1KR2A

Crystal structure of human nmn/namn adenylyl transferase complexed with tiazofurin adenine dinucleotide (tad)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
271
structure length
233
Chain Sequence
EKTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEAAVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Hhuman of Nicotinamide/Nicotinic Acid Mononucleotide Adenylyltransferase. Basis for the dual substrate specificity and activation of the oncolytic agent tiazofurin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords NICOTINAMIDE MONONUCLEOTIDE ADENYLYL TRANSFERASE
total genus 80
structure length 233
sequence length 271
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.1: Nicotinamide-nucleotide adenylyltransferase.
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1kr2A00
4MWDA 1YI8A 1GLNA 4ZT2A 3DV2A 3SZ3A 1ZUNA 1RQGA 2A4MA 1F4LA 4L2IA 5DK4A 1A8HA 3Q4GA 5H7XA 1NUSA 1JHDA 1KQNA 4DDHA 2QTMA 4I6JA 3HV0A 2IELA 1IQRA 3ZJTA 1H1TA 2QUJA 5IJXA 1MAUA 4CDMA 1X6VA 2YY5A 3H05A 3L93A 4EG3A 3IVCA 2CSXA 3RFFA 2JAXA 2A7XA 3FETA 3COZA 1PG2A 1QQTA 4MUEA 2CFOA 4S1OA 2QUIA 4CDNA 3CLTD 1KQOA 3SEZA 1YUMA 1V47A 2CV1A 1QNFA 3GMIA 4MUHA 1I2DA 1QRUA 1KORA 3QTTA 2PZ8A 1M1ZA 2AZXA 1J21A 3FHJA 2E21A 2A84A 4F3RA 1KP2A 5DEOA 4G5FA 2GM3A 4EG5A 5KWVA 3FWKA 4MW9A 3TQIA 1YIAA 2CV2A 1ZJWA 2QUHA 4EG1A 3H99A 1EXDA 4PBRA 3P0JA 3CR8A 4Q93A 2DXIA 2PZBA 1M8FA 1XNHA 3NV7A 4DJAA 1TYCA 1WJGA 1GN8A 1GAXA 4EG7A 3PNYA 5HUJA 3ZGZA 3G59A 2QJOA 3H9BA 4OUDB 1OWOA 4EG6A 3IVGA 1XNGA 1WXIA 3I05A 1OWLA 2VXOA 4OJMX 4DDMA 2E0IA 3A4IA 1PFWA 4U63A 3VGJA 3A2KA 1J20A 2ZUFA 3M5WA 3RK0A 2QJFA 1MBZA 2A86A 1N2GA 1YULA 3RHSA 1QU3A 1WXEA 2QUKA 3IMGA 3INNA 3NBAA 4KPUB 4NATA 2X3FA 3KT6A 2HGZA 3ZXSA 1XNJA 2VTBA 3KT3A 1H3NA 4WSOA 1WXGA 4XFJA 1O94D 5DASA 4Q16A 5TEWA 1GTRA 3FDXA 2WB2A 3RJZA 3TZLA 1O97C 1MJHA 3CLRC 3CA8A 1WQ3A 4K03A 2OV4A 5AHWA 5EKDA 1Y42X 2D5BA 2XRZA 4NAUA 4U8HA 2AG6A 4RUKA 4MVWA 3G6KA 3LOQA 2Z08A 1CT9A 1IH8A 1LW7A 4MQ6A 1EFVA 1TQ8A 1N77A 4MUIA 3N2YA 1G8FA 2CT8A 4YMIA 3SEQA 2CYBA 4U7JA 4K0RA 1J1UA 1IRXA 5H16A 5KCMA 4MVCA 1WKBA 1TYAE 3GUZA 4ND7A 2JA2A 2I1LA 4F4HA 3CVUA 1NUQA 4J76A 1WXHA 3SYTA 3DO8A 3MUEA 1JEDA 1KAQA 4E1AA 1OWMA 5FNZA 3MXTA 3UC5A 4KKVA 4ZCQA 4ZT5A 3K9WA 1GZUA 1K4KA 5TEVA 1M8PA 3UOWA 1IVSA 1LI5A 1OBHA 2CUZA 2PFSA 1JEEA 3N8HA 3UMVA 1EFPB 2EL7A 4ZT4A 1ILEA 1EE1A 2WQ7A 4ND6A 1VLHA 1OBCA 3X1JA 4EG8A 3ND7A 1NSYA 1EJ2A 1N2OA 4ARCA 1KQPA 3IOCA 1OD6A 3N05A 3F3MA 2J5BA 2GKSA 1KR2A 1F7VA 5FO1A 4PBTA 5KHAA 1T9GS 1VBNA 2DR2A 1H3FA 4A91A 1U3DA 2ZUEA 1R6XA 1ZH0A 3FY4A 1O96A 2A1UB 1WY5A 4KR6A 2PZAA 1F9AA 1T6YA 4G6ZA 4MWBA 2JANA 3U1VA 2PXHA 3TNJA 1PG0A 1U7XA 3P52A 1TYBE 2X1LA 3G5AA 2J07A 2NZ2A 1O97D 1JECA 3OP1A 3COWA 3QTBA 1JGTA 1O94C 2Z09A 1F7UA 2PIDA 1U3CA 2Z3VA 3E27A 1JIIA 4ZCPA 3S3TA 1O0BA 4EGAA 3CLSC 1N75A 1PFYA 1HYBA 1O5TA 1N2EA 1DNPA 3ZIUA 1N2IA 1Q77A 5JBNA 3BL5A 4I6GA 4MW7A 3CVYA 1U0BB 3MMXA 3Q10A 2DERA 1D2RA 1NP7A 5IHXA 2RD2A 1GTSA 3HZRA 3CVWA 2HZ7A 4J75A 3DPIA 4MUGA 3AIIA 5LLTA 1T6ZA 1EUYA 4KR7A 5HG0A 1EFPA 1O6BA 3D6VA 1N1DA 1K4MA 2A1TR 3UY4A 5K0TA 1ZH6A 4YP5A 4PY2A 3JXEA 4QBTA 3LCJA 3AL0C 1IQUA 2WSIA 4NAHA 1S4MA 4MWEA 1N2HA 3PNBA 5FO0A 4UZFA 2H2AA 1B6TA 1TYDE 4MVXA 3ZUGA 1MOPA 3L92A 3FH0A 4G5YA 3X1KA 2PG3A 3C8ZA 4NZPA 4YP6A 4L2IB 4QRDA 2DPLA 2GOYA 5LFAA 3IUBA 2A88A 4ZCTA 1XJQA 3KT8A 1I6KA 3ZXIA 1QU2A 1NZJA 3COVA 1MB9A 4XFDA 1O0CA 1KAMA 1QRTA 1NUTA 2YXNA 1NUUA 1WXFA 4MW4A 4MLPA 3TS1A 2E89A 3CLTC 5HUHA 1YUNA 3AG5A 5TGTA 1JZQA 1PFVA 2IP1A 1N3LA 4DLPA 1K97A 3SDBA 2H29A 1Q19A 4YP7A 3COYA 4MUKA 3HMQA 2DETA 1J70A 2YWCA 4GRIA 3AG6A 3A05A 3PXUA 1VBMA 4CT0A 1KH1A 2VTBB 4EFKA 4AQ7A 2DEUA 3FI0A 2G36A 5J58A 3OTWA 1X8XA 3ELBA 3FG9A 1JIKA 1T6XA 3LE8A 4MW6A 1EUQA 2CYCA 3H9CA 4HK4A 4HJXA 4JXZA 3SZGA 4NX2A 3NBKA 2QTNA 4KPUA 4ZCRA 2YWBA 3IOEA 3VU8A 1EFVB 3TQOA 1BS2A 4MW5A 3RK1A 4AS1A 2QTRA 3ILVA 3CLRD 3DLAA 3N9IA 4EG4A 2V0GA 4MUJA 5TS2A 4FZJA 2A1UA 1I6LA 3MLAA 4I6EA 1KH3A 3ND6A 1PFUA 2J08A 2R5WA 3HL4A 4TS1A 1JZSA 1LI7A 4MW1A 4JZYA 3IMEA 5J5AA 3GLVA 3CLUC 4MWCA 2CYAA 1N2JA 2AKEA 3IUEA 3P0IA 2WQ6A 1WOYA 4WNYA 4KR9A 3A04A 2OQ2A 2RE8A 1IFXA 2IJGX 4MULA 4ZCSA 4RPIA 2X0KA 1H3EA 1GPMA 1NI5A 1V8FA 1VL2A 1TFUA 2XRYA 1YIDA 3PRHA 3IDFA 3CLUD 4HPWA 4EF6A 5LM3A 2TS1A 1IQ0A 1O95C 3CVVA 3CLSD 5J59A 1COZA 3KFLA 1M8KA 4ARIA 1P7PA 4JYZA 1QRSA 5BNZA 3HGMA 4MAFA 2EJCA 2QJTA 2J09A 3MLBA 3RBAA 1K92A 1M83A 4BWVA 4YBRA 4MW2A 4QREA 2BYTA 1FFYA 1QJCA 1J1ZA 1J09A 2X1MA 2O5RA 3CVXA 1WZ2A 1R6UA 3TZEA 4MW0A 1JILA 1IHOA 2HMAA 1N78A 4P2BA 2O8VA 1MC1A 1Q11A 3AFHA 1U7DA 4CQNA 2DUMA 4HJRA 5DB4A 4H3SA 1M8JA 2J4DA 4R0NA 1QTQA 1ULHA 3FIUA 1Q15A 1UFVA 4MUNA 4JXXA 1MAWA 5F23A 2B7LA 3H97A 4XSVA 3ZJVA 1KH2A 2D13A 1JIJA 2ZP1A 4R2MA 1FYDA 1SURA 2C5SA 1KP3A 4MUFA 3K32A 1G8GA 3ISJA 2A1TS 1G8HA 4MVYA 3IODA 1NURA 1KKUA 3FNRA 3IVXA 3IH5A 1TEZA 1O95D 1MB2A 4ZT7A 3QE4A 1I6MA 3HFJA 3VRHA 4GU5A 1G59A 1O96B 3ND5A 4OUDA 3X1MA 1OWPA 3P0HA 1WQ4A 1JMVA 1T9GR 4X0EA 2CV0A 3IOBA 5K0SA 4DDKA 1VBKA 4ZT3A 3FOCA 4UZEA 2NSYA 4R2LA 1N2BA 1OWNA 3IMCA 3D6UA 4ZT6A 3UK2A 3ZJUA 1NUPA 4JFAA 4DNXA 3KT0A 1R6TA 2DLCX 4PBSA 2BTEA 2V0CA 1NYLA 3PNVA 3Q12A 1MRZA 2D54A 2E18A 3SP1A 4DE5A 4NDAA 1M8GA 3AKZA
chains in the Genus database with same CATH superfamily
3CG4A 2IX3A 4RTNA 1MQ8B 4I4IA 1SZDA 2PUWA 3R5SA 5EIEA 3WE7A 1G38A 4NJMA 3L5KA 1DBSA 2BUAA 3F3KA 1JAXA 4MWSA 2Q1XA 1CFZA 3WOHA 5C37A 1W1WA 1VB3A 3AP3A 3WWPA 4N48A 1E2DA 4RMJA 1SXJA 3RUFA 3Q72A 4RGYA 5IJXA 1YHNA 3C6XA 2ZRKA 1M54A 4COKA 1XTKA 1ZJ4A 3FVWA 1L8XA 4CMIA 3BRCA 2JAHA 3OQMA 1PJAA 2O1SA 1VE6A 2GYYA 2XRMA 3BJEA 3PFNA 1GPNA 721PA 4GGPA 4YRPA 3RFFA 1Z4JA 1ULTA 1RAGA 3CXUA 4H6XA 2ODBA 3VR5D 2G6BA 2GPAA 2JCGA 4UU7A 1ONNA 3N28A 3A4TA 3IAAA 4RY9A 4E2XA 1DIOB 2AFHE 5K5EA 2O19A 3TRJA 4DV5B 2PEYA 1W0KA 4YJHA 3OJEA 2IHYA 2HK6A 3DLCA 5HIJA 2P9CA 3NJ8A 4N12A 3OUZA 2IBMA 2X2OA 2ARKA 3TTUA 4IJ6A 5FF9A 2O07A 2GKOA 4R1NA 4BP3A 1IPFA 1TQDA 3PQFA 4E51A 2EWMA 3QEMA 4EJFA 1SVKA 4MRAA 5TMPA 1X7YB 3QPUA 5KVVA 2O6HA 4AJIA 3FHJA 4IRUB 1OC4A 4PR0A 1JG2A 4QHYA 2ON6A 4F3RA 3QX9A 1IBKB 3BD9A 1JIXA 3Q7EA 5IUKC 2XZTA 3QLVC 3NALA 3ZCQA 2EF0A 1H2WA 1JR2A 3MOSA 4GH5A 2ZYSA 3BDAA 1A1SA 1CUEA 3PSHA 1ZI8A 3QF4B 5KEIA 5KU1A 5CH5A 4F9TA 4AU1A 4MS1A 4WXMA 1LSSA 2EARA 2GPWA 3DYBA 2QUHA 3MMZA 2ODAA 1W4LA 5SZHB 4X5OA 3KJQA 3STYA 1KJJA 3VC1A 1S8OA 3JZMA 3DHEA 1TJ5A 4HLQB 3EVFA 3TCKA 4E2YA 1G6Q1 4XEHA 4C7JA 1LWNA 3QF7A 2FA9A 4EG7A 5IJWA 3G59A 4K9QA 2XAAA 1UP6A 1IG3A 1QLWA 3RSQA 2IYNA 3RV3A 1H2AS 3EDCA 1ZNZA 1ECLA 2X76A 3BGDA 1LF5A 3MOIA 2H1IA 3PUWA 3OX4A 1E6CA 4BB5A 1KWGA 2CD9A 3QJYA 3EX7C 1GQSA 2EF1A 3R8CA 5E1DA 3QP9A 2F4VB 3A4IA 1PFWA 4OMCA 4BP9A 1Z13A 4OY3A 4EMTA 4C30A 2XHEA 1FFHA 2AN9A 4UAJA 1M34A 2NUAA 3BB4A 1SCJA 4FXOA 4GLFA 4R8KA 4LRTB 4BGEA 3KD3A 4WMLA 2CLCX 2QPAA 2EQ5A 3B5IA 3NTUA 2EU8A 2OXIA 2C84A 3EVDA 4HC4A 1H1LB 2OHFA 1L2TA 2V7GA 5EPOA 4JLDA 1DAGA 4GM0A 4LY0A 4A92A 3D6MA 3GFRA 3KL4A 4QT4A 5HKAA 5K01A 3GJQA 2W42A 4OP1A 2FXIA 2G80A 2YY7A 1N25A 1YKGA 4OAPA 4IL5A 4MVJF 4PYRA 2GPBA 3RPEA 4B5KA 1QOPB 2R87A 4YALA 4DQ0A 2FGJA 3WWDA 4ZIRB 2ZREA 5AFSA 1JFLA 1NQWA 2N0SA 3A6ZA 2A78A 3Q98A 3MK31 4H77A 4F2WA 1XJ5A 2IYVA 3BJIC 3RYHB 1PNTA 4ZEOA 2PMDA 2ZRQA 1VA4A 3UHAA 3MBOA 4KFRA 2O2GA 2D5BA 1C3OA 5K4AA 3RRNA 1BE8A 1PUXA 2SICE 3ZEIA 4U8HA 2NQ2C 4HZIA 2FW9A 3TPCA 1Q0UA 1YZQA 1ZX1A 3TVTA 3KKEA 1I24A 2F55A 1R9MA 2Y92A 4BNZA 3T94A 1IXZA 5DNCA 1Z15A 5G4KB 4IGFA 4FJ0A 4RHYA 4YMIA 1NJ8A 3WLMA 1ZIXA 1Z0UA 1JA0A 3H2SA 1PSWA 4M55A 4PAQA 3A70A 3SSOA 4D7AA 4M8IA 2ZULA 4XWTA 1CDOA 3MJHA 3OZRA 5JD3A 3EGXB 1XZKA 1F5SA 3GT0A 4XRRA 1ICIA 3H1BA 2XEXA 5EQFA 1YSCA 5JR3A 4LYHA 3Q3EA 4RADA 3TB4A 1WXHA 5J3JA 5K2OA 3EEOA 1WZNA 2IOHA 2GK6A 1GRQA 2EFHB 3ZQKA 1Y7PA 2XDQA 1I2CA 3V97A 1KMNA 2BDTA 3KZCA 4G56A 3OFND 3GRRA 3S4YA 4EEKA 3G9ZA 1E69A 1EJBA 1OHHD 3OT1B 2EKDA 3TLKA 1NXSA 5AI5A 5LLSA 2J85A 3U4AA 2WKQA 1RE1A 2Q2VA 1DJQA 1L7RA 3OE5A 3PQEA 3PHHA 4JT8A 4MV6A 1OT5A 1Z0DA 5FPHA 2HLHA 2XJ9A 2QW1A 2XQFA 3Q8LA 2PUFA 3ZUPA 2RJ3A 3INGA 1W4BA 2R8EA 4EPXA 5MN4A 4ND6A 1VLHA 1Z28A 2VH1A 3LI2A 5IAAA 4C22A 4KV9A 4NNOA 1ESZA 4N6OA 1F8FA 3M34A 4O4JA 4OXNA 4DCPA 2VF2A 5LQNA 4PSKA 2UZ4A 4TKVB 2Q1UA 3JQ8A 4LTMA 2ZRHA 2AH5A 1P8JA 1NPYA 3T5GA 3W9BA 3ZWNA 4C3VA 4KYTA 1RHQA 1E3IA 2CDCA 2RHJA 4K0KB 4KO4S 1DWUA 4E5PA 4O4LA 1PVDA 1E9EA 4A91A 5J4VA 2DX7A 2ZJ1A 3TTVA 1I33A 3CW9A 1WY5A 3NV9A 4KQ6A 4TKVA 1VI5A 2ZJYA 3WKEA 1E8MA 3GY0A 4C4PA 2FOXA 1UBMS 1XL1A 3GRPA 3QM1A 1Q0ZA 4O08A 1I4LD 3U1VA 2WUGA 4LA4A 4ZYWA 3PRJA 4RW0A 4UFNA 3AJEA 2I4LA 1IG0A 2ORED 2J59A 2Q3EA 4LFBB 3X2SA 4HFJA 1O94C 2BF7A 3OURA 4L0CA 4Q4CA 2EW8A 3OU6A 4K9SA 4M49A 4PN3A 2ZXUA 1H2ZA 1XEWY 1NYQA 3BZUA 3KZ1E 1U9YA 4YPVA 1O0BA 1BWSA 3TMAA 1B8PA 5T4BA 2HRZA 2W4IA 2WJJA 4IV5A 3V8VA 4KN8A 4X65B 4DQKA 3NTVA 5IJ9A 4LZAA 1EESA 4J4TA 1I7LA 4D4IA 4EYGA 4KXVA 4OYLA 2O8BA 2OWEA 2R9VA 3R7NA 2BMWA 2I6TA 3RHZA 3JQGB 1KXZA 1L3BA 2HCTA 3QVTA 1NX6A 2HCBA 3TAHA 3WZ2A 2DERA 2KPOA 1W96A 1QIFA 2OXEA 1U9IC 3B5JA 3BGSA 3BHMA 1F4PA 3CRVA 3LKBA 3E3LA 3O8RA 2G9QA 4ZO7A 3CZAA 1XFAA 2VRBA 4LG1A 2AG0A 2N3ZA 1T2CA 4GP6A 2CSUA 4RL4A 5A0FA 3KIPA 3RC3A 4PC2A 3AQIA 4QBTA 2XLBA 1PJSA 4F7WA 3HDJA 3KZMA 4YROA 5HKLA 2HU7A 1N2HA 4JVSB 1SKUA 6ADHA 5KOJA 2D7CA 3TOSA 4Z49A 3EGIA 3ESAA 3F9IA 3L92A 3S2EA 1DWPA 1N9GB 1Z9BA 2AFIB 1XPUA 3C3DA 1ZCJA 1MX3A 2XVYA 4HGPA 2GDZA 1M2KA 4X54A 2DPLA 3UMYA 2YJTD 1G17A 3KYJB 2D3TA 3AYXB 1QB7A 3FPFA 1U7OA 3IUBA 2SNIE 2Z98A 1ZINA 2GD2A 3QKRB 4N40A 5J4YA 5LD2B 3T3NA 4MHTA 1UDBA 1P0IA 2X7XA 3FF4A 2CJWA 5REQB 2WTNA 3PQ3A 1FDOA 1PBTA 1ZM2A 2MCFA 3GZNA 1IY9A 1R6BX 3B2QA 3FRJA 1WZUA 3QA3E 3RTAA 4HOYA 1EUCA 2HA6A 2AC4A 3A4YA 3OC0A 3TIVA 2C2MA 1X13A 3WWZA 1M6EX 1R4NA 3RHTA 5HUHA 3OLQA 4JSTA 3UMSA 1PFVA 4EF4A 5B1HA 5DM60 1CXZA 1NJ2A 2FFBA 3DDZX 3HEAA 2H0RA 4N3GA 4CIWA 2CEAA 1U81A 1QHHA 4LS3A 3KAPA 4DG5A 1A9SA 1TKAA 4MUKA 4DQVA 3G8AA 3HGTA 1HY3A 2V5VA 5ALXA 4D79A 3LW8A 1M0TA 1JL3A 1W52X 3VC7A 2F43B 1SC9A 2BIFA 4HB4A 4ZZ1A 2A3NA 4QXRA 1NOKA 3E9EA 3LBAA 4A0FA 2NO0A 3FBWA 4OUKX 5T6BA 3SDZA 4EHAA 2FPIA 1C0LA 5CG1A 3GIDA 1PWXA 3W2HA 3OTWA 1M34E 4QGAA 4P6VF 4HLDA 2J9RA 4CV3A 4JI4B 1P73A 1EVEA 2D1SA 2PSHA 4G9GA 5D01A 2YHAA 5H82A 5JAIA 3FMVA 3G13A 3NG1A 5EJ6A 4DLRA 4OHWA 1WKCA 5EXEA 3DWFA 1WMSA 2MR5A 2ZYWX 3VU8A 1EWRA 1QR6A 4GX0A 3IEUA 5LXTF 3SBDA 3U16A 2FFAA 2JFBA 4JQSA 3W2GA 4DMCA 4FYHA 1A4UA 1Q92A 1E6KA 1WB6A 3CLRD 1QH1B 4JBLA 3AEKA 3N6RA 4POAA 3AUXA 3LD9A 1FFXA 3OE4A 3SX2A 2Q4RA 2O0JA 3LUCA 1ADFA 1N33B 2WV7A 2V7XA 4H60A 3WYCA 1PK7A 5J2UA 2RCNA 1O03A 4B09A 3KOZA 4TS1A 1USVA 1DU4A 1N2CA 2CLHB 4MW1A 2DZDA 4X41A 5FR2A 3EQ8A 4RABA 1I3KA 4BO0A 2AOUA 5EIFA 4CTNA 5IAEA 1KK2A 1NBEA 3WGZA 3ENWA 4LE2A 1OZAA 2X8LA 4LIPD 5J2TB 3CUTA 2XCTB 4QGSA 1V41E 5DGDA 2NU8B 4I5DA 4EUNA 4PCVA 4IINA 3SSMA 1AT1A 5B7NA 2C9MA 2JFZA 2QP3A 4LMBA 4DR1B 1GPMA 2I34A 1UC9A 2Q5EA 3EBLA 3BWCA 3FF1A 4JSYA 4YDHB 4A1FA 2P2YA 1L5RA 4JR2A 3SXJA 4RF2A 4KGXA 2R44A 3STTA 4QBFA 3CPEA 1O95C 1VRVA 3FUWA 1HGXA 5G0TA 3CVVA 2WAOA 4QHSA 3GN2A 1OU4A 3KWFA 1QV7A 1QV6A 3M5DA 2H1OA 3M2TA 2BRUA 4P7FA 4EVSA 1JTEA 1SZCA 2ZITA 5IABA 4GYKA 2L42A 2JFNA 3U4GA 1VG9B 3U9TA 1OE0A 1P4AA 4YQFA 3FHLA 4HX2A 3DBOB 4OMUA 4XD2A 1XE3A 5KHLB 3EMBA 3F0TA 3G9QA 5B1DA 2EP8A 3MTJA 2IYTA 1FFGA 4FKBA 4DNFA 3NNNA 3T1YB 2GUWA 2IC5A 3RIYA 3VKGA 1Z5ZA 4EO4A 4IXNA 2EBFX 5J40A 1DFIA 4I5IA 3PC6A 1K9SA 2GBLC 1Q0QA 1NZDA 1DELA 1X74A 2X1MA 3LA8A 1DO0A 1Q0LA 2HQOA 1R6UA 5AOCA 1WZ2A 2WFZA 3LPCA 1YGPA 3O4HA 1CRPA 2GBFA 1K9VF 4LF5B 2FSSA 4ZDWA 3BXZA 4P2BA 4UU1A 5ULLA 1W88A 3AHEA 5F2NA 5HFAA 3R5HA 4HDAA 5B12A 3PK0A 3L4JA 3DOEA 2B0JA 4M8KA 4R3UC 5LWQA 2AV6A 2X1VA 1NZFA 2AS0A 2W2KA 2VR1A 4FW8A 4Y6GB 2YJGA 5KYWB 1WHTB 3FOBA 4RC9A 1UCFA 2C4HA 3T4XA 3AEUA 5HIIA 2FYTA 3FIUA 3OBBA 2DPYA 4G1CA 5EZQA 2V55B 1C9EA 5IDYA 2BHNA 2BEWA 5E4FA 2NQ8A 4P83A 1AZWA 1E92A 1V7PC 3I1JA 3TQQA 1R50A 2VO1A 2EZUA 2Y67A 4EUSA 2DHEA 3VUFA 3MTQA 3SOZA 3ILSA 1A5TA 4OHPA 5CIQA 3TQCA 3C4QA 2RG7A 3OWXA 3JATB 1SUFA 3ISJA 1E9DA 4R81A 1QRDA 4UM8B 2JAWA 2HGSA 1ONOA 4GNKA 2AUNA 2IZZA 1RXUA 1LSUA 3A0UA 1F2VA 4CG2A 4ESOA 4IFBA 1TLTA 3DDUA 2A9RA 2I62A 2J3QA 4I55A 3ZZTA 4YV0A 1CUWA 3DQPA 1NU8A 5JDCA 1YBMA 1F8YA 1KOFA 1UMCB 1QVVA 2DE0X 3QKUA 4FE3A 3ZW9A 3VDNB 3ESRA 2R86A 2PMBA 1WUHS 3DOCA 3FOAA 1VE5A 5CDUA 5D00A 3VKFA 4N6GA 3OEHD 4U00A 2QTFA 1MA0A 1FNNA 4A8JA 1BMFA 4S04A 4Y2GA 3VOBA 1B0UA 1E3WA 2XZDA 3C5HA 3OIGA 1QONA 5GVRA 3SX0A 3UFXA 1JDBC 1UAYA 4M86A 2I4OA 3PPXA 2P4QA 2DQKA 1KFEB 2J1LA 2W37A 3L7LA 1FBTA 4BX0A 2ET6A 6REQA 1QZ3A 4Q9DA 4H4DA 4B9EA 5FTWA 2WUVA 4UHBA 3CIOA 2COUA 1Q3TA 4J07A 4HMPA 2VEDA 3UT5A 3SHWA 2JRCA 2I91A 2I6SA 4JL5A 4BQOA 5DT9A 2CNLA 5E1BA 4B6OA 2QIPA 1IVYA 1E2MA 3C74A 2IYFA 1RP1A 2AR0A 5JQGA 2ZATA 1G4AE 4IS3A 1WOMA 1UXJA 2HO5A 2C31A 4J03A 1P1CA 1DHTA 1GPBA 2AFRA 1U8CB 1QG4A 1YB2A 2FEKA 1YJQA 1YZKA 2XBLA 4G07A 2F9FA 4KXNA 5EJFA 2Z04A 3HKDB 3ZIDA 4YHHB 4MAMA 1C9YA 3D5QA 3O83A 3PJFA 3B3FA 4JEUA 2CXOA 4H3HB 1AMUA 2M1XA 3CO5A 3HV0A 4NI5A 1XVAA 2GAFA 3O4IA 2MINB 4MR9A 2HY7A 4L9RA 5IMBA 4YYZA 4GBGA 2NTNA 5JNTA 4D82A 4XJXA 2HJRA 2X86A 5G1OA 5AJZA 3OZXA 3GOQA 3HU5A 1XKXA 1LDBA 1VHTA 3BSWA 1A98A 2QMOA 2PJUA 5L3ZA 1FMCA 2AE1A 4PYIA 1R8QA 1EGVB 2UYOA 1ZRNA 2EFEB 5TQVA 4E30A 3HGQA 2IH5A 2GPNA 2UYYA 2RH8A 3W6OA 2H0QA 3EEFA 3GJ0A 3RWBA 2JGJA 1ODCA 1NVTA 5EHGA 2FRDC 1NJ1A 1CE8A 3WY9A 5AK5A 4PXSA 4B0PA 5JUWA 2FFJA 5CUQA 1J0XO 3MG9A 4ZYLA 1K06A 4CPDA 1W9HA 1V47A 3UUEA 1DQRA 4XGIA 5EFOA 1EEXB 2WT8A 2G0AA 3V48A 2DCUA 5I7OA 1FU4A 2PX6A 2HM7A 4IFEA 5JH7B 3BGWA 3IHTA 3W2TA 4CT5A 1TD9A 1JQEA 1L7QA 3L79A 1J21A 4J2TA 3A9TA 2I9PA 4O5AA 3USES 4OLBA 4R69A 4WOPA 1OSNA 3TSWA 4AWBA 4EO9A 1MD9A 2C97A 3I1FA 2QXYA 1GGMA 4V1CI 3UMBA 4D9CA 2O8DA 1YQDA 1E1KA 1ZM4A 4FCTA 4KQHA 1IOZA 2JEZA 2WYVA 5BV2P 1CEEA 4Z7QB 2XWQA 2P5YA 1VSUA 3CMCO 4NFSA 1EP1B 2G1AA 1NSTA 1T1IA 1ZN8A 2GM9A 3ECCA 3O94A 4CKBA 4K6OA 1IK4A 3BK1A 3ZG6A 4HVCA 1BEUB 2ZYGA 4F6RB 1SG9A 1I01A 2OV2A 5CIWA 4ZMBA 1UKZA 1Z2NX 1QHGA 1UXHA 4HV4A 4YR7A 1KHHA 4XJVA 5EVCA 5BSVA 1QIKA 4MKIA 4G1FA 5NLLA 1E5VA 3JQ7A 4KDEA 2A35A 2D7DA 1LTQA 4Z86A 2A57A 5TQJA 1JLLA 1SUEA 2FPGA 2YVAA 2VAVA 2PUVA 4X6YA 1DZIA 1Y1PA 3AJ9A 1GL7A 3PQ5A 2VSXA 4LF7B 4RTQA 1CY0A 2ZVJA 4JI7B 2QE6A 2JAUA 4U63A 3OQJA 1L8OA 4FOLA 2WD9A 3GPBA 1SRQA 3WJ7A 3I0MA 2YV4A 4A0GA 4HUTA 4Q7QA 1L5FA 2OBXA 2G7ZA 1NPDA 4Y1EA 1UIMA 4ZPXA 5ALLA 1T0HB 4ZVLA 1MJNA 3OE7D 3OTQA 5LZ2A 4Q82A 2GETA 2XT9A 3SQDA 2B82A 3SSAA 1NF2A 2ADOA 1UODA 3VX3A 1Z6GA 2OENG 2J7KA 2VYVA 3RYHA 5IEBA 1QYWA 1VPVA 1H3NA 2NO5A 3EXG1 2ZG6A 1HETA 1X15A 2BBWA 5JZ9A 1D4OA 4PZ9A 4G8BA 3SVLA 1O6ZA 2YINC 4Q7KA 4CN9A 2PFKA 4O4IA 2UUPA 1WHSA 4G1VA 1WSDA 2ZIWB 4P3OA 2GB4A 1YZVA 3L8YA 2WU8A 4B3DA 4WBNB 4BNIA 3OLXA 1AKQA 1KVQA 2EJWA 2B9VA 4Y2QA 2Y4OA 5AHWA 5CLHA 5AK4A 3IR5A 1Y42X 4UXIA 1KO7A 1SCQA 4RUKA 2OLEA 2YV2A 4GSLA 4LYYA 4BNDA 3SEFA 3MGCA 4WNAA 1RAIA 1WMEA 4JUIA 3CRRA 3PFBA 4MQ6A 4AIRA 4D6XA 2IEDA 2R1VA 3KOXA 4G5QA 4WLFA 1R4ZA 1K8YB 3F74A 5E1MA 5AQEA 4DMRA 2VRNA 2XXJA 2O05A 2Z1DA 1P18A 1TVKB 1TZMA 2AEMA 2VPQA 3BOSA 3TLAA 2V3VA 4FNAA 2QMHA 4YASA 5EQJB 1BQ4A 3RSGA 5M2QA 1P0MA 1WW8A 1NVGA 4QQKA 3ZBQA 5JAZA 1M0EA 4RDCA 1UOPA 3ANYB 3KZXA 4NLLA 4P4LA 1KNXA 3VU1A 4DNPA 2K7FA 3FPCA 4RD3A 1Q21A 4I1PA 2FPLA 2CNWD 2H7YA 1TQ2A 2JJ2A 2QORA 5DHPA 1I5RA 1NXOA 2WTMA 3DO8A 3SZUA 2VDJA 3W8RA 3ZU3A 1SXPA 4YHBA 2AJLI 3CEPB 1MA3A 5FNZA 1DAPA 5CFMA 1CG6A 2ZT7A 1DBRA 2IV3A 1JQLB 2QLNA 4I50A 1QHNA 3O8OB 4R5HA 1IBSA 3OX3A 2AQIA 2QZZA 1XTSA 4A82A 4J8PA 5KNLA 3AEYA 4OV6B 3PHJA 4I9GA 3RAEC 4MUBA 3EDMA 4IZHA 3RIXA 4K8RB 4YQZA 1UPXA 4QYIB 1RLIA 1EK0A 5EIWA 1HEIA 4NOMA 2PUDA 2WIKA 5SYMA 1EE1A 3CPJB 3DE2X 4JYAB 2PS9A 1OOEA 1Y6QA 2X7HA 5HSGA 1D1QA 1C1XA 1U5AA 1U5BA 3TXAA 4EH1A 1L4BA 1QAMA 1ZOIA 2EWVA 2UU9B 2LP4Y 2O06A 1Q17A 2AR7A 1PWZA 5M34A 1ZI6A 2X14A 1RWXA 3FAZA 2CNKA 2IHZA 3RVRA 2YS6A 2H1LA 3NR2A 1ECFA 5DHSA 2GKSA 4CIXA 3EBPA 3U7IA 1D5CA 3GIWA 4YRIA 5EKXA 2HB6A 2PS1A 4N3NA 4LBZA 4R6XA 2QD2A 4MVJG 4A5SA 1JSXA 5E6SB 3ZI4A 4L9AA 4QX6A 1LRJA 2OCXA 2EBHX 1MCZA 2IP2A 1DDGA 1G5FA 2R6FA 3EZ2A 3KQWA 3Q5DA 5K3DA 4GT1A 3HV2A 2SKEA 4JC0A 3TNJA 4KVAA 5ENDA 4PCLA 4KXLA 3KPWA 4ZRNA 5FULA 3RKRA 3UK6A 4BLSA 4DV0B 2AXEA 5TDHA 2DFDA 2PCLA 4FZ5A 1Z29A 3JPYA 2QWXA 3KB2A 3PE6A 4CU2A 4CEJB 1ITZA 1LLCA 5KYGA 4X66B 1BGXT 4NZYA 2JBAA 3MELA 3N3AC 2I22A 1DKQA 3MB5A 2QEQA 4H4EA 4OHZA 2BEUB 2RGYA 4UUOA 4BV9A 2DBZA 3K70B 3ESBA 1W34A 2YHSA 3EMKA 4QIHA 2R96A 1QKJA 4LOLA 3HXQA 1JWAB 3OX2A 2EP5A 3GA0A 2FXVA 3BULA 4MMXB 3NP7A 2P27A 3QFFA 5KNDD 4B3BA 1D0VA 2AG8A 1Z88A 3BH7A 3AKEA 4URWR 3MMNA 3QXSA 4FMCF 2CLKB 1ODSA 3WV4A 2JLRA 4ALJA 4CDRA 1G2OA 5IHXA 5F98A 4KHPB 2WTAA 4JMLA 1HDEA 8LDHA 3CH5A 1PFGA 4AG5A 5P8WA 1U3VA 3A1VA 4XYEA 4ZV4A 3VNUA 1MZPA 3K2BA 4ENUA 2A1TR 2AXPA 2OG1A 3BRWD 4FEGA 4W63A 3UANA 4CKCB 1PR5A 3ENNA 1I80A 1FTQA 2ZTHA 2DLNA 1C50A 4J0KA 4PY2A 2QN1A 4QUDA 4UM7A 1EDBA 1QK4A 4MP6A 4Q1FA 1MFPA 4QARA 1IQUA 2V7QD 3HR4A 4ND8B 4IVQA 4TTSA 1LDYA 1H8HD 2ZYTX 3I9V6 1OLSA 3ASUA 1TTHA 3DC7A 3L8FA 4ZDKA 3OOSA 1WG8A 5A9RA 5BQ3A 3TLGA 3DKPA 2G3YA 1X1TA 4EP1A 3NAQA 3W2IA 3R6GA 2F3QA 4FGKA 1D2MA 2W2VA 4QM6A 1J23A 3WKBA 1FZQA 1N6RA 1N0WA 2WAMA 1A9ZA 3K31A 4NK5A 1G2QA 1U6KA 2W6JD 1QU2A 1BMTA 1TM3E 1CIJA 4ZOAA 1L1RA 2AI1A 4YRAA 4HQLA 3TM5A 4Q4DA 5HUQA 4MJ3A 2VJCA 1T2VA 3TIGA 2BWJA 3GFFA 4KZPA 4XXHA 5HTOA 2FW1A 1O5IA 1A7KA 1V5IA 3Q9LA 2P5TB 4BMNA 1RW4A 1UJCA 3GCWA 3H1AA 2WZQA 4RF3A 4TZTA 2PMKA 5CX1A 3ZVRA 2NYUA 5E3HA 3TSYA 1JZQA 3MCZA 3DMHA 4EHKA 2H52A 2EKLA 5EKUA 5HGJA 1ZICA 3O0TA 4UNQA 1WDMA 4BZPA 4NZZA 2O1EA 3IAFA 3RSFA 3STVA 3WIBA 2VLBA 3ON5A 2XQGA 4YRTA 4DPMA 3C3CA 1YE5A 2YOGA 3CZQA 4D98A 3D64A 5AW9A 5TE9A 4DR5B 3P45A 4UHHA 2YWCA 4KFTA 5E6UA 4J7XA 1HA3A 3NW9A 1BJKA 4D5EA 4GPD1 5ADWA 3NAGA 5CYFA 5FBWB 2Y1FA 4CFYA 5C34B 4ZYVA 3OQOA 4YN3A 5FTKA 1KFKB 3N39C 4MWGA 5HCNA 3A7DA 2QMQA 1V1MB 3A58B 1HC7A 1T9ZA 4K1LA 1VZ2A 5ESXA 4AUMA 1XPJA 4YRMA 5KPDA 3ERCA 1KIMA 3BQMB 4JLKA 5A4KA 5KJCA 2REQA 1KI9A 3C6KA 3F5QA 3H0EA 1YZLA 2AMFA 2DFNA 3LUHA 4X90A 4CLEA 4EW1A 1X1CA 3QXHA 4WOBA 3DAHA 1KBOA 3AF5A 2QTNA 4S0XA 4HYQA 4JOQA 4BDSA 2GVNA 3CJRA 1TO2E 1XRQA 3WL8A 3FPGA 1NPTO 5TQ2B 4C6TA 2OGZA 3UHPA 5J63A 4AS1A 2Z30A 2I33A 3WNVA 3KAQA 4K40A 1QS0B 2C8LA 3A6FA 2QN8A 5EIBC 3LQ2A 2XB9A 2RMKA 4UATA 5TJ9A 1JKJB 7YASA 1SKMA 4E15A 5L45A 3MJEA 3L8CA 1Z6PA 2D5CA 4CMGA 4WK2B 1PFUA 1JP7A 3PUKA 1IK6A 3GX1A 3R0JA 3UV3A 5JZOA 3DA8A 3EZ6A 2BGTA 4P4UA 2XA2A 4NK4A 2C9ZA 5FV4A 3IBTA 3HZOA 4RKRA 3DXYA 5LBIA 4FCVA 4RDHA 4C4AA 1M2OA 2GK3A 2ZZMA 4KPFC 2RE8A 3CH7A 1Y6JA 3HDTA 3AUYA 1N9ZA 3WHLA 1H8EA 3BTUA 4IJQA 2WU3A 3EN0A 4D6YA 5ALVA 3H7AA 5I51A 3MRVA 5I9TA 1NI5A 4DLVA 2P77A 3WBBA 3FRHA 3CLUD 4XWOA 5I7VA 2GASA 1BVRA 4F8EA 2NO6A 1D04A 3RC9A 1W36D 3OU2A 1V26A 1FYEA 1GKIA 4KXUA 5TRTA 5JCXA 2RHCA 4TSKA 5HTKA 2MMCA 3U3OA 1FSGA 4DSTA 3EXFA 1CR6A 3K20A 3R44A 4GVPA 1CKEA 2EJCA 1M1NA 3LBNA 4ITVA 4RELA 3C24A 5FLYA 5LP6C 2A0WA 2PKEA 4IGEA 1QNLA 4PTZA 3OD5A 6Q21A 4KDCA 3SY8A 2Z57A 3FBGA 3LC7O 5LDDC 2W6QA 4BO7A 5IT4A 4MW2A 1OLSB 3QEKA 5IN4A 1CEQA 1I3LA 1MC4A 2Q2QA 3K16A 4KGZA 1J1ZA 2E37A 1U9ZA 2O5RA 3CVXA 2W6IA 1KGSA 4M36A 4U7WA 2NXJA 4E5KA 3LYHA 2YXBA 2NTEA 5IANA 3Q40A 4ZAGA 2O52A 3ZGVA 1L4EA 1TA4A 4DCJA 2ZJ2A 2FHSA 1MB3A 2GZAA 2Q3DA 4OAQA 2VYVD 1UBGA 1WL8A 1XV5A 3K1JA 4G0QA 4Y2VA 3WLFA 4WKGA 4B76A 4Q9IA 3K70C 2ISQA 1UBLS 2ZDHA 4QPDA 2AKAB 1TXGA 4JBIA 2BFBB 2I1QA 4N03A 3ZS8A 2ZI9A 1UXGA 4R7ZA 1P1BA 4EMSA 1RWKA 1E63A 1M6HA 2HSDA 4KIFA 1DEHA 4PU0A 3O3CA 4BRSA 4YMWA 2WHQA 1S3FA 3HB7A 2YJ3A 4RGVA 4Y2UA 3AF3A 3B9QA 2YVQA 3A1DA 4OL0A 1VLJA 3KOOA 3BFPA 2HK7A 2FSVA 2XIQA 1A9OA 2WHPB 3IILA 4MDEA 3IUYA 4FPXA 2JKVA 4D8TA 4DIUA 3K8QA 2SBTA 3PZRA 5ALIA 1U2SA 1CUSA 1MXFA 3R20A 3UAWA 1X3SA 1V16B 5ERGB 3STUA 3U4QB 1LBIA 4B40A 1OY1A 1KKUA 2JIQA 5L3SB 4O29A 3GLIB 3ZGXA 1K6XA 3BD6A 3I6QA 2YIMA 1G3QA 1QP0A 3VXKA 1O95D 3MINA 1CX9B 4P3NA 4ZQGA 5JTUA 4TLAA 2VIIA 1QKIA 1QQ7A 2PDAA 4ASUA 4DV6B 1Q84A 1OX4A 4UBIA 5ALEA 3KHSA 5HDBB 3EG5A 5E9JA 4DMMA 3B6MA 1CVRA 1X7WA 3LYAA 4UBLA 4W5JA 3L0CA 1J4AA 1JMVA 1TZJA 4RFSB 3HUFA 4CLOB 1DV2A 3IJEB 2D8MA 2OK7A 1IXRC 2A9JA 4PLPA 3USZA 1BCSA 1GTG1 1RCTE 1T5SA 1H2XA 2DLDA 2O7QA 1CBUA 2PM8A 2WNSA 3GXOA 1T2DA 4HFNA 4IF6A 3OZUA 3X2EA 3SQWA 1JHQA 3ENKA 4EATA 1A9QA 3KQLA 4E1VA 4LSMA 1KK0A 4M1WA 1E4EA 1PQ4A 4GUAA 1HNXB 3PFWO 1SM4A 2IUSA 5IF3A 4PLYA 3KT0A 3ILYA 3JX9A 2ZQ5A 1O4VA 3JWJA 2NVBA 3NM6B 3OJLA 2E6KA 1LKZA 3K94A 4RY2A 3D4BA 5DWVA 1OGJA 1UPBA 3PNVA 4AK9A 5LOVA 3OM9A 4CE6A 1KPGA 1Q12A 5ESDA 1B8UA 1ZSNA 4RD0A 5AKJA 3FCUB 2D4AA 3Q6NA 4BFXA 2P9QA 4B33A 4HDOB 1TA0A 1BXKA 4INPA 4PAGA 4MYRA 4BP8A 4C20A 2QZ9A 5A4IS 2OHGA 4LKOA 1XA4A 1T35A 2YZ7A 5D5HA 4P5PA 3IX7A 2VCEA 1XAJA 1DIRA 3HUDA 3JV7A 3DLTA 5TNXA 4LZZA 3SEAA 5C1DA 1G1MA 3HBJA 4KXWA 1U9JA 3GR6A 4DDHA 4LF8B 4B4VA 2GAOA 1CFJA 4QSHA 2E5WA 2IELA 3BJRA 4JP3A 2ZJ6A 4YK7A 2PUEA 3DE3X 5D3QA 2WIFA 4RV5A 5ADVA 3O4JA 2Z8XA 3ZE9A 1MJFA 1V48A 1FVFA 3H11B 4D97A 3ANNA 5I9BA 4ZI7F 4EG3A 2CCGA 4RKYA 4O8ZA 6AT1A 3FW1A 3CE9A 5DNEA 2ZU6A 3L6CA 1RYFA 4J3FA 3BIWA 4C3OB 4E2WA 1FL9A 2OXFA 3FETA 3N8IA 2WYIA 4ML3A 5DMHA 1Q7CA 2IWHA 1GL3A 1R64A 1ISFA 5GONA 3LBYA 4LJ7A 2PTHA 3LHDA 3ECSA 3K0FB 1W25A 4BOYA 5M7EA 5A6VA 3TLMA 4HDRB 1KQOA 3H4TA 4BX9A 5JSUA 3E1SA 1SVLA 2A5FA 3JR3A 1AD2A 3GMIA 4EVIA 4Q19A 4XB2A 4UCQA 1JR3D 1YBHA 2EAUA 5HF5A 3FZYA 4U2FA 3OMLA 4REOA 5F7JA 1Z33A 4WXHA 3TAUA 3ZZMA 3OCCA 5DNYB 2BHTA 2RGBA 4Y18A 4CHTA 3ILHA 4B43A 1JAYA 2Y1XA 3AV3A 4O4HF 3BBLA 4HLCA 3GLSA 1DC5A 5J5VA 2WP0A 3LFHA 3FWKA 4H0FA 4EA8A 1U3UA 2V4MA 1NG9A 2IXTA 3FWHA 2I3ZA 2WIAA 3QXJA 3ZY4A 3FI9A 3U7HB 1IPEA 4H7JA 3UGTA 5IXJA 3TFWA 3T1HB 4WXYB 3GAAA 4EO7A 3CR8A 1QIGA 1WBJB 2XNCA 3EAQA 4EYKA 1I7NA 4KN9S 1DAEA 4C5AA 4HDRA 3QFSA 2P9BA 1OFHA 2E49A 2EX1A 3HSYA 1PI3A 2GD1O 3AILA 4HFMA 4I3FA 5FI5A 3EOZA 1JBQA 2I8AA 1E0DA 5DNUA 3AB7A 4MIEA 4Q34A 2VHWA 5T64A 3LLMA 1V43A 4X1YA 2WJ3A 2D8AA 4KQIA 2JDID 3VGJA 4DVJA 5I01A 1DHRA 1YL7A 2JVJA 1AXGA 3ZZ0A 1XTPA 3M6LA 5ILOA 5IT9A 3INNA 3NBAA 2RGRA 2YZKA 1LK5A 4R2XA 1X87A 3TPZA 1FXWF 3EZXA 3NUQA 1IZ8A 4Z6KA 2PD6A 3HJFA 3EIFA 3U3XA 3KB1A 3TL3A 4EB6A 1Q5PA 1SHKA 3CH4B 2VTBA 1R37A 1V3UA 1V5GA 2ODEA 4L72A 4FTWA 5AK0A 3U6KA 3ZY3A 1NMYA 1PUIA 5CDYA 2H0AA 4WXRA 2HJSA 4HN2A 4EW6A 2Z0MA 4D02A 3VZPA 3K8OE 3BWXA 5CYOA 2P2CA 1QCCA 1GCUA 3VSBA 5IWCA 1V11B 2VSFA 4OI1A 3P0FA 1UAGA 3FPBA 1VSTA 2H1VA 3EBOA 5HZGA 1PGPA 1FDTA 5LDHA 1QZUA 1XOIA 2PYDA 5I9LA 3O3NB 4NBSA 5EKDA 3L9WA 1ISSA 1SU7A 2FW6A 2MSDB 1PS9A 4C89A 1JNXX 1AB6A 3C5EA 4RXTA 1A95A 4MJLA 3OCXA 2OZLB 1L6RA 3BA1A 3LJKA 4ONEA 1P7VA 3ABZA 5C1OA 4B6RA 2O3UA 1SD1A 1TTQB 2Q3CA 3GD7A 3SEQA 1P0QA 3GEGA 5SY9A 1Y5LA 2PKQP 1IAVA 2VAXA 3C3XA 3GRCA 1OMOA 3O7MA 3OY2A 1W46A 4M9CA 4Q9AA 1EWKA 1A2KC 2FN3A 5D1NA 2X4LA 3HBMA 3L6OO 3LVQE 4D0RA 1Q3HA 2LVBA 3GG2A 4KC0A 4GRAA 3KLPX 1P2VA 3FYUC 5B3JA 1X19A 1EQUA 2A58A 4F4HA 4FUTA 2IS6A 3PNKA 4ZOLF 4CM8A 4H7FA 4LOKA 3GDWA 1LY1A 1BE0A 3I42A 1JEQB 3VO9A 1ZRHA 3D6JA 3R75A 3VI3B 3M9XA 4G4JA 1JHMA 4C3ZA 4D9MA 4E5VA 2WUDA 1U7UA 1FYWA 1B3BA 3N2GA 3QENA 5HMMA 4CR7A 2J3DA 1CR1A 3AJ8A 5G41A 5LCXA 4BZXA 4EELA 2XJ4A 5DZSA 1K7CA 3BSYA 2OPBA 1CCWA 2QL6A 3R3ZA 1AC5A 2IK8A 4LVNA 4M54A 4C7OA 3RRFA 1DAMA 1OJLA 3HEMA 2R47A 1H93A 4ZDIA 2VYND 4QNRA 1DL5A 1G7CA 1U3WA 4Q1CA 2B1GA 1RYZA 1U0SY 3HXTA 4WNAB 3T9FA 4YCSA 1GAJA 1ZJ5A 3EC1A 2WQ7A 1IPHA 1FVHA 3NBMA 1WDTA 1E59A 1TIBA 3TQFA 3ZU6A 1EAMA 1ESDA 3WTBA 1VXRA 2B3DA 4HDNB 1YNSA 4TQUS 4G5RA 5LBTA 4I1VA 3RFUA 1OD6A 2VDUE 1H6AA 1K75A 2FE4A 2HIMA 2J5BA 1NVVQ 2HKIA 2AW3A 2LBPA 2P9HA 1Z0AA 2XSZA 1TJ4A 2HA2A 3A25A 3MJSA 3MSCA 4FHZA 1MJGM 1DKLA 3EZ9A 3INYA 4LV6A 4C0XA 2ZUEA 5E3JA 5EUBA 4DQUA 4KG7A 5FNVF 4CQLB 1KQFA 1H22A 3QPCA 4PANA 4TN5A 4QYWA 4UEOA 1FCJA 3MRXA 1Y8ZA 3K6RA 3T3GA 3OZBA 4DIFA 1GVNB 2W6NA 2ZBVA 1MP0A 1XPOA 4LYFA 1BEZA 1IJEA 1XK6A 2ZTLA 4URFA 5JS6A 4R71A 1IE3A 3NIFB 4NSNA 1R88A 4AJ2A 1D7OA 4FX5A 1TF7A 3V00A 5JSQA 1P9RA 2RGXA 4ALKA 4D4KA 1GV1A 2C2OA 4HB2A 3FSJX 4RL6A 1V6AA 1TC1A 2XGOA 3FDIA 3QBVA 3H11A 1Z4MA 2AMYA 4EGAA 4YX9A 3IIJA 3I9MA 4EY3A 1Y8CA 4XOIA 5CT6A 4WBNF 1K66A 2JPDA 2GNPA 3W8NA 4OHXA 5A2QA 4HXFB 1RP7A 1Q77A 2G1KA 4L9SA 1H2YA 2BKEA 3BL5A 3GROA 2BJHA 1KDYA 4Z7OB 1KTIA 1NBIA 2OGTA 3G5UA 5JIBA 4YP1A 3D81A 4MS1B 4PM4A 4H1HA 3EHEA 4OQZA 3SXUA 1QQBA 1DBVO 3QLJA 3V3KA 4B82A 3EOAI 4BAUA 4Q3EA 1EBFA 4TUYB 4U7DA 1W0CA 4QAJA 3WI7A 1U0NA 1VGRA 1A04A 3GLHE 3ICVA 4ENTA 2QVZX 1Q1ZA 2ECPA 2OQIA 3PVSA 4CCWA 4YT8A 5JECA 3DPSA 3PUXA 3CN7A 3HB9A 4HEA6 2YMLA 3L8EA 3C41J 1BNCA 4GOOD 5HQJA 3ZEAA 1CY1A 4ED9A 3MD9A 1SBIA 5DM2A 4XIJA 1OAKA 3M4ZA 1LD3A 2OM6A 3R8XA 1BHJA 3PFCA 1B16A 1YZYA 2XGSA 5F73A 5ALOA 2XD9A 1B93A 4Q4AB 4DCNA 2A88A 2H1CA 4JLOA 2Z5LA 5AR1A 3F7NA 1UADA 4YCDA 1I6KA 1QFXA 2I2DA 4JGBA 4V03A 3ZXIA 1TK9A 1SVUA 2K87A 1F0YA 1NUTA 2G83A 3PWTA 2Y0BA 5ES4B 4KE8A 3WL4A 4MLPA 4U2DA 3TS1A 3SC4A 3SC2B 3SQNA 3F96A 4QKQA 3OPMA 3WWCA 3D7LA 4M83A 5JZSA 3HB1A 4NICA 2Q8QA 3IEPA 4RANA 1HOXA 5T4FA 4GICA 2ZJZA 1YUNA 4GXTA 1VYHA 1AY0A 1E77A 2V5AA 2F9LA 2VATA 3KSMA 4X1YB 3VFDA 3WIUA 2Y1EA 2ORIA 3ESCA 1KHTA 1ZMTA 3CGGA 3KR2A 3OECA 1KJQA 3O9VA 4OQEA 3B1KA 1N3LA 4TUYA 4A0QA 2A9PA 1K97A 3O8OA 2H29A 4EY8A 3CGWA 1JYEA 1H0HA 1QIIA 2SKDA 3F2VA 4Z0PA 1V1RB 4RE5A 1L4LA 5DM1A 1N2CB 1Z75A 1GKLA 4Y7DA 1CQJB 1HORA 5AUQA 5M5BA 5EWJB 1AKYA 2OO5C 2ZZNA 3JZIA 4UM9B 5IXYA 2PL9A 2PEZA 2IV7A 3LL4A 3AVVA 4JHXA 3WHPA 4EUHA 5K3BA 3AZOA 1C7FA 1M2EA 3B5EA 4UNRA 2HK8A 3ZE2B 1EUQA 1EM6A 2YVLA 3QNWA 3SICE 1UM8A 5FEUA 3U61B 3G23A 4RVCA 3B8EA 1WP9A 3G79A 4NJEA 3FSGD 4KPUA 1TM5E 1KC3A 4PXAA 1MIOB 5EEGA 5LMZA 5G0SA 4DT1B 4ITUA 2J3HA 1TJNA 2XTJA 5HJEA 2V97A 3D6HA 4NC9A 5KAPA 5TV2A 4RKWA 4B8WA 5ITZB 1RI2A 3N9IA 1XTBA 2R85A 4IDNA 4ZZIA 2OCYC 3TI9A 3C85A 4UARA 1LSJA 3IQDB 5EHNA 2A1UA 3RYFA 3RYCA 1SIWA 3WLOA 1S9HA 2M2IA 2Z3ZA 3G5LA 4I99A 3RU9A 1H05A 1ND6A 2WWWA 1VJCA 2Q6LA 5DCWA 1WMDA 4XRGA 4GHWA 2ZSIA 3TKLA 2Y8EA 2XMSA 3FGPA 4RTMA 1F38A 1FNBA 5JAHA 3CNLA 3PFKA 2ACEA 3O3MB 1C8KA 1HO3A 1WOYA 3ROZA 4W8OA 3JQAD 2XBUA 3L8ZA 2ZWVA 2OR3A 5KSZA 2AKYA 1TO1E 4UBJA 3R7AA 3L1KA 2X9GA 4B6QA 4NMMA 3H2HA 1QVZA 1M2GA 1ZITA 3AKYA 3EFHA 1V8FA 4OEHA 1N4AA 4BN4A 1R8JA 1I3OA 2GA8A 4IVRA 2G1JA 2B6NA 1DTSA 2HYDA 3GBVA 3IPYA 4MRMB 5DMXA 3ROMA 5DYYA 2PBRA 5I7SA 2IU3A 4F2DA 2I54A 3VPCA 4YJ3B 5AW6A 3L1VA 1Z8FA 3E84A 3TL2A 1P7PA 3BRWA 3KCQA 4R54A 5K6RA 2YBEA 2GXSA 3CLHA 3MWDB 4OYRA 1J25A 5D86A 5FLKA 1VHDA 5IKEA 1VCHA 4YAEA 5JJBA 2O8CB 2VWQA 4RENA 1TF2A 4B3IA 2I2CA 2YWEA 3SF8A 2YIDA 5F2KA 5C5DA 2C4TA 5LYJB 1E2BA 3LBIA 5GIPE 5C7LO 3ZHRA 3H3JA 1F51E 3JZAA 5DP2A 4BE9A 1SXQA 1E79A 4FVTA 2AZDA 4AZ3B 5KYUB 1DIBA 3MWEB 5D7NA 3CX6A 2XNDD 2FPSA 3A9SA 1SU6A 5F3WB 2JIBA 3WJ2A 1RHJA 4PZYA 4QGBA 1YB6A 3WLJA 2GO1A 1M6VA 4OPMA 1ZZEA 3QLEA 5FL7D 5JWRA 3WGVA 1QGUB 5SZIA 1X9IA 3IELA 3IO5A 1M72A 3MSXA 4N5IX 3IIIA 3MW8A 4BZWA 5KTYA 4CQNA 1VPEA 3PDIB 1BIFA 5FWYA 4TKLA 5DB4A 3T1TA 4H3SA 3TUIC 3WRYA 3GRFA 1Q7TA 3MWLA 5I6DA 1LLUA 2IPLA 3BFXA 5GONB 2BLLA 4CBVA 1K08A 1R0SA 3BWMA 4K87A 2OHJA 3CX4A 2ETXA 1ZD4A 16PKA 4WCDA 2B7LA 3RVKA 4FMCB 4BO8A 4CFZA 4DPKA 3OPYB 2GVZC 2Q46A 2QRVA 3QUAA 4H7KA 3K32A 4PPFA 4CNQA 1N32B 4UJ5A 3UTCA 3B70A 3H8JA 4GL4A 1Y0BA 2YZNA 4BLWA 5DN6D 1RACA 1C41A 4TXLA 3WX0A 1QP4A 4BY9E 2YWJA 1RMTA 1G8SA 1P2TA 5SY6A 3AETA 3SXUB 4BP1A 5AVTA 1V5EA 2JIDA 4YAOA 5BSMA 4LZOA 1ZMRA 2WEKA 2M6KA 3ZJ5A 1E5XA 3ZHSA 3ZY2A 1VDMA 1ISGA 1VIYA 2DHDA 2HRBA 1FP4A 1K89A 3PA8A 4FHFA 5JRZA 4NXMB 1SVNA 4F5WA 2HLDD 3NOXA 5LNK1 3IVAA 1ZCFA 2CK3D 2J4FA 3P9ZA 4MA0A 4CF7A 3WAGA 1G59A 1JH8A 4EHDA 2ZSJA 5DX8A 4F5YA 1KY3A 2LIVA 1RT9A 1ZRMA 2C5GA 3NLLA 4AJEA 1PR9A 4NFYA 4KQWA 4L08A 5T4HA 1LGYA 1RRPA 4C4YA 4GFDA 1ZCBA 5CCDA 1A8PA 5KNBH 3ZN2A 1H42A 4KN6A 1VKHA 2ZYVX 4NMWA 4W8HA 5FJJA 2EX0A 2GPYA 5AVOA 2CMKA 2XMPA 4AZ0A 4YQYA 2GPSA 2RJOA 1EFLA 3QWFA 2YRWA 4V0SA 4LJKA 3DM5A 1D7AA 1A71A 3Q2OA 2RKOA 2V7EA 4INOA 2E18A 2FF5A 3PS9A 4UMVA 3ZE8A 5FL7A 1Y6ZA 1QG0A 1D8AA 3CCCA 5ALWA 4WZAE 1EGAA 1KIAA 4TTAA 4BEJA 3CY6A 3TQSA 1F8GA 1YI8A 2XUZA 2B4AA 2FK8A 1WHSB 3M6VA 3DV2A 3B85A 3WA6A 3RU2A 4D3XA 5IYZA 3B1VA 1MT3A 4RZXA 1RQGA 1RBQA 4GZ3A 3NPMA 5F64A 3NTRA 2GARA 1XDSA 1QF6A 3RT7A 3DBHA 3P9YA 3K5HA 3IXMA 3GVHA 1NUSA 3LDUA 1J9EA 3TZ6A 1SXJD 2LKDA 3DP9A 3OIWA 1JDSA 3LM8A 4KNVA 3K0FA 2IXAA 5BW5A 3TSOA 3K5IA 4F06A 2DR0A 1T8PA 1X39A 3NC4A 2GTIA 4UNSA 1RWOA 1F0NA 4BU0A 1OH7A 4UPDA 4MEBA 2DWPA 4QOHA 4C04A 5CDHA 3PGMA 2I4RA 3Q7TA 2GF9A 3SKYA 5TY0A 4TZKA 4FGLA 1QBGA 3OPQA 4F21A 2D1RA 1JVBA 2FPGB 2QN7A 4J1TC 5F7ZA 1SOUA 3O8LA 5CGQB 3RNLA 1NXWA 1DC6A 4G8JA 2C07A 4I50F 4WDQA 4DY4A 3HZZA 3OE7A 3QYFA 2NADA 1Z6ZA 2JCYA 3D6NB 3H2ZA 4W6ZA 2CV1A 3IHWA 1NW3A 1PK8A 2AL7A 2RHOA 5CVJA 4LZPA 3SJZA 1CEYA 5MGNA 1C9MA 3CUEF 1FVOA 2PZLA 3L82B 3SYLA 4A0RA 4B7CA 2Y1KA 4EJ6A 3T6KA 3WRWA 4D3ZA 3W06A 2AZXA 9ATCA 5B6PA 4RK4A 5T3YA 1NT4A 2FX5A 2QV0A 3PXXA 2X8WA 4JC4A 4KQKA 4JUFA 4UMFA 3P26A 5CMLA 1FVXA 1OPRA 1WUIS 5K0NA 2HXGA 3DZCA 4DOMA 2ZB4A 1UBRS 1G5HA 4LWQA 3RSCA 3VR6D 621PA 3QWAA 2REQB 2R6HA 1OYYA 2BL4A 3TRHA 3VKVA 2JARA 2PSSA 4PPGA 4LJ6A 3BK2A 5TT0A 4O4LF 3CE6A 5FFNA 4FILA 4F6CA 2BGMA 1H9CA 1BGVA 3P9CA 1TZ2A 4AG3A 1UOEA 3UMFA 1QCDA 2ZB8A 4Q93A 4DADA 1ZLXA 2POCA 1CERA 4IOJA 1BH2A 4PC1A 1DIAA 3Q3JB 4BPRA 3B6KA 4C43A 1GN8A 4Q9NA 5GINE 1DT5A 2EXXA 4RFSA 3FDZA 4TMTA 2C5LA 4TT8A 2PS3A 3L77A 1JDPA 4XLLA 4CT4B 2YDXA 2ONZA 1CQWA 4JDPA 4FFSA 2C95A 2I2AA 1L5LA 3UAYA 4EKEA 3TIFA 3F6RA 4D4GA 4O1MA 1U8YA 2P91A 3JARA 1GGFA 2WM8A 4W1RA 4C6RA 5KB3A 1GTJ1 1RIIA 2BKLA 2E0IA 3A1TA 5DI3A 2VC2B 3AESB 5BR1A 1VKRA 1G66A 1MG0A 3O8BA 2XBMA 2Z58A 4KBYA 3L8GA 1Q14A 3K1YA 1SJ9A 4OQFA 4UOQA 1N2GA 1YULA 3C39A 3CNBA 3HM2A 1KR5A 4KCGA 4NV1A 4B31A 5L3SA 2I29A 3GLIA 2QUKA 3IMGA 1OAOA 1ZFNA 3CLVA 3L7MA 4ZJYA 2NIPA 2IHNA 4TTQA 1Z7GA 2JCSA 4Z7NB 3UVEA 4GR9A 4QFBA 5DHRA 5BNTA 2AVDA 3IEKA 3O4RA 3VDMA 3KOYA 3KT3A 1OFTA 3ONEA 1ZZGA 3EYWA 2VBIA 1Z0KA 3OJFA 4DBLE 5DBGA 4ENQA 5CLIA 5FYDA 1UBNA 3ZH9B 2QTWB 2W6ID 2EHJA 2TECE 2LR0A 4FEYA 2YN0A 2ST1A 5F33A 2OV8A 3HQ4O 3C97A 4PZPA 5CIYA 4GKAA 1CY6A 3HYLA 1MZVA 3G9UA 2Q3LA 4LAFA 2PRIA 4W7HA 4PLZA 3NHUA 2B25A 4QTXA 4PF1A 1COWD 1M1YB 4I0WB 1IH8A 2G71A 2QGZA 4MINA 2HU8A 4KX3A 1YKSA 2D5AA 4HWOA 3TDKA 5CB8A 3U7GA 3UHFA 4MUIA 1AA6A 1LX7A 2OSBA 1I3NA 4HPXB 5IC6A 2D7JA 4N7BA 3W1VA 3ZXUB 1SEVA 2WVHA 4MH0R 5LC1A 1WQ1R 2HRDA 1L5HB 4MVCA 1WAMA 4DIBA 3D2LA 2Q7DA 1VKJA 5IASA 4WK4B 3ZVNA 1U8UA 4EY6A 4Z54A 4NXNB 2B5VA 2I03A 2QZJA 1PL6A 1ZEMA 4ZCLA 3NM5A 5BSWA 2L82A 3EFBA 1UFRA 2BONA 1AGNA 3FCXA 1JEDA 2O8FA 4CEIA 3QJGA 2FPOA 3BD7A 1DC8A 1AUOA 3DBLA 3LZCA 4RA9B 4YAFA 5CNJA 5IP5A 2NZ8A 1ST3A 2VNIA 2X9QA 2OT3B 4JXKA 3WOVA 4QVIA 1Z63A 2JBAB 3PFFA 1Z8NA 1AVTA 3PQ2A 1HWYA 5C31A 3N2KA 2V6JA 3TW0A 3UQYS 3UOWA 4NBWA 2WUEA 3D8BA 2VT3A 3QELA 2GAIA 1QGAA 5GMOA 4TYYA 1U2TA 1LBQA 1M5TA 1T15A 5F2OA 1WVIA 2COKA 4IO1A 1R4NB 4BFTA 5IVDA 1VE3A 3UHOA 1HLDA 1JZTA 4ZTUB 2GH1A 4HAWA 3JWEA 1OFIA 1IHUA 1KC1A 1F7VA 4DLNA 1NSYA 4XWAA 2PSEA 3ETJA 3KXIA 3QUSA 1WWKA 1UDXA 2FEOA 2ERCA 3SJ7A 5AOVA 1U98A 4BJHB 1N0UA 4M0PA 2WTUA 3GMDA 2H4XA 1RWBA 5HILA 1BKSB 1TMYA 1DBWA 1I3MA 1MNAA 1R6XA 2AMLA 1OYWA 4G0NA 3UJAA 3N07A 3ZU4A 3C4JA 4N6NA 4EJ0A 1IN1A 2ZJ4A 1JT2A 3DD5A 3TRIA 3NWEA 4QG3A 2VUSA 3B7WA 3PCXA 4RU1A 3O95A 4A73A 4CQJA 1QS0A 1R8SA 4EI9A 1ZHHA 3Q5GA 2WZBA 4U3JA 4W9NA 3JD1A 4AMZA 3H6HA 2J07A 5KJ6A 2I76A 1IZYA 3QE0A 3KETA 3BMCB 2GCPA 5K3EA 4KRFA 3SN6A 2ZYIA 1UEJA 1Z37A 4LHXA 1MABB 2GN1A 1AJEA 2Z09A 5FOSA 4R1LA 3KTAA 4H15A 4RBNA 4WQMA 2CF5A 2PMFA 4KMRA 4MUYA 5FA8A 4O8CA 5BNFA 4LNUB 2EBWA 1JDJA 3R76A 4OP2A 4QICA 3UBMA 1J0EA 3A1WA 1X1QA 5FH9A 7GPBA 2G63A 5DXAA 1USIA 4DA7A 3FJOA 1EGQA 1Z8DA 3UQZA 4KI0A 1WPGA 1Z07A 3CVYA 5CD1A 3B9RA 4Z0TA 4AYTA 4MA5A 3EG9B 2G9UA 2IXEA 1BKDR 4LBYA 3H18A 1XDDA 1OFGA 1BDIA 4WTOA 5TQ0A 3MT7A 4QU5A 4I08A 3AIIA 1NC3A 2F3SA 2F17A 3HSKA 4CCAA 1O6BA 2GN0A 3FROA 4NR0A 2O8EA 1U0TA 1VIDA 2OSVA 3BVPA 2BGNA 4GQBA 4IXMA 4OLHA 4JJKA 3OQPA 1YC5A 2BM9A 3QSGA 4UXHA 3UK1A 1M2WA 2H07A 2HHAA 1T1JA 4JX9A 4CF5A 3S29A 4HXGA 4IIBA 1BMQA 4UOEA 1YR1A 1U11A 2LUOA 3HCDA 2YJ4A 4F4FA 2HYIC 3DMTA 4UE2A 1BDBA 4K9DA 5DRYA 3FH0A 4EFLA 1M5UA 1E3WB 3NP9A 4LI0A 4CQMA 1ECJA 2PR7A 4L2IB 3E82A 3TB6A 3ZQJA 4CUJA 1KI6B 1OLUB 3G88A 4MUXA 3ET5A 3VSDA 3ZX5A 3H7IA 1NUHA 4EKIA 3BF7A 5IN5A 4UDOA 3WL5A 1V4BA 3COVA 3L0ZA 1WZIA 2HFJA 1E32A 4GLJA 3EWNA 3VZDA 2YXNA 1FMTA 3HCEA 3ER6A 1OI7A 3ASVA 4HB3A 5CK4A 2GF0A 5EC8A 5DTRA 4EUEA 1J8VA 1EX7A 1B8VA 2IKSA 2UZ3A 5CNMA 1XMIA 4J90A 3RTBA 4G8DA 4YRBA 1RR6A 5CGZA 3SHFA 1ISMA 2GXQA 4MQEB 2E89A 2FMFA 4RPLA 4TV8F 4YBZA 1DIHA 3DFIA 4J0DA 5EMKA 4CMIB 2V6GA 3EVGA 5JQWA 1ZDMA 3BXEA 1WU7A 4Y2JA 1EI9A 1NATA 1L7VC 3BQ9A 3GFGA 3OQHA 1GJRA 3AEQA 2B78A 5DYTA 3K4PA 4BJ3A 2Q3FA 5KX5B 4L1KA 4RCVA 4YP7A 3ESDA 4LJ4A 4M0EA 3A06A 1RZRD 1I3CA 4PFSA 1E96A 2HO4A 5IX8A 3B89A 3JYOA 2CXUA 3N0VA 3Q6MA 3R3XA 1GA4A 2ZUTA 1NI4B 3BWYA 2ZZKA 1CJVC 4NV3A 5J2TF 2HXSA 2M6SA 2XWJI 3AXTA 1BYUA 2DUWA 1GRRA 1ZESA 5FFFA 4AWXA 4JUAA 4TKZA 3UNXA 3S5UA 4EFKA 5BSFA 2C2ZA 5BWBA 1M6YA 7MDHA 1L5GB 4EJSA 1GGVA 1TDJA 4HNGA 3GVPA 2QX9A 2ADFA 4M0UA 3WISA 1NM5A 1U0EA 3ZWXA 2COEA 3DB1A 2OECA 3LE8A 3LMKA 4LEIA 3T9DA 2BHRA 3F71A 5AKIA 3C1AA 3NHMA 4DLYA 1F0KA 3W2EA 1EUDB 1S9DA 2CNNA 2G25A 2IY7A 2Z2XA 3OIVA 2UUCB 1SN7A 1X1EA 2DBRA 3LCCA 1EGHA 4KSBA 4DMUB 1U5CA 1ZQ1A 3RTCA 1O08A 2EG9A 3MCAA 1RRFA 1UBFA 4PZZA 1Z2EA 2BGWA 3KL2A 4N0EA 2HT1A 2A0KA 2WDZA 4QXOA 4M9SA 4BVFA 5FPQA 2QRUA 2AX4A 2O48X 2VF5X 3A3YA 3K5WA 2IYEA 5C8YA 2V96A 5TJHA 2PGNA 4DIMA 1CZRA 3ND6A 4PZAA 4TWAA 1ORTA 5AQ1A 1RPJA 3C1UA 3NIWA 1XLTA 3IULA 5J5AA 4HUQA 4FMDF 1L1FA 1ADBA 2CLIB 4C2TA 4XWGA 1AQJA 2H16A 3CMMA 3EHDA 5TVGA 4QDXA 3VYUB 1PQUA 1EFRD 3KCNA 1JQDA 2F6RA 3ORQA 1KS9A 2Q07A 3RS3A 3MGGA 4Z1MA 3UJPA 5AICA 2D0DA 1IFXA 3EMDA 1CJBA 4PLTA 1Y98A 4RPIA 4X60A 5EKSA 2B69A 3ZLBA 3E9YA 4EW2A 1YQWA 1LC3A 2F3RA 5GPBA 4DSZA 4BGVA 1Z45A 3Q88A 4M0DA 2J30A 3FDJA 1VL2A 4IDGA 4Y6RA 4EF5A 1FRNA 1GYRA 3FOFC 1JEOA 4XLZA 1HE3A 3L7CA 3FPKA 1HT3A 4M4SA 4BKPA 3AF6A 4BQQA 4MPPA 3PPWA 1XGKA 2VPWA 1SULA 3GPLA 4B83A 5KYYA 3BMNA 4BVJA 4LQ4A 1FE8A 1G5TA 2IXFA 4CTJA 5IULC 1VG1A 1TGYA 2PXAA 3JTMA 2P2ZA 3NANA 4JJIA 3RBAA 1UINA 2CL7X 2Z83A 2ZSUA 3BB1A 4Y9DA 1MOSA 1VTKA 1PZHA 4FDUA 5F1OA 3H84A 3AIKA 2K2QB 1C14A 1NMXA 4IEIA 1QE5A 2J0UB 2QUZA 4TTRA 5AXAA 2HTFA 4YJGA 4MKXA 1TVKA 4XARA 2W71A 5FADA 2P75A 3DLPX 3TZEA 2C2GA 3GJ5A 4IIJB 2PGJA 3IHLA 2AMJA 4IVNA 3ZVMA 3DGEC 4JP2A 4A8JB 5KSWB 3GLFB 3DEKA 5CLJA 1Z7YA 2O20A 4X1KA 1F6DA 3V1TC 4GOMD 4KXFB 4E1BA 1R7RA 4R9RA 4YCLA 3W5HA 1R6AA 3ML1A 4N3AA 3BDVA 3F97A 4G5GA 1PO7A 3ZZUA 4OQPA 1NJGA 1P5FA 2Q5OA 2ZE5A 5E6RB 5JE8A 5BSRA 4EB8A 2QY9A 2O2XA 4J2HA 5CB4A 4GOND 3UENA 2Y93A 3URKA 1F8UA 1CNMA 1V7ZA 1JFSA 2ZP1A 3NTQA 4W5OA 3RIMA 3A3PA 4Z1OA 2PPVA 2EDAA 4ZGBA 4LC0A 4BMYA 5HF9A 2FVYA 4RKEA 3EXIA 1SPBS 4WINA 3W6NA 3NTXA 4FXPA 1IU9A 3FNBA 4JBYA 4EPYA 3C5WP 1X92A 2J3JA 3JYLA 1U2GA 4YRRA 2H54A 2ZSBA 1MVOA 5FCDA 3ZK9A 3KWMA 1I1NA 2E1PA 4UVEA 4P86A 3QNUA 3QE4A 1T9AA 4RHFA 5BT9A 2WWTA 4L76A 3CKYA 2Z1NA 4G0YA 1XPRA 3WLRA 3HA2A 5H3CA 2R7LA 2P9TA 4K6HA 2W4QA 3KSBC 1ZWLA 2IIVA 3GFQA 3M7IA 4HGZA 2PRZA 5E1OA 3ELDA 4PLHA 4UTVA 1JEYA 2XITA 4S0ZA 1OWPA 1D09A 5ABPA 1PW5A 1QTNA 1G0NA 3K6SB 1XAHA 3UWOA 1OHHA 5ALSA 3RLFA 1G20E 3I9LA 4LFCB 4I9NA 4WCFA 3DV9A 3NHAA 3GGDA 4R2LA 2W70A 3SKVA 3VPGA 3EUEA 5EMLA 3RRJA 3VZBA 4Z0NA 2GXAA 1BROA 3AGPA 1OF1A 1XVLA 3GO4A 5H5JA 3CV3A 4R5MA 2DQSA 1VKOA 3QVGA 2QYOA 3DWEX 4D4MA 4ZJPA 1IHYA 1M7HA 4GI3A 4URYR 3RUEA 1ISJA 1R6TA 3JAMA 1C3OB 1RDFA 3IEIA 2VZ0A 3L0IB 5F12A 2V0CA 4B74A 3Q8MA 2ATXA 4DJ5X 3CUUA 2ZXEA 3EIUA 3P2EA 3FWYA 3QBTA 4AURA 1DJMA 3C48A 1Y1LA 3I45A 5EJ7A 1JHRA 1HZZA 3AKZA 1JV2B 4TQGA 3RS5A 3JQGA 4EHFA 3EDRA 4LE0A 2OWDA 2B30A 2ORWA 4ESVA 5DIZA 3V1UA 4RGBA 2KQUA 1YB7A 4UUNA 4C05A 5TXGA 3Q4GA 3PC2A 2GFQA 4L5IA 4WFJA 3ZY5A 4EAAA 2H4WA 3OJWA 4ZJZA 2JEOA 2WMYA 1P39A 2DOKA 3ZWYA 2CMDA 4LF4B 2PVPA 3HJGA 4H4CA 3P32A 3AWIA 1R6VA 4M1OA 3CINA 2YY5A 3TPFA 4ZFNA 3ET4A 3E35A 1GUZA 1R27A 2F9MA 2FZCA 2H5EA 2IYQA 3LOUA 4BL5A 3QUBA 2DWCA 2TMGA 4JQYA 4BC1A 1EAYA 2NU7A 1FS5A 4EKNB 3N6XA 5KTRA 1IM5A 4DXHA 3E70C 4D9GA 4MUEA 1A76A 5BP7A 5K45A 4P3XA 4KFCA 5HRCA 5M3BA 3JAKA 3QFRA 5EINA 2J33A 3CEAA 3G8BA 3L1JA 2VTEA 3V9AA 1I7DA 3OM1A 4LPSA 2OB2A 4X6UA 4URVR 4JOCA 3T5CA 5JANA 3M6MD 3UXYA 4CMCA 3CLTD 4PRLA 1FPMA 3REFA 3SR4A 4CKCA 2AFHA 3EWIA 3V8MA 1FFXB 2PUCA 4A4DA 5LP1A 4LOHA 3OZVA 2VNAA 3IDZA 2P9EA 4HT3B 1IUNA 4IUCS 2VWGA 3I04M 3GJ6A 3RS7A 5B6IA 4ZGGA 3NPAA 3OX1A 3H19A 1AF4A 1RPTA 2KWIA 3QF4A 4W5HA 4QE3A 5GAJA 3A9CA 5F1PA 3NGMA 3DKVA 1QV9A 4ZU3A 3HNPA 2XDWA 2EBUA 4P4SA 4BMPB 2CDBA 3PGLA 1UDRA 3IP1A 3U19A 2KLBA 5CP8A 2VDWB 1BDMA 3SIXA 1LCIA 1L6IA 1YL6A 2ZBDA 2Y3IA 3S2YA 4BNUA 2PAAA 3O1LA 4TZ0A 2ENUA 2Z5VA 3NX4A 1V3QE 1TX4B 4EOGA 1NLUA 2XDAA 4DLTA 4UAUA 3T61A 1GAXA 1ORRA 4S3MA 1DBIA 3CF2A 3ZNPA 2H9IA 3ZGZA 3TTXA 4DABA 1MG5A 3H9BA 4EG6A 2XZOA 2QI9F 4JJGA 1PR0A 3S1AA 5HVNA 1PSZA 3I05A 1KRHA 4NBUA 4D92A 1J8QA 2F4NA 4OJMX 3AFNA 3AK4A 1KYXA 3CTPA 4C0WA 1VHJA 2VDOB 3AVPA 2YYZA 3D3QA 3MJCA 1DVRA 4ZQEA 4FCCA 3ETGA 1H5NA 2JJ2D 1TU0A 5LBUA 4WW0A 2OGUA 3GLGB 1O58A 3NC1C 4BRUA 1KY4A 1S2GA 3ELUA 4FNMA 4HR7A 4PPNA 4TUYF 4O2RA 4OHMA 1B6SA 1WR8A 2Y1OA 2HGZA 1W0KD 1XNJA 2V3WA 4DV3B 1QQ5A 4RVHA 1B1CA 2X0RA 2ENWA 4R1UA 1USKA 2FK7A 1T0UA 4WLUA 3SCZA 4PNEA 4PYOA 1AKNA 3DKKA 3H6KA 3K6JA 1YDGA 3K35A 2IZ5A 5LQMA 2WB2A 1Y8AA 2C7BA 3ACBA 3R0IA 1E2LA 5L51A 4LXHA 1N9GA 2AFIA 3S81A 1JN0A 1RLUA 2PA3A 4YB8A 2NUTB 3ADKA 5KOJB 1T3GA 1JS1X 1PP4A 2QG6A 4L4XA 1CNFA 3WK5A 4WZBA 4FN5A 3RG8A 3TM4A 1GFIA 1MT0A 2AG6A 2CHVA 3AM3A 3VJMA 1T4CA 1KFJB 4C0BA 1E2HA 4YRCA 1A8UA 3SI7A 1P7YA 1SB8A 2WB4A 4ERNA 1TQ8A 4BO1A 4EHBA 4HRXA 2XRFA 2W5UA 1B7GO 1G8FA 2EYUA 3PUIA 2H8GA 4MRPA 3SLGA 4DDWA 3LKZA 4MS3B 3S1LA 4Y2SA 3THXA 1E3SA 1TU3A 2HJVA 1JQKA 2Y77A 5KCMA 1BD4A 1XSEA 3GQVA 1B6GA 5D3MA 1W6RA 1PJ2A 2HC9A 4ZQFA 1QJ4A 2Y1LA 3KHTA 5EE3A 2HQRA 1NVKA 2MJLA 4FFBA 5E9QA 1MNQA 1C30B 1KK3A 2JFHA 2O2SA 4KI7A 4YI5A 4Z9BA 3HCOA 2CHFA 4A16A 2B0CA 3GLHB 4MR7B 2QLBA 4DLUA 1PJTA 3AMVA 4QWMA 2XAUA 2VRWA 3TLEA 1CQZA 4ER6A 2WG2A 3E0QA 1LDMA 5H59A 2R11A 2B36A 1W2HA 4INAA 3A1EA 2R66A 2ZJ8A 4M88A 3E03A 3QBDA 2X8JA 3S1SA 1OKKD 2X5OA 3BD8A 3UUFA 5FEMA 2VUUA 4ZVOA 3VH4A 4YDQA 5FBLB 1UMDB 4DR3B 4MP3A 3AX6A 1RBZA 3FWZA 5CA0F 3MQ2A 1H6DA 3HJAA 1EG7A 3INTA 5JSZA 4DA9A 3F4BA 4P58A 1WTCA 3MFYA 3LBHA 1VLVA 2RI1A 4B2IA 5I8PA 3N5CA 5FL3A 4XJTA 3HJHA 1ENOA 4TLLB 1LRKA 2P6MA 4E31A 5F78A 4ARCA 4EKGA 5HZHA 1V4VA 4L57A 4DMKA 4A2QA 1XVIA 4X1KB 1KR2A 1Z0FA 1VBNA 1IXYA 1GTMA 2NMVA 4MICA 2CJFA 1HFKA 4V0MA 1KY5A 1W19A 3MBIA 4MVJM 4NVRA 1Y3AA 1KOGA 5B64A 2PXHA 2YQ5A 3ZDQA 5IT0A 1QQAA 1R0RE 3BHJA 2XVMA 3DDHA 1USGA 4MKZA 3FCSB 1NI3A 3P52A 1SVMA 2QR3A 4IOKA 3TNDA 3W5IA 2TMKA 3KO8A 1G5IA 1MUUA 3TW8A 5EHXA 2ZJ3A 2BEVB 3OQVA 2O5EA 1ECCA 5EYPB 4FE7A 4G0MA 1FFCA 1N7JA 1REQA 4D9EA 5C3MA 2HIGA 3N8KA 3SE0A 2GDJA 2QTGA 2I67A 3CYFA 2IW3A 3OMXA 4ZEWA 2CFIA 2XCOA 2DHQA 2C2YA 3R2JA 5AI6A 1JDUA 2B83A 3DCJA 2QT1A 4L73A 2B61A 4OQQA 5AJXA 3CLSC 3GVCA 5TQ0B 1DEAA 1KMCA 4RGQA 1YZGA 3CW2A 4Q3AA 2AOTB 1NJ6A 1ZIPA 1DNPA 3DVAB 4JWTA 4HKTA 3S70A 1YQGA 3HTXA 3BE4A 3IAUA 4MW7A 3MD0A 4UMEA 4IX1A 2VNKA 1AUPA 1BA2A 1VE1A 1U1IA 2C03A 2OHXA 3FRIA 3G2IA 1L7DA 3Q10A 1DKRA 4M1ZA 4BBPA 2BTEA 1AZTA 3CNEA 3W79A 2O2HA 3VGPA 4X62B 2MYTA 1Z6AA 3I62A 4OA5A 5EG5A 1P19A 4LJ8A 4J3NA 5CW1A 5EFZA 3EVNA 4AICA 5KSYA 4BCCA 4AO7A 3VU3A 2FCRA 3LDGA 2V6BA 4N65A 4RXUA 3D0KA 4J0IA 4OH7A 2GCOA 3KV3O 5HW0A 1R1DA 2WKWA 3JXEA 1SHZA 3WBJA 1QGOA 4R8VA 1SUPA 2LNDA 3P9KA 2CNOA 4OMDA 5G53C 3T41A 2NXCA 3B2NA 5KYXB 5AW7A 4QJBA 4UVHA 3DM9B 1B6TA 1J7JA 4MR7A 4ZVMA 5LPNA 1YIOA 3BFJA 4HL6A 3HVJA 4QEKA 1DQPA 1E3LA 4R31A 1CQXA 1ST2A 3C8ZA 3E4CA 3EIQA 4LJ5A 1DGQA 1P29A 1Y3BE 2ZKLA 1ZNQO 4QOGA 4FQ5A 4HGRA 3RO7A 5C8YB 1P7ZA 4QPJC 5LFAA 1ZJZA 3U0BA 3WAJA 3WR5A 3SYRA 2W2QA 5JNLA 2OOKA 1UBHS 1Z22A 2QTLA 1RJ9B 5LZ8A 4B2PA 2FR8A 2VTVA 3H6GA 1Z0JA 2B7BA 4KXMA 5ILQA 6NULA 5M29A 1DQZA 4HXEB 1Y7HA 4KIJA 5D5PA 2FG7C 1FNSA 3AKCA 3NHFA 4OXXA 3X43A 4BO3A 5KC8A 1GZVA 2MIIA 1ODTC 3IVRA 4FMPA 3P2JA 3NVMB 1TCBA 4LX0A 5KTOA 1FFBA 4TT3A 5FA6A 4ZC8A 4DFDA 4OX9Y 4TKMA 1CZOA 3HDGA 3I9OA 2ZRFA 4G0WA 2EFCB 3SR0A 4BBZA 3IXQA 2PL3A 3OCYA 4TS4A 2V98A 2RC5A 4WCFB 4PG8A 1GKKA 4FZRA 3H2KA 1A72A 2FN7A 3WIVA 2VQ6A 4Q18A 1DLIA 1JYSA 4O02B 3M3DA 4LHWA 3AI3A 2CJXA 3HA7A 1ES9A 3MJDA 3E48A 3KLNA 1V2HE 3NUGA 1GZ5A 1NASA 4FFPA 2F2TA 1HT0A 1G4UR 3H5IA 3LUJA 3O38A 1MH1A 4IUYA 4LYAA 5BRJA 5HHTA 1U1CA 2XODA 4OU4A 5D2CA 4JOSA 2Z2KA 3AEQB 1UPCA 2WW8A 3GP3A 3WQSB 3CG0A 3HVRA 4RLSA 4LV8B 1GTL1 3FCCA 1QYRA 2FN9A 3ELBA 4NU8X 2GF2A 4O2BF 3P7MA 4LI3X 4J1NA 1LK7A 2CDRA 1NT2A 1U9IA 3U26A 5I7WA 3ZLJA 1P8AA 2XMZA 1RTKA 1FTWA 2QLMA 3G0BA 5DM0A 3T4PA 3WGHA 5B5SA 4NX2A 4UTPA 4JKIA 1MDFA 2IEGA 3ZHQA 4YMTA 1J8FA 1IRIA 1TPYA 4K7JA 4NNPA 3ZDZB 4ZOQI 1K7EB 2PANA 3HI6A 2DHCA 1M1YA 4LHVA 4AJJA 1HMPA 4NBRA 3LWZA 4YJ2B 3U6BA 1E62A 1VI2A 1Y1KE 1KI6A 2WTEA 1GAWA