1KR1A

Hevamine mutant d125a/e127a in complex with tetra-nag
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
273
structure length
273
Chain Sequence
GGIAIYWGQNGNEGTLTQTCSTRKYSYVNIAFLNKFGNGQTPQINLAGHCNPAAGGCTIVSNGIRSCQIQGIKVMLSLGGGIGSYTLASQADAKNVADYLWNNFLGGKSSSRPLGDAVLDGIDFAIAHGSTLYWDDLARYLSAYSKQGKKVYLTAAPQCPFPDRYLGTALNTGLFDYVWVQFYNNPPCQYSSGNINNIINSWNRWTTSINAGKIFLGLPAAPEAAGSGYVPPDVLISRILPEIKKSPKYGGVMLWSKFYDDKNGYSSSILDSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expression and Characterization of Active Site Mutants of Hevamine, a Chitinase from the Rubber Tree Hevea brasiliensis.
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Hydrolase
molecule keywords Hevamine A
total genus 100
structure length 273
sequence length 273
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kr1A00
1Q4NX 3PZGA 3VIMA 4PSPA 4MJ2A 1V0KA 1JYWA 4AIEA 2EXOA 1XD1A 4Z2IA 2D1ZA 1GHSA 1UOKA 1WNOA 1E56A 5F7UA 2FDMA 3MS8A 2UY5A 2D3LA 3WL0A 4K68A 2UY3A 5FD0A 2F8QA 5I5RA 1FH7A 1MW2A 5CZKA 5BRQA 2D22A 5FL0A 1GQIA 2DT2A 4UQBA 2WMGA 3W25A 2CETA 3GXMA 3VNZA 3J7HA 1W9VA 2PF0A 1HJVA 5IFPA 1MQPA 3W26A 3VGHA 1CXIA 1NH6A 1GOMA 4PUEA 2OSYA 4W88A 2OWXA 2BHUA 1PX8A 1VBRA 4E8CA 2JIWA 4J3SA 2E40A 4BF7A 3ARVA 3VM5A 4HOZA 3VDCA 4DUVA 1GPFA 3F5LA 1BYAA 2XFYA 1C8XA 2PC8A 2E9BA 3VMOA 2VR4A 4H04A 2XPKA 2D0HA 3WQVA 4CD8A 3UG5A 5HXMA 5C70A 1WO2A 7A3HA 3BLPX 4ACZB 1PAMA 3PZUA 4M8UA 1LJYA 3CMJA 3L4ZA 4X0NA 3ZSTA 3EMQA 2J7EA 1GW1A 5BXPA 3WD3A 2EEXA 3L4WA 1GNXA 2CBVA 1BFNA 3MSGA 1E0WA 1UD3A 2WBGA 4E8DA 1E3XA 3GH4A 3U57A 5DT7A 3DHUA 4QCEA 1CXLA 3OB8A 5AC4A 1W2VA 1EH9A 1HKIA 2W67A 4FK9A 5CSYA 2X2YA 4PMYA 4HOWA 2ZUVA 4NSBA 1HT6A 3PTQA 1V6VA 1W9UA 1Y7VA 4KGJA 4N42A 3GBDA 5BCAA 1D3CA 3ARSA 1E4LA 4TX8A 3N11A 3AYRA 1ZBKA 3ARQA 1KGWA 4P8VA 1OSEA 5GNYA 5E0CA 1Z32X 2WMHA 2DSWA 5DFAA 2JIEA 4MPKA 3THDA 4AZGA 1WDSA 4HPHA 2WLYA 4UQEA 2JF7A 3VGDA 4IPLA 1OT1A 4AIUA 1V3LA 2DEPA 5IHRA 1KWGA 1OGSA 1ISZA 3VD5A 1E6QM 3WF2A 1VEPA 3WQ6A 2WC4A 4LGXA 5HDRA 2XJ7A 1UWUA 2EPMX 1KR1A 4D6FA 3WUEA 3W27A 3TTSA 1QBBA 3BAYA 4W8LA 1AQHA 3AS1A 5IHSA 1GORA 1E5NA 4CGTA 5JBDA 4GKLA 3NCOA 3VILA 5M17A 4UZSA 3FHQA 5D4YA 4Z2LA 1GVIA 1GQLA 1SMDA 3WNLA 2VRQA 1GONA 1LL7A 1J0HA 3WF1A 1G0CA 1BYBA 2G41A 1MWOA 1QHOA 2OWCA 2J25A 3MUAA 2VMFA 5A8OA 3SUSA 2CERA 1QI0A 1UYQA 2VCAA 2OWWA 3WD1A 2YDQA 1HJUA 2FHFA 3FAWA 1QNSA 4HA1A 4PMRA 3AHVA 1JG9A 3W0KA 5FL1A 2VO5A 3GBEA 1H2JA 1GHRA 4BQ5A 3WY1A 1B31A 2E8ZA 1UD5A 4F9DA 1BLIA 3MV01 1G5AA 1OBAA 4AEEA 1JXJA 4TTUA 3VDBA 3MO4A 5FKYA 3GM8A 3AOFA 3VGEA 1OB0A 3N1AA 4FF5A 5HPCA 3VMNA 4AZCA 4D6JA 1FA2A 3N17A 1K9DA 1UKOA 1E5JA 2ZUSA 4GINA 3K8LA 9CGTA 1GVYA 1ITCA 1CGWA 1QNRA 5E9AA 3VMPA 4TVCA 1JZ7A 3GNPA 3W82A 1E6ZA 1OD8A 3LPPA 4DM2A 2DGAA 1BPLB 1NOWA 3APGA 1JDDA 2VCCA 2HVMA 1JI2A 5E0FA 3AIVA 2BHZA 4HTYA 1ZS2A 1U33A 4DWSC 3WDJA 3I3BA 1XC6A 2GUYA 2HISA 2XIBA 3WD0A 5ABFB 4RE3A 4AD2A 1ODZA 4P7QA 3EYPA 3CHDA 4AZIA 1JZ4A 2EJ1A 1MW0A 2VQUA 3T2QA 2EPNA 3FY1A 1G1YA 4L4OA 1KXQA 3WSUA 4CD7A 2DT0A 1J9YA 3L4XA 1UWIA 1UWRA 4AZ7A 3VM7A 1R87A 4AD0A 5A2CA 5LA1A 2CCRA 2VQTA 1GZJA 2OLHA 3ZT7A 2W63A 2D3NA 3RCNA 4BQ3A 2WWDA 4CVUA 2GJPA 5BWFA 1ZB5A 4FLSA 1AQMA 3SUTA 3VKKA 1NARA 3CZEA 1ZBWA 3OG2A 1UKQA 3CUHA 4P7NA 2WVVB 4HMDA 2EPLX 1TA3A 2CBJA 4GZEA 1E1EA 1WCGA 1YQ2A 2WB5A 2JEQA 4AWEA 1BG4A 1DWHM 4PTWA 2WZHA 2AOSA 2VURA 3NDZA 1DTUA 5E09A 2PWHA 4OKDA 2VI0A 2WBKA 2XG9A 2YL5A 2X0YA 4D6IA 5CJ5A 3BCDA 2G8ZA 3PBGA 1A3HA 1V3IA 2XGIA 1H11A 2VRKA 1LLOA 1BGGA 1QI5A 4W8BA 1CENA 1HL8A 3VPLA 4RE2A 3SCVA 3QR3A 2PWFA 4JKLA 1CLXA 1W91A 1AMYA 1E71M 1EGZA 1GJUA 1JYNA 2ZUWA 5HBFA 1Q6EA 2XSBA 4BQ2A 2WZIA 1FH8A 5A6LA 4DWSD 3VX1A 4TVUA 3TTYA 2YL9A 1TCMA 1JAKA 4HZ8A 1C91A 3FAXA 4U2YA 4WSKA 1LL4A 4URIA 4W5ZA 4PN2A 4GXPA 1WKYA 1JYXA 2QLYA 1QVBA 2CEQA 1V0NA 3MUZ1 3AMKA 3AXXA 2ZUNA 1X1NA 1H09A 1NWUA 3W53A 5A6SA 4JKKA 4PUDA 1M7XA 1UD4A 2IXVA 3A47A 5HOSA 4AISA 3BAIA 2XFRA 4J3UA 5DF0A 1UHVA 1W9XA 3SCQA 3AIEA 1P6WA 2GJXA 2RGMA 2VC9A 5ABFA 4HMEA 3UR7A 1JD9A 1QNOA 2MANA 1JD7A 3BAJA 3N13A 4PMVA 2Y24A 1NOUA 3NSNA 2DIJA 1PJ9A 1K6AA 5I24A 5CLWA 3OZOA 3GH7A 4YHGA 2VX4A 7CGTA 2XHYA 1E15A 4JFSA 1TG7A 4ACYA 5LA2A 2XVKA 3OLDA 4CCCA 4JAWA 4EK7A 4CN6A 1WZKA 3O6AA 1W1VA 2XVPA 4H7VA 1GCYA 2W61A 4MAVA 1VF8A 3CLWA 1ISWA 4OBSA 4PMUA 4JL1A 3WQ4A 1HL9A 3JUGA 1BVNP 3MU7A 4JHZA 4CVWA 3PHAA 1E40A 4W93A 2XSAA 1NP0A 1W9BM 5GNZA 5A3HA 1DWFM 2E8YA 4FMVA 1CIUA 3AISA 2XYLA 1V02E 1J0ZA 1HJSA 1OM0A 3DYOA 3L4YA 4ZXLA 2WZEA 1BYCA 2E0PA 2CBIA 2EPOA 1AQ0A 4D71A 1BGAA 2D2OA 2J7GA 1EXPA 2WMJA 4WIWA 2W5FA 4OBRA 4UQ9A 2IXUA 4H8UA 4PMDA 2UY4A 1CDGA 2IUZA 1B9ZA 3PZIA 3THCA 3T0DA 3WUGA 2ZWZA 2ZXQA 4UQDA 3WF4A 4CCDA 1WP6A 3CGTA 5JIPA 1IV8A 1UZ1A 1XGZA 3VIHA 1E6NA 2BY0A 1WDQA 5GPRA 1UKPA 3SUWA 3IJ9A 1W1TA 1HNYA 2YA2A 4EE9A 3VDAA 3B8SA 1KWKA 1CLVA 2NT1A 4MB5A 5CPTA 1UR2A 4QAWA 2FGLA 3ZSSA 1K9TA 2ZX7A 1E1FA 4PSRA 1X6NA 4OOZA 3HU7A 3A6OA 4DWSA 3AJ7A 3WNKA 2WLZA 1R86A 1J11A 1G9HA 3MUY1 2WYSA 3NIYA 4PMQA 3VO0A 6TAAA 3FW6A 2WMFA 2YLAA 3PZTA 3CIVA 4P7RA 5A8PA 2PWEA 5BYWA 2J7BA 3N12A 1IZKA 5I0DA 3K1DA 1ZJBA 2XTKA 2QMJA 2D0FA 3NSXA 2O9TA 3POHA 3AIUA 4KWUA 6A3HA 4DUWA 4CD5A 1E0XA 1RP9A 4E2OA 3FXYA 2WNWA 5AYIA 3K8KA 3EMCA 4U31A 4XUYA 3PTMA 4JL2A 1MYRA 4CU6A 3BCFA 2QMKA 2J79A 1CXHA 1QHPA 4BZYA 1H3GA 3LPGA 4Y7EA 4AXNA 3HN3A 1HN1A 4X0VA 1OIFA 1LL6A 2FH6A 4MADA 4B15A 3OA5A 2XFFA 4JFTA 1US3A 4GIAA 1CXFA 2JE8A 1PEZA 3RILA 3MUIA 3PTKA 1ECEA 2D20A 3F4VA 2XVGA 4TX6A 5I3DA 2W4XA 1KXVA 3SCPA 4PMXA 1WB0A 4OUEA 1QPKA 3UR8A 1KGUA 1UZ4A 4XZWA 3WQ5A 1NWSA 3EDDA 3L4TA 4U3CA 1V0LA 4UFKA 3WEOA 3TTQA 2A3CA 2J62A 1NM9A 1OIMA 2GK1A 1TZ7A 3CZGA 4CUCA 3BSGA 2E4TA 2O9RA 1XRVA 4MDOA 5BRPA 3AS3A 1JZ2A 2DPEA 3EDFA 1BAGA 2G3NA 2ZXAA 2ZUMA 2GSJA 1JDCA 1VFMA 5A2BA 2WHJA 1E6RA 2CESA 2QHAA 1JF6A 4PMZA 3IAQA 4TOQA 3K8MA 2V3FA 1XV8A 1VRXA 1TMQA 1ZL1A 4UZUA 3VNYA 2GJXB 3EMZA 1MFVA 4H41A 2Z1SA 4UFMA 4Z2HA 5DEZA 2AMGA 3A4XA 3CHEA 2OSWA 3S6TA 3VINA 2VZUA 4QFUA 1KR0A 4F79A 3CZJA 1J0YA 3DYPA 5LYRA 2D0GA 1JZ8A 4TTGA 4NRRA 5I78A 3SCTA 1OWQA 1UQZA 1QOXA 3KWXA 1KGXA 1LG1A 3HJEA 1W3JA 1ISVA 1A47A 2YBTA 4AMCA 3WN6A 4MB3A 3IJ8A 1E4NA 1J12A 4X9YA 4EKJA 2Y2WA 1CNVA 3WH9A 4HZ7A 1W1YA 5I2UA 3WENA 1MQRA 2XWDA 1UKSA 1JXKA 3VDHA 2CXGA 4GQQA 1Q6CA 1Q6FA 3GNRA 3LMYA 3T0BA 1EA9C 5FOOA 1UR8A 3AHZA 2WC3A 3WH7A 2JFEX 1I1WA 2WHLA 1E70M 4ZEPA 1WDPA 4M24A 6CGTA 1TE1A 1QBAA 4AD1A 5A69A 3W24A 5D9NA 5CG0A 1J18A 4PRWA 1UD6A 3WQWA 3GZAA 2V3DA 2OYLA 1C90A 4JFUA 2BVDA 3AHYA 5GQBA 4AZHA 1CPUA 3VGGA 8CGTA 4EAMA 1E55A 1FHLA 2FHBA 1PIFA 1QW8A 1KCKA 3KL0A 4NZCA 3UG4A 2FH8A 3WEMA 3N15A 5BXRA 1S46A 3CTTA 2WC7A 3CHCA 1CXEA 4M29A 2VX5A 1QI2A 2Y8VA 2WXDM 2PBOA 1VEMA 2D24A 3SEPA 1CEOA 3WDIA 3W38A 4MJ4A 4JCMA 3RJYA 3RM4A 5A6BA 4P8WA 5A6BD 1GJWA 4PBGA 1OT2A 4HMCA 3ARXA 2XM1A 5I77A 5A95A 4AD5A 1C7TA 5BXSA 2C8NA 1XD0A 5EMYA 4GI8A 4CKQA 1C8QA 3VIPA 3O2LA 5E6YA 4OJYA 4WKHA 3VD3A 4JZ5A 4HZ6A 1HVQA 2O92A 5A8QA 3D3AA 4KRTA 4AY1A 3ARRA 4J27A 1B3WA 1F4HA 1V3MA 3VOCA 3T0AA 4TVDA 2QF8A 2WCAA 1HJWA 2PBGA 3N04A 3UERA 2DT3A 4WLCA 4V2XA 4W8AA 1GOIA 1XYFA 2CITA 3CPUA 2ZXDA 4NI3A 4JCLA 1UD2A 1Q6GA 1ZBVA 4WKAA 5TD4A 1GOKA 2W66A 1EQPA 3FN9A 2QPUA 4MB1A 5JIWA 2WK2A 5M3WA 3L2MA 4WKFA 5DO8A 3CUGA 3WD2A 2WVSA 2YJQA 3OZPA 3OBAA 2FGZA 1C8YA 5A6KA 3WKZA 4W7WA 5D8ZA 1B90A 4IUGA 3IAPA 4AZBA 3FHAA 1DHKA 1C93A 3G6MA 4J3VA 5E70A 5CPSA 2WWCA 5ABGA 1ESWA 3UCQA 1V6XA 1JZ5A 2F2HA 2BVYA 2EO7A 4WF7A 4W86A 3SUVA 1R8LA 4W84A 1BHGA 3W6LA 1CZ1A 1UKTA 2WMIB 5CXPA 1HX0A 1W3HA 1E3ZA 3BMVA 2EQDA 3BLKA 3T09A 1QW9A 3QHMA 2DH3A 2GFTA 1J01A 2NT0A 5AY7A 1D7FA 1JAEA 2WSPA 1GQKA 3HMCA 3MSDA 4OIFA 2VVNA 4W7VA 4UOJA 1E43A 5D9MA 3T2OA 1B3VA 1UA3A 1WDRA 1XSJA 2VJXA 4A3YA 2J7DA 4J28A 1JDAA 3QHNA 1I1XA 3CMGA 2PWDA 1O6IA 5D9OA 4D6DA 1TFVA 1XH0A 3W29A 3WUBA 2CYGA 1VJSA 1UWQA 3ARZA 5JUVA 1HJXA 3WDQA 1J0IA 5FIPA 4V28A 4CN1A 1PZ2A 4UFIA 5A8MA 3BC9A 3AQUA 4GI9A 5BXTA 4D6GA 3RJXA 3O9NA 2NW0A 3L2LA 3DECA 2UY2A 4PEEA 2O9PA 1UR0A 1H0GA 3VUPA 1RP8A 2UWFA 3M6DA 4MDPA 4AD3A 2WCSA 4HPGA 1BYDA 2ZWYA 4CN4A 3NSMA 3WMCA 1LQ0A 4H8VA 1XCXA 2ZIDA 1RH9A 1V0MA 3CZ8A 4HP5A 1B3YA 1ZJAA 1EDTA 3MMDA 1E6PA 3G6LA 1XSIA 1EO5A 3TTOA 4UFJA 2J8GA 1KQYA 2VZOA 2A3HA 2G4FA 3WDRA 2VL4A 2ZOXA 1M01A 3SURA 3ARYA 1KB3A 4IPNB 5M5DA 4PYSA 3PN8A 4KMQA 4LQ1A 1PIGA 2DSKA 2E9MA 3SCUA 5GNXA 2DQXA 3NDYA 1L0PA 4MNMA 5EFFA 1CGXA 3VGFA 3FNDA 4PTXA 3U5YA 4U2ZA 5EB8A 1BF2A 1IT0A 2BY1A 3BSHA 1WZLA 3W37A 3RIKA 3A3HA 4UQCA 3WD4A 3KE0A 3U5UA 5CGMA 1XCWA 2J47A 1JZ6A 4BS0A 4UFLA 3VIFA 2V38A 4M1RA 1QI3A 4D6HA 1W9DM 4F9JA 3RO8A 4RE4A 4BCEA 1QHZA 1HF6A 2E9LA 5D9PA 1DWJM 2X05A 2DT1A 2WHKA 1SMAA 1H1NA 2EBNA 2G3MA 4MAZA 5EBAA 3CZKA 4D1JA 2PWGA 2YA1A 3ZR6A 3GH5A 2J8FA 3QOMA 4J3WA 3GXFA 3EBVA 4ZXOA 3CUFA 1AVAA 2WANA 4UNIA 3ZT5A 3WNMA 1KXHA 5A6AA 1PPIA 1HVXA 1HXJA 3ZOAA 1CGYA 2FHCA 2J7HA 1K9EA 4C7FA 2YBUA 4HOXA 3WMBA 1GOOA 3L4VA 2BY3A 1V6YA 3VU2A 3W81A 1V6UA 1UH2A 1SFSA 3B9DA 4NF7A 1G01A 1E6XM 3WFZA 4UOQA 5C71A 3GTNA 3AHXA 1W1PA 2CHNA 1FP8A 3WNPA 1VFOA 3GYCA 5KEZA 2C0HA 1G94A 4UOZA 2DH2A 4WJXA 2D23A 2WMIA 1XH2A 3SUUA 2BS9A 4J3XA 1EDGA 4WK9A 3VIIA 7TAAA 3VIJA 1HP4A 2WVUA 5HPOA 1DWGM 1ISXA 1XH1A 3SCWA 2V5DA 2BFGA 4U3AA 1YHTA 3F5JA 3WBEA 1UUQA 2QV4A 1J0JA 1JGIA 1GOWA 2WW5A 2J4GA 4D6EA 1RPKA 1R7AA 2ZUTA 2YOCA 1OCQA 3K4DA 1E72M 1DP0A 1C3FA 3KZSA 4TUFA 1WPCA 2ZE0A 3F5KA 1MXDA 3WH5A 3B9EA 2BXZA 2BHYA 1EOKA 4D72A 3ECQA 4AZ6A 1B0IA 1FFQA 3VVGA 3ZT6A 1UR9A 3GDBA 2DDXA 2ESCA 4IISA 1E6SM 2X09A 3ALGA 1EOMA 2WPGA 3VTRA 4DM1A 1UH3A 1PX4A 1M04A 3MMWA 3NUKA 2J78A 2XM2A 4C7DA 5D8WA 5CQ1A 2X8RA 5IFTA 1VENA 5A6MA 1DWIM 4AD4A 4H2CA 5A8NA 4HA4A 4H8HA 3AS2A 2ZX9A 4S3JA 2YLLA 4OZOA 3QOKA 1W2PA 1OD0A 4LYPA 2AAAA 1V3KA 3MKKA 1E73M 4GO9A 1H5VA 3ZJ6A 2WHMA 1CGVA 3M7SA 4OOUA 1C92A 1NWRA 2YDRA 1WE5A 3AMDA 3PZQA 3M46A 2PB1A 3AI0A 4RL3A 3CUIA 1HKKA 1H0IA 1FFRA 3RDKA 3GXIA 2VTFA 4U5IA 2JALA 3ZM8A 1LF1A 2J77A 4XB3A 3WL1A 1JIBA 2VX6A 2WAGA 2DSZA 2X0HA 3CH9A 1W3LA 3DYMA 4AYSA 3ZMRA 4LX4A 3AICA 4R5EA 4M80A 4W7UA 4Z2GA 3BXWA 3VD4A 1PX3A 1TR1A 2A3AA 3AYSA 4GI6A 2J75A 4ZENA 2VVSA 2F61A 3WF0A 5CLTA 3SIMA 1UWSA 3AS0A 4LYQA 4UR9A 3ZJ7A 2OYKA 1DWAM 1LWHA 3BAXA 4AZ5A 2YIHA 3N18A 2C7FA 2GDVA 4E4PA 2CKSA 4QLJA 1C7SA 1EIBA 3AXHA 4UCFA 3NYDA 2JF6A 2DSUA 4PTMA 4CD4A 3WDPP 2VZTA 3TONA 4Q22A 2VCBA 1HJQA 3ARUA 4CU8A 3WH6A 4ML4A 3UEQA 2CNCA 4HA3A 1WAWA 4B9ZA 3RMEA 4P7OA 4FLOA 4M82A 2WVVA 1QNPA 1EHNA 1B3ZA 2DSVA 4DWSB 1B3XA 3KL5A 1JI1A 2XIIA 3LPFA 8A3HA 1PBGA 1R85A 4ZE4A 1U2YA 4ACZA 5A94A 2Y5EA 1BG9A 4GZJA 1HKMA 1TA3B 5A2AA 4NRSA 5HNNA 1K9FA 1BVZA 4M56A 4A3HA 1ZBCA 1ODUA 4KH2A 5ABEA 5I6SA 1L8NA 4JFVA 5BROA 1H49A 2OSXA 4B9YA 3AIRA 2WMKA 2PI6A 4LPCA 4B16A 4PTVA 1B2YA 4GO8A 5AC5A 3VX0A 2GJRA 2O9OA 4N0RA 3AZRA 2B31A 5DMYA 3AIBA 3SCSA 3GNOA 3SCOA 1NQ6A 2ZX8A 3IK2A 1JFXA 3KL3A 4R27A 5M03A 2ZX5A 5CSUA 1VFUA 1KBBA 1V02A 2XGBA 4F66A 4FLRA 2EPKX 1OGGA 5C8BB 5A1AA 4S3KA 5FCZA 4FLQA 4AC1X 3DC0A 5IDIA 2YL6A 1KQZA 4MNKA 2J74A 4Z2KA 1UH4A 1VJZA 4HU0A 3IANA 4UQAA 5JBEA 4LYRA 3PZNA 3ZJKA 2ZXBA 3IJ7A 3VIOA 3PZMA 1UA7A 3WEZA 3WNOA 4D1IA 3ZR5A 3VGBA 4IM4A 5EFDA 2YDSA 2GVYA 4B3LA 3WH8A 1EQCA 3ZJ8A 1XHGA 3B9AA 3OLGA 2VZSA 5IXEA 1R7OA 3EDEA 4W85A 3I3DA 1PZ3A 4P7LA 3VIGA 1CGUA 5AYBA 4PMOA 4QLKA 1CBGA 2VUYA 5I23A 4AZCB 3OGVA 3PZOA 4PCSA 3ZIZA 1UQYA 5ABHA 1GUVA 1VBUA 3MV11 1UR4A 1JFHA 5KZ6A 3WFLA 4U5KA 5CGTA 4GZIA 3E1F1 4PCTA 1QNQA 3ARWA 4YPJA 2ZX6A 4C7GA 2Q8XA 1V3HA 3WF3A 4XV0A 1E9LA 4WSJA 2WVTA 1ZU8A 1OGBA 1QI4A 1MVYA 3UESA 3MMUA 5JBFA 2GDUA 1EHAA 1D2KA 3ARTA 3ZO9A 2WKLA 1US2A 4ATDA 3EDKA 4UFHA 4EANA 4CD6A 4MB4A 4W5UA 2VT0A 2VR5A 2Z1KA 2V3GA 3WELA 1UD8A 3AFBA 2VRJA 2YA0A 4P8UA 3AIQA 2J7CA 1OINA 2ZICA 3W6MA 3POCA 1JNDA 2XVNA 1HKJA 2WKGA 3OLIA 2WM0A 3VD7A 3PZ9A 1H41A 1E4IA 3W4RA 4HU8A 3K46A 1FH9A 1JL8A 3EDJA 4CU7A 3WQ8A 3AMGA 2VX7A 1GQJA 3NJ3A 3AMCA 1HIZA 1V08A 1HP5A 2XVLA 3N9KA 1SR0A 1NWTA 1KXTA 1BQCA 5CPQA 4PMNA 4MNLA 2CHOA 1ISYA 1U30A 2E3ZA 2W92A 3BAWA 1O7AA 2QPSA 4CCEA 1JYVA 4QP0A 3CBWA 3ZQ9A 4ZFMA 2BNJA 1UWTA 4A4AA 1RD6A 5ECUA 4M81A 1FOBA 1JZ3A 4B3KA 4F8XA 2ZUUA 4QDMA 1UG6A 2VZVA 3OLEA 3ARPA 3WDHA 2G3IA 1VIWA 3RM9A 1MQQA 1MW3A 1FP9A 5I79A 4MNJA 2NSXA 4BA0A 1FHDA 4ZE5A 1KFWA 2RGLA 4JIEA 3UETA 4ATLA 1V03A 3WIJA 3II1A 1MXGA 4KGLA 4YN5A 3WMSA 2XWEA 4QCFA 1MFUA 3AROA 1W9PA 4KRUA 1JNEA 3BAKA 2DIEA 3AHTA 2CIPA 1CGTA 3BMWA 1CXKA 2J7FA 3RPMA 1V6WA 1TVNA 1EO7A 1NOFA 4DUXA 1F4AA 2W62A 3BH4A 3T2PA 2CPUA 1CTNA 3KEHA 2Y4SA 1M53A 1WZAA 2YL8A 1X6LA 3U7VA 3SCRA 3AXIA 4MTVA 4Z2JA 1V3JA 1BTCA 1I75A 3VD9A 2BVTA 1E4MM 2TAAA 1WZMA 4JFWA 1TVPA 1VAHA 4JKMA 1NP2A 3L4UA 3TP4A 3QHOA 3WBAA 1GOQA 3T08A 3A4AA 4V27A 2OYMA 1KCLA 1E0VA 2BV9A 3A4WA 4W89A 1XSKA 3W28A 2A3EA 2CBUA 3RM8A 1VB9A 5A6JA 3AIWA 1EDQA 3CUJA 2GK1B 1JF5A 1W32A 2WCGA 1VFFA 3QGVA 1TUXA 2VNCA 1MW1A 3M07A 4P8XA 4Q7NA 2JEPA 4LXFA 1ITXA 4XZBA 4JHOA 4XX6A 1KBKA 4J7RA 2Y8KA 2BY2A 4L4PA 1H4PA 3DHPA 3AMLA 3TOPA 3OGRA 4AIOA 1W3KA 3CO4A 5DT5A 3S2CA 5E6ZA 4TXEA 2W91A 2CKRA 1IZJA 2BXYA 2V3EA 4AW7A 2WSKA 3LPOA 5LA0A 2G3JA 4J3TA 1J0KA 3AZSA 3MANA 2A3BA 3VIKA 1LWJA 1CWYA 3OIHA 3U7BA 3WUFA 3UG3A 4BQ4A 4U33A 2X1IA 4QLLA 1VEOA 3GXDA 3OGSA 3CHFA 1LG2A 3I3EA 1CECA 3SCNA 4UTFA 1M03A 3CZLA 4YHEA 1J10A 1Q6DA 4W87A 3D5HA 1N82A 3BGAA 1SYTA 4AEFA 4ATWA 3AZTA 4GQRA 1BSIA 3WNNA 3K4AA 3ALFA 1DEDA 3PZVA 1CYGA 1XYZA 2V5CA 1B30A 4D6CA 2VOTA 3TA9A 1UR1A 1B1YA 4GPNA 2XUCA 2YKKA
chains in the Genus database with same CATH superfamily
2ZADA 3PZGA 1QJWA 1V8EA 3S5YA 2EXOA 1LT8A 1GHSA 1UOKA 1W56A 1E0UA 1EXBA 5F7UA 3E0WA 1WQ5A 4HCDA 3FYYA 1ZY9A 4ZOAA 2VWTA 4DI8A 2OU4A 1W1A1 4LVGA 4UTHA 3I4KA 2PDFA 4HYWA 2AQWA 1MW2A 2VEFA 5BRQA 1TYGA 4AF0B 2D22A 3L0NA 3W25A 5I07A 2ALDA 3GXMA 3E2RA 4B5VA 1QK2A 1FWBC 5H2ZA 4GACA 2PF0A 1ME7A 5IFPA 1MQPA 4WCJA 3A9BA 4LVBA 3CS2A 4PUEA 4O0KA 2OSYA 1OFPA 1IQ8A 1EP1A 3UXKA 1JCLA 4GNJA 3RU6A 4BF7A 2Y62A 3UJEA 1GPFA 3PP7A 2XFYA 3C3UA 1UB3A 3ZVHA 4IPIA 5G4EA 1C29A 1H1YA 8RUCA 1LDCA 5AECA 3T0CA 1TX2A 3UG5A 1BRLA 7A3HA 4ACZB 2NQ9A 4JTAA 3EKZA 3NXFA 4DPQA 3KLKA 1VPYA 2P8CA 4N4QA 2GLKA 4G7EB 3C61A 4X0NA 2ONEA 2BDQA 1WXYA 2J7EA 1GW1A 1W3NA 4IJCA 4E8DA 3UZJA 4UMBA 4QTGA 1JCXA 4C6MA 2VOMA 3B8UA 4QCEA 3OB8A 2J8TA 2HNHA 2I7GA 4NJHA 2G97A 3B9NA 4HOWA 4NSBA 1DTNA 4ASTA 1HT6A 1Q8AA 1AK5A 3RU8X 5EBUA 1W9UA 3UWYA 3QRHA 4AHPA 3LENA 5SWUA 5BCAA 4C6IA 3G1HA 2PGRA 1E4LA 4I9JA 4TX8A 1H7RA 2D2JA 2PGFA 3AYRA 3NURA 2OLSA 2YXOA 1FDZA 3ARQA 4PULA 4P8VA 1OSEA 5GNYA 5E0CA 2ZFAA 1XIFA 3C0LA 5AB3A 3W7OA 4PB3A 2RUSA 2HEJA 1OFEA 1OCNA 2XINA 5JQ9A 4IPLA 1SQ7A 1E6QM 3WF2A 5I09A 2QCMA 3C0QA 3ITTA 2PTDA 5HDRA 2PGEA 4AHQA 1M41A 1UWUA 3PB2A 4H1ZA 3W27A 1EYWA 3GXTA 3TTSA 3CEUA 1QBBA 3LHVA 4AX7A 3BAYA 2XDFA 2AKMA 4CGTA 1Q2SA 2ISWA 4MWAE 4XTIA 1ZJHA 3LLFA 2B81A 2VEPA 3A24A 2PTWA 2QDHA 1GVIA 1GONA 1BYBA 1OVDA 1MWOA 5I03A 5XIMA 2J25A 1GYMA 2Z1BA 2H8XA 3MUAA 2VMFA 3NOYA 3B4UA 1R30A 1UYQA 2OWWA 5AYYA 2FHFA 1QNSA 4PMRA 1TJPA 3AHVA 3C2YA 2VO5A 1H2JA 1GVQA 3WG6A 1GHRA 3UXIA 3R11A 3CMFA 1V77A 3QEZA 1QOQA 3EB2A 4TMBA 4F9DA 1DV7A 1OBAA 3H53A 5FF7A 1A5LC 3MO4A 5G2IA 1YIXA 3LHTA 4FB7A 4O11A 1VCFA 2GQ9A 2GUBA 4QG8A 2H90A 5HPCA 4AZCA 4D6JA 1LBMA 1UKOA 2ZUSA 4CQCA 2HQAA 1MEHA 4R3UA 4YNGA 3F4DA 1QNRA 3RN6A 4RZBA 4JX5A 3BANA 3NL6A 3LPPA 4P2VA 3MYPA 1D7KA 2ZRVA 1JDDA 2VCCA 3PVFA 2ZZ6A 2DZPA 4HYRA 2FZ8A 4D8ZA 5ENLA 3I3BA 2PDJA 1R3YA 4MLRA 2HISA 5DY3A 4B2DA 5ABFB 2DUXA 1XLIA 2XN1A 4RE3A 4Y96A 1ICPA 2O4MA 4AZIA 5AC6A 4EX4A 3CWHA 2C3ZA 1MW0A 3FY1A 1G1YA 4CD7A 2DT0A 5FF4A 3LSCA 3MUXA 4NQ1A 1UWIA 2YYUA 4YTRA 1FXPA 1VPQA 4AD0A 1GZJA 4Z1BA 1OX5A 4XVDA 3HM7A 4FNUA 3TYZA 1FWIC 3B0PA 3RCNA 3D46A 3CQHA 1OX4A 2WWDA 4LFYA 6REQA 3REQB 2GJPA 3JRKA 4FX7A 3N73A 1ZB5A 3AYTA 2PDUA 1S1RA 4HU3A 3VKKA 5AHMA 4RDZA 4FIQA 1ZBWA 2QNEA 4LNCA 1RPXA 3CUHA 5AYZA 4P7NA 3CH0A 4DNHA 3UWZA 2BASA 2VEMA 3CWOX 2Z4GA 2GWGA 2JEQA 4YCPA 2WZHA 2V2CA 1TJ0A 3UZ5A 4QX4A 2OKTA 3IK4A 4Q8WA 1DXFA 3QR0A 3EOEA 2WBKA 4D6IA 4GY0A 3BG9A 3PBGA 1MDLA 1XLDA 1LLOA 4I5XA 5E1QA 1QW7A 4JKLA 2GUUA 1DBTA 1GJUA 1O1HA 2YFNA 1Q6EA 2XSBA 4WDXA 2ZDSA 5A6LA 4DWSD 4HVXA 3UQNA 3IJ6A 2FZDA 4ZCWA 3M16A 3TTYA 2YL9A 1TCMA 2QCNA 1C91A 3FAXA 1PZ1A 4PN2A 1JYXA 2QLYA 1OG6A 3PJWA 3W22A 2QCEA 3WLSA 3B04A 3BURA 1CCWB 3MUZ1 3AXXA 2Z6JA 1X1NA 1NWUA 1M7XA 3KS6A 4I90A 5HOSA 3AXKA 4MWAD 5DF0A 3GG7A 3QXBA 3WJXA 1H5YA 1UHVA 6TIMA 4HA0A 4Q8QA 2VC9A 4HMEA 3LB0A 3SJNA 2QIIA 3KAOA 2NLYA 1JD7A 5BOOA 5LXXA 1NOUA 2DIJA 1K6AA 3QPYA 1FWHC 1Z42A 2PDPA 3GH7A 2HNEA 2VX4A 7CGTA 2XHYA 3G2GA 3FVDA 3P8IA 1TG7A 4OWGA 5LA2A 4ACYA 2XVKA 3OLDA 4OTKA 2NWRA 4CCCA 1G7VA 2VFEA 4H6EA 4LUSA 3SY5A 3O6AA 3I4EA 4TQTA 2PDHA 3UWWA 2E6YA 1RBAA 3WQ4A 3UT0A 3RLGA 3M1ZA 3FGCB 4EP8C 3WBWA 4Y9AA 4X3ZA 3PHAA 1E40A 3NQMA 4GIYA 1ZQ5A 5DY2A 1F6KA 1Q6RA 1Z7AA 1P0DA 4QM1A 2VP8A 3EKGA 1CIUA 1V02E 1RALA 3T8QA 3L4YA 2WZEA 1TR9A 4GFIA 3NQ8A 3ZVHB 4NL1A 1I2NA 4KCUA 1OX4B 5BOEA 1WDWA 3MT1A 4OBRA 2FDSA 4QDWA 1B9ZA 2V8ZA 3W1XA 1REQA 2ZWZA 2ZXQA 4YWSA 1PSCA 4DJDC 1WP6A 3FKRA 3VIHA 1MRQA 3R25A 1UASA 1DXIA 1K02A 1XQKA 1UKPA 2YA2A 1XLBA 1IHIA 1YNYA 2GYIA 2RHGA 3PPCA 4ZO6A 1BWVA 3JVAA 4GX8A 2NT1A 3SW6A 4DF0A 2BGSA 2FGLA 3FV9A 1XG3A 3R5EA 4DZAA 1K9TA 1T7LA 4GXWA 5AHNA 4PSRA 1MUCA 1H7NA 3HU7A 1LQ2A 2E68A 3A6OA 3LK6A 3M0VA 3DHFA 3OG3A 3OIXA 3WQDA 5HANA 2P50A 3R0KA 1R86A 3FA4A 1G9HA 3NIYA 3IIOA 5FJJA 3GKAA 3FW6A 1Q2RA 2WMFA 3UNTA 4PA8A 3KVMA 2FFCA 4GYFA 1VIZA 4IH3A 3F2CA 4WJ8A 3DFQA 4LC6A 2PWEA 2J7BA 4L56A 3K1DA 1Q65A 1TMLA 2FZBA 2H6RA 1WX0A 3NSXA 4S23A 5TQLA 3AIUA 6A3HA 1VS1A 2E1WA 3DESA 1HGYA 3EX3A 1IIGA 3K8KA 1POJA 2YXGA 2C1GA 2FFIA 4XUYA 3PTMA 3FSTA 2Y89A 2J79A 5C6MA 3GUWA 1UZDA 1QRQA 2FTPA 1H3GA 3P7YA 3ICJA 3LTSA 3P62A 1ZCCA 3HN3A 4S3FA 1LL6A 4MADA 1KFKA 4YL2A 1MEIA 3TMLA 1WKDA 3GNNA 3OW1A 3PTKA 3W7QA 4GA8A 3W7NA 1XQLA 5F2MA 3TN5A 4C6OA 4AIBA 3QFEA 4OU1A 3WQCA 4PMXA 3DUGA 1KBLA 3ITVA 4F0SA 1NU5A 3M43A 5EMUA 5FJIA 3ABZA 4B5TA 3TWAA 3A21A 3WQ5A 3KRZA 4LVFA 3G24A 5BW6A 2PU1A 3M0JA 3WEOA 2A3CA 1J93A 1HO1A 4LAOA 4LBSA 1XRVA 2DZBA 5BRPA 4IL0A 1TV7A 2DPEA 3T1GA 4A8RA 3EDFA 1BAGA 4MG4A 1QPQA 2G3NA 1P6CA 3NEVA 4FA3A 4AUBA 4LS1A 1VFMA 4S1FA 3E49A 1E6RA 2CESA 1JF6A 2Z29A 4MUZA 3IAQA 2A0NA 1EZWA 1P5BA 5L6UA 2C0AA 3QLDA 2GJXB 3EMZA 3RGTA 1H51A 1Z3NA 5D30A 4UFMA 5DEZA 2AMGA 3S6TA 3VINA 2PCQA 5C9RA 1JZ8A 3U0HA 4GCAA 4TTGA 2Y5JA 3GW3A 2Z1XA 5I78A 4QQ3A 2ZYFA 1BWKA 4DWDA 3WBYA 1ISVA 5D09A 1VBGA 4MB3A 4EOUA 2Z7KA 4CCZA 4EKJA 2CFFA 3WH9A 1CNVA 4ZSTA 1W1YA 5I2UA 5D2XA 3EEZA 2E5DA 2VD9A 1H62A 3RFAA 4XTDA 2CZDA 2GQ3A 3QY8A 4GQQA 1TMHA 4LSBA 1Q6CA 1W17A 3M0HA 3DXIA 3T0BA 1R3SA 3WH7A 1VD6A 1GJPA 1P0BA 3S1WA 2WHLA 1WDPA 1Q5MA 4M24A 4JY8A 1TE1A 1ZAJA 3H6OA 1GWJA 4NASA 5CG0A 2V5LA 2W3ZA 5T8GA 3WQWA 4XIAA 3ITOA 1AZ2A 1YPIA 3AHYA 3EZ4A 3PJTA 3VGGA 1E55A 1EC9A 1YDYA 1PIFA 2FHBA 1KCKA 4FNRA 2OMAA 2QT3A 3N3MA 5ECVA 1CXEA 1KRAC 4M29A 1W0MA 3PBMA 4MJMA 1QI2A 2Y8VA 2VFDA 3QM3A 1TWWA 1VEMA 3CYJA 1CEOA 4JTSA 3W38A 3DIPA 1PCKA 4JCMA 2HTMA 4JN7A 1GJWA 3TX9A 4HMCA 5KSWA 2XM1A 2IKJA 2NQHA 3O07A 5HATA 3A12A 3EX4A 1GG0A 1DOSA 1EPXA 1SFJA 2C8NA 2ISVA 4PE8A 3URBA 3VIPA 1RQHA 5E6YA 3VD3A 3LCWA 1TPWA 2O92A 4MF4A 5K4ZA 4KRTA 4AY1A 4Z08A 1DJXA 4O10A 3U8GA 4AWSA 1B3WA 5JU6A 1RVKA 2Z7GA 4WUIA 2PPGA 1R2TA 3UERA 2DY3A 1SGJA 1KC7A 2EG7A 2ZXDA 2PDMA 2TODA 1UD2A 5TD4A 1GOKA 1EQPA 4AMAA 2OQLA 2J9XA 3FKKA 4AHOA 2ACSA 3L2MA 3QQ0A 2HJPA 4AEOA 3WD2A 4Q6JA 1I60A 4UB9A 2E28A 3UG8A 4LY4A 1A3XA 1FDYA 4F3HA 2WNNA 4DRSA 4CQBA 3RRAA 2F6XA 1PKLA 4QJ3B 1Q7ZA 2GOUA 4J3VA 2WWCA 3VKCA 1R46A 4IF2A 5G1YA 1WDDA 4WF7A 3SUVA 1R8LA 1Z44A 4W4QA 1BHGA 5DN1A 2WMIB 4G7EA 1A5UA 2EQDA 4M7TA 1OZMA 2DH3A 4IICA 2WSPA 4KPLA 3QV9A 3MSDA 3GSMA 1VLIA 1YBQB 4H8NA 3L66A 3T2OA 1UA3A 3GAKA 4QG6A 3LV5A 5HA7A 5HR7A 1I1XA 3CMGA 4PC8A 1TFVA 4JTHA 2RFGA 2PE4A 1K70A 2CYGA 5G1TA 3UWUA 2NX3A 5CC7A 3A3XA 4LBRA 4K1GA 3UU0A 5A8MA 3AQUA 1S38A 4RNIA 3WK0A 1K8ZA 3O9NA 2NX1A 2NW0A 1TV3A 2PSNA 3L2LA 1SVDA 2FZNA 2WJEA 4ZQPA 2UY2A 4PEEA 1UR0A 4GWEA 3DCPA 1RZMA 3M6DA 4AF0A 4AY8A 4I5RA 4MFDA 1BYDA 3WMCA 1LQ0A 2Q3OA 3W7KA 2ZIDA 3L67A 1RH9A 4HP5A 1IGSA 1B3YA 1EDTA 2NVDA 1E6PA 2J9YA 1EO5A 1KQYA 2VZOA 1QUMA 2ZOXA 1M01A 3QLLA 2C19A 1NEYA 2I9EA 1TRDA 3C0SA 3CTLA 3DFTA 3GIQA 4IPNB 4J35A 4NY2A 3PN8A 4LQ1A 4PBFA 1VC4A 1UW9A 1ICQA 1O5RA 1TWDA 5GNXA 3ERPA 2XIQA 4KETA 4DXXA 4TIMA 1K8YA 5U7SA 3FNDA 2C18A 1RAKA 1IT0A 2FTYA 3BSHA 5HINA 3ZS4A 5AC8A 4GISA 4RNJA 3A3HA 4UQCA 5HNRA 3KE0A 3N2BA 1XCWA 3V0TA 2J47A 4BS0A 2QJNA 5HAOA 2WJZA 4D6HA 1XGEA 3CV7A 4BCEA 4FAMA 2E9LA 1DWJM 5TF0A 1SMAA 3EB4A 3G1RA 4MAZA 1HGWA 3KXQA 4YIWA 4KWOA 4C5YA 5LNVA 2YA1A 3GH5A 4RUBA 4H4IA 2V82A 2NV9A 3U2EA 5TIMA 3QOMA 3JW7A 4IX2A 4UTLA 4H7CA 2ZRYA 3CUFA 1AVAA 1TQXA 3C6CA 1PPIA 1HVXA 4C7FA 3TFXA 1VP5A 3O7UA 1TQJA 3L4VA 2O0TA 2BY3A 3ZLHA 1V6UA 2ZZ2A 1GG1A 4PEKA 1JUEA 1QPRA 3M0XA 3QPEA 4UOQA 1W1PA 5A5WA 4GGBA 2NQZA 3GVVA 2W9MA 3GYCA 4E3VA 2OVLA 2C0HA 4NUWA 2XIOA 2HVNA 2EKCA 4DPPA 3BLDA 4XD3A 4RDYA 2Y7EA 2GVLA 3N2CA 1HW6A 5LNSA 2WMIA 3KRUA 5I3JA 4BFAA 1T8QA 5DMMA 3TOYA 4J3XA 3B05A 5AHLA 4DYKA 4Y6GA 2QXWA 2D2GA 5XIAA 5E9XA 3OOQA 4LCSA 1XF0A 3SJ3A 4HPXA 1XH1A 1F2JA 4DJFA 4QRNA 2CWXA 1JGIA 2WW5A 5LGXA 4Z0SA 5PTDA 6REQB 4LRTA 5HMDA 2C1HA 5AN7A 1DJYA 3BG5A 1OCQA 3LM3A 3SN0A 4DZIA 3SRKA 5DXXA 1WPCA 1DXEA 2IPWA 1P48A 4L65A 1DJQA 5I3IA 3DFHA 4D72A 3EWCA 2ESCA 3QY7A 4HHHA 1UH3A 3MMWA 1WUEA 5D8WA 2X8RA 3TC6A 5T26A 4HTBA 3ABSA 3AXMA 3IGSA 5A8NA 3LERA 5D2VA 3AS2A 3AU6A 2ZX9A 1GVRA 4S3JA 4F48A 2A6NA 3IUIA 2YLLA 1OD0A 4LYPA 3C2EA 3ZJ6A 2WOQA 4XG1A 3S1UA 2WHMA 3W7CA 1C92A 3PF3A 2INEA 2YDRA 4N9DA 3M46A 2PB1A 1WUFA 2P0IA 3QW3A 3G22A 3UPWA 7REQB 4LB4A 1D3HA 4US6A 3ME3A 5C7HA 1SZEA 3O15A 4JIRA 2VTFA 4CQ8A 3LXAA 3ZM8A 3WL1A 1JIBA 1W3LA 3CM4A 4H6RA 2XISA 4Q8PA 4AYSA 1JGMA 3L9CA 5CAKA 4Y9MA 4LX4A 2AQVA 3G1AA 4W7UA 2QCCA 1TR1A 4CEXC 2J75A 3M44A 4KRZA 1UPMB 4OV9A 2YZRA 3OZYA 5CLTA 4Z17A 4GLEA 1UWSA 4LYQA 4UR9A 4Y9PA 4JY9A 1UC4A 3S9YA 2GDVA 4DO4A 2CKSA 4E4PA 4TMCA 3LBCA 3HB9A 2ZZ3A 3AXHA 3NYDA 1QXLA 2DSUA 3LHZA 5HMEA 3WDPP 4HCLA 3GG8A 2V63A 4K6AA 4Q22A 3UCCA 4A2SA 3BSMA 3I7RA 3UPMA 3UEQA 3O6CA 4P7OA 2Y88A 1EJSC 4KWVA 4HD5A 4FLOA 4GE8A 2C16A 4LEFA 3URAA 1A5SA 1B3XA 1LBLA 2QGHA 1HTIA 1PBGA 3RLVA 3P0WA 2Y5EA 1OCJA 4GZJA 4KERA 1FWSA 1TA3B 1K9FA 1BVZA 3LBMA 4M56A 2HBVA 3DFYA 2YYTA 1MNZA 3QYQA 3CC1A 3VZYA 4B16A 4LPCA 4E38A 1RLDA 1FCBA 1LTDA 3SY8A 3P8JA 2O9OA 4NI8A 5DMYA 2B31A 4O50A 3AIBA 1QAPA 3SCSA 3K2GA 2XH2A 4TV5A 3GFZA 3NG3A 4LNYA 4IZGA 2P53A 4NJKA 4AVOA 4R9XA 5FEWA 4F66A 1GYNA 4KIRA 2AL2B 1PTDA 6XIMA 4ONVA 4DF1A 3W1MA 1OFBA 1GKQA 5FCZA 4S3CA 4FLQA 1HUVA 4WGHA 1YADA 1KQZA 2PEVA 5EA9A 3WLNA 5REQB 3ITLA 3BL3A 2J74A 1B9BA 3PSWA 1UH4A 1VJZA 3N6JA 3SFKA 2J13A 1PYFA 4O1EA 2PMQA 5J8LA 2ZXBA 1ZP3A 3VIOA 1UA7A 2I56A 4AH7A 3TVAA 4D1IA 1EP3A 4GVFA 4FNPA 4LY8A 1Z6KA 3QV6A 5EFDA 2YDSA 1VZWA 2GVYA 1ADOA 4B3LA 1P4CA 4RNHA 3B9AA 3OLGA 3EGJA 2VZSA 4LVDA 1GEHA 3EDEA 1P7TA 1CGUA 2ABBA 4PMOA 3W02A 1CBGA 3ZIZA 1O1ZA 1VBUA 1CLKA 1GW9A 3OBEA 4C6DA 4U5KA 1V3HA 4KWWA 4LU0A 1OFOA 4XV0A 4IQJA 3LV6A 4WSJA 3GVQA 1OGBA 3NM3A 1QI4A 1FWJC 2OX4A 1NF7A 3E2VA 1D2KA 1AL8A 3ARTA 4KEMA 3Q2DA 3UD6A 4UFHA 4CD6A 2VEIA 2VR5A 1Q13A 3W7JA 3TXZA 4ML9A 2QJMA 1THFD 1WYIA 3WELA 3WLRA 2OT1A 4WR3A 1OINA 2QW5A 4Y2WA 3POCA 4WJEA 2ZZ5A 1HKJA 3OLIA 1H41A 3EB3A 3WCZA 5ABTA 3FJNA 3AMGA 2WQDA 1QWKA 1XW8A 3HBLA 3DKJA 3DFNA 2BGNE 2XVLA 1KXTA 1BQCA 3S3GA 4GFSA 4GK8A 1M65A 3VK5A 4LS2A 3BAWA 2QPSA 2I16A 4CCEA 5AZ0A 3GO2A 2ZKMX 4QP0A 1ZUAX 3N2TA 4M6VA 4WXZA 1UWTA 5JMUA 5HJXA 3LRLA 4IFKA 4M81A 3CUXA 4FOJA 5HUPA 4DJFD 1J79A 2VZVA 3LXBA 2RDUA 4G56A 3W1LA 3OLEA 3PPHA 2G3IA 1VIWA 4MYXA 1SZRA 4MNJA 4BA0A 1I8JA 1K03A 5AHEA 4JIEA 1V03A 3GY1A 3NFUA 4QCFA 1TV8A 4OT7A 5HR6A 3NR0A 1L2UA 3BWWA 4K37A 1W9PA 3UVIA 1XIEA 5DCBA 1JNEA 3GVGA 2DIEA 3AHTA 3LGEA 3T81A 2CIPA 4A6GA 1FKWA 1PL9A 2A1YA 1V6WA 3O6DA 4CQAA 1F3EA 2GVEA 1EO7A 3GG0A 1KTBA 5DRIA 1M53A 4JTRA 1DQXA 1EGVA 3U7VA 3SCRA 4XQ6A 4NG3A 3TCSA 4Q4KA 2TAAA 3N6QA 1WZMA 1TVPA 4JKMA 1NP2A 1XLCA 3TP4A 9XIMA 3ABXA 3U48A 1D3GA 1ONWA 1W8GA 4O17A 1E0VA 3A4WA 3WK3A 2QJIA 1IGWA 2X30A 1EDQA 3LSBA 1JF5A 4WVXA 1W32A 2DJLA 2NWSA 1VFFA 4MKNA 5DBTA 1ADDA 1L6WA 3M07A 1SO3A 4E2BA 3GC5A 4P8XA 3L7RA 4QROA 3MPGA 4A3RA 1KBKA 5DELA 3QGAC 3UVAA 3JZUA 4YJ5A 1JULA 1H4PA 1OZQA 4AIOA 4TXEA 1SFTA 4J2MA 1XGDA 3DAQA 1IZJA 1MMFA 3N19B 3LCLA 4AW7A 4IMFA 3QKZA 3CL8A 4IXXA 4J3TA 5LIKX 2VGFA 1MUWA 2JBMA 2Y6ZA 3BLFA 3V16A 3TW6A 3C8NA 3TZFA 3GTXA 4IT1A 3LD5A 3G1VA 3BMXA 3E96A 3S0CA 3C2RA 3KBSA 4GCXA 4XVEA 2X1IA 4QLLA 3TQ0A 1VEOA 3GXDA 3KP1A 3BJTA 2QVNA 1U83A 1CECA 3PULA 3CZLA 4F0HA 4W87A 1M68A 1N8IA 1TO3A 3KM8A 3WNNA 3ALFA 5H8MA 4I5UA 2V9DA 3PZVA 4GY1A 2GQ8A 4HNUA 4D6CA 2VOTA 1NSJA 2PDNA 3MKVA 2YKKA 1Q4NX 2Q01A 4PSPA 3EWWA 2Z24A 4AIEA 3SADA 2D1ZA 3COTA 4I6KA 1IWAA 1M1BA 1TPC1 2OGYA 3PY2A 3QV8A 5CZTA 3OVPA 3SAZA 2UY5A 5FSEC 1EBGA 2PRMA 3S2MA 5K3VA 3HG3A 3REQA 3GNDA 3FXGA 5FD0A 1FH7A 1OG0A 4YTUA 5FL0A 5F1VA 1IXOA 2OGJA 2CETA 2DZSA 4LWWA 1XPYA 3VNZA 1XDMA 4O13A 1EJWC 1KFEA 4FXFA 4ECLA 1W1B1 1CXIA 3GIPA 5KZMA 1C9WA 4W88A 4PRTA 3B40A 2GZXA 1PX8A 3VZZA 1VBRA 2ZE3A 2DUZA 1LCOA 2JIWA 3BZGA 4MZ8A 2E40A 2W6RA 1E9IA 3VM5A 3VDCA 4H9UA 1F7BA 3TIMA 3F5LA 4JTFA 2QJGA 5LHFA 3VMOA 2VR4A 1KLZA 4H04A 4AY7A 4HNCA 3WQVA 3LTYA 1TX0A 3SBFA 5HXMA 3BLPX 3PUEA 2DZAA 4XAGA 4JOMA 3MBFA 1K8XA 1LJYA 2QCFA 3L4ZA 3U4AA 3R43A 2HV5A 4PR4A 2OQYA 3LG3A 3G0XA 2Q09A 3LY0A 3WD3A 2EEXA 3L4WA 3JS3A 1R2SA 4GHRA 4PB4A 2CBVA 1KFLA 1UD3A 5IM51 3NL2A 4RDVA 3UR2A 1O12A 1OADA 2POZA 3EPNA 5DT7A 1OEPA 4DJDA 3ATZA 2IQ0A 1CXLA 3PWIA 1EH9A 1HKIA 2B7PA 4FK9A 2X2YA 3O06A 3VZXA 1DIDA 3PAJA 2RDWA 1KV8A 4XO7A 2OOFA 1QDSA 5FEZA 1QOPA 1V6VA 3KOYA 1Y7VA 4KFPA 4MWAC 4KGJA 3KTXA 3PANA 2YCEA 3GBDA 4IFOA 1T96A 3GG1A 1X1ZA 3ARSA 4XBSA 3QN3A 3N11A 2Z2AA 3M6YA 1C9DA 1Q6OA 1YXCA 2OZ0A 1KGWA 1R0MA 3A23A 5DCEA 2OODA 4U4MA 3LI0A 5BU9A 3FA5A 3QV7A 4L5ZA 4HT3A 3M0LA 4JEJA 2JF7A 3TC3A 5IHRA 2PD9A 4DAIA 4GQGA 5BNKA 3HQNA 3MMTA 1VEPA 2WC4A 5CBBA 3W71A 1ZENA 1H7XA 4D6FA 2GDQA 2OZTA 3GXPA 4W8LA 4CNPA 3AS1A 5IHSA 3GDLA 2V5KA 1E5NA 4H19A 3WLOA 4S3AA 7PTDA 3NA8A 1SW0A 1A53A 3N9SA 4O28A 4Z1CA 5LIXX 3A4JA 4FOUA 3WNLA 4JN6A 1LL7A 3KBNA 3CQKA 1RQBA 3GWQA 4B3ZA 3FK4A 1JUBA 2G41A 4BWLC 3QYSA 4V1YA 4JDYA 2PGWA 2J66A 4S3DA 4GRSA 4RLIA 4Q4SA 4NX5A 1PWLA 4UUIA 1YDOA 3R12A 1Z8AA 3PUOA 2D73A 5FJUA 3H4XA 2ZC8A 3UCDA 2QF7A 3WY1A 3F2DA 3UPBA 3TQKA 4MIMA 4R34A 4AEEA 3ZLFA 4DVOA 3MI6A 3EWXA 4TTUA 5FKYA 1JDFA 4MYAA 3HG4A 3E0FA 3AOFA 4RV8A 3V0UA 1VFSA 4QS5A 3QC3A 1R38A 4YVPA 3VMNA 2FQIA 1LROA 4ALDA 2BMBA 3TN6A 2IKIA 4LBUA 4FNQA 5FJTA 1CGWA 2G0WA 3VMPA 2PDQA 2Y0FA 1JZ7A 5JVLA 4JD4A 1IT8A 3W82A 1E6ZA 4DM2A 2DGAA 1SM9A 1YPFA 1V51A 1NOWA 3QPZA 2ATSA 1W5MA 1DIKA 3AIVA 2A4AA 1LWIA 3BLEA 3UZYA 5HJLA 2BHZA 5MKGA 3T44A 1BQGA 4MUPA 2NV2A 4DWSC 3T4CA 3WDJA 2FIQA 1XC6A 5HWMA 3VABA 4AD2A 4KF1A 3TLLA 1HKWA 3CHDA 3S1GA 3ANYA 3ZWTA 4L4OA 4LF2A 1KXQA 2FKPA 1IEWA 1B3OA 1Q8JA 3L4XA 1UWRA 3VM7A 5C0QA 1R87A 5D02A 5A2CA 5LA1A 2CCRA 1S5TA 2OLHA 3ZT7A 5F1UA 4MKVA 2W63A 4S2BA 1XICA 2QQ6A 1FVPA 4JYFA 7TIMA 3EWBX 5BWFA 3C8FA 3SUTA 2NX9A 3P14A 3OG2A 1EJUC 4KEUA 4XKMA 2G95A 4HSNA 2NXGA 1H7WA 3SQLA 2CBJA 4GZEA 4RJEA 1E1EA 4IQDA 4E8GA 1YQ2A 1NDYA 1LUCA 4ZO7A 4QNEA 3R89A 3IJDA 2GL5A 2XG9A 1LLWA 3DC8A 1GVFA 5G2HA 3GB6A 1V3IA 4RR4A 5TBOA 1P0KA 1BGGA 8XIMA 4N9EA 1CENA 4NAFB 1HL8A 3VPLA 3NZRA 4NYYA 1W91A 1AMYA 3CPGA 1VFTA 4IL2A 4BQ2A 1AG1O 1FX6A 4TVUA 3ZZ1A 4PH6A 4B91A 3GRIA 5H6HA 1W3TA 4U2YA 1LL4A 4URIA 1Q6LA 1XDLA 2G96A 1A0DA 3RCYA 4R7JA 5HQMA 1GYLA 1QVBA 1KTNA 2XFWA 2CEQA 2IPGA 3AMKA 1P43A 1H09A 3W53A 4JKKA 1SJCA 5D38A 3TYEA 5HJYA 4R7OA 3A47A 1H61A 4AISA 4OV4A 4J3UA 1W37A 4NZ3A 2PLKA 3V36A 3SCQA 1XIIA 3AIEA 4HMNA 1KM0A 4R88A 3IGUA 3P84A 2CLFA 4NNCA 1QNOA 3N13A 4BJHA 3NSNA 1TVLA 4ZQNA 2NXHA 2WJFA 1PJ9A 5G4WA 5LIUX 3LCXA 3LCFA 4EK7A 1JCMP 1GZ1A 1W1VA 4H7VA 3KBVA 3CLWA 3C2VA 1L6FA 1V4YA 4OBSA 4PMUA 1GQNA 1HL9A 4EPEC 4AFYA 4GUHA 1BVNP 2PDYA 4IIBA 3LHWA 3TROA 3ES8A 4FNSA 2ACRA 4M51A 5GVJA 4W93A 3CAVA 1FCVA 2PDBA 4GABA 4DBUA 5GNZA 3OHIA 3RITA 1LT7A 1DYSA 3KVJA 3N34A 1DWFM 2E8YA 4FMVA 1KKRA 3AISA 2XYLA 3NQVA 2EGZA 1J0ZA 3M0IA 3DYOA 3L68A 4OFCA 3WZ0E 2E0PA 2EPOA 1U5JA 3P74A 1AQ0A 5K9DA 4WDTA 3HG2A 2WMJA 1AH4A 3UBPC 3MWCA 4H8UA 1RVGA 4M7SA 1W3IA 4L4LA 3PZIA 3THCA 1GEQA 3SO7A 1EL3A 3MUCA 1AZ1A 4EF8A 1F07A 1DHPA 3Q94A 1RCOB 1BKHA 1UZ1A 1E6NA 4DI9A 4XZMX 3HV9A 5GPRA 2PRLA 1HNYA 4Y8EA 4EE9A 3W2KA 4FO4A 4A22A 2JGYA 1A49A 4C6JA 1UR2A 1AH0A 3LS9A 3IJIA 3PG9A 2ZX7A 4OOZA 5HNUA 1XIMA 3W7RA 4DWSA 3OVRA 4CQDA 2PP3A 3HGJA 4Z0JA 1BVWA 4HIBA 3MUY1 4PMQA 3F4WA 2BOGX 1SW7A 4K3ZA 4IIGA 5A8PA 2FB2A 3GR4A 2XTKA 1T99A 2XGZA 2D0FA 1EFZA 2O9TA 7ODCA 4CD5A 1RP9A 4JYEA 5BZAA 5I3HA 3EMCA 4U31A 3URNA 3QZAA 5LZLA 2WSYA 3BCFA 2XH0A 2QMKA 3HQ1A 5LXEA 1G4SA 3VFLA 2FJKA 3W83A 3E9AA 4H00A 5I06A 4GX9A 4OHQA 1HN1A 2FH6A 4B15A 1WXJA 2XFFA 1US3A 1CXFA 4O52A 1PEZA 4YMZA 3MUIA 3GR7A 2W27A 5I02A 3MCMA 2D20A 4JPGA 5FAJA 5K2ZA 1X98A 2H9AB 1AW5A 1KXVA 3SSZA 4IIFA 1WB0A 3NTYA 3FA3A 3OYXA 4YYFA 4BY3A 3UR8A 3EWDA 1KGUA 3L4TA 3HGSA 1AJ2A 3TTQA 4HNNA 1TV2A 2J62A 2GK1A 1TZ7A 4CUCA 1SJAA 2C13A 3TWBA 2E4TA 3NPXA 2ISDA 3LZ5A 3AS3A 3PFMA 4YWIA 2GVJA 4G6CA 4IMAA 3IACA 2HS6A 3H12A 4JTCA 1O66A 5A2BA 2WHJA 4G1NA 4LUTA 3K8MA 2V3FA 1ZL1A 4UZUA 1WOAA 4GQ0A 3PTDA 1EBHA 5D04C 3ANVA 2Z1SA 3GR8A 4O1BA 1FWAC 3CHEA 4UTWA 2OSWA 5IBXA 2VZUA 5I7GA 3CZJA 5LYRA 3DYPA 1Q6QA 1MDRA 4PUWA 2AKZA 3B03A 4HYVA 3NL5A 4LS0A 3H54A 3U6WA 8TIMA 3KWXA 1KGXA 4RX0A 1LG1A 3HJEA 2YBTA 3L2IA 1S5VA 3IRDA 2QUVA 4L6DA 4WY0B 1E4NA 4X9YA 4M1BA 3W01A 2QDDA 2H9AA 5DX7A 4J2PA 3WENA 1AD1A 1MQRA 2XWDA 4DELA 4UC5A 1UMYA 2CXGA 2QDGA 3RX4A 3M0MA 3NQAA 1LOQA 4NNAA 1XYAA 3APTA 1I1WA 1OY0A 1I9CB 1A5MC 4QNWA 3IVUA 4HN4A 4AD1A 3W24A 3TU9A 3WLTA 3GZAA 4E2VA 4IGMA 2V2HA 4EAMA 1UPPA 4NZCA 3NQGA 3I6RA 3UG4A 2FH8A 3WEMA 3S5ZA 1G7UA 1QO5A 1LM1A 2WNZA 1S46A 3C4UA 4QEEA 4ENLA 1WBHA 4JTJA 2HMCA 2VX5A 3N2OA 4N6EA 2WXDM 4E5TA 4L1GA 2F6UA 2PBOA 3K30A 1MUMA 3SEPA 1OF6A 2XH4A 3SRHA 2EG8A 4JN8A 3ABOA 3RJYA 4U10A 4GNKB 5A6BA 1BSLA 4FNTA 4P8WA 1RJRA 4I8YA 4OUIA 3ARXA 1Y8BA 4AD5A 4MLJA 1XPGA 2VD8A 4WRHA 1XD0A 3EXRA 3W2LA 4CKQA 1C8QA 2ZC1A 3PSVA 4OJYA 3CT7A 4G8TA 1HVQA 5A8QA 1T0OA 5EKYA 3MY9A 4XD6A 3TQPA 1TRIA 2GSHA 3T05A 1LYXA 1V3MA 3TA6A 1BF6A 1TJ2A 4TVDA 3KOXA 2Q02A 3E5PA 1EF3A 1HJWA 2OG9A 2PBGA 2PODA 3B0VC 3EKLA 4W8AA 3W23A 2A21A 3QGKC 2QCHA 4NI3A 3XISA 3OQ8A 4NT0A 1ELSA 4WKAA 7XIMA 5FI8A 4XWUA 1ONRA 1NY1A 2WK2A 4JTDA 5GJNA 1S1PA 1S3TC 4GC3A 1DE5A 2FGZA 2NXIA 1RA0A 1C8YA 2Q3RA 1B4KA 1F73A 5D8ZA 3QSTA 4IUGA 3IAPA 3FHAA 1QO2A 1W6TA 1C93A 3G6MA 1CB7B 5E70A 5CPSA 4G2DA 1EUNA 5ABGA 3WFAA 1Y5XA 1ESWA 3UCQA 3H22A 4R7WA 1RJQA 2EO7A 1TV5A 4W86A 4YU1A 1ZZMA 3G1XA 2W79A 1HX0A 4H9MA 3T09A 3W7DA 3NQEA 2GFTA 3M41A 1I0DA 1D7FA 1GQKA 2ZCGA 3HMCA 3S4TA 4FX6M 3NQCA 4OIFA 2VVNA 3NEHA 3MP4A 4UOJA 4A3YA 4O12A 2F9RA 3T55A 1FBAA 2R82A 5CSSA 1TWZA 1ADSA 1K4GA 4AVFA 3QHNA 3MW7A 3HFTA 4M6UA 1O6IA 4D6DA 4O16A 3GD6A 4Y9NA 1F6PA 3VCCA 2HE8A 1CB2A 1U1JA 3ARZA 5JUVA 2QS8A 1J0IA 4IGSA 4RZ4A 3F2BA 4QE5A 4O14A 3BC9A 5BXTA 2G37A 1XIGA 1E1CB 3Q65A 3TV8A 1SU5A 3UF9A 1H0GA 1RP8A 4I6VA 4BF5A 4B2DD 4F0MA 2E6DA 4HPGA 2DZVA 4POCA 3NSMA 4Y90A 4H8VA 3MCNA 4GUIA 4UFJA 2J8GA 4RW3A 2VC5A 2A3HA 1QR7A 4B5SA 4LRSA 3UWQA 3WDRA 2CLMA 4A3UA 4PYSA 1PIGA 5I3KA 1TPB1 3EPMA 2DQXA 3NDYA 5HULA 4MNMA 5EFFA 3VKAA 3K4WA 4LYKA 1F8MA 2YZ5A 3LQGA 4LEQA 2Z2BA 3SZ8A 3S1VA 3I7SA 3RIKA 2QV5A 3EX1A 3W76A 3MQTA 3U5UA 3WLKX 4UFLA 4MY1A 1EB3A 3H2EA 1VH7A 3KCLA 4L6HA 2HRWA 1QHZA 3LEPA 3WLIA 5D9PA 2X05A 2DT1A 4O1AA 3W1RA 1Q85A 3CZKA 5C9UA 3VOJA 3ZR6A 2PDCA 2B4GA 2QUMA 3B8TA 1A4MA 5DBUA 4YCOA 3BLIA 3EWZA 4UNIA 2P3EA 3W7GA 3B4YA 1HXJA 2J7HA 4L4MA 1QMLA 2YBUA 2XN0A 1UUMA 2BVWA 3WMBA 1RD5A 1GOOA 3BJSA 3EAUA 4JTIA 3VU2A 3DG7A 1UH2A 1DQUA 1SFSA 3OVQA 4DUOA 3BPWA 2Q71A 4QS6A 3UXAA 1E6XM 3ISIX 5RUBA 4XK2A 5C71A 3WNPA 3BQ5A 4K36A 3QFWA 4UOZA 4XSMA 2DH2A 4WJXA 3P81A 3T9PA 5H1WA 1XH2A 2VUNA 1TV4A 2BS9A 4WK9A 4GBUA 3UP8A 2OTDA 2YX0A 4DZ5A 2WVUA 3P93A 1XKYA 3H24A 3A3WA 4DJFC 1YHTA 3WBEA 1LRNA 1LP6A 1TPH1 2NSOA 1TUFA 1GOWA 2V6AA 2J4GA 2ZUTA 4LVAA 5AC7A 4NVTA 3OTRA 5F4WA 3CU2A 5LNRA 2EJAA 3KZSA 4TUFA 3L5AA 3Q4DA 5CG7A 4Q33A 3BW2A 3ECQA 3LDVA 5EYWA 3ZT6A 3HGRA 1NFGA 1JPHA 1TPEA 3ALGA 5F2LA 3VTRA 4B5NA 1M04A 2J78A 2XM2A 4C7DA 3PFRA 5IFTA 1VENA 4KFNA 4C91A 3SIZA 1QU4A 1V7AA 4O4WA 3WMLA 4OZOA 3QOKA 1ZAIA 3EA3A 4GUJA 2R8WA 1SO5A 4WHBA 1H5VA 4NNBA 1XLMA 2PRHA 1CGVA 3M7SA 1NWRA 3G1DA 3QW4B 3TSMA 2Y61A 3AMDA 3PZQA 3AI0A 3GHUA 4RL3A 1DJWA 1XJBA 4KCVA 1FFRA 3RXZA 3TTEA 3QY6A 2XZ9A 2JALA 1LF1A 2J77A 4XB3A 3S83A 2WAGA 2DSZA 3V0SA 3TDFA 1XYBA 3G5EA 3M5VA 1VR6A 2FTWA 1A0EA 3E3HA 4DYEA 2VGBA 1E0TA 2QIWA 2A3AA 4B5XA 5AVHA 1QPOA 3AS0A 4ERAA 3NQFA 3TYBA 3ZJ7A 2NUWA 2PLCA 3GDMA 1DWAM 5EY5A 3QC0A 2C7FA 2F38A 4QLJA 1KCXA 5BRBA 5AHFA 1C7SA 4UCFA 4D8LA 3TONA 3N4FA 2VCBA 2TYSA 3ARUA 4CU8A 1F5ZA 1WAWA 3LGDA 3RMEA 4US5D 1GOXA 3O63A 2WVVA 4DN1A 1IZCA 4NXKA 2DSVA 4YTQA 4IP5A 3RUBL 2PDXA 2H8ZA 2XIIA 3IGHX 3CAKA 1BG9A 5A2AA 4ERIA 1WBJA 1ZBCA 1ODUA 3E74A 4GVGA 5CH9A 3AUOA 3ZWSA 2Z28A 4AU0A 1UBPC 1FXQA 1W5PA 2VGIA 2DVUA 1RUSA 2P8BA 3GZ3A 3UJFA 3E0LA 3AZRA 1YW1A 2J27A 1JFXA 4XZNX 1KRBC 1N55A 1L6SA 1OGGA 1EEPA 2R1LA 1I2PA 3TAOA 2Q8ZA 3PUGA 1J2WA 4JTEA 1YE6A 3P2VA 3U2ZA 1IXPA 3MSYA 3PWAA 3DC0A 4MNKA 4JNMA 4IG2B 1HG3A 2X40A 4UQAA 1S5MA 1LBFA 4WY0F 1PV8A 1I2RA 3ZJKA 3IJ7A 3PPGA 1NDVA 3NL3A 3EWYA 4X61A 3ZR5A 3HGOA 3GYEA 4IM4A 3NDOA 2DQWA 1Q66A 4YVXA 3WH8A 4BWLA 4C65A 1XHGA 4A35A 3AYVA 3UW6A 5IXEA 1R7OA 3IIVA 3I3DA 3G0SA 3FCPA 2VGGA 4NILA 1PZ3A 3VIGA 1XIBA 3JZEA 4KIEA 1DVJA 3OGVA 3BTNA 3BV7A 3RLUA 1UQYA 3MC5A 2BGQA 4OGZA 1OC7A 2VWSA 1JFHA 3CQIA 2GGJA 4ZTYA 3E1F1 2ZX6A 3OVGA 4C7GA 2QCLA 2PTZA 1LOSA 3OEXA 3WF3A 1TIWA 3B0YA 1FWFC 5JBFA 4QDPA 2GDUA 1EHAA 1L2QA 2WKLA 1F8IA 1US2A 4ATDA 1F3XA 3EDKA 3S1XA 2DV0A 2I17A 2VT0A 5FJPA 3VNIA 4GOAA 2Z1KA 2V3GA 2PZ0A 2R1PA 3AFBA 2BX7A 1QK0A 2C91A 2J7CA 2ZICA 3GU9A 1Y0EA 3T8LA 2XVNA 4XAPA 3TN4A 2WM0A 1WOBA 3S9IA 4HU8A 3K46A 1F05A 1FH9A 1JL8A 1XISA 2PA6A 3EDJA 4CU7A 1I4NA 4K8EA 3NJ3A 1GQJA 3TAKA 1WV2A 3AMCA 3N9KA 4Q8OA 1GT8A 5CPQA 2ZTJA 1KM5A 4E3TA 1BKSA 4QR6A 4FP1A 4JICA 3DBPA 3BQ6A 4MGGA 4HK6A 2GGEA 5KINA 5F4XA 3KTCA 3H7RA 3W1UA 1UP2A 1J2BA 2V2DA 3ZQ9A 4ZFMA 2CZFA 3TYCA 4L9ZA 1MZRA 4B3KA 1N2VA 4HCHA 1UBSA 1UG6A 5D2WA 3CJPA 3W1NA 1K7EA 3ARPA 4XKYB 3G8EA 5G2WA 4JHMA 1JPDX 1FP9A 1OABA 4NP7A 3RNDA 3P60A 2CLLA 4ZE5A 1KFWA 3TJIA 3WIJA 1XWYA 3II1A 4DLFA 1VGAA 2ZVRA 1NDZA 1IEQA 1O60A 5HUOA 1RJPA 4Q4QA 1GVOA 4PBEA 1TVNA 3NO3A 3GLCA 1F4AA 3T2PA 4BKNA 4DLMA 2CPUA 3IRSA 2C14A 2RDTA 3BVJA 4MTVA 1V3JA 1BTCA 1I75A 2V0TA 2BVTA 4JFWA 2OEKA 3L4UA 2QR6A 1TCDA 1GOQA 3R2GA 1KRMA 3W2NA 2HCVA 2AL1A 1ONXA 3IV3A 1KCLA 1A5KC 2CLOA 1KLYA 1XFCA 1M6JA 1EIXA 4NZ5A 2FB3A 3CUJA 3NQ2A 4Q4MA 2GJNA 2GK1B 5GJMA 2WCGA 4PFMA 3QGVA 1TUXA 2QCDB 4C6KA 1PB0A 4LXFA 4XZBA 1IF2A 3QMTA 3C2OA 1LOLA 4C60A 3L0KA 4JR5A 1FRBA 2C6QA 1MO0A 1I45A 3OGRA 5DT5A 3NZGA 5FF3A 2W91A 4DQWA 2R1KA 4HNTA 1XC4A 4CNNA 4FR6A 2WSKA 1GTEA 3AZSA 2X7VA 2PDWA 3MANA 4AWUA 5T9CE 3VIKA 1PWMA 3W07A 3E02A 1QCWA 3UG3A 4FS9A 1JR1A 2O56A 4H01A 5IOBA 1OCBA 3P5ZA 3OGSA 3CHFA 4OE7A 1XLFA 3I3EA 3M4HA 3SCNA 4E2DA 2DZTA 1M03A 4UTFA 4YHEA 1Q6DA 3V18A 3D5HA 3D6NA 3M5ZA 5HQLA 3AZTA 3H2OA 3NWRA 2EPHA 1TTIA 1B30A 1ME8A 2JK2A 4GPNA 4B90A 2XUCA 3VIMA 4MJ2A 1V0KA 3M64A 1XD1A 4WOQA 4Q8MA 3W86A 4UMCA 3WBXA 3BZJA 2D3LA 3WL0A 2Z0IA 1HFBA 1OYBA 1H63A 2KX9A 2WSQA 4H9ZA 3C52A 2F8QA 3GDRA 4MVAA 5CZKA 1R3TA 3THAA 1YDVA 1IIHA 4PUJA 3F03K 2ALRA 6PTDA 4XD5A 2DT2A 2G50A 2YCLA 2WMGA 2OLAA 3BARA 3SQSA 3J7HA 1W9VA 1HJVA 3KCJA 3DKLA 3W2MA 3NM1A 3ID7A 3GQYA 1J96A 2OWXA 3HIJA 1VJIA 1E1CA 3O05A 4NXSA 3B8VA 3C5QA 4DUVA 1BYAA 3CV6A 1KFBA 1C8XA 3PC0A 3HOJA 1AJ0A 1WO2A 3CB8A 2B7NA 4M8UA 4LTSA 3VOGA 4UTMA 1XRFA 3AWNA 3FJ6A 2P10A 3VNKA 4S39A 4ZMGA 3EMQA 5BXPA 1GNXA 3B8DA 3MSGA 2WBGA 3UA4A 1E3XA 3GH4A 1I2QA 1I2OA 3QMSA 4CEUC 4A2RA 3C2FA 1W2VA 4HNOA 4N9BA 4X2RA 4PFHA 3PTQA 2JKPA 2P5NA 2F84A 3QBUA 5K9XA 4YXGA 1A5BA 4NIRA 1D3CA 1IWPA 2H3BA 4ZR8A 2PFHA 1ZBKA 1GPWA 4C6NA 1EZ2A 1RCQA 4IPPA 4DF2A 5KMYA 5G1MA 5C9ZA 1BTMA 1Z32X 3RPDA 1XYCA 2GJLA 2WMHA 2DSWA 5DFAA 2CHRA 3H55A 3THDA 1WDSA 1LORA 1A5NC 4UQEA 3TLQA 3VGDA 2FJUB 4WQ6A 5CZJA 1V3LA 2DEPA 1K8CA 3VD5A 2V67A 3WQ6A 4GJ1A 2XJ7A 2EPMX 4BK9A 1KR1A 4LAZA 3WUEA 2E6AA 4MZ1A 1YLVA 1GORA 4N2YA 2REQB 4NZJA 5JBDA 4DXKA 5I3FA 2REQA 3NCOA 3VILA 5M17A 1POKA 2OXNA 3DFPA 1GTHA 4Z2LA 3WX7A 1GQLA 1TJRA 5FEXA 2VRQA 1XDJA 1YXYA 1J0HA 3NQ6A 1G0CA 2CU0A 4RE0A 3SGGA 4BEUA 1M9HA 1YX1A 3CXOA 4GIRA 3SUSA 2CERA 1QI0A 2VCAA 3WD1A 2YDQA 3WO8A 3FAWA 1MXSA 1S2AA 3FFSA 3IVTA 5FL1A 1XM3A 3H2MA 1YNQA 3TSDA 1FKXA 3AJXA 5F2GA 4L7ZA 1BLIA 3MV01 1G5AA 3TFCA 4IMGA 2CXEA 3G1FA 3F4CA 3VDBA 2G5WA 4OECA 4ZFCA 1OB0A 4YTSA 3N1AA 2INZA 5CCZA 1QASA 4G5DA 1NF0A 4FF5A 1RV8A 3CAWA 3L5LA 3N17A 1K9DA 3LCIA 5AKQA 1E5JA 4BR1A 4GINA 1GVYA 3E0IA 1L8PA 4X22A 5CBIA 3CWNA 4TVCA 1KM2A 3IARA 1BPLB 2DP3A 2CLEA 2PUZA 1UIPA 3UJSA 1KNWA 1JI2A 4IGNA 3ONCA 3S5SA 1FWCC 3DFSA 4HTYA 1ZS2A 4WY0A 3VOIA 1WA3A 4LUSB 2VEKA 3EEGA 3VOFA 2NQ5A 2GUYA 5REQA 3BV4A 1ODZA 2E09A 4P7QA 4Y9OA 3EYPA 3E38A 3A5FA 1JZ4A 3B97A 2EPNA 3LOTA 2FPVA 4MSSA 1UIOA 1MI3A 2YSWA 2TSYA 2OEMA 2CC0A 1EP2A 1BXNA 3SRFA 1G4EA 1LQAA 2INFA 4QITA 4CVUA 4FLSA 3AUJA 2CZVA 2HE5A 1NARA 2ZRUA 4K1WA 3TYDA 1UKQA 5LKYA 2WVVB 1Y65A 4R9OA 2EPLX 1TA3A 1FWGC 1EC7A 1DJHA 2WB5A 4AWEA 1BG4A 1DWHM 4PTWA 3R1ZA 3NDZA 2PWHA 4OKDA 2VI0A 5CJ5A 3BDKA 3GVWA 1ZTVA 1A3HA 2XGIA 3T40A 2DFAA 1H11A 2VRKA 1RBOB 3PK7A 1SW3A 3Q37A 4W8BA 5LGZA 3O1NA 4RE2A 3SCVA 4ZQOA 3P6LA 1P7TB 4GVIA 2XSXA 1JYNA 5JH1A 2WZIA 1FH8A 3GDTA 4I7WA 3IPWA 1FWRA 1JAKA 4HZ8A 4LALA 4RZ5A 3HFYA 4W5ZA 3QQ1A 4GXPA 3TJLA 1WKYA 1A80A 3VCRA 1OC5A 1HQTA 3DFOA 1V0NA 2GGHA 4S2CA 4PUDA 4Z42C 3GVRA 1U5HA 1TIMA 4R33A 3E2QA 1AD4A 2IXVA 4XZHA 2YW3A 1PKYA 2XFRA 2OO6A 3W9ZA 1SFLA 4Y8FA 1W9XA 1D8CA 1XLEA 1XL9A 1KM3A 4GMEA 2F7FA 1JD9A 3BAJA 4PMVA 2Y24A 2HS8A 4A05A 1NVMA 1OYAA 2YFOA 4HSHA 3OZOA 4JQ1A 4YHGA 2FZ9A 4UTKA 2GWNA 2Z6IA 1VQTA 4JFSA 1KBJA 3L12A 1ZALA 1R2RA 2A7PA 2NQLA 3GHRA 2AAMA 2XVPA 1KO0A 1P1MA 4A21A 2A2IA 4MAVA 4LOCA 2FVKA 3C86A 4IMDA 5D2TA 3QZ6A 4LCQA 9RUBA 1LLZA 3MU7A 2A7RA 4JHZA 4CVWA 2BOEX 2V5JA 5AVNA 4JIPA 2ZQ0A 4ROQA 2A85A 4ICMA 1NP0A 5A6TC 4JS3A 2C71A 1HJSA 3W72A 2XU2A 2Z1VA 1BYCA 3NNTA 2CBIA 3CAQA 4GUGA 1BGAA 2D2OA 2J7GA 2AL2A 3WJZA 1EXPA 4WIWA 2W5FA 4UQ9A 2IXUA 4PMDA 1QT1A 2IUZA 3RPTA 2NVCA 1IEIA 3T0DA 4LUTB 2FMOA 2ZRZA 4CCDA 2QJJA 1NFBA 4O18A 5JIPA 2F2KA 4DJEA 4JX4A 3MDWA 3BJFA 1Z9AA 1WDQA 1KW1A 4QAIA 2NUXA 3SUWA 3Q67A 3AAMA 1NELA 1F74A 4JIQA 3WK2A 2BOFX 3VDAA 1RY0A 3B8SA 1KWKA 4K7YA 1CT5A 3QR1A 4AYGA 4GZ7A 1ALDA 1IR1A 4XBJA 1PDYA 3CEPA 4UR8A 3H2FA 1IXQA 3R8RA 1X6NA 4INFA 2FGBA 1TE6A 3O0KA 3U2OA 1BXCA 3TH6A 3WNKA 3IIXA 1IEXA 5AYXA 1J11A 3SQMA 2WYSA 6TAAA 1R9XA 2RAGA 4CLMA 3UZXA 4TX9A 4H6QA 4H7ZA 4P7RA 5HMSA 4PUMA 4EXBA 5E0KA 1L9WA 5D37A 3CK5A 5LSMA 1M3UA 2HXUA 4C6EA 4XZ9A 3GC4A 4DUWA 1E0XA 4PRRA 4E2OA 2WNWA 3W1QA 2DZUA 3W1PA 1XI3A 1SR9A 4BZYA 1H50A 4Y7EA 3USBA 5D32A 2QKFA 4QSFA 3OA5A 2BB0A 4JFTA 4GIAA 2JE8A 3IEBA 3ITCA 4QGCA 4C1NB 4L80A 3WQEA 2YCIX 1VYRA 1ECEA 3H4GA 4EAYA 1T8XA 4Q8NA 4S3BA 3KUMA 5HWNA 5AFDA 3LRMA 6ENLA 3VE9A 4FXSA 5I3DA 1OFQA 1EJ7L 5DLCA 3SCPA 2CLIA 2PWVA 5DMNA 1QPKA 4H9XA 2PDKA 4PUUA 3H23A 4XZWA 4ZO8A 4OVXA 1EF2A 2FVLA 4U3CA 4ZQCA 1RXOB 2X1TA 2OZ3A 1YE4A 5FJOA 3BSGA 3R58A 2O9RA 3FDGA 2ZXAA 2ZUMA 2ISSA 2GSJA 1JDCA 4DO6A 3KDOA 2QHAA 3H7VA 4PMZA 2Z25A 3AWOA 4LH8A 3GU1A 1X96A 1PO9A 2YR1A 2RKXA 3G3MA 1MFVA 4EVZA 4H41A 4AAJA 4Z2HA 2D69A 3A4XA 3PPFA 1P0NA 4F79A 3P82A 3KBJA 4NRRA 2OOGA 3SCTA 1OWQA 3PB0A 3RLHA 1QOXA 4GYJA 3LQLA 1M7JA 1NJJA 1W3JA 1XLLA 4Q8VA 2PP0A 4AMCA 5DMLA 1G69A 3IJ8A 1J12A 4IMCA 3MSRA 4XKYA 2Z2UA 3LM7A 3TSBA 2Y2WA 3W00A 2PC4A 2PURA 2V69A 1TSIA 1UKSA 4GJJA 1W1IE 3WLHA 3TEVA 4PB5A 1WKFA 1Q6FA 3GNRA 3LMYA 1LZOA 4QE1A 2Y8UA 2WC3A 3AHZA 2ISFA 2E67A 4JNYA 3KP0A 1E70M 2A79A 4H3DA 6CGTA 1QBAA 3ABRA 1PDZA 4XD4A 3BICA 1Z89A 2C1IA 1J18A 1NAL1 1UD6A 4ZZ9A 3GX9A 4GQBA 4MPQA 2V3DA 3BG3A 3NVDA 1C90A 2BVDA 2OFJA 5GQBA 5L9FA 4ZGYA 4AZHA 4F40A 1CPUA 8CGTA 1VCGA 3MB9A 3RK8A 3VDGA 1FHLA 3W7MA 1QW8A 3KL0A 3PM6A 3BOLA 3H21A 1DJNA 3KVLA 3N15A 3WLJA 5BXRA 2WC7A 3CHCA 3H7UA 2HROA 2W0UA 3H8AA 3GTIA 4ZOCA 4LV9A 1ZNNA 2J24A 1B5TA 3T0TA 3WDIA 3GTHA 2E5BA 3LLXA 3RM4A 4MMWA 1RR2A 1XBVA 1OK6A 4YYCA 1PUDA 3VA8A 5I77A 5A95A 5BXSA 1U1HA 3SSJA 3K1GA 4K2SA 3O2LA 1X7FA 4AG0A 1S2UA 3D3AA 1TZ9A 2DVXA 2TRSA 2WZMA 4B92A 4Q8TA 3IUDA 2L5HA 5C9XA 3SGUA 4Q7IA 4RXFA 3T0AA 3W87A 5EMJA 4H9YA 2HWGA 3UYIA 1PKMA 1W8SA 1Q6GA 3QZEA 3CYVA 1UP3A 2QPUA 4GJIA 1ICSA 4WKFA 3NXLA 3CUGA 4M6PA 2YJQA 3OZPA 3OBAA 1EWDA 1OYCA 3H26A 3V5OA 4QEHA 1S5NA 2ZZ1A 4O8RA 1DHKA 4K8HA 1AFSA 5HK4A 4F0LA 3EOSA 3S2JA 5FF2A 2XN2A 1BXBA 1V6XA 1R5YA 4HNVA 2BVYA 3BW4A 2Y1HA 3OJGA 4W84A 3HTWA 3M9YA 1ZPTA 3W6LA 1CZ1A 3STFA 2Z27A 5CXPA 4Z1AA 1MSSA 1RA5A 1W3HA 2X1UA 1E3ZA 2B7QA 1PHQA