1KR2A

Crystal structure of human nmn/namn adenylyl transferase complexed with tiazofurin adenine dinucleotide (tad)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
271
structure length
233
Chain Sequence
EKTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEAAVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NICOTINAMIDE MONONUCLEOTIDE ADENYLYL TRANSFERASE
publication title Structure of Hhuman of Nicotinamide/Nicotinic Acid Mononucleotide Adenylyltransferase. Basis for the dual substrate specificity and activation of the oncolytic agent tiazofurin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 80
structure length 233
sequence length 271
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.1: Nicotinamide-nucleotide adenylyltransferase.
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1kr2A00
2YWBA 3P0JA 5BNZA 2GM3A 4MUNA 3FH0A 2O5RA 4J76A 3N2YA 1O94D 3ZXIA 1IVSA 4EG3A 5TGTA 1JIKA 2IJGX 2DEUA 1TEZA 2JA2A 3ELBA 3MUEA 2QTNA 1QU3A 4XFDA 3CLTC 4F3RA 4HK4A 4HJXA 3CVYA 4CDNA 4MUKA 2R5WA 5J58A 4MVWA 1M8FA 4QRDA 2C5SA 3SEZA 3FG9A 1I6MA 3TZEA 1NUPA 2HZ7A 3X1JA 1GZUA 3G6KA 4Q93A 4KR7A 3MXTA 2VTBA 1MRZA 1OBHA 4MAFA 1G59A 1VBKA 4MULA 1KKUA 1IQ0A 1XNJA 3RK1A 1J1UA 1X6VA 1O0CA 1N2JA 3K9WA 3QTTA 4UZFA 2D13A 5TEWA 2A7XA 1M1ZA 4EG5A 4MWEA 3IVCA 5DK4A 2J07A 3HGMA 1YUMA 1U7XA 1YULA 4MVYA 4ZCSA 3NBKA 2DR2A 4I6JA 2V0GA 1F9AA 3E27A 1N2GA 4ZT3A 4YP5A 3A2KA 5HUJA 2PG3A 4MUIA 3AG5A 1MB9A 5J5AA 2OQ2A 1N3LA 1OD6A 1IQRA 3NV7A 2V0CA 1N78A 1KORA 4KR9A 3PNBA 4R2MA 4U63A 4R2LA 4E1AA 1EFVB 3HL4A 3OTWA 3FIUA 1IH8A 4KPUB 1WXHA 3PXUA 1MB2A 3ND7A 4RPIA 2VXOA 1QRTA 1UFVA 4GRIA 2QTMA 4MW7A 1XNHA 5EKDA 1MJHA 3TQIA 2QJFA 4EF6A 1FYDA 4DNXA 1V8FA 2DERA 1KQNA 4A91A 3QE4A 3SZ3A 3COWA 3RBAA 4JZYA 4PBSA 2CSXA 3CLSD 3A05A 5AHWA 1QRUA 5K0SA 1K92A 1WKBA 3H9CA 3IOBA 4KR6A 3LCJA 1PG0A 1KH3A 5FO0A 1ZUNA 1ZJWA 2Z09A 3D6VA 3X1KA 3X1MA 1MC1A 1QU2A 3CLUC 2A88A 1QNFA 3IODA 3P0HA 1ULHA 4MWBA 2AKEA 2BYTA 3FHJA 4MW9A 3FWKA 2XRYA 4MW2A 2QTRA 2YY5A 3ND5A 4GU5A 1VL2A 2EL7A 1N2HA 2X0KA 3G59A 1OWOA 1JMVA 3DO8A 1PFUA 2GKSA 4L2IB 2TS1A 4DDMA 3BL5A 1T9GR 2O8VA 3NBAA 3L93A 2H2AA 1GLNA 1M8JA 1U3CA 2CFOA 1O97D 1K4MA 5H7XA 3TNJA 1IQUA 2A1TS 3HZRA 4ZCPA 2BTEA 1G8HA 2A1UB 3ZUGA 1GTSA 3OP1A 4OUDA 2CV0A 3SDBA 2A84A 3SYTA 1J20A 4I6EA 1XNGA 3CLRC 5JBNA 1BS2A 5LM3A 3KT8A 2X1LA 3CA8A 1DNPA 5H16A 4ZT5A 2IELA 2CT8A 4NATA 4DE5A 2Z3VA 1JIIA 3ISJA 2OV4A 3ILVA 3CVUA 1G8FA 2ZP1A 4MUEA 1WXFA 2WQ6A 2PIDA 1WZ2A 1EUYA 4U8HA 1KH1A 1VLHA 3N9IA 4ZT6A 2VTBB 1OWPA 1M83A 1T6ZA 2A1TR 3ZJVA 1Q15A 1YUNA 2X3FA 3VU8A 1WXIA 3M5WA 5DB4A 4DLPA 4MUHA 3COZA 4DJAA 3A4IA 1PFVA 1JEEA 3IUEA 4G6ZA 4YBRA 2Z08A 3CLTD 4MLPA 1EFPA 3KT0A 4G5FA 4WSOA 3I05A 1LI5A 2QUJA 3H97A 3IVGA 3CR8A 3PNVA 4R0NA 3G5AA 1FFYA 4DDKA 2DPLA 3CVWA 2GOYA 1TYCA 1WXGA 1MBZA 2CYAA 1F7VA 3FNRA 1JZQA 1HYBA 1R6XA 4JYZA 3UMVA 4EG1A 1N2OA 2J5BA 1NUUA 3IMEA 1O96A 1O5TA 2JAXA 2PZ8A 5FNZA 4ARCA 5TEVA 1QRSA 1EE1A 1QQTA 1ZH0A 4EG7A 1PFWA 1N2BA 3ZXSA 3MLBA 2DUMA 1H3EA 5HG0A 3DV2A 2J4DA 3C8ZA 3KFLA 4FZJA 2HMAA 3VGJA 1WOYA 1J09A 3VRHA 1P7PA 4ND7A 1M8KA 1R6TA 1Q77A 3IMGA 4CQNA 1ILEA 4EG4A 2DXIA 2DLCX 1ZH6A 4MUGA 3AG6A 4Q16A 4MVXA 4U7JA 1TQ8A 3IH5A 1N2EA 1J70A 1M8PA 1IFXA 1T6XA 2AG6A 3SP1A 3CVVA 4NDAA 1PG2A 1JGTA 1COZA 3TQOA 1GAXA 2DETA 1S4MA 4RUKA 3ZJTA 3Q10A 2YWCA 4XFJA 4MWCA 4MUFA 4YP7A 3RJZA 4ZT4A 1GTRA 4NAUA 4CT0A 4F4HA 2H29A 2G36A 1IRXA 1WXEA 4ZT7A 4HJRA 1QTQA 2ZUEA 2QJTA 2QUKA 1Q19A 2I1LA 3H99A 1KAMA 4EFKA 1QJCA 3A04A 2ZUFA 3UOWA 3IMCA 4ARIA 3LE8A 1NUTA 3IOCA 3Q12A 4G5YA 3CLUD 4X0EA 4OUDB 3N8HA 4S1OA 4TS1A 1O6BA 5KCMA 1NSYA 1NZJA 1R6UA 4ZCTA 1U0BB 1MOPA 1KAQA 1WQ3A 3L92A 1H1TA 1NYLA 3FOCA 1F4LA 1PFYA 1TYAE 3GUZA 1MAUA 3UK2A 3P52A 4MW0A 3SEQA 2YXNA 2XRZA 4MW4A 4MUJA 2RE8A 4KKVA 3LOQA 2NZ2A 1J1ZA 2E21A 3UY4A 2J09A 3COVA 3S3TA 1N77A 3COYA 4ND6A 4MWDA 1F7UA 1H3FA 2CUZA 1T6YA 1NURA 3INNA 1VBMA 1WQ4A 3CLRD 3HV0A 1YIAA 3GMIA 2E18A 5HUHA 1JEDA 2QJOA 1KP3A 1NP7A 4H3SA 4PBTA 1KP2A 3ND6A 3PRHA 1RQGA 4I6GA 2E89A 3JXEA 4UZEA 3ZIUA 3DLAA 2NSYA 3RHSA 5KHAA 1EFPB 1EXDA 3H05A 4QREA 2CYCA 1IHOA 1V47A 3K32A 4CDMA 3ZJUA 3AFHA 2D54A 3RK0A 1KQOA 2RD2A 4OJMX 4MW1A 1WJGA 2PZBA 3AL0C 2HGZA 2WQ7A 1J21A 3H9BA 3MLAA 5LLTA 1LI7A 1U3DA 3QTBA 1K4KA 3HFJA 1KQPA 4JXZA 1NUSA 4JXXA 1O96B 2E0IA 3RFFA 4NAHA 1O95C 5DEOA 2A4MA 1EUQA 4MW5A 1N2IA 1I6LA 4ZCQA 3D6UA 4ZCRA 3F3MA 4DDHA 5K0TA 2A86A 3PNYA 5FO1A 1OWMA 5DASA 2X1MA 3P0IA 4MW6A 4BWVA 1D2RA 2CYBA 4PY2A 1K97A 3CLSC 3ZGZA 4YP6A 1YI8A 4EGAA 2B7LA 3FETA 4AS1A 1EFVA 1YIDA 3IVXA 1NUQA 1OBCA 1TYBE 4PBRA 1O95D 3AIIA 5IHXA 1JILA 1B6TA 1X8XA 4KPUA 5F23A 2CV2A 1GN8A 2WB2A 1Q11A 3DPIA 3GLVA 2D5BA 1OWLA 3KT6A 3N05A 1T9GS 3FY4A 3FI0A 3MMXA 2QUHA 1SURA 3IDFA 2J08A 1G8GA 1WY5A 3UC5A 4K03A 1XJQA 1TYDE 4J75A 3KT3A 1LW7A 5LFAA 4K0RA 3IOEA 1Y42X 2EJCA 4P2BA 1M8GA 1O97C 1JECA 2WSIA 4ZT2A 1CT9A 2AZXA 1KH2A 1A8HA 3AKZA 1JIJA 1I6KA 4MQ6A 2IP1A 4XSVA 4EG8A 1I2DA 4YMIA 4MVCA 3FDXA 3IUBA 4NZPA 3HMQA 4WNYA 1OWNA 1N1DA 1O94C 3SZGA 5KWVA 1JHDA 4JFAA 4QBTA 2QUIA 4L2IA 1EJ2A 1NI5A 1N75A 2PFSA 4AQ7A 2PXHA 1TFUA 5TS2A 1O0BA 3TZLA 4HPWA 3CVXA 1GPMA 5IJXA 2JANA 4EG6A 3Q4GA 3U1VA 1H3NA 1U7DA 1JZSA 4NX2A 1VBNA 2A1UA 1MAWA 1KR2A 5J59A 3TS1A 2CV1A 2PZAA
chains in the Genus database with same CATH superfamily
1EX7A 3KKNA 4M1TA 3K5PA 1TW3A 2Q4OA 5DV9A 2NUTA 3RC8A 2MINA 5CA1A 3L7IA 5B2EA 2JBAB 4ZVSA 3HB9A 1OZ0A 4V03A 4PHHA 3JASA 4BKMA 4ZEVA 3KWLA 1R16A 3HJCA 1UH5A 2GHRA 4LHSA 3RYHB 3TLEA 4MJLA 3HVJA 4HDSA 4Q3AA 4X44A 3B53X 1QDEA 3EFOA 1K86A 3FOBA 4X8MA 5ANRB 3RK4A 4C4YA 3B9BA 3LRXA 4CNBA 3IDOA 3UICA 5K6AA 3N58A 4R8MA 3RF7A 2HYIC 3A3KA 3W5AA 2QTGA 4TXJA 1QZUA 2K4MA 1RYZA 3DCNA 4KO8A 3DFZA 1RC0A 4EVQA 1M8FA 4N48A 4AYXA 5INTA 1P4JA 5IX8A 3PQ4A 1CDOA 1PX2A 4D0NA 3M6FA 4RVDA 4YYEA 4ZZ3A 1SVWA 2E4YA 2GK7A 2GXUA 2X19A 2ZT8A 3OSUA 3B20A 4YROA 3LV8A 5G2OA 2CLDX 2POQX 3UFXB 1BX3A 4B31A 4ME6A 3HLYA 4UHCA 5EJ6A 1T15A 2X58A 3QJGA 3OZUA 2AFIE 1K7YA 1KKUA 1BHQ1 4POOA 1MJNA 1DBIA 4QELA 2I67A 1UDRA 3ORRA 2P69A 2QZ9A 2GZHA 1YOVB 1A5TA 2FXIA 2QI9F 3C6ZA 4P7JA 3EIWA 5LBTA 4DA9A 2GNPA 1V16A 1TVKA 3MINB 3QTTA 1FX1A 1VZ3A 2Z6QA 4TWBA 2F1JA 2C9DA 2H5EA 3UB2A 1V8PA 1BWRA 1GNQA 1V7ZA 3MWKA 3JZIA 4ZEXA 4LOJA 1A8IA 1HYHA 1YULA 1IEQA 4G8JA 5F2NA 1CZHA 4IUYA 4ID9A 4N5IX 4E6EA 3IAHA 1R8JA 5D3MB 5F3WB 3WTBA 3PWTA 5EGSA 3STWA 1FNSA 4LJKA 5H83A 2QN2A 3FTPA 1HTTA 5HX7A 4RZXA 5DISB 1C7RA 3ZVNA 1SOVA 4B7CA 1A04A 3E27A 3ZDAA 4PPFA 4YP5A 1RR6A 3D8UA 3A2KA 4NG5A 2Y93A 4RETA 4ZOQI 4NE9A 3WOHA 3AG5A 1CEQA 3A1CA 3SFTA 2FWIA 2YJ5A 2H06A 3KV3O 2GD2A 4QUJA 2GBIA 4CF3A 2B7CA 3OE5A 4OF4A 3TTYA 4Y9UA 4AF6A 4KR9A 2P6NA 4R2MA 4R2LA 1T35A 1EFVB 1E3IA 1DC3A 1JFTA 4KN6A 4XD7D 2FEOA 4ROTA 1IH8A 5F21A 1P44A 1P8JA 1U2GC 4M0CA 3QLTA 3TKYA 3UMSA 5MFZA 1Z4KA 1AT1A 1DTWA 1XZFA 4RZSA 4MAMA 2CCKA 2JEOA 2NZYA 4RS4A 4X8LA 5LB4A 4BMPB 1LQTA 4FYXA 4CMCA 2G40A 1DBSA 5JIBA 5JSQA 3RIEA 3CN7A 1XNHA 2EFGA 1UZUA 4UE6A 4TM8A 5BUZA 3ZDBA 3ZHZA 5LQKA 1R4AA 5CFZA 2A5FA 3GDWA 1RYEA 2PCJA 2EWVA 3KAQA 1NOKA 4I2VA 4QQNA 1Y7TA 3RBXA 4Q7QA 3HXMA 5FAKA 1DPFA 1W93A 1Q20A 4PQEA 3B1XA 4RORA 4U3JA 5DNUA 3NP9A 3DE2X 3H2HA 3UCEA 3VYTB 5ILOA 3D5TA 5D6OA 5DTJA 1T5BA 4XLZA 5A6VA 3PRYA 1E2KA 1BN6A 4FDMA 2A9QA 5C80A 3LF2A 2I4OA 2I5PO 1P75A 3CLHA 4IICA 2QBYA 1EDEA 2JLCA 3SXUA 4K0KB 3HUDA 1WVIA 3SZMA 3L6DA 4BASA 4PN3A 2ZWMA 4MWGA 1AS0A 1KJJA 1MQ8B 2P5UA 2DQ4A 4P84A 1C3OB 5EIEA 1NOJA 3QELB 2EFDB 4RFSB 1VI2A 3EXAA 3OTIA 3H2IA 1JMVA 1C0IA 2QM8A 4UW9A 5ALWA 1CR6A 5JH7F 1EGAA 4UMFA 4ZPJA 2YVAA 1TKBA 3MMSA 4WKCA 3VDMA 1ZRHA 4JI6B 4B34A 1Z06A 4KGDA 4CF7A 3LPCA 2X8AA 2EHJA 3OSZA 1PZNA 4NR0A 5IMBA 2G04A 4P3NA 1HF3A 1WHSA 3B51X 1JTEA 4R8RA 5F1PA 1OY1A 1YBAA 2A1TS 2XY4A 3J81A 4L4XA 2BFEA 1MO4A 1J9GA 4I36A 4IKPA 4QPPA 2PAFA 4CZ2A 4IV8A 4EJ2A 3KZXA 4GPBA 1Q84A 2IUFA 1N92A 3JW8A 5D5PA 3TRFA 4YJ2A 4MV5A 2X86A 3M1YA 3SDSA 1FF9A 4K6OA 2I8CA 3BQNB 4PQRA 3IXLA 4MYSA 3T5BA 1TA9A 2JCSA 2K6GA 4RMIA 1EYZA 2X1LA 2CXPA 3FXAA 1MJGM 4YUZA 4PCAA 4HQLA 3EDYA 1RCUA 5LQSA 5JPDA 3CURA 1YDFA 2IPOA 1R4NA 2P3QA 2WINI 1YVRA 3GV0A 1J56A 4TL8A 3LC0A 4YRIA 3IL2A 4DV6B 3AZQA 5JWOA 1R37A 4JLVA 4L0MA 2EJBA 4IYJA 4JVSB 4K6KA 1XTRA 4M53A 4JY7A 5C81A 4FFRA 3LSYA 5CIQA 1X3LA 3IKMB 1R0SA 2AR7A 2G4LA 2XMSA 3AF0A 4X1OA 3UK0A 3ZCTA 4FUQA 3LRPA 3FFTA 2JH8A 3EF1A 3WLFA 1IZ7A 3FPHA 2I4MA 4NBUA 4FR5A 5GV8A 4H17A 1Z6ZA 3ZWDA 4A1OA 1XDZA 5KWIA 2VSFA 4MV1A 1EWVA 3DLTA 1R50A 5EIAA 1OFGA 2JGJA 4ACBA 2OHHA 1SR8A 4X90A 3ZJVA 4O4HB 2NADA 4F56A 4QU0A 3DLPX 1GNRA 3G9TA 4LMBA 3H8JA 4DG9A 4GOLD 4NAVA 1NQUA 1JEEA 1PFVA 5I9SA 2CKMA 4LISA 1Z6TA 4ALIA 2IZ5A 1KO8A 4M7OA 3ILYA 4JKOA 3BXXA 1DIAA 2PWAA 4O1MA 4YGXB 3JQ8A 4P7FA 3AEUB 3OQ6A 1SCBA 1Z18A 2Y1OA 4DEVA 5L3RA 1E8MA 2I2WA 3G1TA 3EPPA 4GC5A 2PBZA 3ZKWB 1E2QA 1ARZA 2DSNA 4CEIA 1YVPA 3L7BA 3O0TA 1AK9A 4ZQFA 5L3ZA 3CVWA 1TRKA 1Z73A 2OBYA 1B41A 5FULA 2VDWA 2YZMA 4JEIA 4XUDA 3HRHA 1UP4A 3I6ZA 2PMBA 1XAHA 2CJXA 3I45A 5J3JA 3PXGA 1FFAA 5CNIA 2ID8A 3G88A 2BIFA 4ILKA 4JYZA 3B1WA 2W6NA 2E4ZA 5DH9A 4ARUA 3ZW9A 4BZXA 3BJIC 1QYDA 2XUJA 3ASUA 4D6XA 1F4VA 3TSOA 3PQ7A 2HADA 1YWGO 2VBCA 2VQFB 1P45A 2GZMA 4JR1A 1POXA 4OPMA 3BXGA 2WDPA 5C8DA 5C8XA 1E1RD 1EE1A 5JSYA 2A0YA 1PFWA 3W5BA 3ADDA 3KZCA 5E7JA 2OQIA 4P53A 3DE6X 4DXHA 3ZZTA 3U5ZB 3CLKA 4R2KA 2BL4A 4Y0NA 3BWCA 3UPUA 1D0VA 4FHEA 4MRMB 1NN0A 1Z47A 2FCRA 4AQYB 3HZHA 3SKYA 1Z17A 4FKMA 4PCVA 3U17A 3KTAB 2D62A 2XOKD 3R0VA 2QN7A 3N2IA 5EP4A 1ILEA 1P3Y1 1VIAA 3QWHA 4D9BA 1J0DA 4CUKA 3BGIA 3KEGA 1DKQA 3O4IA 4U2KA 4ZAWA 5A05A 4TQAA 3EVDA 1L6IA 1UKCA 2FPOA 3PXBA 4HWGA 1U98A 1SPXA 3BRCA 4YV7A 1IFXA 2GAOA 3I4LA 4V0ME 1KXJA 1Q1EA 2JLSA 4N8DA 5DU2A 4UVHA 3I61A 2J45A 2BHRA 3PQ3A 3UHAA 1IC6A 2REBA 4M21A 2XW6A 4ECAA 3EQ2A 4ZI3A 3WAGA 4D4MA 4KXQA 1GAXA 4RDCA 2NPOA 5ER9A 4XZ3A 1LWOA 2JLZA 1P5FA 4WUVA 3BULA 4TKMA 3K0FA 4PSCA 2XIQA 4G0PA 3KOMA 4QXRA 2ZXEA 1DADA 4X6UA 5HK9A 3KAKA 3IPRA 3AHHA 1BHO1 3PXAA 2VDVE 4D9JA 1CERA 1Q19A 1QYCA 2BVNA 3Q5GA 4E4RA 1KAMA 4UXJA 4AS3A 3IHWA 4C7KA 1E2NA 3Q9UA 4Q7EA 2YTZA 4ARIA 3GLRA 3MTIA 1WCWA 3OJEA 1U2DA 2N47A 2W0SA 4WCFC 3ENWA 1N3BA 1GUBA 3CW2A 4H7JA 3IEIA 4TS1A 1T8SA 1E2PA 3D0QA 3T9DA 1GG8A 1EAMA 2ZR7A 3GO4A 3UMJA 3B60A 1EVYA 5JANA 2VPZA 2PZGA 3IE1A 4COKA 3UCXA 2X13A 1IY0A 4WZBA 1MPXA 4R69A 2RHMA 1XZAA 2UZ3A 2JFHA 5IDVA 1KMNA 3VVMA 3S1SA 1L5FA 2H59A 3L1KA 4MUJA 3LFTA 4OL0A 4PNEA 3WISA 4DXAA 4I1YA 2RE8A 4D98A 1PDVA 1U6KA 1SKUA 4HMOA 2AN1A 2AJLI 3E53A 1HE8B 5DHRA 4ZQEA 3COVA 3SG0A 3LGXA 4EL5A 4G1CA 4HH3C 4PHCA 4I5DA 3OZRA 1I1QB 2V9ZA 2RGEA 5FLKA 1U28C 3E18A 5ESRA 1G3MA 3N07A 2GJKA 3QIVA 1UIRA 2NYAA 2W2KA 5HCUA 5C37A 2KX7A 3CLRD 1VHQA 4U7DA 3AIMA 4KACA 2JLBA 4A10A 4LDAA 5IHPA 3GU3A 3C3AA 1I4WA 3F4LA 2FUEA 2R2GA 1ADGA 3Q5DA 1DCMA 1GAQA 5HK8A 5HQJA 1EK2A 3CIOA 5JPIA 4ATNA 2O8CA 2HWWA 1LZKA 1OC2A 2GZAA 3VOAA 4MYCA 4CLDA 1APBA 2VATA 1S2GA 1T8UA 3PXDA 2VJPA 1JQLB 1O57A 1S2OA 1XZQA 5D00A 5DXJA 3QUAA 3JXEA 4XCVA 4UZEA 5C1OA 3HWX1 4L5BA 2CZQA 2XLCA 2ON6A 4LF4B 4YT4A 3EA4A 3WJ2A 1CKEA 5CITA 1S89A 1WSAA 3D7RA 4LOLA 2BEKA 2DUNA 2H8GA 3OJCA 4I4LA 4Q4JA 4WUTA 3MFQA 2CYCA 1LSJA 1UMDA 3MM4A 4A2WA 1JA1A 3V5NA 3QEBZ 1N32B 5G3ZA 4Z54A 5CDGA 3JQ9C 4YJFB 4G65A 1IWOA 3PJRA 1DKRA 1XVVA 2WP8J 2IYZA 4MV4A 3IJRA 4W9MC 3UUWA 3NT4A 2YJGA 3JWGA 1KPIA 4Q3BA 3VZBA 4LWPA 4US1R 5PGMA 1L7QA 2G1KA 2JI6A 2QM0A 4UAJA 2V1UA 1S96A 1VPDA 3RRMA 4MGYR 4BJ1A 3SZUA 1Y9EA 2B5OA 4TV8A 2E0IA 1Z4IA 2DY1A 1XDGA 4HAXA 4UU7A 5IBCA 3QW2A 5HFAA 4TLDA 3RAGA 3WADA 1KI3A 2QD3A 1EB8A 1LGYA 3LBAA 3H11B 2OO5C 3TTTA 4IF4A 3PPIA 1IM8A 1PV1A 4FMDB 3NOXA 4EQZA 2A86A 3HK2A 1Z74A 5KWJA 3DBVO 1UQUA 5C32A 4NXNB 2EBUA 3E1GA 2EVWX 3QF7A 3B3FA 3VTFA 5GQSA 4LF7B 2XTAA 1L4KA 3E5HA 4IF6A 3VNQA 3I2HA 3ZQUA 2W6JA 4J0IA 4FILA 3TZ6A 1Z6AA 4AMUA 4RKFA 4N5DA 1G4AE 3GAFA 2GCOA 2IE0A 2IW1A 3IX7A 3K5IA 3CLSC 3DW1X 3L7KA 1SCAA 3OA0A 4II2A 4RMHA 4YP6A 4AMGA 1U02A 4EO9A 3HCNA 1ATIA 2DH6A 2JGDB 2WTNA 3WIEA 3KB8A 3F6EX 4DIMA 2IL1A 2G9VA 5DHAA 4Y2UA 1XQVA 1ZKMA 3RLIA 4LXTA 5DJ5A 3F98A 1DUVG 1IAQA 1X8XA 1Y6JA 4YAOA 1NVWQ 2YXBA 4XGNA 3ZZNA 3GLVA 3PPYA 3INGA 2BMEA 5EERA 5JHHB 3EGEA 4QOIA 2YBDA 2ZCUA 2JGLA 4ND8A 3UXYA 3V8PA 3BE6A 2CEKA 5DI3A 4BVAA 3UJ6A 1LRJA 3ZR4B 1E66A 4XAQA 2NZ8A 4NHEA 5BSEA 1C4XA 4C3OB 3PWZA 5LZ4A 1OMOA 4M1ZA 2PT6A 2XMDA 4FFPA 3B38A 3NTOA 4C20A 5JQWA 3UGQA 1LS6A 4B5LA 2FCAA 4J75A 4JC5A 5LA6F 4XWWA 3ET5A 2TYSB 1NF9A 5TQ2A 4TTVA 1SC4A 3A9WA 4FU0A 4UOEA 2V54A 2EDCA 5BR1A 1T3SA 4PYIA 4F4UA 2BI7A 2IT1A 3L6CA 5BUSA 3TD9A 2IWHA 2P8SA 5H70A 3EWSA 2I4RA 2PPLA 3HI6A 3UANA 2OZLB 4MQ6A 1RWXA 4G0UA 1YFLA 2FZCA 4JI4B 4QT4A 2ISQA 4BEWA 3LUKA 4ZYZA 1X8LA 1U9CA 1TZ2A 5NULA 4NWIA 2YXEA 1PJ4A 2X5OA 4KOAA 2YHIB 1ZLYA 4JBWA 5FI5A 3ZWAA 4B46A 5CCEA 3WL7A 4DLVA 4QOGA 4IIHA 3BD9A 1JHDA 3I6IA 3GWZA 4KX5A 2W2VA 4EJFA 1Z8NA 1WX1A 2RBEA 3IV6A 3TFQA 4BMVA 1BQEA 1XZIA 2CZCA 3RARA 2O2GA 1TUEA 4Y6QA 1UODA 4RZIA 3TQSA 5ES4B 4EBFA 3UYKA 3OX4A 1RSZA 3W0LB 4OGWA 5DLEA 3UAGA 1JDZA 4B3JA 4X62B 5E38A 4HF7A 3T5AA 2FRXA 4C06A 4C0BA 4WERA 1KYZA 3MG9A 1I2CA 3W3ZB 3DBHA 2EZ4A 1UMKA 1P1CA 1M1UA 2FZ4A 1Z4OA 2W2TA 1JV2B 4NZMA 4UAUA 1HFEL 1J06A 2QZ4A 3V7FA 2CV1A 2WLSA 5HKAA 1W19A 4MPJA 3I72A 1GZ3A 2CCJA 1CFZA 3HN7A 4HDNB 1ZVQA 2YKGA 1UKBA 3GRRA 2UYGA 1TU0A 3LA8A 3KDPA 5E3HA 4KFUA 3L9WA 3PGLA 5DEIA 4FYPA 4QJ4A 2AI1A 2CVHA 3USZA 3VO2A 3PTAA 2YHBA 3LWDA 3HSSA 5IKXA 1DT5A 3NOOA 3OKAA 3FLBA 4MHOA 3AVVA 1UFOA 5CAEA 1CNMA 2J3HA 2OZKA 2IYNA 5F3DA 4HX5A 1ECBA 3C14C 3BRSA 2ZSHA 4FYYA 4WZAA 5DBFA 3IVRA 4OX9B 4DILA 3C6MA 1RWBA 3R3XA 4X92A 3FG9A 1I6MA 3A1EA 3I9KA 3ZOZA 2VG8A 3KSMA 2R3SA 4N5LA 1UFRA 3SHFA 3U3XA 4DQXA 5LZ2A 5IC5A 2C99A 1M6EX 1JXMA 2XIJA 3DQZA 3QV2A 4RTKA 2ATIA 3OURA 1VJRA 1X13A 4FHGA 1D4OA 1K8YB 2W37A 3B3QA 5CGQB 1JEJA 2HR1A 1J1UA 3BWDD 1TB4A 4CUJA 1LLFA 4KWEA 3I5XA 2FR1A 3M3HA 4JH0A 1WIWA 3GHYA 1QFXA 4G8CA 2DTXA 5AJVB 5CYGA 5IXSA 3GRZA 3P9PA 1PR6A 5IDYA 4EG5A 3BXHA 4BKOA 4Q9IA 2PT9A 2RHLA 1A98A 3VMFA 5FORA 1MO2A 1RQNA 2WJ4A 5DLQC 3TVTA 5CB4A 5A4FS 1C1XA 2WHQA 3N0RA 4X63A 1ST2A 2JAOA 2BSAA 1OB2A 4NHOA 5EJAA 2BV3A 4JVMA 3LGSA 2I4IA 3OEED 4OP1A 3NGMA 2BJWA 1XMSA 2XWQA 4LVUA 4MMZB 4XIGS 2W42A 5CLFA 5FDFA 2DE0X 1N2GA 1RJ9A 1QG6A 3A32A 4FVTA 5EJ9A 2BFCB 1JSRA 3D8NA 3G8AA 2IOYA 5JY1A 5CCXA 4B75A 5KTRA 1EFKA 4L3WA 1SU6A 4UFNA 4D26A 4KFSA 1SO8A 4NZYA 3E23A 1GUFA 1GADO 1K98A 1WUKS 5AXCA 3BA6A 2WF5A 4U63A 4R8VA 3HSYA 4ZREA 4DC0A 1I8TA 2OZVA 4D41A 5G0TA 5FV4A 2FW7A 3L8FA 3FIUA 1ZMBA 1T5HX 1P9OA 2FSGA 3N39C 6NULA 1GGMA 3L79A 1T2NA 1U65A 5DWVA 1ZA1A 5EJ8A 4XTCS 4MI1A 4TTQA 3HFSA 4GRIA 3H8VA 2O05A 2RKWA 2PX8A 1OV4A 2W2LD 4BMSA 3SM9A 3WL6A 4C7VA 2OM2A 1PU2A 3O21A 4MCJA 2X0EA 1NBEA 1R18A 4BNYA 2BGWA 2CE2X 2XBUA 1FYDA 1KBOA 2C57A 2JIDA 5FBQB 4ESVA 2AR9A 1RHUA 1YKSA 3RBAA 4QM6A 1G55A 3WLOA 2Q8PA 3EDMA 1XDWA 2NZXA 1Y6FA 3BXEA 5ELLA 1QB7A 4E94A 1FX0A 1KK1A 1K7CA 3S40A 4O4JA 3T7JA 1W2WB 4KBGA 5FYDA 2YDXA 1G20A 2C5FA 1YASA 3CUVA 2IXEA 3OOEA 1BA2A 1F2UB 4MQ4A 5AI4A 3HEAA 3PPVA 5EE0A 2O7NA 4F9EA 5JU6A 1SG6A 1K88A 3A4VA 4X84A 1T2VA 4WRRA 2HMVA 4JP3A 3PUZA 1GDHA 1MC1A 2P3SA 4MQMA 2BUCA 1IHXA 1HQDA 2C9CA 5LOVB 2GETA 3TE6A 1XFAA 1JQJC 1I7DA 1TX4B 3KPUA 1YQWA 3EEFA 4MW2A 5K0EA 1N9GB 4YWJA 3KL4A 4BVGA 1N2HA 1E3SA 1C5KA 1UZAA 2IYOA 2GCPA 2RBGA 2Q3FA 3NDRA 4HFMA 3WQHA 4D0SA 2RCNA 3E3MA 1K4YA 1IY9A 4EMUA 4EHLA 1A95A 3JCZA 3IULA 4OHFA 4IOKA 1MOZA 4R2IA 3BL5A 1G3UA 4Y6SA 5C1PA 3IAEA 1EFTA 1YFJA 4DRYA 4B83A 4AY3A 1SHUX 9ATCA 2MYTA 3ID6C 4ER0A 5G3YA 4JLDA 2WKQA 4M83A 3G2LA 2NV6A 4HUQA 3KKZA 2GM9A 4OHZA 3LIPA 3EDCA 3HY3A 3TD6A 4LJ9A 1Y7IA 2EF0A 2UZ1B 5C1DA 1GTSA 3SYKA 1M2EA 1JG4A 3AUFA 1BH6A 3HR4A 4XKJA 3TLBA 3WHIA 4YCMA 3IPAA 3FCSB 2P6PA 2RGNA 1GYPA 2ADMA 2QVGA 2AZMA 3HBJA 4L5CA 4WJZA 4ZP1A 2IYEA 3A1SA 4QDZA 3SXPA 5EHIA 4TRJA 2PL9A 1CE8A 2C2XA 5JLJA 3PLNA 1C4OA 3KV1A 4JI7B 2Q3MA 3FW1A 3CG4A 5LBUA 4E4YA 4HNUA 2EKDA 3QU2A 1I7LA 1Z75A 5CVDA 4ZDKA 3NX4A 4KODA 2VK2A 5EWMB 5AXDA 5IXYA 2I6GA 1MB4A 4OFXA 4E3WA 5JR3A 4PZAA 4ZTZB 5D2CA 1P2GA 1X0VA 1LX6A 2JIZA 3ITNA 2OWEA 1YTUA 3RAPR 1AQ6A 4J3JA 4QUAA 2P2YA 2BFAA 3GLHB 4YP1A 3HG7A 2N46A 4IM7A 2IOQA 5AK0A 4QWWA 5DRYA 3HRKA 3Q85A 3CIFA 2QD4A 3OFKA 2XYHA 5A5GA 4YJGA 4Y2PA 2VHUA 4JAVC 2YOFA 2NACA 4FDTA 1NW4A 1W0JA 1J8YF 2R7KA 2YJTD 3W5UA 4QXOA 4NBWA 3JD1A 3AGQA 3W6NA 2O0MA 5LU9A 2FSHA 3WKEA 3ZZ0A 3QPCA 1Z6XA 2Q6VA 4PX9A 5KNBH 2OVFA 4DJAA 1ECFA 4Q9JA 1R4MA 3KQQA 2ONKA 3QNWA 4O2BF 2XCQA 3KALA 4LBZA 1WRBA 2B99A 3V8NA 5SZHB 5AUPB 1AX9A 5LC1A 1OSNA 3PR3A 3WGLA 2VKQA 3KSDO 2GMWA 1M9NA 1RFGE 3K0AA 4RK7A 2AQIA 4FZ5A 5DWDA 2LTAA 3BRWA 1YBFA 1ZJYA 4BNUA 5HTOA 1E7WA 3L07A 4JWTA 1KAOA 4FE3A 5E3IA 4BZWA 1C8KA 1W87A 1QV9A 5AW4A 3KL2A 3ECSA 1DDOA 2WYVA 1V1MA 3KQUA 1NF8A 4K6CA 4KGVA 1X39A 2I2BA 1TL7C 1KR5A 4Q18A 2E4XA 5EWLB 3B9PA 1SHTX 2VHYA 5C3MA 1AKNA 5CXUA 2L18A 1G0OA 2AIRA 2C92A 3CMCO 1IHDA 4HATA 3OJWA 3F96A 1CP2A 4WNAB 4FGSA 4LZNA 1P9LA 1EWTA 4BRWA 2A5DA 3RS0A 4EAQA 4KH0A 5LDHA 1LPMA 3W5SA 2HN9A 5CDYA 5I7HA 1IRIA 2Z56A 2PK3A 1UK8A 2YVUA 4MS1B 4TT3A 3UA3A 3TUJC 6GPBA 3ROXA 3K0HA 1A9PA 4Q9AA 2XNKA 4GR4A 1JPVA 1QRSA 1PZEA 2Z5LA 1M2FA 1U6IA 4E5NA 1XZPA 5FWXB 3GXBA 2PTGA 4KQMA 5CLHA 5HG0A 4MK4A 1V3UA 3ZLJA 1O77A 5KJEA 3EAFA 2VT3A 3UJ8A 4FBLA 2OLKA 1ZGAA 3NHSA 4FZJA 4QXQA 1P6UA 2D0PB 1KAEA 1QKJA 1VBFA 3DYIA 3W9YA 2HDHA 2E4UA 6REQB 3K35A 3OIDA 5TF4A 3AEKA 3CRQA 5EVJA 1P7PA 1M8KA 4HN2A 5JFTA 3S44A 2VHJA 1JNYA 1R6TA 3D3NA 2YXLA 3K1JA 3NHYA 4MLDA 1QH8B 4QLAA 3JWJA 2EG5A 4A0RA 3DTYA 4JJGA 4L7VA 1WXXA 5AVTA 1D4AA 4E7PA 3I58A 5LUBA 2DKFA 5EPUA 5FTJA 4FS3A 5ED4A 1XTPA 1PR5A 2FKNA 4OQFA 3GFTA 4KDCA 1KFCB 3C74A 3JZDA 1VLQA 1I3MA 1UK9A 2GO7A 1X8KA 2HQ1A 3KR2A 3QKUA 4JUCA 4ZVVA 5J2UF 3AY3A 5EJ4A 4WXEA 1M72A 1RHMA 3G8DA 1C29B 3HCPA 3OBIA 2G1UA 2DETA 1Z8DA 2ZJ5A 3RJTA 4BUZA 1O9BA 1U2EA 1ECJA 2C9BA 1H0SA 2QPOA 2QU8A 2V7UA 3FPLA 3EMDA 3EYWA 1RYDA 2YWCA 3GRFA 1FQOA 3LBIA 3M6IA 5I4KA 4XFJA 5KBYA 1YB7A 2Q9UA 4Y2SA 5BV2P 1XU4A 1HGXA 2OK7A 2GNOA 4OJKA 3HVKA 4QVGA 1LA2A 2IU4A 3WBKA 4KQEA 1Z28A 1A69A 4CTJA 4HJRA 2WWTA 3DXFA 1WUIS 2V5AA 2Y2UA 4J6FA 3R23A 4DYVA 4ZYYA 3HEMA 1EFAA 3FHOA 1OB5A 5HZGA 2JJ8A 3K20A 4U6QA 2GPJA 3DQPA 2DJIA 4Z4EA 3TECE 4FDAA 5KVVA 4DCCA 1A7UA 1ICEA 2QYSA 2WD7A 3DP7A 2J1LA 2J41A 3K0CC 4KE8A 3R1IA 4X0EA 4B3HA 2ZE5A 1HE3A 3S1LA 3PICA 4C04A 5FBRB 4A0FA 3L0SA 3JPWA 2X8JB 1DIOB 4QLOA 3U1TA 1V6AA 2L82A 5BNWA 5JZ9A 3BQ9A 2UZIR 4RELA 2O8EA 4U02A 1QX3A 1ECCA 3MD0A 4EM6A 1TZJA 2XA9A 1U1DA 1CLUA 3DD5A 3DBLB 4NG4A 4PRKA 4QHSA 2VUSA 5FBWB 5K3EA 3LTEA 3K70C 3MA0A 5DCWA 5LD2C 3T3OA 3GJQA 2CF6A 3M33A 3TLYA 4PZPA 3JU3A 2CHGA 2IQ5A 1U0JA 4HNAA 4IRUB 1IB6A 3VR5A 3A11A 5JAPA 1JYEA 1PRYA 1Q2XA 3NHKA 1IXSB 3KXKA 3TRIA 2F8MA 2G8LA 3A6FA 3EUEA 1V45E 4B3BA 3TGLA 2Y66A 2WIGA 4FFMA 4DPKA 1V8OA 1LDNA 1YONA 3KEQA 1HBJA 2JBAA 3RABA 2Q5QA 2QJRA 2ZJ7A 1BD3A 4GUAA 1WXDA 4MKIA 3ISTA 5C34B 3TTXA 1M2GA 3IGFA 5SICE 1Y7HA 3RYHA 3UK7A 1M0SA 4PS0A 1TJ3A 2I6TA 4AKTA 5AI9A 4QJ3A 3GRPA 1US8A 5JFOA 4UHKA 2ZCJA 1YVUA 2QJOA 5CK5A 2V7TA 4I4TB 4DNOA 5K3AA 4DQKA 5LQUA 3RSZA 3MB5A 1BU5A 5G0WA 2WAXA 1EGMB 4UARA 3HO1A 2E89A 5DK6A 1OHHD 5EJGA 2HSZA 2JRLA 3ZH9B 4CI0B 3PDUA 2ZZNA 1DT3A 4P6VF 3PKZA 4GZLA 2RH8A 4NYMR 4ZHSA 1WKCA 1MW8X 3KVRA 5BNIA 2PZMA 4UTPA 3DVLA 2WWHA 3KEOA 5I9TA 2BOVA 1BXZA 5LP6F 1TCVA 4CMIA 3UFXA 3C7AA 4FYHA 3NXKA 3VH4A 2IHVA 4L57A 4DPLA 4Y67A 4PQFA 4EH1A 1IN6A 4QOJA 4CMKA 3TB4A 2P2ZA 1F6BA 3Q6IA 4D97A 2VXYA 1K66A 3QNMA 3TLXA 2BFNA 3T0IA 5IT0A 2BH9A 3MINA 4B3DA 1M66A 3N6XA 1GGNA 3FFAA 4RGQA 2Y0DA 2QJWA 4RMGA 4A2PA 4Y1EA 1TI7A 4CLHA 1JHPA 4UREA 1X8JA 3DZHA 3KZNA 2H65A 1XVUA 1Q3TA 2IKQA 3AJAA 3ONFA 4OD0A 3UUGA 3WMGA 4ZICA 5A03A 1DZ3A 1TLFA 3IDSA 2FP4B 2VPIA 3WIUA 3G6WA 2FQYA 3CZ4A 4GI1A 3CRNA 3Q8KA 4KQJA 4C88A 4WE3A 2DBZA 5G02A 2P90A 4N3GA 5T8KC 1BMQA 3ZE6A 4B4KA 2Y76A 5LQMA 5B3JA 1IMJA 2DVMA 2IK8A 4DIEA 4F45A 4EL0A 1B8OA 1Q6YA 3ZTTA 5IFKA 1X77A 4QTTB 1ZM4A 2QLFA 3PUHA 2F43A 2VJQA 3ASZA 2CYBA 5KTYA 1FZQA 2FETA 2H9AA 4WH0A 3I52A 3W90A 4BC1A 4BNNA 4HG2A 3RR2A 1YI8A 1PS0A 2AF4C 1E5LA 1FXUA 2H0QA 3O2QB 1CNFA 4ZO4A 4KQ2A 1EFVA 1FXSA 2ZGVA 3FWPA 1GAWA 1M2OA 4PBRA 1RXIA 2CXOA 3O91A 4JN6B 2NU8B 5IHXA 3JQ7B 1XEXB 4YRQA 5GOTA 4EUSA 2R60A 5F23A 4FHFA 1ADCA 4AZSA 4IS2A 5FWYB 2IFTA 4RLHA 1Q11A 1FTGA 1UWLA 2QP4A 1QCYA 3A14A 521PA 3SLRA 3NWJA 5J2TF 3TW4A 1NG9A 4FCTA 4WY5A 1LNSA 3C15C 3NRJA 4ZU6X 1U2SA 5FTWA 3D4OA 2PUAA 4WVFA 5DCLA 4IIVA 5LXTA 4LWOA 5D1HA 1VJTA 3FZYA 5CLIA 4OXRA 4X24A 5FTMA 4YUYA 2ZI3A 2RC5A 2GKOA 4L8GA 2VFAA 3DG9A 1QV7A 1XV5A 4W8HA 1MDFA 4OHVA 4ILEA 2ZSKA 1I6WA 2Y0PA 3A25A 3H0KA 3L1JA 2DH5A 2DHQA 4BBZA 4ZT2A 4CGZA 4XQEA 2ZANA 1CT9A 1QK3A 2NWQA 1A8HA 4G63A 3RUDA 3ZDQA 3NNSA 2YW9A 2AMYA 4WBNF 5BWNA 3ZI4A 2XUIA 3MJCA 4YI3A 2VT7A 2B78A 2IHYA 3E4DA 1CSEE 3FDXA 2QTTA 3IQGX 3E0QA 4LSWA 3ZS8A 2DECA 3VHXB 3BILA 4NDNE 3QELA 5J9FA 2PKYX 1EIWA 1KF0A 4RFSA 2IEIA 3H75A 3HR7A 2V8BA 4OQQA 1JKFA 3ZW8A 4HO1X 1RRPA 1H2WA 1T8PA 3HCBA 4GQBA 1P1BA 3JQRA 4V24A 1NI5A 3ADPA 4F5YA 3UJHA 1Q22A 1KZYC 4WFJA 4NKRA 7YASA 3S8EA 3KR9A 5EZYF 1CS0B 3UF0A 2P9QA 4D4GA 2YWDA 1L7VC 1P1FA 4KR0A 2CHFA 2I6UA 3M6UA 4IYRA 5A7HA 1HR0B 1AN9A 5E1BA 2C7QA 1ZGJA 2GPAA 3VSDA 5FEUA 3I6YA 1X1TA 2P1RA 4WHMA 3DOUA 1HDRA 1MZPA 3NIBA 1P1IA 4IXNA 3TS1A 1KY5A 1SUSA 1O9GA 3CHYA 2Y0BA 4MGHA 1XO1A 2OT3B 4F5EA 1XF9A 2DFNA 5A71A 5H5JA 3RF6A 4HAOA 4XGQA 3WLHA 5DHTA 1CQWA 2H5LA 4QVIA 2XECA 1AGRA 2HJVA 1CFJA 1H23A 1RXCA 3KQPA 2CMHA 4YMTA 1OLXB 3C7KA 1BW9B 3MUEA 3QG5A 1ZZGA 3ZUPA 1QIFA 1AGXA 2HCBA 2UDPA 5FUBA 1UZMA 1QU3A 2RAPA 4IFTA 4ZK2A 1QHYA 2EX4A 5I7UA 1KEEB 3STYA 4ZIRB 1GU0A 1RXVA 2O19A 3HY4A 4CDNA 2ONYA 3AJDA 5BW4A 1VCMA 3NYQA 2Z2YA 5BSGA 2ZE6A 1E63A 4YLGA 4PW0A 1XB2A 4CL3A 2BSXA 3OCJA 5BSTA 1EM8B 1G16A 4Q93A 4QAQA 2BGRA 3JD0A 3DOFA 3K1YA 1DAKA 1NKVA 1TAGA 4UUNA 4B76A 1JMYA 1TCUA 1T4MA 4H59A 3VYUB 1W52X 3KQWA 3O8OB 3F3SA 4O4HA 3SN6A 1BDBA 1NLZA 4Y30A 3U2QA 4C6HA 4DOMA 2J9FB 3PHCA 1D8AA 1Y1LA 2BMJA 1M1ZA 2VHVA 1BKSB 1T9BA 1TAQA 2Q3JA 3FKSA 4IDDA 2GZDA 1EQ2A 2QKYA 3H7IA 1KTVA 2QGNA 4MITA 2AC2A 1QYRA 4ZCSA 2X41A 5GOZA 2A5JA 4Q05A 2Z2ZA 5JG7A 2B83A 2Y99A 4BMDA 3OFND 1AS3A 3QXCA 1TD1A 4NVRA 2VDPB 2XZPA 5AVYA 5K8UA 5MHTA 1H6DA 4Y7DA 1VPLA 1U0HC 2WM2A 3KSRA 3OO0A 2C61A 2YWGA 3PEVA 4LRQA 1O0SA 4FXPA 2BLLA 4WGGA 1A27A 3WGMA 1UIMA 3QPAA 4TV9F 2JB9A 2IXGA 4JGGA 1TO6A 3USES 1NF2A 2ZIVB 3R6DA 4K9RA 3UK6A 5LA6B 4HGNA 2WUVA 3NV7A 2AFHB 1J25A 1EGVB 3B2QA 4Z49A 4CIBA 4U7HA 2X0FA 1MX3A 1U7OA 1CUEA 2JFBA 3PWSA 1P7YA 1DWUA 4G09A 4GXQA 2GWHA 4MUXA 4P7KA 1YQXA 5JAQA 3SU8A 2GTPA 3AFIA 1Z88A 3CH6A 4P0PB 4KBFA 4I08A 4TRRA 2NXWA 3O4FA 1A9QA 3DB1A 3KKPA 4CMAA 5JNRA 2NVUB 3PD7A 1Y5NA 1RIFA 1TE2A 4HD8A 1PS8A 4LNUA 4P22A 2HWYA 1BE8A 1FYWA 2KM1A 1MF7A 1PX0A 3HBLA 3OM9A 1YC2A 4MRMA 3RAJA 1ZVJA 4M7WA 2V45A 4AMVA 1JWLA 2AMLA 2VH5R 2YJ4A 2FPSA 2ZIFA 3F5FA 4MYRA 4EF6A 1GITA 1SXQA 4R2HA 4WI1A 3SZ3A 1IZYA 1ISSA 1QIIA 2V65A 4CKEB 3W2GA 3ZCRA 1BYUA 2UYOA 4V0LA 3UG6A 4F6LA 4B71A 1VA5A 5IAOA 3BS4A 1LV7A 1NY5A 2HF9A 4KNYA 3BE5A 3M3PA 2WF9A 2IXDA 1L5KA 2XUGA 5E2BA 4QM7A 4CEJB 1Y6ZA 4MNTA 4UVDA 1CUUA 1XD9A 4AU1A 2X9GA 3L49A 3TKLA 4KR6A 2ZOSA 4IR7A 1C7QA 1QH9A 4Q47A 1Y63A 3HUFA 3U40A 3EXEB 3K96A 1Y4AE 3UTCA 3X1MA 3K70B 3TEJA 2H1RA 3CLUC 1XCMA 3WNDA 3VPAA 2D0IA 2P9YA 1RRKA 4M99A 1NJ1A 2BHNA 1OILA 1QHIA 3A9SA 1AHIA 2D1QA 4IMIB 4L78A 4YRFA 4CG1A 4IH9A 1E9CA 4WX2B 2MSNA 4EA7A 2AOTB 4MS4A 3TOCA 3BYZA 3WWYA 1OFUA 1TIKA 3KYBA 2BUAA 4IFEA 4AX4A 1RHKA 1A5SB 1YR3A 2I7CA 3O3OB 3MGCA 4BFWA 3OOHA 1Q1QA 1WDWB 3V46A 3BH6A 5FPYA 4HLDA 4F96A 1NDQA 2ZVJA 4EO7A 2IYUA 6YASA 4BO0A 3L0PA 4J9VA 4ZCPA 5FX2A 1XZCA 2YC2C 4CV3A 2QD5A 5T5QA 3SI7A 1ZJZA 1Z25A 3UC9A 1ZYUA 4FFBB 2CV0A 5E4TA 3ZWCA 3SDBA 2I71A 2CNWD 3K71B 4L9RA 4FS8A 4ALKA 3U3OA 5LIRA 1WWKA 4WK0B 4QTYA 1MJGA 1UQTA 1Q21A 2AX4A 3DAGA 3WYBA 1QANA 2DPYA 1JB1A 2BAGA 1QNLA 4LQ4A 5B58T 1M76A 1OXBB 1U0EA 2QR3A 3EQ8A 4QU5A 4JL6A 5H16A 2ZUBA 2VJLA 4BGEA 3V8RA 5AHKA 5EPEA 3V7WA 2OCAA 1GN9A 5ELXA 2WJIA 4HDMB 1OH6A 3TUZC 2IF2A 3HYRA 1J2JA 3Q7EA 4JXKA 5K2OA 3CLVA 3QK7A 3M6WA 5ER6A 3DEHA 3RVJA 1GSOA 4F4DA 4KI0A 4OXKA 1G8FA 2EOAA 1N8TA 3ULKA 2PIDA 1ORRA 3AUUA 4XD7A 2VC2B 1KH1A 3AHDA 4HGZA 1TYEB 3JRWA 2A58A 2QPTA 4YNBA 3UUEA 4GT1A 4HDKB 5E1DA 4OHYA 3BMQB 3JVDA 4UBLA 2F3RA 2HLPA 3AXSA 1FJHA 1NN1A 4DLPA 2UYQA 4F9FA 3EPHA 1EFDN 3SR4A 4PRLA 1P7ZA 2OP1A 3P2MA 4KHZA 4ARVA 1CRZA 2XD9A 4M7RA 1KKMA 3WK9A 3ZCVA 2C00A 1ISFA 4Z3KA 4YY3B 1VIVA 1UBHS 1PJTA 5A0VA 1N0WA 1OPRA 2GWRA 2XAAA 3GLQA 3ORHA 3V4PB 2JGNA 3KT0A 1YZ3A 2Z58A 4Q9DA 1ULBA 1GNPA 3BB3A 5TGZA 2XAUA 3M9LA 4Q9HA 3GQVA 5ITWA 3K05A 3PITA 3ZZMA 1YRAA 1QP8A 3DVQX 3GCGA 4PC3A 3I1JA 5KO2A 1U2GA 1RU3A 3N0WA 1FSSA 1R2QA 4D8YA 3NU1A 1W76A 4IEFB 2CYAA 4L0DA 1UJ6A 2ZPTX 5DGIA 5CH8A 5ALNA 3ZKAA 5KQMA 4NJEA 1NVUQ 4WOPA 1OTYA 1ONBA 3RC1A 4NBVA 4BE9A 3U4QB 2WILA 2ZYAA 2W8ZA 4FSXA 3HA5A 1VKRA 5JMPA 3ESZA 5DZSA 3TPCA 5LQCA 2WABA 3RWMB 1DDIA 4RAQA 1BWQA 2H2WA 3MJEA 1SVNA 4TZKA 4AWBA 5SY9A 4MUYA 4MP3A 1O5TA 2PZ8A 4BRUA 1N3IA 1NF3A 1SVSA 2F00A 4Z3DA 1MA3A 2JH9A 4FFLA 1X14A 4LFAB 3MGGA 5FAXA 1RTKA 1KEZA 3P7MA 3H11A 4Q4DA 1RFLA 5SYNA 2I66A 3GT3A 1SXPA 4FN5A 3G2NA 1H3EA 3TK1A 3CONA 1KJWA 3TBKA 5LMUB 1ES9A 4KSYA 4Q3EA 1J8FA 2LNDA 3I39X 2MCFA 3ZD7A 1OJ7A 1TJYA 3MC1A 3TRJA 3LW8A 3KQYA 3NTRA 3GP5A 4Z86A 5T6BA 4QG3A 4S3MA 1PYDA 4BX8A 1NLUA 4UEQA 5L7TA 2FPMA 1WCIA 2VAVA 1B6SA 3FPEA 4J0QA 4OLAA 2PXXA 2UVPB 4LZWA 1O9HA 1BEZA 1K9SA 2IZ0A 3A70A 2PA3A 3HZZA 4NOMA 4P83A 4Q16A 1S9HA 4P3PA 1Y9DA 3TXYA 4D5EA 3FYUC 1JWBB 2ISSD 5J2UB 1W1WA 4PZYA 1I30A 5T7BA 3DW3X 3THYB 3LO5A 3OFJA 3PNKA 5HUQA 1S01A 1ABFA 4RTPA 1CHDA 1QLWA 1SBHA 3GIDA 1OBOA 1LBIA 3VTAA 2ZUVA 4F3YA 4PC6A 3BORA 3MGKA 4F04A 4R01A 1I5OA 2ZVPX 1ZJJA 1ZOSA 4I9HA 2XKJE 1E6KA 1Y4SA 1THTA 1UWKA 1R74A 5F9HA 4I5IA 1IRXA 4BNWA 1CTQA 2R00C 2BR4A 4XDGA 3EULA 4B3GA 1YIOA 2ZXFA 3RS4A 2K7FA 5CXSA 3C1OA 1HDCA 3ZK8A 1DAHA 1L4LA 5B55A 2BM0A 2OZLA 2WICA 5LZ8A 4PC7A 1Z6PA 3E3LA 3FUUA 2FPKA 2AJ8A 4L0QA 1BXRB 1QV6A 3ACDA 4H4DA 1QGOA 3HPQA 1XJ5A 4TMTA 1PLLA 1N8NA 2YHIA 3C41J 4L8WB 5H68A 1CUWA 3GXOA 2C7PA 4IUCS 1I3OA 2WUWE 2PPVA 4OXXA 4DR3B 4I3HA 2AVNA 4HCJA 4U7GA 1D8TA 1YRQA 2FX2A 2L42A 3OBBA 3STHA 4HTFA 4KPYA 3QSYA 4XTRA 1V6CA 2ODTX 1TF5A 5AKLA 4AJEA 1GJRA 3EG5A 1WNFA 1TYAE 2Q5JA 3AUXA 1FDOA 2O1XA 3GA7A 4S0ZA 1OAOC 3WDKA 4FWIB 3WV4A 4CKXA 2BKUA 4LE2A 1HUQA 3DZGA 4O2BB 2NU6A 1S5PA 1XZEA 2VRWA 1HOTA 3X1DA 1N9KA 1Z5OA 1INLA 1T9AA 1KPHA 1AU9A 3SX4A 2A0FA 1K6JA 3K6RA 3CO0S 1KMMA 4RKEA 1FQWA 2F9LA 1PZXA 4JLAA 4MYUA 2E2WA 1W5AA 1H3FA 1N6IA 2CUZA 4LNHA 1EFCA 1NURA 4NPAA 1I7PA 4QJIA 4E5UA 2MSDB 3N70A 1MG0A 4F1JA 1BEUB 4KNWA 2RIPA 4NJMA 1GZ4A 4F4CA 5J40A 1KP3A 1WXQA 3V4FA 1Z4QA 4I19A 1KAGA 1D2HA 1GGVA 3DFUA 4J7AA 3UT5B 1UC8A 4DCOA 5BURA 3MN1A 1LRKA 3JS5A 4AQDA 3WSVA 4LDZA 2E5WA 3N7TA 3CT6A 2IV7A 3FYTA 1GEEA 2NSYA 4JYMA 3GPCA 4JUFA 4FSHA 4TMVA 1OZHA 3OZBA 4IIFA 4YCCA 3HA2A 3LL7A 4IJ5A 3IA7A 3KLBA 1OROA 4FHDA 3ZGNA 1UMCA 1T2DA 1MGOA 2C5LA 4Y0VA 4K86A 4KO3S 1XYGA 4KHPB 2O2SA 1KOFA 1PVVA 4BNKA 1AK2A 2WB4A 2FA9A 3OC0A 4LX8A 4UULA 1JLLB 4RVUA 4FWTA 3KKQA 3U5TA 4ZTBA 4XYBA 2QMZA 1L8QA 2EQ5A 2R4TA 3UEOA 2Y1CA 5EY5B 3AESA 2DFTA 2YWJA 2W2QA 1QPGA 4D82A 1RYHA 4DYDA 1E4OA 1JXAA 3QOWA 5EP1A 2OMEA 4RM3A 1F2DA 1EUQA 4RU1A 1N2IA 3KZVA 2BFOA 3AO0B 1UPCA 4G85A 4LUCA 3ZD6A 3NG1A 2PKXA 3AM4A 4XOUA 2PZLA 1D2MA 5IVDA 4FBGA 2PDAA 2L19A 4KU4A 1E94E 1S8OA 2IY9A 2IPLA 3DL4A 2QHXA 5AT1A 4G1FA 1XKXA 2BFCA 1JAHA 3DMTC 3PJDA 3BMOB 4FE7A 5ERXA 3KLNA 3ONDA 4GIBA 2N3ZA 3QVUA 4LXHA 4MWSA 4AO6A 1JLKA 3NC0C 4TSKA 1Z62A 3G0HA 1XCPA 1K8ZB 4PF1A 2ESRA 13PKA 2G09A 3TW8B 2W6IA 4WJKB 3V3KA 1YIDA 3IVXA 4BLVA 2Q4TA 4UHFA 3AKEA 3B3AA 1JIVA 1ZK1A 1P0FA 4JBLA 1CEXA 5EHQA 2GO1A 4ZMBA 4IW3B 1MLDA 1QCZA 3RSLA 3UHPA 4BFUA 2D5BA 4LC0A 2J5RA 1DWPA 4BO3A 1J1IA 1GFWA 5GIOE 3BOSA 3CZ5A 1NA5A 2D7CA 1BDMA 1DX6A 1YU6A 1FQKA 3H8WA 4GYJA 3ETNA 3N2KB 5IAEA 1UWCA 4MR9B 4DHWA 3M6AA 3RYCA 4WCFA 1PT6A 1XLVA 3MMXA 1TQ2A 1TQHA 1V8BA 1V35A 1W5BA 1XA0A 4K40A 1Y81A 5DT2A 3DF7A 7GPBA 2FVXA 2HK6A 3VO1A 3RJ9A 2C7BA 2XF2A 3PPXA 4NULA 4R81A 4Z7OB 5LLSA 5A4IS 1MXHA 4QUEA 3S4YA 1NVKA 1VC2A 1F2VA 2P78A 2RHOA 4GBJA 4J07A 3CGWA 3NM5A 3UV7A 4YRKA 2QF7A 1EP3B 3ABQB 3PWKA 3QENA 5LOVA 1GCGA 1E4VA 4TYYA 1JA9A 3R5TA 3UMMA 1KY4A 5TPZD 1PSZA 2SBTA 1N9GA 1USGA 2NMVA 3BIJA 4G36A 1N1DA 2JGIA 1U28A 4GP6A 4RFLA 1G6HA 1T0HB 2QUIA 4C3UA 3EK2A 1E7QA 4N0DA 3DT6A 3OCVA 5ALLA 1YA8A 1JEAA 3GLUA 1W29A 3IP9A 3ZHYA 4IDGA 1MVNA 5K2MA 4ENSA 4C0SA 4MPRA 3ML1A 1O0BA 4GZMA 1M34E 3ZLBA 4HKTA 1I24A 3OZ7A 3KYDB 3IHTA 3A3NA 1A7JA 3EC1A 3R9KA 4UBJA 1K7EB 2EGUA 3WNCA 3Q3IA 2VSOA 3WGIA 4FP9A 4BL5A 2X4GA 2PZAA 1WZCA 2PR2A 2ZRNA 2EKPA 3TSZA 2GM3A 4C4ZA 3RVQA 1RAGA 2O5RA 721PA 2E4VA 5BQOA 2REXB 5TMDA 3T0FA 4CKWA 1TQDA 2BM1A 1T1GA 2JC3A 2JF0A 2ST1A 3DYBA 3JQ9A 2IJGX 3IR5A 2G9NA 4LZZA 2LIPA 1SEVA 2Q0HA 2DBRA 3A2LA 3GBSA 5TMBA 2BJHA 3WKDA 4E14A 1H5QA 4B6GA 1HFJA 2PBRA 2UAGA 4KIJA 1M1YE 1ZIOA 3UJAA 4RQTA 4XFDA 4ALLA 1UM9B 1UZNA 4HK4A 3WMEA 1PE0A 4OCZA 2GJ4A 5D85A 2ZRKA 2R751 3I73A 4Q7KA 4UCQA 4FGWA 3OQPA 1RQ2A 4R8SA 3SS9X 5IKEA 1ESDA 3GLHA 4UFPA 4TGLA 3SEZA 5MF6A 3R09A 4KAXA 4WEOA 3QLUC 4H15A 5CLGA 2IOHA 1IY1A 3I9NA 4UVGA 2PRYA 5ALUA 2ZYDA 4FKBA 2IDZA 5F78A 3JYOA 4XWGA 1JWAB 4QDKA 4UM7A 1HFKA 1TM4E 1YHZA 4ER5A 3BXOA 2C84A 3R75A 4DGQA 3NVDA 5H1YA 2EKBA 4GZ5A 1VJCA 1K2VN 4RA9B 5A5VA 4FIDA 1WLSA 5JSFA 4UDXX 3ZY6A 4G4SO 4MWEA 3AETB 4DJDC 5HRAA 1JQ3A 3CCCA 4EITA 4GW3A 4NOJA 1RQRA 4KV7A 4TS4A 2B4AA 4DZRA 3F1LA 2QUAA 2Y1WA 5FA6A 5K3DA 5HJ5A 5EZQA 4E5YA 3CF0A 2Z98A 4F3KA 1TKCA 1GGHA 2B92A 1FYXA 3OLZA 5ERYA 5IBRA 3CNQS 2PQ2A 4MEAA 5J2TB 1YD7A 2R84A 1QFYA 1Z3CA 2XR1A 3PTLA 4QTZA 1YQQA 1Q1NA 2Q1XA 4ZT3A 4ZAZA 5EWLA 3NPAA 4XYGA 1FQJA 4OMDA 1HDYA 2VXBA 3FYUB 4H2DA 2ODWA 4M0LA 3SM3A 3IUSA 1FL9A 3SC6A 1MKYA 4NIMA 3JRNA 3V1YA 3I01M 3OHMA 4RH1A 1IOZA 1L5HB 2OO3A 1MQSA 2HA5A 1SQSA 3GROA 3MWEA 2AEJA 5FBHA 1MO5A 2ZPAA 2UV8A 2R8ZA 4PYKA 1NR1A 5CJPA 3NYRA 4DPMA 1EH5A 3BMCA 3KAJA 3A6GA 3IA2A 3O8DA 3LQYA 1C7JA 4R7GA 1O8BA 5JXHA 2V4MA 5FWXA 3FSGA 3TB6A 1QRRA 4D8TA 4WBNB 2E85A 1ZGZA 2FHSA 2P6OA 3EEIA 3GVHA 3HZOA 3I04A 2PSSA 1B0ZA 1XRRA 4GI3A 2Z5FA 3IPLA 3OJLA 4UNNA 4V2UA 3VZSA 4CQMD 5LYJF 2NGRA 1Y8QB 5C8YB 4P1ZA 1Z5NA 5DBIA 3KQTA 1V8FA 1WMEA 1XE3A 3G3EA 1XVAA 3EY4A 4RHTA 4PO1A 2QSYA 4HVAA 4BGUA 5EE1A 4BN0A 4AMBA 5ES3A 3AHGA 1JSXA 1QH8A 1KMIY 1Q1BA 3PVZA 4GD3Q 4HWKA 5DTEA 5CFPA 1GT6A 1EWRA 1TJ5A 1WUTA 3BCRA 3MS7A 5EZYB 3OZTA 3K7EA 4ZVLA 1XYYA 1SIWA 4QPDA 4DKJA 4ZQIA 2OSVA 5GJBA 5GONF 3ETGA 4LK2A 4AG5A 3QMVA 4DT1B 2ZREA 2W4IA 2IU0A 3PKJA 1ZK0A 4EGJA 5CDTA 3QXGA 2XNSA 4X5OA 2HD4A 2NO9A 3IODA 2LCQA 3BBLA 4TMYA 2GD6A 1E61A 3SICE 2Q9AA 1SD5A 4HL6A 5KYKA 3V8VA 2NAPA 4NNPA 4C05A 4EY8A 3WLLA 1OWOA 4ZD6A 3CUYA 1M54A 1RE1A 3ZDZB 5FTKA 3I4FA 5HYVA 4KQ9A 4UTNA 4A2CA 5B3LA 5HOQA 2V7VA 8ATCA 5BQ5A 5FUQA 5LNK6 1T9GR 2OORC 2X22A 2Q3BA 1RPJA 4IJMA 4XJTA 4ZV7A 4A73A 4YUAA 4GDMA 1DX9A 5BVGB 5H7XA 2PX5A 4KOEC 3P27A 3NHFA 5KYNA 1PJLA 2R2AA 2WWFA 3FGNA 3NIWA 4FSDA 4W7HA 4BB6A 4BLRA 2B3TA 3QPUA 3WLSA 5FOVA 3VPDA 4MCIA 1E32A 3T5DA 2A4KA 2Q0QA 1X0XA 3KOUA 4I1PA 1D6SA 5BSMA 1W5EA 1D9ZA 3U48A 2X8JA 2UXBB 2CUKA 3A4MA 3IP3A 2Q50A 3JRXA 2VHXA 3PHBE 5LWHA 2PMFA 1RHQA 4ZAFA 3VDXA 3ZCUA 1XZJA 3HU3A 3B36A 3V2HA 4YRTA 5HOEA 2W71A 2WUDA 4HAIA 2LE0A 2XDWA 3DBLA 2WJZB 3D0KA 3NP7A 2PE5A 2IELA 2VP3A 3LYHA 4R1OA 3BXPA 3PZBA 1Q1AA 3S28A 3D02A 3VR4A 2PO7A 2HEGA 2O6LA 4KBYA 3HVUA 4CM7A 2FVYA 2UYHA 1T2FA 3AX6A 1DKLA 2WZCA 5JNSA 1F3LA 2VAXA 4ICIA 4JYCA 1TZCA 3DWEX 4Z53A 1RAEA 4G89A 3LVQE 4EJ0A 4YCSA 4M0DA 1UBTS 2JA1A 3EDRA 1HZJA 1WXWA 2CLCX 1E1DA 5MDHA 5TC4A 1AMOA 1NIPA 3PQ5A 4EGCB 1K27A 1GTL1 2UUPA 1RWNA 1Y1QA 2QRQA 1Z7EA 3CXUA 4ZT6A 1O1YA 1XRSB 1ZJ6A 2IEBA 1ZNQO 2Y1DA 1OWPA 1M83A 2XEXA 1C8LA 3O3CA 2V7QD 1IEXA 3HSKA 4NARA 4RVCA 5A3SA 1R8SA 2W2LA 3HBFA 3MUOA 2JCGA 4TV9B 1NXOA 4I4TA 4ZI7F 4J0GA 4HZGA 2DWOA 3LUGA 4H3KB 4WLVA 5JWHA 3O26A 3R0XA 1TO1E 4ZQCB 3ETHA 4ZWNA 2FLKA 3FCEA 1SBTA 1W30A 1Z34A 2VT6A 2PRIA 4C4RA 2V59A 1VHWA 2G4VA 4EKDA 3AY0A 4EARA 1POWA 1KPGA 4YBRA 5CB0A 3AV3A 2AE2A 1JEOA 3GPIA 3I05A 2R8YA 1W36D 3GFRA 4L16A 2AC4A 2Z2XA 1OBFO 2ZJ6A 1NI4B 2VNSA 2GLTA 2E37A 3D6MA 1K68A 3PUJA 4FCVA 4X1IB 1FFYA 4KAAA 3CWZA 2VH2A 3MMPA 3MOGA 4V2IA 2YVLA 1T34A 2HSGA 1TYCA 2OCKA 2RHRA 3WYFA 1G41A 1GTG1 2JIMA 1Q50A 2AZDA 1GTZA 2GVZC 4KAFA 2BEUB 1MEOA 1CQZA 4ZOBA 2IITA 1XWFA 4UNIA 1X7GA 3NEPX 2OBFA 1JHZA 5DBGA 2G82A 2HMWA 2JGRA 2YYAA 1QONA 2Z8XA 5DNDA 4BTLA 1XXLA 3FTCA 4QTUB 3REQB 4UNPA 1G8SA 2VQ3A 4HSGA 4MV0A 2HRQA 2L0XA 2QQGA 3WYEA 5A5EA 4TVKA 1QF6A 4G0MA 2JAXA 2BFMA 1RAIA 4M1EA 4ZAXA 3S2YA 2JAWA 3EXG2 1SQ6A 3SFZA 1EDOA 1Z0ZA 2WNHA 3CTMA 2V6JA 3VJKA 1B76A 1JKIA 1QQTA 3ROGA 1YDWA 1XOIA 3MCVA 3MLBA 3ZNOA 3LX5A 1GGEA 3NANA 4MRRA 3W3AH 1TVCA 3DV2A 2PO5A 2OE2A 1CJCA 4MV3A 2BKEA 3O8LA 2FMTA 3QKSB 1E1KA 3R7FA 3IT1A 3CF6R 3TLJA 1A2KC 1HWYA 3B5JA 4KC0A 3DE1X 3CISA 5ECYA 5EHGA 4WW0A 4QEKA 5AW6A 2FN7A 5IK2D 4HUTA 4Q9NA 1F6WA 3LGAA 4RXTA 3ET4A 2G77B 2FFBA 1XZMA 1GQQA 1JZTA 2AD5A 3T12A 3R44A 4HDRB 2NU8A 1AZSC 1XEXA 3JQ7A 1FSPA 1MNQA 1ZH6A 2IUYA 1MC5A 2CY0A 4AJIA 1AUOA 4YMUA 3SMVA 3W9SA 1P4RA 1TQ8A 4XQGA 3K0KA 1M6HA 3PCTA 4M1KA 4RBNA 4CM4B 4FGZA 4MJ3A 4NDAA 4CKCB 5EVCA 3UMBA 3ZWVA 3FTFA 2Z30A 4DMGA 3E03A 2ZK7A 3L8GA 1FFXB 4JROA 5LJIA 3T1YB 3OPYI 4EW1A 3TEFA 3PFIA 3G1UA 1ISGA 1Y1PA 3OQIB 4TTRA 3DP9A 4BJ3A 1GKUB 1L5RA 5FOWA 3UQZA 4CM8B 1WEKA 3BM5A 3HFGA 5CFRA 5JAMA 2Y0EA 4NAUA 1GNTA 3IUMA 4RTJA 2O8DB 1GPNA 3HB4X 2BT4A 5EEGA 3VISA 3RVOA 3ASYA 5DO9A 4B2PA 1QTQA 3FF4A 4F06A 1Q5PA 5IEJA 1UEXC 4K88A 1QS0B 3R8CA 3DM5A 4J8PA 3L7AA 4L73A 3RIXA 2J67A 3L01A 2FPXA 3TN7A 2ZR9A 3CW8X 1MXFA 3G5TA 4UUAA 3A4TA 4M0KA 5CLLA 3F1KA 4G5YA 4CGYA 1MVOA 2ENWA 4OUDB 4EW3A 4LF6B 3I34X 5EHNA 2P9EA 1A7KA 2R65A 3MCUA 5KCMA 2X8LA 3KOOA 3TM5A 1JP7A 3JARB 4D80A 4ZCMA 1Y9JA 2I80A 2F55A 1H8EA 3E70C 2C95A 1TU3A 2UVDA 2YRWA 5FPQA 3NW9A 3L40A 2I7DA 1BQ3A 4GR5A 2NUBA 3FOWA 4XCXA 3TR5A 3WNVA 4YRBA 1PFYA 1F5NA 1Y80A 3GPLA 4JI5B 2C7GA 4MJ7A 4JP5A 4DS3A 1UP7A 4RXUA 4HMQA 4GMFA 4JLUA 3B8HA 3G5LA 4AECA 4UTVA 4IHAA 4F8JA 4XJSA 2II6A 2WVGA 3EE6A 2HYDA 5HIAA 2QRUA 1EVKA 4JFRA 4WXYB 4PPNA 2XMZA 4NFYA 2QR2A 1X7ZB 2V3VA 1DJPA 2BDTA 4EBBA 4ZZ1A 2BD0A 1DRUA 3KX2A 4IX9A 4ND6A 2Q0SA 1C8BA 3PLAE 4AJPA 3G2KA 4E88A 4HGQA 4BLQA 1YIAA 3EMBA 3PL1A 5BSUA 3PNLA 4M9SA 1PNVA 1Y5IA 4YAWA 4ANFA 3AF1A 4KXMA 1QO0A 1L4YA 4EFDA 4EFMA 2YIMA 1OLXA 4D7AA 1BW9A 2CBZA 1RM4A 5DTRA 4LJAA 4PEVA 5EKXA 4ALJA 1FRZA 5DMXA 3OTOB 3Q11A 2QT9A 2WFAA 3EGCA 3BJRA 4UHHA 1RVV1 4ZOEA 1JUDA 2GCEA 4XVUA 4ZIRA 1KEEA 1ZD5A 3CRVA 2X7XA 3O90A 4GEKA 3LOPA 4JLWA 3RHSA 3U19A 4GZ6A 2X1HA 1F60A 2Z4SA 1T0UA 3DC2A 3HYTA 4KRGA 3WJAA 4PQGA 5JJBA 3KKLA 1EM8A 2J7PD 2R4UA 2AB0A 2Z5VA 2WPDA 3GB9A 4CF5A 1T3GA 3HKEB 5CA1F 1NMXA 3W9UA 4V3CA 1G0NA 4YP9A 3E9QA 3M6LA 2NXEA 1XN4A 2WBLC 3ANTA 4G0ZA 4MW1A 3R4VA 1GXSB 4OU5A 5EESA 4LZJA 3SBXA 3WJ7A 3BSWA 1L5NA 1GAEO 3WLKX 2EP5A 1Z08A 4DSAA 6ADHA 3I2IA 1ESNA 1T3HA 1RP1A 1FXWA 2PQMA 2W98A 3QLVC 4FKZA 4GM0A 4HWSA 2OYCA 2C5AA 1XD2B 1BJRE 4G1VA 1PLJA 5ECWA 4CDRA 3KJNA 5TMEA 1UXIA 5CU7A 1EX1A 2VL7A 3H6GA 1VKOA 2MMCA 4UEKA 1KGDA 3ICVA 4TKVB 2PGLA 3O8QB 4FJ0A 1SZJG 5JUWA 3ZU3A 5T6MA 3ZE8A 3MRSA 1QH0A 4EMTA 3CRZA 1P1HA 3BSYA 1K6XA 2XXAA 1H2BA 1XZNA 4R2WA 5DSZA 2WUGA 2IEAA 2C5BA 2OCGA 2NPFA 3VMMA 1FVHA 4Q1FA 4KREA 5IC4A 3J81k 4R1LA 4OI2A 4KR2A 2XUPA 3F0TA 4DJJA 1O87A 2D2EA 3OQNA 3MS4A 1T4GA 5E9AA 2HA3A 5GZ3A 2NQTA 2ZSEA 3R5XA 5LA6A 2F4NA 5JCPA 4OKSA 3V34A 3DHWC 1B8NA 2PGXA 1SEPA 2R1VA 2FMIA 3M1AA 5T64A 1HETA 2A14A 3H1FA 3OX2A 4I1UA 4REQB 5LLDA 1BE0A 1L7XA 1ZQ1A 4GG1A 1BMFD 4DUZB 1KFBB 4J0FA 2NVUA 3NV9A 1KETA 2W70A 4CV0A 2MYPA 2H00A 1KYVA 5JISA 3T5PA 2HLNA 1PFKA 2O0KA 5E3JA 1Z6QA 5DXFA 2A7QA 2FSIA 2COEA 2ZYSA 3CEMA 3O1JC 2P65A 3PQ6A 3HDGA 3Q40A 1YJQA 1VYVA 4UBKA 3OE7D 1Z13A 3K0CA 5FRDA 5G0UA 2QX6A 3C6BA 3O1HB 4G01B 5CURA 1YAJA 3KPYA 4AP6A 4ZOAA 1Z7GA 3HXTA 4LPKA 2V3WA 4RD4A 1LW7A 4ZGGA 5TE9A 1GL6A 2FR0A 2ZW9A 2QDXA 3IOEA 2FDRA 3MWLA 2X9QA 5DLDA 1KDZA 3WGHA 4FM9A 4CEJA 1P3DA 4YB8A 4QTXA 1CJMA 4QWMA 1C9KA 5C9ZA 3VX4A 2B35A 4IIBA 5FB3A 1M1NB 4LXQA 3Q1KA 1HTWA 3Q3GE 4HX2A 4WA7A 3G2MA 3O4HA 5HFJA 4CKYA 4EG8A 2UZ4A 3GEIA 4LKRA 1VB5A 3AGPA 2DQKA 2YUIA 1Z39A 3WLAA 1EVEA 5JCXA 1DBVO 4KEAA 4YACA 5TS3A 1BE1A 2AOTA 5KI6A 3MTBA 4DMMA 3JTMA 5J4VA 3VYSB 4LYEA 5JD5A 2DWUA 3LBFA 3SQXA 3SE7A 2PFSA 3LMKA 3UZUA 1S9DA 2QYHA 2CHUA 1SXJE 1TFUA 3HABA 4WV3A 5HZKA 4AG6A 3IIJA 4YK7A 4EQ6B 5JADA 4FNOA 3I5UA 5AVOA 4I9NA 3TZLA 1U9IC 2DAPA 4URYR 3P9XA 2FW1A 4BECA 2JJQA 4MI9A 2UXCB 2H7XA 3AI1A 4CIAA 2WHEA 5K0ZA 2FXVA 2NO6A 4FFBA 2A1IA 2ZBDA 1DG9A 3HP1A 4Q9LA 2PUBA 4M9UA 2PH3A 4JQZA 2QMEA 4J16A 4E5SA 4NCXA 3RGGA 1OGYA 5KPDA 1Z07A 4KXVA 3V1LA 3B2NA 1GA6A 3N2YA 5KPJA 3I9OA 4ASUA 1NW3A 3O3NB 3FKQA 2ZB2A 3EZNA 4H7EA 4K9LA 5TXGA 2NUAB 5HIJA 3HACA 2C9ZA 2OAP1 2QNIA 2ZTLA 2Q4EA 2P1DA 2W4QA 5JTTA 2VYFA 4ISBA 4R68A 2HREA 4I4CA 4BFYA 3LUPA 1QUEA 3NVMB 2QUZA 5JXJA 1U8FO 2O2DA 3OLXA 2XQVA 1ZITA 3R0ZA 4XA8A 5KQRA 2O2XA 2VJNA 2ODQA 5J58A 2XPCA 1Y4UA 3C7TA 1GILA 3HJAA 2V6BA 4J1SA 3CKLA 3AEXA 1E8NA 1J00A 5KC9A 3EEOA 2BFDB 4HGYA 4YJ2F 3RVKA 1MG5A 3X1JA 1VL6A 3E4CA 1QHFA 2ZKLA 1A97A 1VPEA 2BEWA 2FMHA 2R62A 3I3SR 3CNOA 1VBKA 2ODEA 1P0PA 4H7FA 4HDKA 4OHXA 4PYRA 3QOFA 4C21A 3BMQA 3O8NA 2FF7A 5T8KA 5AW0A 3GJ0A 1IG3A 4CR6A 4YN3A 3K9WA 3Q5EA 2GFIA 3Q9NA 5HKOA 1PT9A 2PZFA 3FDIA 4B73A 2QX8A 1X92A 3V1MA 3GUHA 3CZMA 5CP8A 3L77A 1ORDA 1TNDA 1YZKA 2Q49A 1VMDA 3HGMA 4ZAYA 3SF0A 3WSWA 7REQA 3PDIA 1VKHA 3SYRA 3WRXC 4E51A 3WIVA 3KWMA 1TAHA 2W2OA 4C6TB 4RWZA 3L8MA 2ZYHA 5K20A 1MORA 1FTSA 4H27A 4B81A 1EG7A 5GJWC 1BWSA 3AR7A 1ZK2A 3CJQA 3R9IA 3D3WB 4KQGA 4CFSA 4E46A 2WE8A 4Q39A 4D8XA 1YRWA 2QAGB 3FGZA 3CMMA 3N0VA 4XUCA 3VO8A 3U4QA 2QV0A 3L46A 4PNZA 3K16A 1C1YA 2I1WA 3FVQA 3SVZA 1B26A 4ZVMA 3F97A 3OUUA 5HGJA 1N78A 3H16A 2QTAA 3A36A 3MFYA 4MDEA 3QMPA 5JVDB 1GQFA 3WB0A 5CA0F 2FX3A 3CPSA 4CVNA 3T9FA 3WS7A 5IH3A 1BIFA 1L5WA 2Q62A 2GH1A 1WXHA 3K1AA 4OY3A 2O23A 2WZQA 4QT0A 1XHFA 3NBYC 5DM1A 4PNPA 1GUAA 4ZALA 1YR2A 2WG2A 2E6KA 4MVJE 4I2NA 4O25A 1L5LA 5BV8A 1EMDA 1NBME 4WJLA 2WHYA 3IHKA 1AUPA 1ZRNA 4Q00A 2KWIA 5JC1A 5H3CA 3L05A 4F71A 5K8LA 3DO5A 1Z2AA 4W82A 5JNTA 3WB9A 2DP4E 3CN9A 3TNLA 4B0OA 2QPLA 2QTZA 3L7NA 5NLLA 5KNBA 1ILWA 1QGZA 4KSBA 3ZE0B 2AJBA 4KN8A 4AT1A 1EVQA 3WOVA 3QXSA 2V58A 5F4ZA 1KIFA 2ATXA 1WUYA 2IYXA 3QE3A 5F7ZA 1K5DA 2PD3A 4RXMA 3HO8A 3IJPA 4D9EA 2XTMA 1I9CA 2XGSA 3BVPA 3Q72A 4W1SA 4QPZA 3HWRA 2FDXA 2W6MA 1X9IA 4IH1A 2O4UX 3K94A 2F9MA 3N2EA 2C4WA 3HKDB 3Q0TA 3BWVA 3THYA 2JLVA 2OC4A 1M6YA 2O52A 1YZNA 1OOEA 2E49A 1VL2A 5EZSA 3IB3A 1UOOA 2RHCA 2X0KA 3RI3A 4ARSA 3AF5A 1W8IA 1RCTE 3PVCA 2A0WA 4IEEA 5F76A 2IPXA 2EEZA 4B8ZA 4BOYA 2ORVA 2IH5A 3ZK9A 1YR6A 3BC1A 1AUVA 3BHMA 1G8YA 3EVNA 2C4HA 2OV2A 4PZLA 4FOLA 5CB8A 4RTNA 4NXMB 2RAUA 3CNLA 2AGVA 1RM3A 3AFGA 4GBGA 3VI3B 4E12A 1Z2OX 1YRBA 3LUAA 2F64A 3GCZA 1E4YA 1KKLA 3OZCA 3PQFA 1JI3A 2W6CX 1QVAA 5TR9A 2CEAA 2OHFA 3T54A 4GMXA 3FDFA 4A27A 3RHFA 4HQNA 4F4JA 1JEYA 3OKPA 1U1GA 1Q0PA 2FPWA 5EMLA 4D25A 4TMKA 4G5QA 3CA8A 2QW0X 3EF0A 1BRMA 3Q7IA 2QROA 3A9CA 3GPDG 4Z51A 1L4UA 1OF1A 3OU6A 3SCZA 4DCNA 2C8JA 1KS2A 4B3CA 4YRAA 3AU8A 2Z3VA 1PR0A 1RPNA 3LOUA 2Y92A 4YCDA 4HNGA 1QO7A 2BLNA 3A9TA 3MJRA 4ALMA 1CB7A 1J9ZA 1I4LD 2G0NA 3QPWA 3A7DA 5B2ZA 4BO9A 3F7TA 1Z8HA 2ZP1A 1WXFA 4TM7A 4JJEA 2DBYA 1WZ2A 1RI4A 2F3PA 1V43A 4Y2RA 3OJFA 3LX4A 2WJWA 1JPNA 1FA9A 5H9WA 1A5BB 1ZNZA 1J0CA 3T7KA 4DBZA 2V98A 1WB6A 3RNLA 3VOBA 2JPDA 2XI4A 2X3FA 3VU8A 3KB6A 4IPTA 3DYVA 3UT5A 4DGSA 1G5RA 2WD8A 3DDOA 4L6AA 3PGKA 3NALA 4UCXA 3IUEA 1C9JA 1T5TA 5T4FA 5BOVA 1Z9BA 4GXNA 1L0BA 2KW5A 5ECGC 4CJXA 5KYXA 5HXAA 1Y5MA 7ADHA 1M0TA 3B70A 1Z29A 2PU7A 3PNVA 5KTKA 4PYMA 3SYMA 1CUZA 4RACA 2JAHA 1MR3F 1WZEA 1T29A 3JQPA 8OHMA 1FJGB 5TF0A 2PSHA 3KZOA 5LYJB 2Y9PB 4CN8A 1QAMA 1DI0A 2CLSA 2PUJA 5HS4A 1F06A 1R4ZA 3HVHA 4KWTA 1PTKA 1XPJA 4HS9A 1RP7A 1N2OA 5KOHA 1H22A 1JR4A 1Q14A 2AX3A 4OP2A 4OHKA 5CEJA 3T3NA 4ZAGA 1U4SA 2CSUA 2DU8A 4AF8A 4J0KA 3SS8A 1RACA 4Y7CA 3UYLA 3IAS1 2C9MA 1YDGA 3GUYA 5GONB 2PRSA 2C88A 4E15A 2VJKA 2AMVA 1U5BA 5B7PA 1YKGA 1FBNA 4OBBA 5BN4B 5KYTA 1SQGA 3HJFA 1OE0A 4FDUA 4H6WA 1XU9A 1ODKA 3M5DA 4RX1A 3TVYA 4ENQA 1SUBA 3EQZA 2C2YA 4BAZA 3RW9A 1IHUA 3GJ6A 5FUWA 3CKYA 5KVQA 5E6RB 4Z7NB 1HDGO 1QWOA 4LYHA 1E18A 4GVPA 4KMSA 2N75A 3OPQA 4B3MB 4GOKA 4AUMA 2N1BA 3KYCB 2ZRHA 4O2LA 5JROA 2JHFA 4TV8F 5REQB 2Y67A 1P9WA 4B43A 1L9KA 1YTLA 1GARA 1ZZEA 1NV8A 2MIIA 4IRXA 4U6NA 3TTUA 3AY6A 1ESEA 4BFZA 1DPGA 2VZ0A 1HDIA 4U7JA 4BDSA 1KMQA 1D3AA 4KB5A 1U3TA 1NRJB 1X80B 3ERCA 1I0LA 2O06A 2R25B 1J5XA 2V4UA 4JI1B 1RS0A 5CGZA 1ZD4A 3N2KA 5K3OA 5KQSA 4MR9A 2ZT5A 3C2QA 1DG3A 1S1CA 1V7QA 1B0UA 1G5HA 3FZNA 4JL8A 1E3DA 3W9BA 4E5MA 1RRFA 1S3IA 3FVTA 3ZJTA 1E64A 3EISA 3HBNA 5K6TA 3A1UA 3B48A 1X1BA 3QX7A 1QOQB 1RIIA 4EI9A 1Q3HA 4HQ6A 1QTIA 3VR3A 2X40A 4ERNA 3OKFA 3ZLVA 2YMPA 4B84A 3AH8A 1WDKA 2VBFA 1VJ5A 1B2LA 2CW5A 3BWYA 3D8TA 3EVFA 3FBTA 1OXKB 1M2VA 2FN9A 2EATA 4H0NA 2AHRA