 5JIWA 1Q85A 4ERAA 3GVQA 2RFGA 5REQA 2E8YA 1SQ7A 4D72A 2DUXA 2E67A 4CVUA 3EWUA 1JGMA 1N8FA 3PNUA 1GQJA 4NVTA 1MZRA 3R94A 1K8XA 2B7QA 3O6AA 1I6NA 2ZRUA 1UR2A 4KCUA 3LK6A 4LB4A 2NX1A 1VBUA 2DQXA 1LRQA 4ZE5A 1UD3A 2ZUWA 3UT0A 4P8WA 1EJVC 1GEQA 2I9UA 1BVWA 1X8FA 4MOZA 1D3CA 4H8HA 4FO4A 4BI6A 3S1WA 2P8BA 2V63A 3ITOA 2YB4A 2OTDA 4H6RA 1X6NA 4OV9A 4X3ZA 2X1UA 4AUBA 3VMPA 1TWWA 2D0HA 3WLKX 3DH7A 4DWSD 3FLUA 4HPXA 1EQPA 4E2VA 1GVEA 3FJNA 5BXTA 2OZ3A 1Z6KA 4PMQA 3ARQA 3U2ZA 5G2HA 2ZWZA 1M3UA 4RJEA 3DENA 2HISA 1PJ9A 1JF5A 1R6WA 3QGKC 1P7TB 1M68A 1ZS2A 1ZY9A 3OGRA 3W7MA 3MYOA 3A3XA 1IIHA 2JKAA 2HE5A 3T0CA 1TJRA 3EWWA 4W7VA 1XF0A 4F0HA 1E1CA 1Q6RA 3SY8A 1FXPA 2Z27A 4GGHA 4HKPA 1VHNA 1E1FA 3PB2A 4ERGA 2FGLA 2J78A 1E4LA 3ZT6A 2ZADA 4XBKA 3V4BA 5C7HA 5DMYA 2FMOA 4NASA 3TZFA 3E02A 3E0VA 3UG4A 3OBAA 1UD5A 4C90A 3S83A 3N18A 1AJ2A 1XYMA 3OVQA 4M5PA 2QCCA 2QZRA 3AO0A 2ZX7A 3MSDA 2XH0A 1JVNA 4C1NB 3VD3A 3QXBA 1UR8A 2E6DA 1FWRA 3DDMA 2CBJA 2XH4A 3K4AA 4LRTA 2BZNA 2GGHA 3UERA 3W7JA 3CHCA 4KF1A 2J8TA 2QMKA 4AB4A 2W67A 3R0DA 3AALA 3J7HA 3FX4A 3VU2A 1TVLA 1EA0A 2DVUA 1K8CA 1XIHA 3DU0A 3FSTA 1W54A 3G1VA 2JKPA 3TDFA 4M6PA 2PDJA 4PUUA 1JQVA 3ANVA 3BJFA 1XIJA 3BGGA 2ISWA 1AQFA 2UBPC 2JGYA 5CC6A 4LAOA 3MP4A 3W7DA 4D6FA 3TMLA 5H2ZA 5IFPA 1NQ6A 1TVPA 2CCRA 5ABEA 3CAVA 2ICSA 4W85A 1E4NA 3TCEA 3PS7A 1B0IA 4NZ4A 5CQ1A 4QCEA 4IGNA 4QSHA 1B9BA 1TZZA 4CQCA 1LWHA 5AYZA 2VTFA 3EXTA 4D1JA 1XC6A 2NXIA 3M41A 4PMOA 5I03A 4ZQCA 2I5IA 1JULA 3VOGA 1W5MA 4J3VA 3DEQA 5KZDA 2Z2BA 3TYZA 1I2OA 2ZX8A 3HPAA 2E6FA 4UTTC 1IZKA 1ALDA 1YPIA 4IIHA 3SQLA 1S2TA 2A4AA 4NAEA 4MSSA 3W29A 4MNJA 4D6DA 1HO1A 3UXDA 3KRBA 1XLFA 4C1NA 4H83A 1ZBCA 2JKEA 1CIUA 4C1KA 4RE2A 4JY8A 4FA3A 3DG3A 4LJ3A 3UU0A 2FGBA 3QYQA 4GZIA 1PYMA 4H8UA 3NQMA 2J6VA 2PDPA 3MV11 4GACA 3UGVA 4XSMA 4UQ9A 2ZUNA 3E96A 3KS5A 1ZBVA 1E0XA 3MQTA 3NL3A 3BDKA 4LPCA 4IJBA 1TJ2A 5BWFA 1J0YA 4L4MA 3BOFA 3KOXA 4M8UA 3GTHA 1OVDA 3BAJA 3MMDA 1KRAC 4MJZA 2GGGA 1HGWA 1GT8A 1VFMA 3BLPX 2WC7A 2INEA 1U5VA 1FH8A 4IMGA 2CW6A 1NJJA 2BMBA 2ZUUA 3FXGA 1JDEA 3KEHA 3KVKA 4GMEA 2P3EA 1POJA 1FWCC 5JQ9A 1SMDA 3FGCB 4O15A 4HOZA 1C8QA 4QE5A 5H6HA 1PIIA 1DQUA 2P8CA 5FL0A 4OECA 5CPNA 1XL9A 3BAIA 4F0SA 1W3NA 2PRHA 4WCJA 3R89A 3UWYA 2XUCA 1W1B1 2YCLB 3N3TA 3C2YA 4U28A 3VUSA 2ZIDA 4HNOA 3PPHA 4D8ZA 3UJ2A 4MFEA 1J12A 1VFFA 4JTRA 2BTMA 2ZRWA 4L4LA 2J7EA 3PPFA 4HK5A 3EDDA 5DO8A 3B9DA 1B2YA 3RPTA 1RA0A 5I3JA 4TVCA 3FKRA 3TTOA 2G41A 2XVLA 3W7NA 3LX9A 2WSPA 4F2TA 2P53A 4NI3A 1UIOA 3C0LA 3IGXA 2QR6A 8A3HA 4MB5A 3W2NA 2BBFA 1EC8A 5G1TA 1A5NC 2ZX5A 1XLGA 4YVXA 5MF5A 4MG4A 1MO0A 2ACUA 4F0KA 1OGBA 1VRXA 3NQ6A 2Y88A 4AY8A 4WKHA 4JR5A 5LNRA 3AS2A 1CXEA 3CZGA 1A0EA 1RQBA 1SGJA 4WDXA 2V3FA 1WAWA 2GSHA 3VNLA 2ON3A 3UQNA 4HYRA 1I45A 2VCBA 3CV7A 1ZGDA 3H7VA 3ITXA 4ROQA 3V3WA 2R82A 2CLKA 4TTUA 3W22A 4RL3A 3STEA 1UROA 4FEZA 4OFCA 3MHUA 5CJMA 1IEIA 3W37A 1NWTA 1OQFA 3VIOA 4LAUA 3V5OA 3SRHA 4HU3A 3M0IA 5HQLA 3N29A 1SZRA 3C4UA 4AY1A 3H7RA 3OHMB 2INFA 4C7DA 3NYZA 3N2BA 1EJXC 1TV7A 4S3KA 4L56A 3KFTA 3H4XA 1R3VA 1VJIA 4OIFA 1BFNA 3LHZA 3GC5A 1DJXA 1UW9A 1EF2A 1XPGA 2I9EA 3LOTA 3PZMA 4MWAC 5HXMA 3N2CA 3LS9A 1W8SA 1KXHA 5D4YA 1M01A 3P6LA 5B80A 1CGTA 1SO3A 3SFKA 4GC4A 3R4IA 3GXPA 3ITYA 3BO9A 2YYUA 2XGIA 1U22A 1XLEA 4OKDA 1A5SA 4QJ1A 5CC5A 4NXKA 1B3YA 4KMQA 4UTMA 7ENLA 3TCSA 1KTCA 3ANYA 3WF2A 4LUSA 1F5ZA 1QBBA 1M65A 1H11A 5FACA 1MQPA 1BEUA 3N1AA 4J27A 3SJNA 3IACA 3UXAA 2PWFA 1E5JA 3QQWA 2YFOA 4ZQMA 3VC5A 7ODCA 4DBSA 3W82A 2FFIA 1T0OA 1Q4WA 1VLIA 2YLLA 3A4XA 3PPGA 2AQOA 1HJQA 4XV0A 1TMHA 3GAYA 3WH5A 1OFBA 3ECQA 3K1DA 3C8FA 2PDKA 3SRFA 3NPWA 2W6RA 2QV4A 3LGDA 1TTPA 1GOQA 3A4JA 4X2PA 2NX9A 3W2JA 3QC0A 4MNLA 1W5PA 1BQCA 1XIBA 3GDRA 3I10A 4EANA 5A95A 3Q2DA 1XCWA 1RV8A 2GVEA 3WNMA 3WLHA 1JCNA 2HJPA 3TX9A 1B57A 3A4AA 1XM3A 4LXFA 3AIWA 4JHMA 1JYVA 1TREA 1O68A 3B8IA 4XB3A 2CPUA 4DM1A 1X6UA 4HSNA 3EWDA 2P5NA 3WCZA 5A8PA 1ZNNA 1QNRA 3CUZA 1KW1A 1J2WA 6TAAA 1DQWA 4NKCA 3UJSA 3DGRA 3UESA 1XIEA 1CLKA 4WXZA 2DZPA 1QAPA 5IHRA 1PPIA 4O4VA 1KM3A 2X0YA 4PCSA 1X6LA 1PYFA 4DM2A 4N9CA 1OFDA 2P88A 3RCMA 4XAGA 1J5SA 3CB3A 2UY4A 2O55A 4G1NA 2CIPA 4HTYA 4AHPA 1VKFA 4AEOA 5BU6A 3TYDA 3AXXA 5CBJA 3CO4A 5D38A 3CLWA 3VIPA 3AFBA 2Z7GA 3W0KA 2AQWA 4KETA 3HJZA 3LBMA 2BG5A 3SW6A 2P1FA 4LS1A 1EBHA 3BXWA 4I5RA 1THFD 3IIXA 3EWBX 5ABTA 1FWHC 1UBSA 2VI0A 2DZXA 5AHEA 3W1PA 4ENLA 1OFPA 2PEVA 4W88A 1JCJA 1H5VA 1V7YA 4UNKA 1EO5A 3VD9A 3WJSA 4EK7A 3CT2A 2QQ6A 3DAQA 1LUCB 4OVXA 1GW9A 1X1NA 3UG8A 4MYXA 1Y8BA 2Y4SA 1EDTA 4AYGA 4Z2LA 3AHVA 4GA8A 1FXQA 1FWFC 2R1PA 2VHLA 4M56A 5PTDA 4I90A 1KV8A 3PPCA 2QEZA 2DT2A 3SUVA 1W2VA 4NXSA 4YTUA 4QG9A 1ZRQA 1UKQA 1XLKA 2VOMA 2XVGA 3QZ6A 5LXXA 2ZXDA 3VGHA 2XVNA 1WPCA 3A5VA 1W1IE 2ZTJA 4Q7NA 3RR4A 3MJMA 2DDXA 4AH7A 2XH7A 4NSBA 1KCKA 1WXYA 3DBPA 3NSMA 2I57A 4GVGA 4K8EA 5FAJA 1VLWA 4IMCA 1G01A 3UNDA 5DMNA 2VENA 4AD2A 1FKXA 1UUOA 1TPWA 1O6IA 3LLXA 3GBEA 3IRDA 1TFVA 1QTWA 2Z25A 4AD0A 2CWXA 2WVVA 4DUOA 5HMFA 1IYXA 2R9RA 4XX6A 1GYMA 1LRTA 2F38A 4HU8A 4JKLA 3NEHA 3IJQA 3LTSA 1UZDA 2NV1A 5XIMA 4MUZA 1RBOB 2YZRA 4HSOA 3W7LA 1WQ5A 4Y9OA 2ZE3A 1CGUA 1ZJHA 1K9EA 4O0QA 3VZZA 1M7PA 4I8DA 1C91A 1VYSX 2OWXA 4HOXA 1R87A 1FWGC 5FKYA 2BHUA 3WF1A 3RIKA 1S2CA 4N9DA 1R0MA 2V30A 3H2MA 3CHDA 3NA8A 1YW1A 1BTMA 3KBSA 5EMUA 4B3LA 3TYCA 1A3XA 1H7WA 4O1EA 3I6EA 3WEMA 4B5XA 1XKYA 2Z26A 1EZWA 4ZZ9A 1UMLA 1TPB1 1V3JA 3HQ1A 4WRHA 3XIMA 1SFJA 3B9EA 1F76A 2C16A 3HMJG 5EY5A 3SCTA 4MZ1A 4GQGA 2PDWA 1XS2A 2OSYA 2EJAA 2NQHA 2CC0A 3MCNA 3WMBA 4AAJA 4FR6A 3MI3A 2I5GA 3A9IA 4WIWA 3QQ0A 4RZBA 1T8QA 2E5DA 1EWEA 3WIJA 2ZC8A 3TNOA 1EOMA 1W9DM 4AYSA 4XWUA 4PMDA 3NQCA 4P61A 4XK2A 3PSVA 2VELA 4UR7A 4V1XA 4RDVA 5U7SA 4O17A 1DWFM 2OOFA 2FPTA 1ZJAA 3QPYA 9CGTA 1M1BA 3VFCA 1JZ4A 3TW9A 3IARA 2WMIA 1K7XA 3N2MA 2EXOA 3BG9A 1VJSA 3NIYA 3EOOA 3W7QA 4C6PA 3NNTA 3TN6A 1JXJA 2VC6A 2J13A 1UWIA 2ZDSA 1XQKA 1OZMA 4CNTA 3BV4A 3HV9A 3VDGA 3M43A 1I0BA 1LCOA 3T78A 1EKOA 2NQ9A 1XG3A 1BXBA 4G7FA 1WA3A 4MFDA 2C13A 3FEQA 3BGAA 1FX6A 5FJTA 2V81A 3B04A 1F07A 2FVLA 2VCCA 2X0SA 3KOWA 4UC5A 3C2FA 3UCDA 1EFZA 1MQQA 4LH8A 4LYQA 4PULA 4RDZA 4LUYA 1IZJA 1KKRA 5EMJA 4O11A 2OU4A 4D6GA 3PWIA 4IPLA 1H62A 3ATZA 2VT0A 3H26A 4QG6A 3RCYA 3TH6A 5E6ZA 1KM0A 1A5UA 1O1HA 4B92A 5CH9A 7REQA 2FDSA 1BXNA 3E9AA 2CZVA 4PFMA 3SCWA 3G77A 1GHRA 3AYRA 3UG5A 1REQB 2J7GA 4JPGA 4J40A 1K9FA 5C70A 4HU4A 1V0KA 4LF1A 2WZEA 1UYQA 4G5DA 3CV2A 3W88A 4H19A 4DEFA 3LRKA 3PUOA 4F4RA 3S8HA 3SJ3A 3DHDA 2PDIA 2IKJA 1KXQA 1KGWA 1U30A 2C7FA 3A21A 1TQJA 4Y90A 1VPYA 1OYCA 4MJ4A 2EKCA 4CVWA 4V2XA 1W1PA 4N9BA 3BQ5A 4HVXA 1MW2A 3NO3A 3AWOA 4PUDA 1B1YA 5D9PA 4UR9A 4LUTB 2PAJA 2QKFA 4DBEA 3F4NA 3IANA 3E2RA 3PANA 1XINA 2WMHA 1XGDA 2OEMA 1JFXA 3BUVA 2XSXA 1EGMA 2NVCA 1IWAA 1K70A 3AIBA 4GI6A 3HGSA 2GYIA 4IT1A 1EX5A 3G1SA 1ISWA 4XISA 2QNEA 2EPMX 4YXGA 4C6DA 1OINA 1B3OA 1KCXA 3TYEA 4QG8A 3UWZA 3GZ3A 1R9XA 1TPEA 1KM5A 2CLIA 2XVPA 4CNOA 1QHZA 2YW4A 2Y0FA 3T81A 4QAWA 2G37A 4JIHA 5A1AA 3KHJA 3H4GA 4JS3A 1UR9A 3WJXA 1WB0A 6XIAA 2TYSA 3LI0A 5GPRA 4OJYA 3URNA 1JCMP 3MHGA 4PH6A 3VNYA 4G1KA 2J7BA 3I3BA 1WUEA 2H8XA 1EEPA 4FPSA 3UY8A 5DN1A 4PCFA 4YWSA 1DBTA 3O06A 2RGLA 2BASA 1XHGA 1Q5MA 3DN5A 1I0DA 2WMJA 1LM1A 1V3HA 2D2GA 4MAVA 5DEZA 3CGTA 4Q8QA 4ZOCA 2PDXA 4E5TA 3TP4A 3NM3A 1WAUA 3FIGA 2G50A 3EEGA 3WD4A 3P84A 4KS0A 1IE7C 3LNMA 3GXFA 2VR2A 4ES4A 2ZA2A 4US5A 5AY7A 4BFAA 3UR5A 4GZEA 4DJDD 3URQA 2YL8A 4NT0A 3C3UA 4RNJA 2E3ZA 4XIAA 5G1YA 1XYCA 3L5AA 2OX1A 3GNRA 3PJXA 3F03K 5HPOA 3VUPA 2FZMA 3FA5A 3O8AA 4HT3A 4NZJA 2DJLA 5EMKA 3TK7A 4P8UA 1MEWA 3AIUA 3H12A 5I3DA 1G69A 2J7HA 3SN0A 2PF0A 3L66A 1FP8A 1OADA 3CHEA 1HVXA 3MW7A 3XISA 2FVKA 2ESCA 4M6UA 1JCTA 4CQAA 3BMVA 1IXOA 3N2XA 5I79A 5E9XA 1G5AA 4GY0A 2VNCA 3H2AA 4UQDA 1QOPA 5RUBA 4D6HA 1WZAA 1UOKA 3SCRA 2VC9A 1HKJA 5EBAA 2AQVA 1G6CA 3PZUA 3UWQA 1E56A 1GG0A 2W61A 3GU1A 3KHDA 2X1TA 5A6BA 5CGMA 3O0KA 5A6KA 3V5CA 4WQ6A 3KOYA 3NQVA 4DELA 4O28A 2PA6A 1IGSA 3HB9A 3T09A 2R14A 1NFBA 2XTKA 3N04A 5HNUA 3VD5A 2EQDA 4V1YA 1DXEA 4DBWA 8XIMA 3DBNA 5BNKA 4D6CA 4HHHA 3VOHA 2J75A 1QR7A 4PCNA 1OABA 5LA0A 2WZIA 3IEBA 3O0FA 3SSJA 4FIRA 1AH3A 3OB8A 4DQWA 1ZENA 3U5UA 4AFYA 1BYDA 1K03A 3SBFA 1WZMA 4JTJA 3TTSA 3IIVA 3I6RA 4GE8A 2FDMA 2KZHA 3WYZA 5XINA 3T0BA 3KBMA 2L5HA 2WVVB 4US5D 4CQ9A 1ODZA 4PMRA 2O7SA 3DYMA 5GJPA 1N82A 2BS9A 3N15A 3AMCA 1DXIA 4V33A 1TV2A 1UJPA 1YTEA 3HZ3A