1KR1A

Hevamine mutant d125a/e127a in complex with tetra-nag
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
273
structure length
273
Chain Sequence
GGIAIYWGQNGNEGTLTQTCSTRKYSYVNIAFLNKFGNGQTPQINLAGHCNPAAGGCTIVSNGIRSCQIQGIKVMLSLGGGIGSYTLASQADAKNVADYLWNNFLGGKSSSRPLGDAVLDGIDFAIAHGSTLYWDDLARYLSAYSKQGKKVYLTAAPQCPFPDRYLGTALNTGLFDYVWVQFYNNPPCQYSSGNINNIINSWNRWTTSINAGKIFLGLPAAPEAAGSGYVPPDVLISRILPEIKKSPKYGGVMLWSKFYDDKNGYSSSILDSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expression and Characterization of Active Site Mutants of Hevamine, a Chitinase from the Rubber Tree Hevea brasiliensis.
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Hydrolase
molecule keywords Hevamine A
total genus 100
structure length 273
sequence length 273
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kr1A00
3SEPA 1GZJA 2DT3A 4W93A 3MANA 3WN6A 4J3UA 4B3KA 5C8BB 2GFTA 2GJXB 4D6EA 1PX4A 5A69A 1QBAA 2ZICA 3FHAA 7TAAA 1J0HA 2YA2A 3WBAA 3VIMA 1E1EA 2J7GA 4W8AA 2YA0A 4M8UA 1JYWA 5CZKA 4P7QA 1QNSA 3FW6A 1V0MA 4YHEA 5A8MA 2V3EA 1XSKA 3VMNA 4AD0A 3FNDA 2WMKA 1E6XM 1UG6A 5JIPA 1BQCA 1B1YA 1EQCA 3IJ8A 1UA7A 1B3WA 1KWGA 4AC1X 4V27A 3CBWA 2WMFA 3DYPA 2XYLA 2EXOA 3MSGA 1KXHA 1SR0A 5KZ6A 2GJPA 3S2CA 1JZ7A 4UQEA 1U30A 3ZT7A 1TA3A 3T2QA 4XZWA 3RJXA 5E70A 1C7TA 2NSXA 3NSNA 1JZ4A 4WLCA 5HPOA 1NOWA 1B30A 3W6MA 4MDOA 3OZOA 4P8UA 1QI0A 3GH7A 4D6DA 1CXHA 1DWIM 5JBDA 1TG7A 3PTMA 1OGGA 5LA2A 4UQ9A 1E0WA 3UCQA 1PX3A 1W3HA 2CITA 2Y24A 3OIHA 1FH9A 3VIIA 3WDHA 2GK1B 2XVPA 2D24A 1W3JA 4AIUA 2VZVA 4ZEPA 1KR0A 3VOCA 4JKMA 4UFLA 3ZR5A 2VNCA 1KXTA 2VCCA 2QV4A 2Z1KA 1JG9A 4HMCA 4P7RA 5I79A 4EE9A 1WZKA 2PF0A 3WF2A 1GW1A 2WBKA 3W82A 1LQ0A 2WB5A 2X0HA 2F8QA 4P8WA 3UERA 3BLKA 5EMYA 4PMRA 1Q6EA 4XZBA 2WAGA 4FLQA 2AOSA 2DPEA 2VC9A 3AIUA 5JBFA 3VIHA 3W37A 8CGTA 1WKYA 1ODUA 1XH2A 4JFTA 4AY1A 2XWEA 1I1XA 4V2XA 3A47A 2BVTA 1MQRA 1QHZA 3VMOA 3VX0A 1E1FA 1V0NA 3AYSA 2XIBA 5ECUA 4TTUA 2WLYA 1GOKA 4J7RA 3HJEA 1G94A 3OGSA 3WKZA 1WP6A 5IHRA 2WZIA 4C7GA 3NDZA 2E4TA 3BH4A 1QI2A 2WHJA 4LX4A 2BS9A 5A2BA 1KXQA 3AS3A 5KEZA 2WVSA 2J7BA 2PWDA 3B8SA 3CZ8A 2DH3A 3VGEA 4CCDA 2DQXA 4PTVA 4PN2A 2EJ1A 1UHVA 4U33A 3T08A 5I0DA 1XC6A 3VINA 1CZ1A 3FAXA 4WSKA 4L4OA 1HJWA 3HN3A 1LL4A 2WVVA 4FK9A 1BGGA 1UKOA 1SMAA 4GINA 3N04A 3KZSA 1Q4NX 1UYQA 2W5FA 4EK7A 4PMOA 3NUKA 3OLEA 1IZJA 1VFFA 2CBVA 1HL8A 3OA5A 2Y2WA 4FMVA 1E70M 1VAHA 5EFDA 4RE4A 2XG9A 3TONA 4PMNA 2YDQA 2VX5A 4IUGA 2VRJA 2F2HA 3EDJA 3CUIA 1JF6A 4H8VA 4BS0A 1UH2A 2WC7A 5LA1A 3LPPA 5A95A 2Q8XA 4DWSA 2D0HA 3BAIA 4AWEA 4CCCA 1CNVA 3K4DA 4U3CA 3MMWA 4S3JA 5HBFA 3AISA 1W91A 1XYZA 2J78A 2OWCA 5GNYA 3PZTA 3QHNA 4PMZA 4RL3A 1MWOA 4X9YA 1KGXA 3PZIA 5I5RA 4CN6A 1LL7A 1W1YA 4F66A 2XGIA 3POHA 1ZB5A 2ESCA 4HZ7A 1GOIA 3VGDA 1BYDA 4P7LA 2V5DA 1BPLB 5HDRA 3EDEA 2QMKA 1B3XA 1JYXA 3F4VA 3OG2A 1NWTA 3WENA 1Q6GA 3WF4A 1V02E 1ZS2A 1NOFA 1BTCA 2JEQA 2D3LA 3IK2A 1S46A 1WCGA 1YQ2A 3T0BA 1E3ZA 3KL5A 1W32A 1RP9A 2XIIA 2GJRA 4GPNA 3MMUA 1UWTA 4HZ8A 2PWEA 3VM7A 4MADA 1E72M 1C93A 5CPSA 1VBRA 4QLJA 1JI2A 3EMQA 2CYGA 1H41A 4U2ZA 6A3HA 2DSUA 4UZUA 4QDMA 1E55A 4AZCA 2CXGA 4F79A 1V0KA 3VDCA 5BXPA 1LG2A 2V5CA 3AMKA 5BXTA 1BG9A 2WVVB 2BY1A 3U7BA 2EPKX 3GZAA 3OGVA 4IPLA 3AMLA 2E0PA 1J0JA 2V38A 3EYPA 3RILA 1MW1A 4NF7A 4TX8A 1ITXA 1VJZA 3WH8A 2ZX7A 4UR9A 5FOOA 3FHQA 2O92A 4BQ4A 4IPNB 1EO7A 3BGAA 4UQAA 4OUEA 2OYKA 3AMDA 3VGBA 2ZWZA 4PYSA 2CESA 2UY4A 5A6SA 2HVMA 1EA9C 2WMGA 2GDUA 3VO0A 1DWFM 3W24A 3W53A 5AC5A 3N1AA 3ZJ7A 2CBIA 1H3GA 1W2VA 2JIWA 3ZR6A 1XHGA 4WIWA 2WVUA 1OT2A 2OLHA 3IAPA 3VIFA 3SUUA 1Q6CA 2XVNA 5A2AA 3GXDA 4CCEA 3WD0A 5BXSA 5A8NA 1PZ3A 2QLYA 1C91A 4H41A 4JFSA 3CZGA 1JD7A 3WEMA 3N13A 3ZM8A 4E8DA 4TUFA 1SFSA 4JKKA 5D9PA 3PZUA 2VRQA 1EXPA 2VZUA 3AIBA 5E0CA 1XH1A 1JYNA 3MS8A 2WMJA 1VIWA 2YLLA 3BMWA 2OWXA 3AHZA 3WUBA 4OZOA 1CTNA 1KFWA 1VB9A 2J75A 1D7FA 2VX7A 1W1PA 1XCWA 4UQBA 1UWIA 5FD0A 4F9JA 3ZJ6A 3CMJA 1AVAA 3AXIA 1M01A 3A3HA 3BAXA 5AC4A 3DYOA 5D8WA 3OZPA 4W7VA 2EQDA 1QPKA 1UKSA 2WC3A 4P7NA 4CU8A 1I1WA 3CUFA 1BVZA 5I23A 1HKJA 2OWWA 4DWSD 1JZ3A 2YDSA 4OBRA 4PMDA 4Y7EA 2WNWA 4ML4A 4D1IA 1CGUA 1EQPA 3DECA 1JF5A 4ATDA 1EO5A 2FHBA 3F5KA 2XVLA 4AZHA 2JALA 1UR0A 2J25A 2QF8A 4PMXA 1JI1A 2YKKA 1WB0A 1UWUA 2FH8A 1JZ2A 4PTWA 2G3IA 2D23A 4GKLA 2YL5A 1C92A 3WF3A 2A3AA 2ZUUA 4KGJA 1CYGA 5E0FA 2D22A 5AYIA 1B0IA 1DTUA 3VU2A 4J3WA 2ZXQA 2CKRA 2A3CA 2A3BA 1TVPA 4NSBA 5LA0A 4BQ5A 3M6DA 4TTGA 1GQJA 3U57A 3NIYA 1UWQA 4GZEA 1E43A 2XUCA 4OKDA 1JDDA 3M07A 2IXUA 4J28A 4KRTA 4MDPA 1UD5A 2ZIDA 3PN8A 4AIOA 1ISYA 4JIEA 1CENA 4HMEA 2MANA 5A6JA 2FDMA 2OSXA 1JXKA 1KCLA 1NARA 1V6XA 3VIPA 2E3ZA 4ZE4A 5A8OA 4AMCA 3WDPP 4FLRA 3T0DA 1DEDA 3MKKA 1NWRA 5I78A 4JFWA 3AICA 1BYAA 4KWUA 2UY5A 4AD1A 4LYRA 4AD2A 4M24A 1M53A 2PBGA 3RMEA 2ZE0A 4JHOA 3IANA 4QAWA 2VQTA 2Y4SA 2VOTA 3VD5A 2VR5A 1HT6A 1OD0A 4UOZA 4BCEA 1J10A 1V08A 2WW5A 3CMGA 1J18A 3VTRA 5BRPA 1K9DA 1MFVA 3WSUA 5HPCA 1NP2A 1ZJBA 1MW3A 1VENA 4MB5A 3EMZA 2QPUA 1VBUA 1UZ4A 3KE0A 5I24A 1OWQA 3WQVA 1LLOA 4Z2HA 3OLIA 3L4TA 1AQHA 5TD4A 1TA3B 1W3KA 1K6AA 3ARRA 1QW8A 3WQ8A 3VDAA 4OJYA 1JL8A 2WHKA 5CG0A 2C8NA 2WHLA 3GH5A 1UZ1A 3ARVA 3VUPA 4MTVA 3MMDA 1V6VA 3CIVA 4H8HA 2PC8A 1KQYA 2CNCA 1IV8A 1CGWA 1B31A 2VO5A 3GNRA 1C8YA 2AAAA 2J8GA 2JF6A 2J4GA 2QPSA 2WK2A 3TTOA 2XSBA 2DT0A 4H2CA 4XX6A 2X09A 3S6TA 4AEFA 1U33A 3PZ9A 1V03A 3WMBA 2IUZA 5EFFA 3WNLA 3BAWA 1HL9A 5A6BD 5ABGA 1GOMA 3T2OA 2XGBA 4GZJA 3NJ3A 3PZMA 1RD6A 4AEEA 5CSYA 2GSJA 2YL9A 4Z2GA 2CCRA 3UG4A 2BNJA 4HTYA 3QHMA 4GXPA 2YJQA 2WC4A 1EDGA 1UR4A 3RJYA 3WFLA 3WEOA 5M03A 1ESWA 3DHUA 1JFHA 2ZX8A 4B9ZA 5I2UA 4U5IA 2FH6A 5A6LA 3PHAA 4MNMA 3NYDA 4KRUA 2UY3A 3VIJA 3TTQA 1FP8A 4BQ2A 4Z2KA 3WFZA 3APGA 1H09A 1HKIA 4PUDA 4W85A 3LPGA 2ZWYA 1BF2A 2ZUVA 1BYCA 1G01A 2DT2A 4HA1A 1IT0A 3WBEA 1HP5A 2BXZA 2ZUSA 4OBSA 3WD2A 4HU8A 1HNYA 1J9YA 4ACZA 4OIFA 1KWKA 4KMQA 4E4PA 5DF0A 4D6CA 2F61A 1QI4A 2ZUTA 4ACYA 1HP4A 3F5JA 3FN9A 4PSRA 1WDPA 4ZENA 2EEXA 3KWXA 3MUAA 1D3CA 1GOQA 1R7AA 3AHVA 5D9NA 3CHDA 1BLIA 2CERA 4JHZA 2WSPA 4AISA 1QI5A 3BAJA 2DSKA 4A4AA 5CJ5A 4N42A 3WF0A 3VKKA 2WLZA 3IAQA 1BGAA 1R7OA 2VTFA 3U5UA 4K68A 4MJ4A 1H0GA 3TOPA 1HJXA 3SCSA 4W5UA 3RPMA 4C7FA 2BXYA 2FGLA 3GNOA 3SUWA 1MQPA 1XD0A 1ISZA 3W25A 3WNOA 1J01A 1LF1A 1WAWA 2RGLA 4UFKA 4F9DA 3AS1A 2Y8VA 1E56A 3WDJA 4J3TA 1X6LA 4CU6A 4JAWA 3OBAA 1XSJA 1G0CA 1CIUA 2O9OA 2OYMA 4ZE5A 1CGTA 2WCGA 1ISVA 1WZMA 3AHYA 2FGZA 1GOOA 3K8KA 2CEQA 2D20A 2XFFA 3WQWA 2EPNA 3AJ7A 2J7HA 4B16A 1MVYA 5GNZA 2ZOXA 1PEZA 1UQYA 1CLVA 2XVKA 1R87A 1G9HA 3CUJA 1GCYA 1V3JA 3CHFA 4R5EA 2E8YA 1OINA 1F4HA 1M7XA 1UA3A 4GO9A 3WNMA 1DWHM 1R85A 2XVGA 1FFQA 1GORA 2PWGA 3DYMA 3N9KA 3D3AA 1GHRA 2W61A 1VEOA 3AS0A 1JDAA 2WBGA 3OB8A 4ZFMA 2ZXAA 3PZQA 3WQ5A 1GQLA 1Y7VA 1UR8A 1EH9A 1NQ6A 1TVNA 1NP0A 1DHKA 2AMGA 3BSGA 3ARQA 2WKGA 3GXFA 4J3XA 4W7UA 4HPHA 4Q22A 4CVWA 1JIBA 2VVSA 3L2MA 5CPQA 5ABHA 1E6RA 1OD8A 3VGFA 2PBOA 3A6OA 2BY0A 3K46A 5DT5A 5C71A 1TCMA 1ZBCA 3CO4A 2GUYA 3GNPA 2ZUNA 2XWDA 5ABFA 1AMYA 1PIGA 1E3XA 4MAZA 5ABFB 4CD8A 4JFUA 4CD7A 2VZSA 4GZIA 2XM2A 4UZSA 2YBUA 3AIQA 3PZGA 1SMDA 1E4LA 2WKLA 2J47A 1HKMA 1H5VA 5A2CA 2GDVA 3EDKA 3MUZ1 2W4XA 4AD4A 3ARXA 3TA9A 3PZOA 2BVYA 3W29A 2CHNA 1UKTA 2W92A 2WMIB 5BWFA 2WZHA 9CGTA 1X1NA 1CWYA 3CUHA 2GVYA 4DM1A 2X2YA 1CEOA 3VDHA 2CBUA 4W84A 3QOKA 1GVIA 2ZX9A 2DSZA 2A3EA 4B15A 1QOXA 1US2A 4GI6A 1HXJA 3M46A 1TUXA 2OSYA 2WMHA 3MUY1 2O9PA 1OT1A 2WZEA 1VJSA 1NM9A 3BSHA 1DWGM 3WUGA 1UH3A 4NZCA 3ZMRA 1HJQA 1GOWA 2E9BA 3L4YA 3ARWA 2DDXA 2J7FA 3POCA 1J11A 4QLLA 4CD6A 3I3EA 1UOKA 4WKAA 2VRKA 3FY1A 5GNXA 4HMDA 1J0ZA 2NW0A 1OGSA 2UY2A 3AZSA 5IFPA 4GO8A 3B9AA 5DT7A 3VD3A 1CXIA 3UG5A 1L0PA 4W5ZA 1AQMA 1GVYA 1UD4A 4A3HA 1NOUA 4D1JA 4URIA 3ARYA 4EKJA 1EHNA 1XCXA 1M04A 2D0FA 1CLXA 2VMFA 2ZUMA 4ZXOA 1V6YA 3PZVA 4AD3A 1JGIA 4BF7A 1KXVA 1H1NA 2DEPA 2X1IA 2VCBA 4FF5A 4NRRA 1CGXA 3VD4A 3ZO9A 1PAMA 4D6IA 2YDRA 1VF8A 4BA0A 4JZ5A 1TR1A 1WPCA 1JZ8A 1KGWA 2G3JA 5I77A 1GNXA 4GI9A 2CIPA 4BQ3A 2D0GA 4BZYA 1FFRA 3OLGA 1BG4A 5CLWA 4MNJA 4RE3A 1LJYA 3THDA 4LGXA 1J12A 2PWFA 1VRXA 2DH2A 4QFUA 1CXFA 1UR9A 3ALGA 1OCQA 2G3MA 1N82A 4OOUA 4DUWA 3CZJA 2BHZA 4OOZA 4D72A 3EDFA 4NI3A 1BHGA 4UQDA 4XUYA 3U7VA 4U2YA 4YHGA 1CBGA 1HJVA 3L2LA 1PBGA 2NT1A 1ECEA 1US3A 4PRWA 1ISWA 1VEMA 4CU7A 1MYRA 1E6PA 1XGZA 1LG1A 2W67A 2J7CA 1GPFA 4W7WA 4JKLA 2BVDA 2E9LA 4MNLA 5E6ZA 1G5AA 1EIBA 5A1AA 2W91A 4PCTA 4U5KA 4P8XA 2VVNA 4W86A 3U5YA 5BYWA 3IJ7A 3WL0A 1IZKA 2XFYA 5D8ZA 2VCAA 3MSDA 3THCA 5A6MA 1KCKA 2V3GA 4AIEA 3W4RA 1PZ2A 3VGHA 4V28A 4H7VA 3PBGA 3ZIZA 1UWSA 1OGBA 4AZBA 2WXDM 1VFUA 5E09A 4HP5A 1VFOA 5A8PA 3LMYA 1FA2A 1CXEA 4MJ2A 5DO8A 1HJUA 1RPKA 1V6WA 1HKKA 3AHTA 4AD5A 5EBAA 2IXVA 1FH8A 1OIFA 2J74A 3PTKA 2UWFA 3QGVA 4LQ1A 3CUGA 2XTKA 1MQQA 4QP0A 3L4VA 1A47A 3DHPA 3T0AA 3BXWA 1LWJA 3GM8A 3VVGA 5JBEA 2DT1A 4PMUA 4E2OA 3KEHA 5A94A 3EMCA 3HMCA 3F5LA 2ZXDA 4M56A 1C7SA 4PTXA 1Q6FA 1XRVA 1FHLA 4D6FA 3AZRA 5CGTA 1V02A 3K8LA 1GJWA 1JNEA 4WKFA 2XJ7A 1KBBA 1K9EA 4CD5A 2XSAA 4FLSA 1EOMA 2VT0A 4JFVA 4C7DA 2G41A 1W3LA 5CPTA 1KB3A 2YA1A 5DEZA 1W9PA 4PCSA 3VIGA 3ZJKA 2Y8KA 3AIEA 1V3LA 3VIOA 2FHCA 1W1TA 3O6AA 2X05A 1MFUA 1ZBWA 3MV11 3VX1A 1CDGA 2OSWA 2VZTA 4FLOA 3WMSA 4D6HA 1QNQA 3ZJ8A 1WZLA 4AXNA 3II1A 4MAVA 1U2YA 4PSPA 4F8XA 1Z32X 1HVQA 3FXYA 2EPLX 2PB1A 5I3DA 2O9RA 4DUVA 4PBGA 2V3DA 4CD4A 1R8LA 3ZQ9A 4TVDA 2BY2A 1KR1A 5LYRA 3L4UA 3WH6A 3MO4A 3WH5A 3J7HA 1EGZA 2ZXBA 4JL2A 3DC0A 1VFMA 4PMQA 3O2LA 1GJUA 3A4WA 5F7UA 3L4WA 1UKPA 5JIWA 4QCFA 3BAKA 4KGLA 3WELA 3N15A 1UD3A 1OB0A 4HA3A 2VQUA 3SCOA 3WEZA 1FHDA 5A3HA 4D6JA 1OIMA 4YN5A 3WDIA 3ARUA 3ECQA 4M1RA 1UR1A 2ZX5A 3E1F1 1UH4A 2BY3A 4W8LA 1J0YA 3CHEA 1NWUA 4W87A 1Q6DA 3CGTA 2V3FA 3CZKA 3N17A 1W9DM 3LPOA 1FP9A 4EAMA 3CPUA 4UFIA 1I75A 1QW9A 3K1DA 3L4ZA 3UR7A 3VMPA 3WUEA 1PJ9A 5A6BA 1V3HA 2DGAA 2QHAA 1XD1A 4GQQA 2XPKA 3O9NA 2WANA 3BCFA 1JFXA 3GDBA 2J77A 4WJXA 5HNNA 1JYVA 1ZJAA 1JAEA 4W88A 1XH0A 2X0YA 1C8XA 2VL4A 1E5NA 1B90A 4Z2JA 4LXFA 1QHOA 6TAAA 2WCAA 4LYPA 3K8MA 1E6NA 3OLDA 2DSWA 2VX4A 3WD3A 1AQ0A 1QNOA 2TAAA 3WNPA 3CLWA 1H0IA 2VX6A 4MB4A 1E73M 1B3VA 5E9AA 3WH7A 1CXKA 4GQRA 3MUIA 3NSMA 1O6IA 3WQ6A 4KH2A 3KL3A 2VI0A 1X6NA 4TXEA 1MXDA 2EPOA 3UETA 5AYBA 3N12A 4DWSC 3AHXA 3VD9A 2WYSA 3TP4A 3BCDA 2BHUA 2CBJA 5CQ1A 1TZ7A 3AIRA 5C70A 1XV8A 1YHTA 4U31A 1TFVA 2DSVA 5M17A 1C8QA 2D1ZA 1QNPA 5D4YA 2JF7A 3W81A 1RH9A 4D71A 4A3YA 3SCQA 1LWHA 1FH7A 2WWDA 2YL6A 3SCRA 3BAYA 1J0KA 3ZT5A 1PIFA 1VEPA 2JEPA 1TMQA 3TTYA 1QHPA 1JNDA 1E6QM 3B9EA 1ZBVA 1BYBA 1ZU8A 4GIAA 1F4AA 4HA4A 3VDBA 3ALFA 1E0VA 2CPUA 2PI6A 1H2JA 3SURA 7CGTA 1UR2A 3SIMA 2WMIA 3W0KA 1E9LA 4LPCA 1PX8A 3AIWA 3WNKA 1WZAA 1PPIA 1V3MA 3AS2A 5I6SA 3NCOA 4QLKA 3EDDA 3TTSA 3VPLA 2VUYA 4CN4A 1HVXA 3AXXA 4W89A 1A3HA 1TE1A 4WKHA 2DIEA 3QOMA 3FAWA 1V6UA 3W26A 4HOZA 6CGTA 1V0LA 2RGMA 1DWJM 3AFBA 2EPMX 4UTFA 3UG3A 3AXHA 1E5JA 1W9BM 1RP8A 2BHYA 4M81A 2W62A 4L4PA 3UEQA 1WDQA 3WUFA 2BFGA 3ZOAA 1V3KA 3PZNA 4CKQA 2HISA 4XB3A 5D9MA 3WF1A 4Q7NA 4M82A 3SCNA 3WL1A 5BCAA 1W1VA 2XFRA 3GBEA 1EOKA 3ARTA 3GXIA 5IDIA 4ATLA 4AZ6A 1ZBKA 3GXMA 4UQCA 3SUVA 3VILA 2WHMA 8A3HA 1OM0A 4ATWA 2CETA 2O9TA 1JXJA 1ITCA 3WY1A 5A8QA 4JL1A 3D5HA 4AZGA 4J3SA 4ACZB 4HZ6A 3B9DA 5HOSA 4WK9A 1B3YA 3G6MA 3W27A 2YL8A 3SCVA 4D6GA 3SCTA 3WMCA 3I3DA 3N18A 2EBNA 3MV01 4PTMA 2YIHA 3AIVA 5FL1A 5CXPA 1MXGA 1BAGA 4AZCB 1OBAA 3GBDA 2OYLA 2PWHA 3L4XA 4IM4A 2GK1A 3GH4A 4M80A 4B3LA 1B2YA 1GUVA 2BV9A 3BMVA 3SCWA 3CTTA 1XSIA 4AZ7A 5DMYA 1OSEA 1KBKA 3AMCA 2E8ZA 3AROA 2WSKA 1B9ZA 4UFJA 2J62A 5M5DA 1FOBA 2J7DA 4J3VA 2G8ZA 1C3FA 1E4NA 1QVBA 4GI8A 3AI0A 3AQUA 4XV0A 1CGVA 2CKSA 2WPGA 4JCMA 3VNZA 1HF6A 3A4AA 5CLTA 1DWAM 2VZOA 3ARZA 5EB8A 5GQBA 4Z2IA 5M3WA 1L8NA 3SUSA 3T2PA 1E6SM 3RM9A 1BSIA 4JCLA 3VNYA 2JIEA 1HJSA 1CECA 1E0XA 3AOFA 2WM0A 7A3HA 4PEEA 5A6AA 1W2PA 1W9VA 1JZ6A 2WWCA 2D2OA 1BFNA 4X0NA 4MPKA 1E40A 3VD7A 5GPRA 2Z1SA 4P8VA 3LPFA 2JE8A 3WDQA 2G3NA 3WH9A 3A4XA 1ODZA 3SCPA 4B9YA 1MW2A 5A6KA 1XYFA 1GQIA 2C7FA 2X8RA 3SUTA 4H04A 3ARPA 4UFMA 4PUEA 2J79A 1C90A 1GQKA 4WSJA 3NDYA 2G4FA 2JFEX 1M03A 1R86A 5BRQA 1NWSA 1EDTA 3VM5A 2EO7A 1HN1A 4DUXA 2CHOA 1H4PA 3ZT6A 3ARSA 3WNNA 1UD6A 3WD1A 3WD4A 1LL6A 3RDKA 1G1YA 2ZUWA 4U3AA 1QNRA 2WCSA 2DIJA 1EDQA 1CXLA 4TVUA 4DWSB 2J8FA 4MB1A 5FL0A 2J7EA 3JUGA 3AMGA 4W8BA 1JAKA 4UOJA 3RIKA 3M7SA 5CSUA 1UD2A 1GONA 4R27A 4CVUA 4AW7A 4S3KA 3I3BA 5HXMA 2E40A 3AYRA 4UFHA 3W28A 4DM2A 2QMJA 1UWRA 4HOWA 3MU7A 3GYCA 4CN1A 5BXRA 1B3ZA 4LYQA 1DP0A 2VJXA 3W6LA 3WQ4A 1W9XA 1K9TA 4ZXLA 3RCNA 4UCFA 3ZSSA 1E6ZA 3CH9A 5AY7A 3BC9A 3IJ9A 2YOCA 2GJXA 1ZL1A 4YPJA 4X0VA 1SYTA 3UESA 2W63A 1WNOA 3CHCA 1WDRA 1H49A 4TVCA 4MNKA 1MW0A 3BLPX 3QHOA 5ABEA 1O7AA 2VR4A 4UNIA 3HU7A 4IISA 2D3NA 3W38A 4CGTA 1CGYA 2YLAA 5FIPA 3CZEA 3WDRA 2W66A 4N0RA 5CGMA 2XHYA 4NRSA 1D2KA 4HU0A 1E15A 2C0HA 5DFAA 1BVNP 3EBVA 4AYSA 3ZSTA 4H8UA 4QCEA 2B31A 4RE2A 4HOXA 2VURA 1J0IA 1UQZA 1W9UA 5IXEA 1WDSA 1WO2A 1V3IA 4MB3A 1EHAA 4PMYA 2YBTA 5JUVA 5FKYA 3AZTA 3VIKA 3K4AA 3VGGA 1QI3A 3NSXA 1JDCA 1UUQA 2NT0A 1GHSA 1E4IA 2A3HA 1HIZA 3SCUA 1CPUA 1ISXA 5FCZA 1WE5A 2Y5EA 4TX6A 3RM8A 3RO8A 4PMVA 3T09A 1UD8A 3RM4A 1H11A 2FHFA 4HPGA 3WIJA 4WF7A 5IFTA 3CZLA 2E9MA 4CUCA 4TOQA 1JZ5A 4UOQA 4Z2LA 4AZ5A 1QBBA 1JD9A 3OGRA 3PTQA 3QR3A 1K9FA 1KGUA 1NH6A 4EANA 3N11A 5IHSA 1HX0A 5D9OA 4M29A 1E71M 5E6YA 1KQZA 1UKQA 4J27A 3G6LA 3KL0A 1E4MM 4AZIA 2ZX6A 4E8CA 5BROA 3UR8A 1P6WA 3GTNA 2XM1A 2WVTA 4P7OA
chains in the Genus database with same CATH superfamily
3QW3A 1U22A 4ICCX 3WN6A 2FMOA 3NQMA 5HMDA 2HXTA 2ZE3A 4JN7A 3BPWA 4QROA 2ZICA 3V1HA 1E1EA 2J7GA 1ZGDA 2A1YA 4W8AA 2X1TA 3WQFA 2QCNA 2YA0A 2V67A 5CZKA 3BLOA 4IICA 1BD0A 5A8MA 3IIPA 1YE6A 2V63A 6ALDA 1UPPA 5H91A 2NQLA 4C5YA 1UA7A 1SO5A 1I45A 1NFPA 1FWFC 3LUTA 4Y9PA 3DYPA 4XG1A 1XLEA 1KXHA 3GD6A 5KZ6A 4MLRA 1HO1A 1PTDA 2X7VA 4UMBA 4UQEA 3SDOA 1TA3A 4XZWA 1PKYA 5E70A 2NSXA 3NWRA 3TK7A 4DO4A 5HPOA 2YYTA 4LEFA 3HG4A 2PUZA 1SZEA 4RDVA 3MT1A 5XIAA 1OGGA 5LA2A 4G7EA 2EG6A 2XISA 3L5AA 1FXQA 3UCQA 4A8IA 4S3EA 3VIIA 1FH9A 3B0YA 4LVGA 3VK5A 3R2GA 4JIIX 2PDXA 1YBQB 1R9YA 1RALA 3BMXA 3PY2A 1FWTA 1KR0A 3DH7A 3CQKA 3GR8A 4W4QA 3GQYA 1UUOA 2VNCA 1RJPA 3MZ2A 5J5RA 5I79A 4P7RA 3I7SA 2PF0A 1O1HA 2DU2A 3HGJA 1WA3A 1S2VA 2HVOA 2X0HA 1GT8A 1XUZA 5HULA 3UERA 6XIMA 4PMRA 3TN6A 1T41A 4XZBA 1AH3A 2DPEA 3W37A 1XYBA 4GNKB 3CASA 1ODUA 1E51A 3KTXA 5LIKX 3ZS4A 3U0HA 4IX2A 4LV4A 5FJRA 4GA8A 4AY1A 3STEA 2O0TA 2J88A 4ZOCA 3KVKA 1NIUA 4V2XA 2QAPA 1H61A 4RNFA 1QHZA 4MPQA 1V0NA 5I7GA 2XIBA 2Z00A 3SADA 3NQAA 4TTUA 3HJEA 1G94A 3WKZA 1WP6A 5IHRA 2WZIA 4HQVA 4C7GA 5HR7A 3LCXA 2J24A 4UXDA 2QCDA 5KEZA 2G3FA 3CZ8A 2G37A 4PTVA 4C6LA 1UHVA 3T08A 1XC6A 1PKNA 4DZHA 3W86A 1IR2A 2DZVA 3LK6A 1VFHA 3L0GA 4MOZA 2VWSA 3S2MA 5F2IA 3W00A 4I7UA 4WSKA 5CJNA 2BB0A 2INZA 3CB8A 3NL5A 4FP1A 3REQB 3HN3A 1LL4A 1LQ2A 1BGGA 1SMAA 1LQAA 2W5FA 2PRHA 5T26A 2ISDA 3UG8A 3N4FA 3CAVA 1VFFA 2CBVA 3OA5A 3H23A 1B3OA 3Q67A 1FTXA 4RE4A 4PMNA 1Q6OA 2YDQA 1Q7MA 3MP4A 5DY3A 2R82A 3HG5A 4Q4KA 1WXYA 2IQDA 3EDJA 3RRXA 3LB0A 1QOPA 2V2HA 2REQB 4EX4A 1UH2A 1VYRA 3LPPA 2V5LA 4PUKA 2B7NA 2D0HA 3AWNA 3BAIA 4AWEA 1AW5A 1CNVA 3P67A 1W91A 1VGAA 4OGZA 1ADOA 5FA5A 4QHRA 1F8IA 1MWOA 3QY8A 5I5RA 1LL7A 4Y90A 3EKZA 2XGIA 2FVMA 1A4MA 1ZB5A 3OHIA 4BWLA 1FWHC 3UY7A 1XBZA 1BPLB 1Q7ZA 4TR9A 4F0LA 3CU2A 3DUGA 1QR7A 3OG2A 3WENA 4B5TA 1ZS2A 1NOFA 2JEQA 2DZSA 1L6FA 2GQ8A 1S46A 3FSTA 4L56A 1E3ZA 3KVJA 1W32A 2XIIA 1NQKA 4DUOA 3TLQA 2XDFA 4HZ8A 2CZEA 4NNCA 1ZRQA 3LRLA 3VAVA 6A3HA 3S4TA 4QDMA 3LMZA 2MUCA 4AZCA 5REQB 4F79A 1SJDA 3VDCA 4DYJA 3K5XA 3NURA 3U7BA 2BY1A 1CB2A 1ADDA 4KESA 4GC3A 5C5YA 4IPLA 2E6YA 2E0PA 3QLDA 3LXAA 1J0JA 1TO3A 1YPFA 1MW1A 1ITXA 1AJ0A 3QLLA 1AA1B 5RUBA 4XIAA 4UR9A 4R33A 2O92A 2WSRA 3SJNA 3NG3A 1EO7A 3CPGA 3EOLA 4Z1AA 2ZWZA 4Y9AA 2UY4A 3E02A 2HVMA 2WMGA 2GDUA 1DWFM 2Z4GA 3R79A 1V8EA 1H3GA 4AVOA 4YTRA 2JIWA 1XHGA 3B04A 2OLHA 3IAPA 3O1NA 3VIFA 2QDEA 2XVNA 5AC6A 1ZTVA 5EMJA 3TW9A 1C9DA 5EL1A 1JD7A 3WEMA 2HWGA 3OG3A 4H6RA 3ZM8A 4E8DA 4OV4A 4JKKA 1XKJA 3PZUA 3RPTA 1XH1A 3MS8A 2WMJA 3GTHA 3E2RA 3WUBA 1PDYA 3UY8A 3ID7A 4NHVA 3R8RA 4NYUA 4F9JA 3ZJ6A 4HHPA 3CMJA 5SWUA 2PTZA 3ABQA 2PD9A 1HL2A 2VHLA 3A3HA 3DYOA 1PV8A 1EPVA 1QPKA 1UKSA 3PPCA 3CUFA 1K8ZA 4KWWA 4FOKA 2F38A 2GVJA 2DVTA 1F7BA 1JZ3A 4PMDA 3QQ0A 1EQPA 1XFBA 3DECA 1PDZA 1GZGA 3F5KA 3QMRA 3ME3A 4JX6A 2V81A 3PPGA 1LWIA 2YKKA 2BP1A 1FHUA 1HQTA 1JZ2A 2D23A 4Q8PA 3BGJA 2A3AA 1UC5A 2JBMA 2D22A 4JXCA 1B0IA 4WCJA 3GS6A 3VU2A 2A3BA 2R8WA 3LS9A 2QR6A 1KM0A 6XIAA 2ABBA 3PR2A 1LOLA 1E43A 1VQTA 3M07A 2IXUA 4KRTA 4MDPA 5BMXA 3EWXA 3UXDA 1A5UA 4YTSA 1I4NA 1FDJA 4F0MA 1OY0A 2PDIA 2IPFA 2A85A 1NARA 2C14A 4KKXA 3ISIX 4ZE4A 5A8OA 1EUAA 1RVGA 2IPGA 1P48A 2IKHA 1W5NA 1DEDA 3AICA 4JTKA 4KWUA 2UY5A 3IIOA 4LYRA 3DAQA 3EZ4A 2ZE0A 4JHOA 3DFNA 1YBQA 2Y4SA 3VD5A 2VR5A 1WKFA 2ONEA 3THQA 3W1RA 4GUIA 2WW5A 4DO7A 3SN1A 3LLDA 4I9JA 2FZ9A 3WLMA 1Q8JA 1NP2A 3TIMA 4UTWA 4MB5A 5A8GA 5F2GA 1VBUA 2AQWA 1LLOA 1ADSA 5C55A 4Z2HA 2QGHA 4PUMA 5TD4A 1EWDA 3ARRA 3GRIA 1QW8A 1F6PA 4OJYA 5CG0A 4ORIA 4W9TA 3ZYZA 4O0KA 3B0XA 1F3EA 1QK2A 4KS0A 4XWUA 1Y0EA 2PC8A 1KQYA 2DFAA 4EIVA 3R13A 4GXMA 2ACRA 4N9CA 1S39A 4M6VA 2PDUA 1VLIA 3TW6A 2GWGA 1A3XA 3TTOA 4XX6A 2X09A 3S6TA 2HNEA 2Q3OA 4AEFA 3B9NA 1V03A 5CH9A 3G3DA 3BAWA 3DDMA 2ABAA 4J2MA 2YR1A 3GDTA 5I00A 3WJYA 2XGBA 3N4AA 3WQCA 5FF2A 3U48A 1FWRA 2GSJA 2PFHA 3SQSA 3BV4A 3MMTA 1TPUA 3UG4A 2BNJA 1XR2A 1L2QA 4KWVA 1EDGA 1Y8BA 3UJEA 3DHUA 3H24A 3PHAA 4QR6A 3RR4A 1FWWA 2UY3A 1RCOB 1HW6A 4FXSA 3WFZA 4A29A 1Z9AA 1HKIA 2ZWYA 3LDVA 3I6EA 4HYWA 1G01A 1TV7A 4Y8EA 1VPQA 3QH2A 2ACQA 4ACZA 3TCEA 1XRFA 2VEPA 3Q65A 4UCGA 4KMQA 5DF0A 3E3HA 2QUVA 3LHVA 1IXOA 1W1A1 2EHHA 1JPHA 3LM7A 1KBLA 1WDPA 4ZENA 4ES4A 2QJGA 3IEBA 1D3CA 1QJWA 1R7AA 3AHVA 4G1KA 2QVHA 1BLIA 2V68A 3A5FA 2DSKA 1BRLA 5FJIA 1DJXA 3APTA 2NV2A 3W7KA 4KFNA 2OO0A 4N2YA 3VKKA 3IAQA 2VC7A 1RQEA 3HGRA 2OQYA 4HNTA 4K68A 4MJ4A 1I9CB 1H0GA 2X16A 4ALDA 2HVNA 3W73A 3SCSA 2OZ8A 4LUSA 2F6XA 2BXYA 4Z1DA 1HUVA 3OIXA 4GCAA 3O07A 5DY2A 3GNOA 5C0QA 4MGGA 3G0SA 4XZIA 5K9CA 1XD0A 1ISZA 3WNOA 4JNYA 1J01A 1LF1A 1TQXA 4F9DA 4EP8C 5PTDA 4F3HA 1WXJA 2VEKA 5BU6A 1P6BA 1G0CA 1CIUA 2OYMA 1CGTA 5H8UA 4A3QA 3ZXWA 2GZXA 3AHYA 3LXBA 2CEQA 3GG8A 2XFFA 4WY0F 3QYSA 2GUUA 1KFKA 1MVYA 2BOGX 1G9HA 4KEMA 4UUIA 3CHFA 4R5EA 1FXPA 2DUZA 4K3ZA 1F4HA 1QTWA 4GO9A 3NO1A 5IDZA 4PE8A 3BO9A 4DF2A 1OC7A 1SUXA 2VDGA 5HAOA 3D3AA 1GHRA 3PWIA 2A6NA 4D8ZA 3WQ5A 1VPXA 2ZBTA 3G1VA 1XIBA 3VE7A 3QFWA 1XYLA 2GVLA 3NGFA 3BSGA 1Q2RA 3E0VA 3GHUA 4W7UA 3NQ2A 2VVSA 3L2MA 2PGRA 3LCFA 4QS6A 1VKFA 3LD5A 3A6OA 4QNEA 5DT5A 5C71A 3W1QA 3A23A 4UTUA 4DLFA 2AKMA 2XM2A 3AIQA 1E4LA 2WKLA 2J47A 2FTWA 3UA3A 2GDVA 4F2TA 1F74A 3MUZ1 3WBYA 1Q5MA 3CYJA 4YYCA 3P81A 2VFGA 3FJ4A 2CHNA 1UKTA 4WRHA 4IMAA 1OG6A 3R8GA 2FFCA 2WVTA 5BWFA 1XLAA 2WZHA 2ZFAA 4Q8UA 1X1NA 4J40A 2O7SA 1FWBC 1FCBA 4ENLA 2X2YA 2PDQA 4W84A 4H9XA 4RDZA 3QOKA 1GVIA 4B15A 1QOXA 1Q65A 1TPC1 1L8PA 2L5HA 4DI8A 3M46A 2OSYA 4G5DA 2O9PA 4GIRA 3SRFA 1ZAIA 1A3WA 1DWGM 3Q58A 3RYSA 4E4UA 4EXBA 5CBBA 3VNKA 1HJQA 2E9BA 3UGVA 3DFTA 2AGKA 3IV8A 4DO5A 4ZOEA 1TVLA 3POCA 4DRSA 1XKYA 3I3EA 4XD5A 3S46A 3F4DA 1P1XA 4OTKA 3PULA 3W2NA 2BSLA 1V5XA 3NQFA 3GY1A 4NYYA 3B9AA 2Z25A 1CXIA 3UVIA 1TTQA 1AQMA 4D1JA 1RA0A 1H63A 1XUUA 2PMQA 1LOQA 4IFKB 4EACA 1EHNA 1XCXA 1M04A 4TX9A 5EU9A 3CUXA 3HG2A 1XLIA 2CZFA 1JGIA 2VFFA 1YXYA 2E7FA 3G5EA 3M0KA 1S5VA 4C6CA 3KBSA 3QY6A 4HK7A 1OABA 1M1BA 1PHQA 3OP2A 4D6IA 2PDGA 3ZVHA 3LTYA 3EPNA 3OEXA 4DJDD 2E28A 1WPCA 3HM7A 3NL2A 3UNTA 4DWDA 5L9FA 5CZ0A 3DU0A 1H7OA 1LUCA 2CIPA 4BZYA 1FFRA 1FQ0A 2E6FA 4B2DD 1J12A 4AU0A 1N8WA 2ALDA 1IQ8A 2NVAA 4WQ6A 3CZJA 2BHZA 3L68A 3EDFA 1BHGA 4JD4A 4U2YA 5IBXA 3L2LA 1PBGA 1EJSC 1Q66A 5H8MA 4CLMA 1ISWA 4M19A 3W7JA 3RN6A 1DYSA 1GTEA 2OGJA 1XC4A 4PODA 4H9UA 4QDPA 1UBPC 2V0TA 4MJZA 1EYWA 1W8SA 3MKCA 2W91A 4J2PA 1YTKA 4P8XA 3O05A 2DV0A 2VVNA 4LB4A 3IJ7A 3MSDA 2CW6A 2NWRA 2PCEA 4WJ8A 4K37A 5A6MA 5C9XA 5D30A 4ONVA 4O15A 1ZJHA 5LNWA 1UWSA 1OGBA 3W87A 4QG8A 1VFUA 1J2WA 3SRDA 3GVQA 2GGHA 2OKTA 2YYUA 1K4HA 2W3ZA 3LMYA 1T0OA 4S3DA 4MWAD 5LIYX 3OU8A 2A7RA 4WY0A 1RPKA 1HKKA 3AHTA 1OIFA 2Z7GA 4FXFA 4WSHA 2NZLA 3CWNA 1GG1A 2B7OA 5AYYA 2FPTA 4H19A 2XTKA 4QP0A 2XGZA 4FOUA 3VNJA 3DHPA 1K6WA 3BXWA 4PGLA 2YCLB 4HD5A 3EXRA 1JCLA 4E2OA 4GVFA 5A94A 3HMCA 2ZXDA 1TPVA 1C7SA 4PTXA 1Q6FA 1IWBA 3K8LA 1GJWA 4DX3A 2PTYA 3HMJG 1KBBA 1K9EA 2XSAA 3HGSA 4MYXA 4FLSA 4DAFA 2OT1A 4JFVA 1NELA 3P80A 3W1NA 4C6BA 3FDKA 2OELA 3PANA 4MZYA 2C0AA 3EB3A 3BV7A 3VIOA 1GYNA 1DORA 1MSSA 2CZVA 4AWTA 2JQXA 1X38A 3Q45A 4FLOA 2Y7EA 3KOZA 3URQA 4C1NA 4AXNA 3II1A 3BGGA 4RNJA 5LSMA 3RO6A 3EX3A 1LZOA 1YNQA 4GUHA 3FKKA 3GHTA 1BXNA 3QEZA 4CD4A 1KR1A 5LYRA 3L4UA 2X1RA 1EYEA 3ITTA 2AL1A 1PIIA 2B7QA 3B0VC 3J7HA 2ZXBA 4NIRA 5D33A 3DC0A 4GQ0A 5DBUA 3DERA 3TROA 3A4WA 2KX9A 4ZCWA 4HYVA 1EEXA 1ZP4A 3BAKA 4KGLA 4HPXA 4NI8A 3C3UA 3N2CA 3R8HA 3M0JA 5A3HA 3ECQA 4M1RA 1UR1A 2ZX5A 1UH4A 2BY3A 1J0YA 1GVQA 1KM6A 5FEXA 2KAUC 3CGTA 2V3FA 4IP4A 4EAMA 4C6KA 1XP3A 1I0DA 4TU1A 3M7WA 1YPXA 4MY9A 5FEWA 1TB3A 1TRDA 1W6TA 3UR7A 5A6BA 3WUEA 1M9HA 1A5MC 1V3HA 4GVIA 4LAZA 2BG5A 2QHAA 1XD1A 5TQLA 2XPKA 5AN7A 3TEVA 1SSGA 1F76A 3BCFA 3GDBA 2J77A 4WJXA 5HNNA 1JYVA 4E5TA 1C8XA 3NQDA 3UA4A 1E5NA 5FI8A 1MUWA 1TJRA 1XPGA 3ZWTA 4LYPA 1S3HA 2OZ0A 4KERA 5EGRA 1R3WA 3P7YA 3NZ1A 2VX6A 4E2DA 2ALRA 4OHQA 5C9WA 2QXWA 2CLIA 4JIRA 2Y62A 2ATMA 3WH7A 4GQRA 1O6IA 3FS2A 4Q8QA 4KH2A 2VI0A 3G0XA 4GISA 3TN3A 5AYBA 4LWWA 4GYKA 3N12A 3AHXA 2VENA 3VD9A 3T78A 2J13A 3P0XA 1NAL1 3AIRA 4XZ9A 1IXNA 1TFVA 3V1PA 1VR6A 1QNPA 5LXEA 2F9RA 5LGZA 1RH9A 4D71A 3SCQA 4O1CA 5AKQA 4OECA 3SCRA 3MPGA 1PIFA 2V6AA 3EWCA 1GVSA 1EX1A 5HWNA 1M3UA 1Q7QA 2JEPA 1FWSA 3FK4A 4ZOBA 1F4AA 2C19A 1KFLA 4QRNA 1E0VA 2YB4A 4JX4A 1EJTC 5HQMA 4J9JA 1E9LA 4GYJA 4GD0A 3E38A 3WNKA 4XQ6A 2B7PA 3LXCA 4YVPA 3R10A 5HK4A 1F8MA 3TTSA 2VUYA 3CQJA 4W89A 1A3HA 2R6OA 4M5PA 4JBRA 4A2SA 2UZ9A 1DWJM 3SBFA 3AFBA 3FEMA 4UTFA 3UG3A 1W31A 3AXHA 2PAJA 1E5JA 1W0MA 1W9BM 1LT7A 4S3BA 4GIYA 2X41A 3PZNA 1O4UA 4CKQA 4AHOA 4XB3A 1XG3A 4Q7NA 3SCNA 4OBTA 3TDFA 5BCAA 1W1VA 3GBEA 4YVXA 3GXIA 5IDIA 1ZBKA 4UQCA 8A3HA 2PDBA 4ATWA 1NFBA 1QAPA 4HSOA 5A8QA 3D5HA 3S5SA 1IF2A 4HZ6A 3B9DA 4E3TA 2PU1A 3IUIA 3G6MA 1W17A 3U8GA 4AHPA 2I5GA 4O0ZA 1RD5A 1YTEA 3WMCA 4EPBC 1A5AA 1N2VA 2DP3A 4RXGA 1CB7B 3UPBA 3TKFA 1VHCA 4NVTA 1T40A 3FCPA 3DESA 1XL9A 1VS1A 2YIHA 5FL1A 2ZRZA 5CXPA 1MXGA 2OCZA 1DXEA 2G96A 4LC8A 4KCVA 4Q4OA 4IM4A 2VGBA 4JX5A 3MTWA 1IHIA 3SCWA 4AZ7A 4HCDA 1OSEA 3OYXA 4DJDC 4DYEA 1RY0A 2D2GA 3ANYA 3EA3A 1A53A 2J7DA 5D38A 4X22A 4NZ4A 2G8ZA 2YCIX 4GI8A 3M0YA 2G97A 4B2DA 2WPGA 1HF6A 3NM1A 2QAFA 1DWAM 3W9ZA 5C6MA 1OFOA 5GQBA 4HCLA 3G1FA 3SUSA 1E6SM 3RM9A 4JCLA 1HJSA 3AALA 3PUDA 1CECA 1E0XA 4BEUA 2WM0A 4HNOA 3IGUA 2D2OA 1BFNA 4JEJA 1DJNA 5M1TA 4MPKA 3L66A 3UZWA 2F6UA 3B0UX 4P8VA 4XTIA 3LPFA 1H7XA 2DQWA 1ZALA 2GGJA 3A4XA 1ODZA 1XIEA 3WQDA 5AB3A 3ABOA 3WLHA 1XWYA 4KW2A 4Q7BA 2X8RA 4R7JA 3VOGA 3ARPA 3RF9A 2PE4A 3WJZA 2HPIA 4N9DA 5E5CA 1IZCA 2G4FA 2JFEX 2QEZA 5BU9A 1UP3A 5BRQA 3VNMA 3WQPA 1EDTA 1KCXA 3E0LA 4IGSA 5F4WA 4L64A 2NX9A 4BF9A 2QCEA 2J9XA 4XD3A 3R43A 3ARSA 3ZT6A 3IRDA 3UXKA 2ZZ6A 4HU4A 1AL8A 3RDKA 4F0SA 1G1YA 4A21A 4O14A 4U3AA 5MHBA 5IRPA 2J8FA 1PYFA 1ENUA 1UASA 4Y96A 5GJNA 3M0HA 1A0EA 2BBFA 3KVMA 1MUMA 1HFBA 4UOJA 3MDUA 5C9ZA 1RCXB 4XSLA 2BGQA 3GNDA 5CSUA 4C6FA 1GONA 2QJIA 4AW7A 2CU0A 1XBVA 4S3KA 1Q6RA 1EP1A 4DM2A 3TE9A 4GQBA 3W07A 2QMJA 3PPFA 1B3ZA 3NQ7A 1TV3A 1EZ2A 3DFSA 1BWVA 2OXNA 1K9TA 3ZSSA 1D8CA 5G4HC 3CH9A 3L5LA 3BC9A 3BG9A 4X0VA 1SYTA 1VFSA 2VFIA 4Z0SA 3LYEA 3ICJA 2WJZA 4PUUA 5G2WA 4MNKA 3BLPX 3QHOA 4ZMGA 3GFXA 1VCFA 4LV9A 4H9MA 5DX7A 4QG9A 2PC4A 2RHGA 3FJLA 3WDRA 5FF4A 4RPPA 3M4HA 1B54A 3VNIA 5KITA 3QGKC 2XHYA 3VNDA 3TC3A 3QPYA 1K8XA 3RR1A 1BVNP 4AYSA 3BW2A 3GU1A 4GUFA 3M41A 2QT3A 2VURA 1MNZA 4ZB0A 1WO2A 2ATSA 1M41A 4PMYA 3GDRA 5JUVA 3AZTA 3VGGA 4R53A 1QI3A 2ZC1A 4O4WA 1W5OA 2NT0A 2Z2UA 2A3HA 2AKZA 1HIZA 4LSBA 5C9UA 3NOEA 4HNCA 2GL5A 4TX6A 1H62A 3RM4A 2Z24A 1H11A 2QS8A 4G2DA 4OT7A 4TOQA 4UOQA 4Z2LA 4DJED 3DKLA 4AZ5A 1JD9A 2A21A 4Z17A 3T7VA 2HMCA 3QR3A 1TUFA 1E9ZB 4AVFA 3KM8A 3N11A 1HX0A 5D9OA 4M29A 3GW0A 1E71M 1S3TC 3S6OA 3A5VA 1R3SA 2VC6A 3GYEA 5FF3A 2ZZ4A 2R24A 1FCQA 4E8CA 3TNBA 5BOOA 3GTNA 1IT8A 5I03A 1GZJA 1XBXA 5FJJA 4PZVA 2DT3A 3IJIA 1JCJA 1X96A 1QOQA 3MP3A 4UIOA 4RZ5A 3W76A 3M5XA 4QTGA 1W8GA 2I9UA 2YCLA 4A22A 7TAAA 2YA2A 3WBAA 3VIMA 3MKVA 4I5XA 1TV4A 5FAGA 2ZVIA 4M8UA 3R12A 3V5FA 1JYWA 2PDYA 1QNSA 3E0FA 4YHEA 1XIDA 3VMNA 1SVDA 5E1QA 1Q63A 4O28A 3M5ZA 3KHDA 1UG6A 3ERPA 1B1YA 1KWGA 4Z42C 2ZYFA 1NTHA 3XINA 4AC1X 4JIPA 2HDJA 5G4WA 3DG3A 1BXCA 2XYLA 2EXOA 3V0SA 4K8GA 1TPB1 4ECLA 4WZHA 4RNIA 3S2CA 3QR0A 1TPDA 1T8XA 3TN4A 3ZT7A 3T2QA 3RJXA 2QQ6A 2J6XA 1YDVA 1YNYA 3MSYA 1I0BA 4GVHA 1B30A 3OZOA 3GLCA 4P8UA 3H2CA 3M44A 4TV5A 3GH7A 1TKKA 4O18A 1TG7A 4HMNA 3PTMA 2BDQA 3I6RA 3SGGA 3Q4DA 2Y24A 3OIHA 3TAKA 9XIAA 1P7TA 4LCRA 3GR4A 1W3JA 5D05A 4AIUA 3W1LA 2VZVA 3S9YA 4GVGA 4ZEPA 3NVDA 3GNXA 3VOCA 5LIUX 4HHLA 4H6QA 3ZR5A 3B3DA 1XIFA 2HS6A 1UROA 2QKFA 2RJGA 4B5SA 3WF2A 4JIQA 1W1B1 5I07A 3ZVIA 4RZ4A 1KRBC 4IIDA 4P8WA 5EMYA 1XIMA 2NUYA 4FLQA 3STCA 4QAIA 3VIHA 4RK8A 1JUEA 5HATA 1ALDA 1KM1A 4ZQNA 4B3ZA 2R14A 1OCNA 2G50A 2WZMA 4Z0JA 1I1XA 3W2UA 2BVTA 1R2SA 5CSRA 4KT2A 1C9WA 3VX0A 3GAYA 4AHQA 1PTAA 3H4XA 3O6YX 2CLHA 4EOUA 4IP5A 5ECUA 4XVDA 2OVLA 2OEMA 3FJ6A 3MYPA 4UTKA 2VUNA 3BH4A 4LX4A 2GWNA 4JTCA 1K8CA 3AS3A 3B8SA 1H7WA 1CCWB 4Y6GA 1XFCA 4ZQMA 2DQXA 2IKGA 2EJ1A 4G9PA 5I0DA 1SPQA 1K70A 1V7YA 3WLRA 1ONEA 1RK6A 3FYPA 4BEQA 4ZL1A 1EJRC 3KRUA 5CSSA 3FAXA 3K13A 4CNNA 2Y88A 2Z6IA 3KRBA 4FK9A 5BW6A 3NUKA 1DE5A 2I17A 3XIMA 1DJQA 1V93A 1E70M 1EC8A 5EFDA 2HE8A 2NXGA 1RR2A 1PHWA 2VX5A 3OJGA 3N29A 3IARA 2VRJA 2C6QA 3EX2A 1GJPA 3SY8A 4BS0A 1DXIA 3W71A 4RNHA 5LA1A 2LLEA 3EX4A 1P0DA 1VHNA 2Q8XA 3I4EA 4CCCA 1KD0A 3K4DA 4U3CA 4DNMA 3MMWA 3AISA 3CS2A 2BMBA 3S6DA 3GVWA 5GNYA 3F2BA 3N14A 1TSIA 3QHNA 4PMZA 3G1AA 1AH0A 2QCDB 4CN6A 2Y85A 3G77A 2VC5A 3LRKA 4F66A 2PDLA 3W7MA 3POHA 1TJ1A 4ZZ9A 2EG8A 5HQEA 2TODA 1V6TA 4P7LA 2Y5JA 1Q45A 3IS4A 4WY0B 3B8TA 1IWPA 3EDEA 4I9TA 2OG9A 1PUDA 1FKWA 3CV7A 1V02E 2VDIA 5CC6A 1TWSA 4E8GA 4JN8A 4YVVA 2GGIA 3CK5A 2GGEA 3VXGA 2TRSA 3MMUA 5AFDA 5CPSA 4U2ZA 4E4FA 4UZUA 2O55A 1IWAA 1EWEA 1U5VA 2YX0A 1LG2A 2V5CA 5BXTA 3KHJA 3PBMA 2WV8A 4N7QA 3OGVA 3AMLA 3N2TA 3QKZA 3N2MA 2V38A 1SQ7A 4YCOA 1OQFA 1L6WA 2WOQA 4MMWA 2HK1A 3WH8A 4PFMA 2Y6ZA 3NNTA 4MKVA 5FOOA 3P8IA 1KBJA 3FHQA 4BQ4A 3W88A 4IPNB 3LI1A 4RW5A 5DCEA 1O94A 5T8GA 3VO0A 2Q3RA 1U5JA 3KP0A 5DMLA 3VA8A 3W83A 5LHFA 3N1AA 3MA8A 3NQ8A 3PF3A 2CBIA 1EJUC 2OLSA 1W2VA 1SJAA 3B97A 1L6YA 4EWND 1Q6CA 4CCEA 4V33A 1E9YB 3CZGA 1PL9A 1F6YA 3EXTA 2A0NA 1XF0A 1ZENA 3W7EA 3AIBA 1FVPA 4O53A 1TTJA 2JKEA 1Q13A 2J75A 2VX7A 1UWIA 5FD0A 3OO2A 3S5OA 3PM6A 2QDHA 3AXMA 3AXIA 4JYFA 3B8VA 5AHNA 3BAXA 4JTTA 5CC7A 3CIWA 4W7VA 2EQDA 1PCKA 3VE9A 5I23A 2NUWA 3OHMB 2OWWA 4OBRA 3HJZA 4Y7EA 4WDWA 4D1IA 5B80A 2X2GA 1CGUA 2YW4A 4Q8MA 1GW9A 2XVLA 4IMFA 3TZFA 1G69A 2QF8A 3A3WA 4WEVX 4HVXA 1OFRA 3AYTA 3TTEA 5H6HA 1UWUA 5H8PA 4PTWA 2G3IA 4GKLA 2YL5A 2X7WA 1GEQA 5L6UA 2Z0IA 3KLKA 1UMLA 1CYGA 3D46A 1DTUA 2CKRA 4H01A 1GOXA 4BFAA 1Z44A 3M6DA 1OEPA 1GQJA 3NIYA 3U2EA 5CZJA 1I2QA 2XUCA 3KBNA 1J5SA 5CBIA 1HTIA 1POKA 2ZIDA 1HZYA 1KFCA 3G2GA 2E6AA 3CWHA 1V6XA 2E3ZA 2CWXA 3JZUA 2QDDA 4AMCA 4FLRA 3MKKA 1NWRA 4JFWA 3GXNA 3PNUA 4O1AA 2TSYA 4X60A 3V5OA 4AD2A 5F4SA 3GWQA 1LORA 3W7IA 3RMEA 4JQ3A 4CQBA 3IANA 4NL1A 1B4EA 2VOTA 3BWWA 1XRSA 1OD0A 5D2YA 3SR7A 1TREA 1V08A 3AU2A 4NZ5A 4QITA 2CLOA 2XIMA 1WDDA 1SW0A 3ABRA 1F5ZA 1K9DA 1MFVA 2CLEA 1F6KA 3ZR4A 1ZJBA 1MW3A 3H55A 1VENA 2QNEA 3EMZA 4ERAA 1MNSA 3KE0A 1X1ZA 1ZFJA 3G22A 1ZPTA 3R5EA 3MJMA 1K6AA 3WQ8A 1JL8A 4HJWA 2WHLA 1ICPA 2VEFA 1DQXA 3I7RA 4MTVA 3W1MA 3CIVA 4XO7A 3F1QA 1M68A 1IV8A 1SZGA 3MHFA 4OU1A 1XXXA 3UBPC 3GNRA 1PZ1A 4HNNA 4XUGA 2AAAA 2J8GA 2DY3A 2FZNA 4FX7A 2J4GA 3FKRA 2QPSA 2WK2A 2XSBA 4LVAA 2OLAA 3P61A 1A5OC 1U33A 3PC0A 4PB5A 3CV2A 4WHBA 3WMBA 2QCFA 2IUZA 4IG2B 5EFFA 4ZO7A 5A6BD 3T2OA 4GZJA 3NJ3A 3PZMA 4AEEA 4Z2GA 1FDZA 3CQHA 4NASA 3TFCA 4LCSA 3GVRA 3BG3A 3WEOA 1ESWA 3W7PA 2ZX8A 2FH6A 1DPMA 3LCHA 2E5BA 4KRUA 1A0CA 4M7TA 4NKCA 3VIJA 3TTQA 3KZPA 4BQ2A 4ROPA 4W85A 4ZSUA 1WYIA 3PAJA 3TMQA 4O0QA 1U1HA 4LFYA 4RDYA 1HP5A 1RCQA 3WD2A 3O16A 3OYZA 2GGGA 4OIFA 1ZZMA 4J5NA 4A35A 3D47A 4ILSA 6TIMA 2YSWA 4GH3A 2NLIA 4D6CA 4GE8A 1QI4A 2C1IA 4GACA 2RDTA 1HP4A 3F5JA 3FN9A 2R1LA 3IIXA 3ABSA 4C6DA 4ORMA 4FF7A 3M0MA 3RNDA 1ME7A 2EEXA 3KWXA 4GOAA 4XZHA 5TF0A 4KCUA 2CERA 2R1KA 1A5BA 1Y5WA 1QI5A 3BAJA 3ES7A 4N42A 4IH3A 2WLZA 3EX6A 4H9TA 3T40A 2GDQA 3QKEA 2G0WA 3GIQA 3GXPA 4JNMA 3RPMA 4C7FA 4IJRA 3LBOA 3V5CA 1XG4A 2FGLA 4IL2A 4HYRA 4IFRA 2C15A 2VEIA 3VZXA 4K6AA 1XRTA 4ZQOA 5AVNA 5D03A 4CU6A 1XSJA 3CWOX 5I3FA 1JUKA 3PBWA 5J04A 1D3GA 1WZMA 1ICSA 2DZTA 1FKXA 4Q8WA 1GOOA 3JS3A 3WQWA 5JXQA 1DXFA 5GNZA 2F7FA 3TH6A 1PEZA 1CLVA 2Q8LA 3UXAA 3T44A 3CUJA 1TWIA 1DIEA 2E8YA 3WLLA 1UA3A 2YXXA 3QMTA 1D3HA 2PWGA 3S8HA 4DJFA 4GK8A 3N9KA 1TIWA 2W61A 2CFFA 2WBGA 3OB8A 2RFGA 4Q8NA 1Y7VA 1UR8A 1NQ6A 4WX2A 1TTPA 2AMGA 3NYZA 3PJUA 3GXFA 4J3XA 3N2XA 2Q6ZA 4HPHA 4Q22A 4CVWA 4NAEB 5CPQA 3WQOA 1E6RA 1E1CB 1YX1A 4LU0A 3O3RA 2BVWA 2HXUA 3M0LA 4O1BA 4KQNA 2BY0A 1JEZA 3K46A 5KINA 3SO7A 2GUYA 4CNOA 1LBFA 4LC6A 5ABFA 3F03K 1PIGA 4FB7A 5C2GA 4CD8A 4PA8A 4J3ZA 5EPDA 2VZSA 4GZIA 4UZSA 4F0KA 1DHPA 3KXQA 2F84A 2IPJA 4O10A 3NZQA 1EC7A 2QJMA 3EDKA 4ZFCA 1ONXA 3ARXA 3TA9A 3HPSA 3PZOA 1MEWA 4NNBA 2PRLA 3TR2A 2RDWA 3ITVA 4O8AA 3RX2A 4E2BA 9CGTA 4GY1A 2I5QA 3ABZA 2VKZG 1CWYA 3CUHA 3W7CA 4CQ8A 4DM1A 2OU4A 2CBUA 3OZMA 2EKGA 2ZX9A 4AF0B 2DSZA 2A3EA 2J66A 3BLEA 4JQ2A 4KPLA 4FX6M 3BOLA 1SM9A 2PGWA 5FJOA 3C2VA 3E2QA 2WMHA 2RJHA 3IIZA 1Z42A 4HHHA 3W01A 3GO2A 3N4EA 3NVTA 3WUGA 3CT2A 1UH3A 4NZCA 4B90A 3ZMRA 3UWYA 2VXNA 3L4YA 3WLQA 4QGCA 3ARWA 3KOXA 4UR7A 2QIIA 2XSXA 3TJ4A 4ZODA 2BODX 3DBNA 4QLLA 3UZ5A 2ACSA 2OX1A 3LCWA 5EYWA 1J0ZA 5FSDC 5G1TA 4R88A 4GO8A 3REQA 1TWZA 3UG5A 1QT1A 3S3GA 4LT9A 5J5DA 1CLXA 2VMFA 4GBUA 1V4YA 4JR5A 3HG3A 4MUPA 2X1IA 4FXJA 2VCBA 3IVUA 4GRSA 3VD4A 3ZO9A 5HJLA 3STFA 4BA0A 1TR1A 3F2CA 4JTFA 3M64A 3NL6A 3NEVA 1A5NC 2G3JA 1S1PA 3SQLA 2D0GA 3V0TA 1BG4A 3THDA 4RE3A 1LJYA 1QRQA 2DH2A 4QFUA 5D32A 5LHEA 5AZ1A 2IS7A 1UR9A 3FA3A 1QNVA 1VLWA 3ALGA 2G3MA 4E3VA 2R9RA 4M7SA 4OOZA 2Z1BA 4D72A 4UQDA 4LUJA 4AMAA 1Z8AA 3U7VA 1SU5A 2XFWA 5MKGB 4GGHA 2PD5A 1ECEA 3BVJA 1CT5A 4OQVA 2Y7FA 4CU7A 4PRTA 1MYRA 1E6PA 3H26A 1SFLA 3V7PA 4TO8A 3CT7A 1FX6A 1IIGA 3P5YA 2PDMA 1AG1O 4W7WA 2E9LA 4CCZA 5A1AA 5C9RA 1EIBA 3W1XA 3NA8A 4XZLX 3PPHA 5KMYA 3OPSA 3U5YA 4K7VA 4WXYA 3SJ3A 3G1SA 5LGXA 4QQ3A 4IOTA 2XFYA 1KV8A 2VCAA 3THCA 3FA4A 1K7XA 3FVMA 3TXVA 2V3GA 3C0SA 4RXFA 4AIEA 4ADUA 1YDNA 1RK5A 1WKDA 3VGHA 4V28A 4H7VA 1B57A 3PBGA 3ZIZA 4AZBA 3QSTA 3JR2A 5E09A 1OK6A 2Z1WA 5KZDA 1FA2A 1RY8A 4MJ2A 1R38A 5DO8A 1HJUA 2Y63A 6REQA 4E6MA 1QATA 4PB3A 5EBAA 2IXVA 4JEQA 3URNA 4GMEA 2P0IA 4LQ1A 1FDYA 3CUGA 2QUNA 3AWOA 1OYAA 4K7YA 1A47A 1LWJA 2ZA1A 4LY4A 3KEHA 2B81A 1J93A 3FSUA 2TMDA 1VFTA 3R4IA 4GJIA 3UXIA 5T91A 4G7FA 3WBWA 4JTLA 1JNEA 1K1DA 1FWJC 1LP6A 2XJ7A 3BL3A 1PKMA 2VT0A 3RMJA 4E0CA 4KF1A 2G41A 1SSDA 3R89A 2PODA 4G56A 2YA1A 2P88A 3PJXA 3NGJA 3AIEA 1W1TA 2JKAA 2X05A 1MFUA 3F4WA 1ZBWA 1GKQA 3WJWA 2VZTA 3QTGA 4D6HA 1QNQA 1WZLA 4O11A 1U2YA 4PSPA 3QTPA 4F8XA 1DVJA 1Z32X 1HVQA 3FXYA 2EPLX 3HPFA 3VDGA 3RUBL 5FF0A 4UTWC 1DJYA 4DUVA 3QSRA 5EKYA 1R8LA 3TYUA 3W72A 3WH6A 1MZHA 2Z6JA 3ELFA 4S3FA 4JL2A 1VRDA 3FV9A 3CEUA 1SR9A 3BK0A 4C1LA 1IT7A 3DGRA 4IQDA 5F7UA 1TZZA 4GH1A 3ZFHA 1S2AA 4GYPA 4U28A 4HN8A 3PFRA 3UYIA 5TNVA 4PTDA 4XK2A 1G7UA 3SCOA 1OIMA 3WDIA 3A24A 3LQLA 1TJ2A 3RFAA 4HK5A 3CNYA 3CHEA 3LQGA 4REQB 5DQPA 4W87A 3FA5A 1Q6DA 3CZKA 4YS1A 1FP9A 3UT0A 3W7LA 4IIGA 5JMUA 3TJXA 3MSRA 1I75A 3CQ0A 3VMPA 4L4LA 4TMCA 2FIQA 4GUGA 2DGAA 3BOXA 2VYOA 3O9NA 3TCSA 3SIZA 2WANA 4NT0A 1AODA 3W23A 1JAEA 3RHGA 1TV5A 2O56A 3DFQA 3NR0A 1B90A 1VC4A 4RCXA 1EP2A 1OYBA 4BI5A 4MYAA 6TAAA 3K8MA 4NNAA 4RJEA 2DSWA 1AQ0A 1QNOA 3SN0A 4O8RA 1A49A 5CPNA 1H0IA 4MB4A 4V1YA 1PWMA 3O6DA 3U4AA 1EFZA 4H83A 4I8YA 4IL0A 4I5RA 1RJQA 3OVPA 4X63A 1MXDA 3HBLA 4XAZA 3UETA 4GYFA 1GPWA 5I09A 3BLLA 1YYAA 4MY1A 3L21A 4M3PA 4XSMA 5BNKA 2CBJA 5CQ1A 2FDSA 3NQVA 1P0NA 5D2TA 4XISA 1XV8A 4Q8VA 4LUYA 2NX3A 2DSVA 3APYA 1IE7C 1G6CA 4A3YA 1EX5A 3SZ8A 1KTNA 3HQ1A 2RUSA 1FH7A 2WWDA 3T0CA 3BOFA 1TMQA 2AAMA 3TTYA 1Z69A 2FJUB 1QHPA 4NAFA 3E74A 1UPMB 1E6QM 1ZU8A 4AY8A 4GIAA 5I3KA 4PUWA 5C2CA 3A64A 4LUIA 3S9IA 1ME8A 4GY0A 5K2ZA 2V5KA 2XIQA 4QXIA 3SURA 1MMFA 3DX5A 4HK6A 2IQ0A 4LPCA 1PX8A 3CIXA 1SJCA 3M0XA 3AS2A 4IHCA 2E09A 4MZ8A 3GKAA 5K9XA 1RLDA 3AUJA 4CN4A 3AXXA 3UP8A 3QOMA 2QJHA 4Y9OA 3OQ8A 3ZLFA 1FCVA 3W26A 4HOZA 4JYEA 2RGMA 2PWVA 3KDNA 1PO9A 3LGDA 1F61A 4AC7C 3C8NA 1RP8A 3UEQA 3YPIA 2YXGA 3ZOAA 1QCWA 5LNSA 1AW2A 1F07A 3WF1A 4ZQPA 5FSEC 4DB7A 3HPXA 3WL1A 3P0WA 3E12A 1EOKA 3ARTA 3HFYA 2V9DA 3SUVA 3VILA 3LCGA 3HFTA 2O9TA 3UD6A 3DHFA 1JXJA 5KSWA 2CLFA 4JL1A 4AZGA 5KTLA 4J3SA 4M6QA 1XYMA 1XLJA 2VD9A 1K7EA 5AHEA 3W27A 2YL8A 4D6GA 3TXZA 3L5MA 5HNUA 4I6VA 4HSHA 1OFBA 2P0OA 1PWLA 3NQCA 4PTMA 3DZ1A 2EGZA 1BAGA 1ONWA 1L2UA 2OYLA 3L65A 3L4XA 4XZNX 2OKOA 4MWAB 1OX4A 5HUPA 3KCJA 2V2CA 4MG4A 2C1GA 1XSIA 4O13A 4NJJA 3WLIA 2OOFA 3LSCA 3I7QA 3IK4A 4CQ9A 1BRLB 1JULA 3UWUA 2XIJA 1BSLA 2AQOA 4UFJA 1TX2A 4S3AA 4JY9A 3AO0A 4IXXA 4J3VA 2FMNA 1Q8AA 1E4NA 1QVBA 3AI0A 3FGCB 4DXVA 4DAIA 3EPOA 1XS2A 4JCMA 3VNZA 2V8ZA 3W2JA 4O4VA 4B5UA 2ICSA 1GKPA 1FWIC 4HPJA 5EB8A 3KOYA 3R1ZA 4NZ3A 4PEKA 5AZ0A 3DENA 2CWNA 2JIEA 3IPWA 3OVQA 5K7JA 7A3HA 1RBAA 2WWCA 1A4LA 1E40A 2OGYA 3BCJA 5GPRA 2REQA 1WBJA 2A5HA 2JE8A 3WDQA 4MSSA 3GTIA 3M5VA 2Q01A 4XKYA 5AHMA 3WH9A 3SCPA 1RQHA 3C52A 2INEA 4N4PA 1GQIA 2Y1HA 3SUTA 4H04A 3N9SA 2J79A 1C90A 1W5PA 4WSJA 1UWAA 2XZ7A 2OO6A 1M03A 4US5D 1KCZA 3WQGA 4DO6A 3S1WA 1NWSA 3USZA 1O5XA 3VM5A 2ZA2A 4H7CA 3VZZA 4DUXA 2HTMA 2PDJA 1E9IA 1O5RA 2CHOA 4BF5A 4IGNA 1QPQA 3WNNA 2YPIA 1XCFA 3WD4A 2PDHA 2J6VA 2ZUWA 3ZLGA 5FESA 1QNRA 2WCSA 3USBA 1EDQA 4PB4A 3DN5A 4TVUA 1FUYA 4XAFA 3QFEA 5EMMA 4LUTB 3JUGA 3AMGA 1X7IA 4C6IA 3G1DA 4D9PA 3FGCA 3M7SA 1ZLPA 1TX0A 5DRIA 3PB2A 3I3BA 3P3BA 1REQB 4XVEA 1VFLA 4JTIA 3URAA 3AYRA 4UFHA 4YNGA 1M7PA 3I10A 1HGYA 2GLKA 4HOWA 3MU7A 1WAUA 5D09A 4HGXA 3LN3A 2XN0A 1DP0A 2VJXA 4Z1CA 9RUBA 3PBVA 4PBFA 4UCFA 4L1XA 4A2RA 4B5VA 2QIWA 2GJXA 2CLPA 3UESA 3N25A 2W63A 1WNOA 4K36A 3CHCA 1WDRA 1MW0A 1O68A 1O7AA 3B9OA 4DPQA 4UNIA 3KTSA 3VOJA 4XD4A 1RAKA 1CGYA 4IJCA 3C3NA 1YLVA 3CZEA 3IACA 3GVVA 2B4GA 2VP8A 4JTRA 5AYZA 1UIPA 3DFHA 4MJMA 3IVTA 3UJ2A 3KTCA 4JS3A 1D2KA 1E15A 3G1HA 1DBTA 5DFAA 1JRCA 1AK5A 4RE2A 4S3CA 3S2NA 1J0IA 2GPTA 1UQZA 4IFKA 5IXEA 2KZHA 4HNLA 1WDSA 2Y7GA 4XAPA 4MB3A 1EHAA 4HT3A 1YMYA 3QRHA 1JDCA 2OQLA 3SCUA 1UP2A 2DW7A 4NJKA 4UTLA 1WE5A 2Y5EA 1TPWA 3RO8A 4PMVA 5FF7A 3WIJA 4HPGA 2E9MA 4CUCA 2AQVA 1G4SA 3PTQA 1XPYA 2R1PA 2ZDSA 3U6WA 1ZUAX 1M6JA 1LLWA 1UKQA 3QW4B 1XYAA 3O8AA 2PLMA 4FA3A 1DJIA 3CMFA 1IEVA 2P76A 3D3FA 1OADA 3LBCA 2XM1A 2H8XA 3GB6A 4JQAA 3MANA 3W22A 4J3UA 5KZEA 4B3KA 1LCOA 4ZO8A 3P5ZA 2GFTA 3NM3A 2C16A 1BVWA 1SO4A 5A69A 5A5WA 2RDXA 1QBAA 1TPEA 3EWDA 4DJFD 3URBA 2BXVA 2WO5A 3HQPA 1IGSA 4F2BA 2ZKMX 4P7QA 1NJJA 1ZP3A 3FW6A 1V0MA 2V3EA 3UW6A 4FHAA 4DZ5A 1DJGA 3LI0A 3TVAA 4ZB5A 1I8JA 1M65A 4IQLA 1BQCA 3WJSA 5JIPA 4UR8A 3IJ8A 2GOUA 1B3WA 2YFNA 4ZBCA 4DZAA 4JTUA 7REQB 3CH0A 3IGXA 4NXSA 1GVEA 4V27A 4DYKA 4ZA0A 4TV6A 1RXOB 1JZ7A 3EWBX 1U30A 1OFQA 1ZQ5A 3G8RA 3FFSA 1C7TA 1F9CA 2C18A 1JPMA 3CAWA 1MI3A 1O66A 2PDKA 4WLCA 1K03A 1NOWA 1PZ0A 3W6MA 3RCMA 1NVMA 4BY3A 4D6DA 1CXHA 4QSFA 1DWIM 3T8QA 3H7UA 5JBDA 3WLNA 4RX0A 4UQ9A 3WZ0E 1JRBA 1I2RA 4E38A 1PX3A 1W3HA 2CITA 4KBXA 2GK1B 2XVPA 3DGBA 2D24A 3I65A 1TQJA 4UTHA 1VIZA 3GC5A 3PUEA 4FAMA 4LH8A 3H7RA 4UFLA 1E0UA 2C71A 4QQUA 1EA0A 1KXTA 2Z1KA 1JG9A 1Q4WA 4HMCA 1SZNA 3IJQA 2V30A 3W82A 1LQ0A 3PFMA 1UJQA 2F8QA 1AJZA 3BLKA 4AUBA 1X8CA 1Q6EA 4HHMA 1KM4A 4N4QA 3FX4A 4GGBA 3AIUA 5LNRA 5JBFA 4FO4A 1UZDA 4O19A 1MXSA 4JFTA 4L80A 3BW3A 1XJBA 1WX0A 4RLIA 1MQRA 4L7ZA 3SB0A 3CYVA 4NZJA 1ZSXA 4N02A 4Y2WA 4AG0A 1QPNA 1GOKA 3EA2A 5FEPA 2E4TA 1QI2A 5DXXA 4YMZA 3MY9A 2YDAA 2YBVA 2WVSA 2PWDA 2DH3A 4CCDA 1TTIA 1DQUA 4PN2A 3ORWA 2DIKA 8XIMA 1EJXC 1R9XA 1EJWC 3EOSA 3OODA 4D8LA 1V7AA 2OX4A 4XTDA 3E6EA 3LERA 1CZ1A 3VINA 1BWLA 3S2JA 4L4OA 3W7OA 1R6WA 3KOWA 3O7UA 3JW7A 3ATYA 4XBSA 3N04A 1GTHA 3KZSA 1RBOB 4M51A 1UYQA 4EK7A 4F48A 3KOFA 1DIDA 3AUOA 1UIOA 1HL8A 5FJUA 1NU5A 5I06A 5H2ZA 2XG9A 3T07A 3TONA 3HOJA 1QU4A 3GSMA 1FWGC 4IUGA 3SN4A 1DJWA 2INFA 3KBJA 2W6RA 1S2WA 4H8VA 3QYQA 3V35A 3L67A 3R25A 2WC7A 1KA9F 1L9WA 3GIPA 1VYPX 1KTBA 4DWSA 4ZQCA 4N9EA 4S3JA 4KCTA 1XYZA 1NF0A 2J78A 3JU2A 3EB4A 2DZBA 4RL3A 1FCUA 1KGXA 4GJ1A 1W1YA 3ITGA 4I7VA 5D2XA 4L1GA 1FY6A 3MHUA 4HZ7A 1GOIA 1IEQA 4HBKA 2V5DA 1QO5A 5HDRA 4A8NA 1B3XA 3DXIA 4EF8A 3F4VA 3EKGA 1NWTA 4DPPA 4H7ZA 3WF4A 1JCXA 1BTCA 1KM5A 3IJ6A 4GFSA 1XGEA 2Z26A 2D3LA 2EPHA 3ZZ1A 2P8BA 2VGFA 1WCGA 5J8LA 1YQ2A 3T0BA 1P7TB 3KL5A 1RP9A 3GNNA 2GJRA 2Z2BA 4GPNA 1UWTA 5M2FX 3VM7A 4MADA 1JI2A 4LAUA 3UXLA 1E55A 2BTMA 1J5TA 4YTQA 4Q4PA 3AMKA 2PRMA 1X98A 1IR1A 2WVVB 2EPKX 3UPMA 1OFDA 3U2ZA 3LRMA 1B4KA 1Q2SA 3TC6A 3OW1A 4NF7A 4G1NA 1EJ7L 5E93A 1UP0A 2FZMA 2GUBA 4UQAA 4OUEA 2OYKA 5F4XA 4QJ5B 4PYSA 1N55A 2CESA 5A6SA 2YCJA 1EA9C 1X7FA 6ENLA 4JQ4A 4EWJA 2ZRXA 3W24A 3A9BA 2ACUA 2ZQ0A 1HO4A 4XBJA 3HGOA 3ZR6A 2OB3A 4HNVA 2PCQA 4JNZA 4WIWA 2WVUA 1OT2A 2ADAA 4Q8OA 5BXSA 4MVAA 5A8NA 2NVDA 1C91A 2G4JA 4H41A 4JFSA 3VCNA 3TC7A 4RUBA 3BICA 3WK1A 4LS2A 4WGHA 5D9PA 2PLKA 2VRQA 2VZUA 1JYNA 1KC7A 4FNPA 2OWXA 5HMEA 3TOYA 1XLLA 1CTNA 1KFWA 1D7FA 1W1PA 4UQBA 1N7KA 3KRZA 3TQVA 5ENLA 4EPDC 4WDTA 1JPKA 4R3UA 4PMJA 1M01A 4ML9A 4K39A 3W85A 5D8WA 3VCCA 3OZPA 4P7NA 3OTRA 4CU8A 1I1WA 1HKJA 4MFDA 4FR1A 2WNWA 4ML4A 5HINA 1OVDA 4TQTA 3E5PA 1JF5A 1QW7A 2NLYA 1EO5A 3HQNA 4AZHA 1HKVA 1UC4A 1JI1A 2P53A 1WB0A 3MHGA 3RCYA 3LV6A 3P6LA 4IX0A 2ZUUA 1LBMA 1J2BA 4PH6A 5AYIA 4GNJA 3IWPA 2EF9A 4J3WA 5C7VA 4NSBA 1TVPA 4IMCA 5LA0A 2NX1A 1TZ9A 2ZZ3A 4HCHA 3U57A 1OZQA 2HE5A 1UWQA 4H9YA 2OT0A 4LAKA 1JDDA 2Z29A 3FIGA 4J28A 4S39A 5AC7A 1UD5A 3PN8A 1MDLA 1ISYA 1CENA 2HRWA 3AU6A 3LENA 3L2IA 4FR6A 2DZPA 2MANA 5A6JA 4MY8A 5K4ZA 1H51A 3WDPP 3M5YA 1K02A 5D37A 4QM1A 4AD1A 2I7GA 4M24A 1M53A 2PBGA 3SGUA 5LZLA 2VQTA 5AHLA 2POZA 3P62A 2DZAA 1HT6A 4ICMA 4UOZA 4IUOA 3QZEA 4BCEA 1K3UA 3CMGA 1J18A 3VTRA 5BRPA 3A13A 4MWAC 3WSUA 3FYYA 2QPUA 1UZ4A 2AL2B 4US5A 5HWMA 3WQVA 1LM1A 4R9XA 3L4TA 1AQHA 4DY1A 5U7SA 3LU2A 2VEMA 3B4UA 1FHVA 3VDAA 3GFYA 1CX9A 4C5ZA 3VABA 3IJLA 1UZ1A 3CB3A 2Z1XA 3VUPA 3EWYA 2YFOA 1AZ2A 1V6VA 4H8HA 4LAOA 4L61A 1UJPA 1CGWA 4NU7A 1R3QA 2VO5A 1H7NA 1C8YA 2JF6A 1IEWA 1W3NA 2QW5A 1R9ZA 2DT0A 3PTDA 4Q6XA 1AQFA 3MCMA 3CPRA 1TWDA 4LANA 3WNLA 1O5KA 1XW8A 1HL9A 2VFHA 5ABGA 1R3YA 4DBUA 1J8VA 1EP3A 2DZXA 2VELA 1RD6A 3P2VA 4S2CA 3PG8A 2YL9A 1W5QA 2CCRA 4IP7A 5CBJA 4HTYA 3QHMA 2HPMA 4GXPA 2YJQA 1UR4A 3WFLA 1P0EA 2B0MA 2NWSA 3GK0A 4DBWA 5M03A 1Z41A 1JFHA 4DN1A 4B9ZA 1IGWA 5A6LA 1HG3A 4MNMA 3B8DA 3DC8A 4R7OA 2DZWA 4GI4A 3VCRA 4HPNA 4DVOA 2IKIA 2PSNA 1O12A 3B40A 1H50A 1BF2A 4FNUA 2ZUVA 1BYCA 1IT0A 3G8EA 3QZAA 3E96A 2BXZA 2ZUSA 4OBSA 4HU8A 3WK2A 1J9YA 1YKWA 2ZA3A 5MKGA 3TYEA 1EF2A 1Q6QA 3QXBA 1KWKA 4FX8A 1OCBA 4K2SA 3RU8X 4E4PA 1KFJA 1IIHA 5K4XA 4ACYA 1ELSA 1W54A 3LLFA 6REQB 4PSRA 1P4CA 3MUAA 1R3TA 1XICA 1GOQA 1LBLA 4ICNA 4S3GA 4I9MA 2WSPA 2GYIA 4A4AA 3RXZA 1D7KA 1Z7AA 3KX6A 4GIEA 1BGAA 3E2VA 2NUXA 2Z27A 1J6PA 3SAZA 2BASA 1SGJA 1HJXA 1YW1A 1X6UA 4W5UA 2V5JA 4FNSA 3M0IA 1J96A 1SO3A 4ROQA 2V2DA 2ZRUA 3SUWA 3PS7A 1EEPA 1MQPA 4YYFA 3W25A 1RJRA 2JGYA 2PF8A 1WAWA 4KWSA 4Z1BA 3WYZA 2Y8VA 1E56A 3WDJA 1X6LA 4Q4MA 2W9MA 3V0UA 2PP0A 3O0KA 4JAWA 4IPJA 3OBAA 1YDYA 2O9OA 4S2BA 4RV8A 2WCGA 1ISVA 2WKJA 1EGVA 2FGZA 1ONRA 1OFAA 2D20A 4KFPA 2E77A 2EPNA 4NY2A 3AJ7A 2UBPC 4BKNA 2J7HA 4B16A 5ABTA 3S47A 1UQYA 2H9AB 2R91A 5FAJA 1GCYA 2NQ9A 1V3JA 1OINA 1M7XA 3UWVA 3ITCA 3WNMA 4CNPA 1R85A 1GORA 3PSWA 1MRQA 3BJSA 4QJ3B 4KRZA 1YPIA 3HTWA 1VEOA 1JDAA 3MI3A 3TSMA 4ZFMA 2ZXAA 3PZQA 1KRAC 1GQLA 4GYPC 5CPLA 2OMAA 1EH9A 4GXWA 1TVNA 5IM51 1NP0A 1DHKA 3ITXA 1N8IA 3N2BA 1JIBA 4WVXA 3T8LA 3QC0A 1OD8A 2PZ0A 2YCEA 2GQ3A 2PBOA 3C2FA 1LOSA 3VYLA 1TCMA 3P93A 3CO4A 3B05A 3GXTA 3NXFA 2OJPA 1AMYA 1E3XA 3EGJA 3K30A 4MAZA 5ABFB 4JFUA 1S2CA 3UWZA 3B4YA 4D2JA 2YBUA 3PZGA 1TRIA 4AB4A 3NQBA 4DELA 4AD4A 4MIMA 1W56A 2QYGA 3SW6A 3N9RA 2Y8UA 1KKOA 5I3HA 4D8AA 4GFIA 3W29A 3MZNA 4JTGA 2W92A 4WD0A 2WMIB 3MW7A 1NEYA 4JTAA 2GVYA 1CEOA 3VDHA 4AF0A 1OZMA 3BG5A 3HF3A 4HKPA 4A3RA 1US2A 5GVJA 4GI6A 3KRSA 1HXJA 1SW3A 1TUXA 3MUY1 1OT1A 4HB7A 2WZEA 4DI9A 4DZIA 1VJSA 1NM9A 4A8LA 3BSHA 1XM3A 1EBGA 4ERIA 1GOWA 4OWGA 1ZCCA 4F2UA 2DDXA 3QC3A 4K1GA 2NV1A 3GDLA 2YCKX 4CD6A 5CG7A 1R3RA 2VWTA 2X40A 4WKAA 4Q33A 1RA5A 3FY1A 3JZEA 4HMDA 2NW0A 2FB2A 2X30A 5IFPA 3QV8A 3VD3A 4W5ZA 2D69A 1UD4A 4A3HA 4RR4A 4A05A 3EEZA 4URIA 3ARYA 3UU0A 7PTDA 1TE6A 3GDKA 2GSHA 1P0BA 2D0FA 1C29A