1KR2A

Crystal structure of human nmn/namn adenylyl transferase complexed with tiazofurin adenine dinucleotide (tad)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
271
structure length
233
Chain Sequence
b'EKTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEAAVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NICOTINAMIDE MONONUCLEOTIDE ADENYLYL TRANSFERASE
publication title Structure of Hhuman of Nicotinamide/Nicotinic Acid Mononucleotide Adenylyltransferase. Basis for the dual substrate specificity and activation of the oncolytic agent tiazofurin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 80
structure length 233
sequence length 271
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.1: Nicotinamide-nucleotide adenylyltransferase.
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1kr2A00
2DEUA 3H99A 4NZPA 1N2BA 3RJZA 3CLUC 1EXDA 5H16A 5TGTA 1WZ2A 1KORA 1Q19A 1KAMA 4QREA 1IQRA 1N78A 1VL2A 2HGZA 2IP1A 4OUDA 4ZT3A 2AKEA 4G5YA 4P2BA 1KQNA 1EFVA 2GOYA 1N3LA 2DETA 3COZA 4KR6A 1WKBA 1H3NA 1SURA 1T6YA 3HZRA 2PXHA 3H05A 3PNVA 2IJGX 3NV7A 4I6JA 4QRDA 5TEVA 3FG9A 1M8GA 4WNYA 2V0GA 1QTQA 4MVWA 1M83A 4ND7A 4MVYA 4EG4A 2ZP1A 2QUKA 2YWCA 2GKSA 4G5FA 3COYA 1OD6A 2D54A 2J09A 3F3MA 5TS2A 1U3CA 1QNFA 4CDMA 1UFVA 5H7XA 4MUFA 1TQ8A 3DO8A 3SYTA 3IMCA 3C8ZA 4H3SA 1PFVA 3X1JA 3P0HA 3ELBA 4MUNA 4YMIA 1VBKA 4KR9A 4K0RA 5HUJA 2BYTA 1XJQA 2JANA 3KFLA 3NBAA 3PNBA 1WJGA 4ND6A 4KKVA 4ARCA 5DASA 3ND7A 3K32A 4J75A 1TYDE 4EG8A 3AG5A 3COVA 3FNRA 3VGJA 2A84A 4EG5A 3RBAA 2QTMA 2XRYA 3Q4GA 1MB2A 1JIJA 3ISJA 1PFYA 2QJOA 3UK2A 3UC5A 4KPUA 1D2RA 2RE8A 3G6KA 4A91A 4ZT5A 1J70A 4ZCSA 1O0BA 1T6ZA 1IQUA 4MUKA 2A4MA 4PBRA 3SZGA 3ZUGA 1RQGA 1JZSA 5FO0A 3IVGA 1WXGA 1BS2A 1M8KA 1QRSA 3MLBA 1KH2A 2VTBB 3I05A 2CV2A 2X1MA 3RFFA 3PXUA 1VLHA 2ZUFA 1H1TA 4NDAA 4NAUA 2WSIA 4ZT2A 5FNZA 2CFOA 2E89A 4PY2A 1TEZA 4DNXA 1OWNA 1U0BB 1YULA 2PFSA 3FDXA 3DPIA 3TZLA 1EFPB 2G36A 4YP5A 2OV4A 1IRXA 2YXNA 3HGMA 4EG7A 2CV0A 1N2EA 1M8PA 3ZJUA 2GM3A 5AHWA 1FFYA 2QJTA 1OBCA 4MVXA 3CLUD 3ND5A 5K0SA 1T6XA 1TYAE 1ZUNA 1OWPA 2A88A 3H97A 4X0EA 4TS1A 1B6TA 1J20A 5J58A 4MUJA 2V0CA 3FOCA 1JIKA 3QE4A 4MW5A 4U7JA 4XSVA 4S1OA 2TS1A 5KWVA 5DEOA 1QRTA 3KT8A 3GMIA 1J21A 2YWBA 5K0TA 3FIUA 4AS1A 4PBTA 2EJCA 3P0JA 2QTRA 3IMGA 1QU2A 3A04A 4YP6A 1N2IA 3CVXA 2PZAA 1WXFA 2JA2A 2A1UA 2DXIA 1G8GA 3MMXA 1LI7A 1T9GS 1H3FA 1PFUA 1NZJA 2AG6A 3IODA 4MW0A 1IFXA 3RHSA 5HG0A 3ILVA 1O0CA 1T9GR 5IHXA 2DERA 1NP7A 2D13A 4QBTA 2J07A 4MW7A 5LLTA 3RK0A 2CYAA 3K9WA 3IOEA 2EL7A 1MOPA 4GU5A 1A8HA 5TEWA 1MRZA 1ZH6A 2QUHA 2PG3A 1EE1A 1R6XA 3CR8A 1Q77A 1J1UA 2OQ2A 1K4MA 4J76A 2DPLA 2IELA 3SP1A 4DJAA 4KR7A 1HYBA 3S3TA 4I6GA 4JYZA 1GLNA 4L2IB 3IOCA 4ZCPA 3N8HA 2O8VA 1KP2A 3CLRC 3TS1A 3HV0A 3JXEA 1WXEA 3QTBA 3IOBA 4MWCA 1O6BA 4UZFA 2ZUEA 1MAUA 1NSYA 3A4IA 4OJMX 3UOWA 4F3RA 3ZIUA 3FY4A 1WOYA 1NUPA 3IVXA 1YIDA 3VRHA 2X1LA 4AQ7A 4DLPA 3UY4A 5KHAA 1MC1A 4Q16A 1IHOA 3RK1A 4ZCQA 1JGTA 4EG6A 1N2HA 3D6UA 2QJFA 1F7VA 1O96B 3H9BA 4MULA 1GTSA 1K4KA 4XFDA 3KT3A 3X1KA 1JIIA 3MLAA 3COWA 4MWBA 1I6MA 3IMEA 1LI5A 1NURA 3IUBA 5J5AA 1U7DA 1R6UA 1NI5A 3QTTA 1PG2A 1FYDA 2J4DA 3N2YA 1O95D 1Y42X 4WSOA 3L93A 2YY5A 2I1LA 3L92A 1I6LA 3CLSD 3P52A 1F9AA 2DUMA 3Q10A 5HUHA 4R0NA 1O95C 5J59A 1CT9A 1MAWA 4MAFA 1G8HA 4RUKA 1G8FA 5KCMA 2CV1A 1WXHA 4MVCA 5LM3A 4DDMA 3CLSC 4OUDB 1GZUA 4MUGA 4MQ6A 2DLCX 1EFVB 4HPWA 1DNPA 1OWOA 2PZBA 4MW4A 1NUQA 4ZT7A 3UMVA 2DR2A 4DE5A 4I6EA 4MW6A 2A7XA 3CA8A 2WQ7A 1MBZA 1JHDA 4ZCRA 3AFHA 1K97A 3MXTA 1F4LA 1KKUA 5EKDA 1EUQA 3IVCA 3ZJVA 3A05A 1NUUA 4UZEA 1IVSA 4MUEA 2Z08A 1QRUA 4ZCTA 3PNYA 2A86A 3LCJA 1R6TA 3AIIA 1V8FA 2VXOA 2HZ7A 1OWMA 3ND6A 1H3EA 2JAXA 2A1TS 3D6VA 1KH1A 3FWKA 3SDBA 1WQ3A 1NYLA 1GAXA 2A1TR 4DDKA 3TQOA 2XRZA 2BTEA 4EGAA 3G59A 2CYBA 1S4MA 2E18A 3CLTD 3M5WA 3AG6A 2WQ6A 5FO1A 2CSXA 1X8XA 3TQIA 4R2LA 1PG0A 2E21A 3HFJA 3CLTC 1O5TA 1YUMA 1QU3A 1JILA 3N9IA 4EG1A 4MUIA 1MB9A 2E0IA 2X3FA 4EFKA 2QTNA 1J1ZA 2PIDA 3GUZA 1WXIA 4U63A 2VTBA 4HJRA 1O97C 1JEDA 4HJXA 1N77A 2Z3VA 1O94D 1EJ2A 3DV2A 1XNGA 3NBKA 4KPUB 1TYBE 1IQ0A 1EFPA 1JZQA 3CLRD 4G6ZA 1KAQA 1JEEA 1OWLA 1WY5A 2NZ2A 3CVWA 1GTRA 1O94C 1JECA 4EF6A 4FZJA 4MW1A 3AKZA 1J09A 1GPMA 4NATA 2C5SA 4BWVA 4ARIA 3H9CA 1TYCA 1M8JA 5DK4A 4JXZA 3BL5A 1N75A 5F23A 2AZXA 3GLVA 3ZXSA 3FHJA 4DDHA 3MUEA 3AL0C 4CQNA 3TNJA 5LFAA 4JZYA 3SEZA 3IUEA 1M8FA 1JMVA 1KP3A 1N2OA 1N2JA 1QJCA 4MUHA 3HL4A 1I6KA 4YP7A 1IH8A 2CT8A 3ZXIA 1EUYA 1GN8A 2O5RA 4Q93A 4GRIA 4MLPA 2WB2A 3IDFA 4NAHA 3SEQA 4MWEA 3HMQA 4E1AA 3SZ3A 2PZ8A 1LW7A 2CUZA 1YI8A 4PBSA 3A2KA 4F4HA 1M1ZA 2J5BA 4HK4A 3N05A 3U1VA 2B7LA 1P7PA 3KT0A 4MWDA 1Q11A 3LE8A 1I2DA 4U8HA 1X6VA 3CVYA 4CDNA 1WQ4A 1XNJA 1K92A 1MJHA 5BNZA 3OP1A 1KH3A 4MW2A 3X1MA 3OTWA 2RD2A 1N2GA 1V47A 3DLAA 2Z09A 3P0IA 3FETA 1PFWA 3ZGZA 4NX2A 4EG3A 4CT0A 5IJXA 4L2IA 2J08A 1OBHA 1QQTA 2X0KA 3IH5A 2NSYA 4JXXA 2A1UB 4RPIA 1G59A 4JFAA 1KR2A 3G5AA 1ZH0A 1KQPA 4K03A 4ZT6A 2QUIA 4R2MA 1TFUA 3E27A 3FI0A 3LOQA 2CYCA 2R5WA 1COZA 2HMAA 3TZEA 1U7XA 3CVVA 1YIAA 2H2AA 1U3DA 3CVUA 1NUSA 4ZT4A 3KT6A 1Q15A 1F7UA 1O96A 1KQOA 1VBMA 1N1DA 5JBNA 5DB4A 4YBRA 1ZJWA 1YUNA 3PRHA 2H29A 1XNHA 3INNA 1NUTA 1ILEA 3ZJTA 3Q12A 2QUJA 1VBNA 1ULHA 4XFJA 3VU8A 2D5BA 3FH0A 4MW9A 1O97D
chains in the Genus database with same CATH superfamily
1XCOA 2ZQYA 2ZSKA 4N3NA 1F3OA 4B6OA 5CPBA 2ODBA 2PH7A 4DMMA 1QH1B 3F5SA 4GUDA 4BYGA 2GRJA 1L4KA 3IJEB 1FW6A 3HJRA 4YDHB 2W6JA 5BUQA 3OFJA 5K8LA 2C7VA 2G83A 4UAVA 1HNXB 1YDEA 3VR1A 3JYQA 1NQOA 3OZUA 4PLPA 2AKEA 5EJ4A 1ZQ9A 4IOJA 4YJFA 3M6XA 3COZA 4OLJA 3B1VA 2ZYIA 3G0CA 3W79A 4PPYA 5IWCA 3R9WA 5C37A 3U7HB 1SURA 1GTJ1 1MH9A 1WY7A 3KL4A 3FTEA 1SXJB 1IEQA 4QQRA 2Y9PB 4XEUA 5ARBA 5A9SB 3I5YA 3KKPA 2LV8A 1YZKA 3BK2A 5I9NA 1A8PA 1ZITA 3N5CA 3PHHA 2PMBA 2NV0A 1I1OA 2NO4A 2YVAA 1Q84A 2QN7A 5AKHA 1TT5A 1W2HA 4G9BA 3VHXB 4E14A 5JPDA 3FZGA 1TVMA 4FFWA 1P1CA 1VCIA 1P2SA 4MK4A 3ANMA 4PTYA 4K1LA 5DRTA 5U4QA 4E31A 1M8GA 4E4TA 4EI2A 1KP9A 5UKDA 3ROZA 5DNVA 4LOHA 3TUZC 1KY4A 4LZAA 5IBRA 4NK4A 1GFWA 1SUSA 1OXTA 4KWTA 4K7JA 4J16A 3LQRA 2WOOA 2AX3A 2BOVA 2I22A 3KOXA 1C9DB 3W8NA 3ITEA 5D3MB 1AN9A 4DLTA 2OAP1 1NJ1A 4ER5A 4WBSA 1DQYA 3C87A 1D4OA 1YKFA 3WLTA 3QEKA 2GAOA 3RS4A 4D3SA 1IUPA 4RADA 4F7DA 3DE5X 4H3SA 3GHYA 4JQSA 5CX1A 3K8QA 4OKSA 4CG0A 3ZD6A 2R6R1 2H1VA 5COBA 2FPRA 1FXWA 5CRIA 1T6BY 5B4VA 2HJ9A 1WKCA 4JLDA 1FPMA 2FN9A 2JJ1D 4KKVA 3SQLA 1A96A 1M2EA 3G5TA 3PUVA 2PUJA 1HO3A 4Z4IA 1TVEA 3EIEA 4J2OA 1W5SA 1DBIA 3EIHA 2JFUA 4MCAA 3KQNA 4BNGA 5CTJA 3S1LA 1ECPA 3DMTA 3P9QA 5M2QA 3VGJA 1H0HA 2VZ8A 1F5SA 2C07A 1Y48E 1OIVA 1UDCA 3G6WA 4BN4A 4M9ZA 4DLXA 1U7UA 4D0SA 2JEOA 3OPQA 4OQQA 4Z0NA 3MRVA 4K87A 1Z5ZA 2AG8A 1PDWA 1TCBA 5DJ5A 1QIDA 2JD0A 2X2PA 2OFWA 2OGUA 4R1NA 4LDPA 1TRHA 2OP1A 4KRXA 1OLSB 3A2MA 2IS1A 1IIRA 1T6ZA 3RW9A 1KK0A 2A7QA 3JSAA 2W83A 4HDOB 2REQA 3MTIA 4PYNA 5JYDA 1UK8A 4CEHB 1VL1A 1QGAA 1NYTA 2OM6A 2F8SA 2C1XA 1PVVA 5HTKA 2DWOA 4DCVA 3K7EA 2H48A 4YYZA 3ZV4A 2AB0A 4YMLA 1EBUA 2C3UA 3DTVD 2HMYB 2HSJA 2VNAA 5DF1A 3IEKA 1YZUA 4X66B 1EQUA 1NZFA 3SLGA 1FFSA 1C0IA 1SPBS 2UVDA 2HRZA 3HJFA 1XMPA 3M6LA 3SNKA 3HI4A 5EHQA 1N6NA 3NV9A 2LUOA 2QMYA 1O6GA 3FDXA 2IXFA 2Y0BA 1EFPB 4ZMRA 1ZVVA 4WOCA 5CITA 2K2QB 1IRXA 2YFHA 4A92A 1K88A 1DC3A 3I3SR 3DEZA 1PLKA 4TMYA 2R1UA 5AOAA 4HMOA 5H9WA 3I5UA 2VYNA 1MQAA 4OAOA 4DLBA 3L4JA 1V41E 1VDMA 1HY3A 4HNSA 5D3KA 3JQ7A 5KJ6A 1NQTA 4X91A 2V6MA 4GT1A 3IQHX 3ZXXA 3D4NA 2JATA 5I4IA 3Q98A 3TOVA 3GJRA 3LY9A 5FTWA 4NBKA 2FR8C 4AXXA 1ORIA 2FXIA 2D2VA 3EZXA 1HYQA 3EAFA 3FGZA 1KMMA 2YJGA 2ZKIA 4QHYA 4U7JA 3IUJA 3F4BA 5GV7A 5K0GA 1DFGA 3TDMA 3FTQA 4AJLA 4KUGA 3JD0A 1L5ZA 2AOUB 1UBRS 2BFAA 2GTPA 5H4GA 5CA1F 4C07A 2CMFA 4MWGA 1T5LA 1J21A 2QAGC 1ZRSA 3L1KA 2YMLA 1GDDA 3O90A 3F9IA 3DOEA 3Q7TA 4LJ5A 1L8OA 3GZNB 4DA0A 3NBXX 4CV3A 1HPLA 5IJ9A 2FQ1A 3BIXA 3CLVA 3O1JC 4CT4B 1QANA 2ZTHA 3OG9A 4GF5A 4YP6A 5KZMB 3JQ9A 4FI3C 4NZNA 3WOHA 3GLFE 1V5FA 1ZICA 4F3KA 3MMXA 2BHTA 4QBFA 3UHFA 2Q7XA 3IODA 2SKCA 5F4BA 3DZJA 4H1UA 3BZBA 4PS1A 1NSFA 2AJLI 4DV0B 2OLKA 4KEAA 4ZODA 1N36B 1DB3A 3W5BA 2OBXA 3JVDA 4ND2A 4OAQA 1YC5A 2FOXA 1VECA 2NO0A 2PSJA 2FDRA 1XSEA 3V1UA 1U0SY 3CN7A 3SX2A 1H0KA 1TAHA 3PL1A 2WIGA 3CW9A 1NRJB 3RKSA 1NQXA 4MR9B 4RA9B 4F71A 1Q14A 1ISGA 3ED1A 3AYZB 1VPTA 1Y34E 3PFNA 4GD3Q 4TS9A 1FK8A 1XVVA 1R0SA 3DKKA 3JATA 3KNZA 4N9QA 4KMRA 4PLGA 4BEWA 1EESA 1A2OA 3M2TA 3HWSA 5IVHA 4BO8A 3KZVA 5B2FA 4J76A 1TFRA 4NTZA 3FPBA 4KTTE 3ORHA 3CY6A 2ZSHA 2R7KA 3A9CA 1YC2A 4HDRA 3V2UA 2NUAA 1WV1A 4JODA 2EFHB 2EJVA 3VI3B 4PM4A 4QDZA 1A8QA 4QQFA 1NQWA 4RC9A 4BV9A 1S6YA 3IOBA 1PUJA 4MIOA 3MHTA 5JY6A 4MIEA 4F1WA 1W36D 2NTYC 3EN0A 5IAEA 2COUA 2GT1A 1HFEL 4BFCA 4ZAZA 1SCUB 3ROEA 4TTPA 4F6CA 3BGOS 5E1OA 3T41A 5ADHA 5AI8A 1JQ5A 4QYMA 3FUTA 3EFOB 4C05A 4UHEA 4D2IA 5BV1A 1ZNXA 2VF7A 1QMGA 4ZCQA 3STTA 1X74A 3WLPA 4RZQA 2H65A 5DHTA 5ALQA 5EE9A 2ZKLA 3VNQA 4FB5A 4DPKA 3PITA 1NLMA 2VNHA 2Q2OA 1PEKE 3FJ1A 3FI9A 4D92A 5CLFA 2OVFA 3UUEA 1HEUA 1JDBB 4R9NA 1JP7A 3KUDA 1TQ2A 3EDOA 2BD0A 3GEEA 3H9JA 3L8ZA 3OLQA 2ZJYA 1SXJD 3EYWA 5HIJA 2NU8B 3PJRA 1I7SB 3O4VA 3LUDA 4G9GA 1C9YA 1EUZA 1EVLA 2YHIB 4LRQA 1K8RA 3Q0IA 4NJEA 3WIEA 1Q1AA 4O4LB 1QTRA 1VE9A 3IPYA 3MS4A 3LIPA 5AMXA 5I51A 3G0BA 1KYIA 3GFVA 3L93A 5F3DA 3K1TA 4IYRA 2VVTA 3AR2A 4X3PA 5DGHA 3M6WA 3CLSD 1HE4A 3D1VA 4EMBA 3FGOA 4QPZA 4RW0A 2H92A 5H8WA 4M21A 4J0IA 1E79D 2I2CA 3V42A 2C2WA 4Q5IA 3L0ZA 3LLCA 2FSSA 5KVCA 1E2HA 2UZ3A 3U6BA 1QR2A 2IW1A 3P2YA 3C7KA 2BE7A 5BQ3A 1J8VA 1GZUA 1JDVA 1GQSA 2C4UA 2ZWMA 2CDAA 1NUQA 3EZGA 5B3AA 3CC8A 4E94A 5CFNA 3BQNB 4EHJA 4J7UA 3WSWA 5EVJA 3REGA 4LTMA 1ZD9A 4JIGA 1CUUA 2YHBA 3D4PA 1O8BA 1I3MA 1SCBA 2EOAA 1WW3A 3K9BA 4V3BA 5K3SA 1G5TA 1ZIXA 1UDAA 1UINA 4R0MA 2JI7A 4XDYA 1PBTA 1RQLA 4RTQA 1PNTA 2WZCA 3SAJA 1OX4B 2B20A 2IIQA 2ZSIA 3GMSA 5KO2A 5JZ9A 2V45A 1F8UA 1KDRA 5DCLA 3SEAA 3WR5A 1Q74A 4S1VA 5ULLA 3VR6A 1W73A 2J33A 1W19A 2V55B 2Y77A 3A27A 4EHDA 4RVFA 1EE9A 3TW6A 4PPGA 3TH5A 1CJKC 4EL5A 4RGYA 4ZQFA 4CU5A 4BKQA 3DLHA 3OIFA 1RHKA 1XBTA 1X8JA 3FPLA 2BTEA 3HU2A 2PSHA 3TAHA 4IIFA 5JQGB 4D25A 3JPYA 1E2PA 3VYWA 4KNWA 1GVNB 3ABRB 3WQSB 4C7VA 1LJLA 2FE4A 3F5DA 1L8AA 3JYLA 3WMEA 3FHTA 2HQ1A 4PZ9A 4A3SA 3GA5A 4LHWA 3N6XA 4DRXA 1CKEA 1TU0A 2ESRA 1PG0A 3FZEA 3SR3A 1Y1TA 4MRSA 3CUTA 1VJ1A 1W5EA 1IBLB 3KQUA 5K0JA 1ORTA 5AESA 3OUZA 5ALOA 1TCUA 3H87A 2QTNA 4G1UC 3ZZ0A 3HLTA 2RAFA 1G2IA 3DL2A 3L79A 5HZMA 2PCJA 5DLYA 1YDHA 4C3VA 2C03A 4L0MA 3HNPA 3ONWA 1E2NA 1DFHA 1HFWA 5G0TA 4L9WA 2J3EA 2QTVB 2XUPA 2JGNA 3R7DA 1JEYA 1RQRA 4RTKA 1EQAA 1ZN2A 1G6OA 2P78A 3M89A 3QVGA 1QC5B 2PANA 3JZFA 4KGVA 1E3IA 4KPUB 5EJMA 1M1YE 4B6EA 2CUKA 4EW2A 1SQ5A 1WW8A 1KXJA 1ZM3A 3QI2A 4WKPA 1VHWA 3EQ7A 1GZSA 4H4CA 1SM4A 2E4ZA 3WLKX 2RDMA 4NI5A 1L7RA 3ZGLA 1WL8A 1JT9A 4P83A 4I4TF 2IIVA 4BV2A 4AN1A 1FTSA 1E9VA 4QD3A 3RVNA 3WB0A 1CR2A 1NN0A 4NATA 4B8YA 2DY0A 1A5SB 3PGMA 1G5IA 3CUEF 4GPEA 3TMAA 4NCJA 3ZWYA 1EDEA 1GSIA 4V24A 2WSBA 3BL5A 3P9PA 1MTOA 2VQ6A 5FPSA 1IULA 3R5FA 4CUKA 4LG1A 4JYAB 3D2BA 4IAOA 2BZSA 4BKUA 2ZI3A 1I1HA 2CMKA 5HM6A 2WHYA 4FSHA 2AZXA 4DSZA 3U37A 3MQ2A 1T1RA 2C8VA 1SIOA 3D6AA 3WQQA 1IJBA 2ZBFA 2O0MA 2NXWA 5ALNA 4D96A 1KMHA 1HDXA 2W48A 2WHRA 3R0QA 3TTXA 4C0XA 5C1BA 3VC2A 1QJCA 3QLTA 3VPSA 3G02A 5SY9A 5A7FA 4N0PA 2PZEA 5KVSA 2F9MA 3AIKA 5D85A 5TMBA 2FMXA 1G3MA 4Q3AA 3ZWPA 5LJLA 2HEIA 4EPRA 3V00A 1LGYA 4A1OA 1QB8A 3NVDA 3FA2A 3I0NA 5J1TB 5CAEA 3IBFA 3A9WA 4HN4B 4BFWA 1K0FA 2IZ5A 1F06A 1C1YA 4YAEA 3GNQA 5KAMA 3KM0A 4IZOA 5EVCA 5J4LA 1HORA 2B7BA 5DI9A 3P2EA 4TZKA 1YZVA 2GCPA 2HBRA 1TZBA 3Q3JB 5K3AA 4A8TA 3NC4A 1FTGA 2P9FA 2VH1A 1WNFA 4Z1MA 1E8NA 2PXCA 4MLZA 4K9KA 3V7WA 3VOTA 3DNPA 5IUJC 4IMPA 3ZU2A 5JD6A 3KYCA 4ENUA 1EYZA 1KH3A 1DIOB 1UJMA 4UFPA 5JHGB 2VBCA 1B0AA 1TVCA 3R6LA 1IOWA 1Q0PA 2ORWA 1LK7A 1BVRA 5HUQA 2HCFA 1BD4A 2AEEA 3JQ8B 3DDZX 4W7SA 2V7EA 4NICA 5MN4A 4JY7A 1JAIA 2VRNA 2C96A 2UAGA 2W4MA 1NJ6A 4RSRA 2W93A 3OKFA 4K1XA 4RD0A 3PC7A 3N2LA 4F11A 4WOJA 1JDPA 2VYVD 2N0SA 1PJ8A 4HVCA 3N8IA 3EMDA 5H02A 1RHUA 3T0IA 1GA1A 4TTVA 5TIIA 1FSFA 3NO4A 4N0EA 4D26A 1VKJA 4A8JA 2BF7A 3B2EA 2RHHA 3WLLA 2QTCA 3CU5A 1BA2A 4HWRA 4O4JB 4R2MA 3IQZA 2CHUA 2ZBUA 2RG7A 3RVLA 1ONSA 2CYCA 2IY9A 4W6ZA 4Y1GA 2I55A 4E03A 4BTVA 2G77B 3RUDA 4KX3A 1GSAA 3QU2A 2QQ0A 3PL5A 4R1LA 3R5HA 4BFVA 3C39A 4M8SA 4R98A 3DHVA 4EM6A 2ISSD 5E6RA 1CTQA 1R3UA 1KSGA 1BSVA 4KR2A 1QZTA 1W85B 4XYLA 1XL1A 1IVNA 4MCJA 2F1RA 1EFRD 5CG1A 2G1JA 3H65A 3RTGA 5FNVF 2JAOA 1A04A 5G40A 4A7PA 4OO3A 1XK7A 2PYZA 5C0OE 3SM3A 5I8WA 5MN6A 2GBCA 4BLQA 1EB9A 1KO7A 3NYWA 4OI0A 1PDOA 5C51B 3ET5A 2FU5C 4MAAA 3PICA 1T2NA 2G9QA 3RWOA 2YUIA 1RWMA 1WXWA 3DMGA 1N8TA 3LGXA 1XXHE 4XD7D 3ILSA 3RYHA 3L1IA 4L9SA 5KOJB 4AO6A 4CIXA 2NYUA 3DZHA 1US8B 4OL9A 1NVFA 4B2IA 3UOGA 1F8XA 4DCGA 2PPVA 4DS3A 1HLFA 2VXCA 1WZ2A 5B1IA 2PUFA 4CKEA 1E2FA 2HGSA 1KAMA 3SZUA 4XR9A 3EVAA 1DTEA 1CU1A 5I4KA 5JAPA 3BDAA 4LOAA 1ZSVA 4LKRA 2V7QD 5EPUA 5BV2P 4JX9A 4QXAA 5HJ5A 1MJGM 1A8SA 4GNRA 4ABYA 2P75A 2PSSA 3TE7A 1K3FA 3CRRA 1W0KD 4X5OA 4ARSA 3HZRA 1LPSA 3L9WA 3QRWA 3UYLA 1V8PA 1XZIA 3AF2A 3QX7A 1EWKA 1Y3BE 1T91A 4YQZA 3UBMA 4EW1A 1EFHA 4X84A 1E2KA 1LPBB 5EMLA 5LUAA 2VDVE 3BDVA 3CRZA 4FZVA 3CUKA 1EXVA 3KJGA 1TPYA 4G2TA 4IGAA 1FLNA 2E87A 3AF3A 2VT6A 3L1HA 1DCKA 1MX1A 1RJ9B 2NW6A 1U6IA 3O93A 3P5SA 4FQ8A 1AG9A 4AX4A 1TOAA 4DR3B 4AT1A 5DTIA 3NX4A 4FDUA 3QNWA 3VAYA 5FUVA 2PGOA 4UEOA 2HOQA 2I9PA 3UJ8A 2R6CA 4M36A 4D3XA 4D8XA 4NL4H 5T41A 3A2LA 4A6DA 3M82A 3NWEA 1R15A 1PWHA 3DMHA 3F7NA 4ZTZB 2XPCA 1DAMA 3SYKA 1GTZA 3UW3A 4AJNA 4MV8A 1ZH8A 4BNZA 3OQIB 4L72A 5K99A 3QHPA 3O21A 4UHBA 1G6KA 3BRSA 3WYCA 2IPMA 3IAAA 4H60A 1FFBA 2WJGA 3SFZA 1KHHA 3MFYA 4YXWA 3N58A 1O6FA 2PRIA 3L06A 4P33A 3T7CA 2NXJA 4Z7OB 4JH0A 5KYXB 4FWTA 1QE5A 3HUUA 3HCFA 3LUFA 4EG8A 1KGDA 4V1CB 1RNLA 1KVQA 2RHOA 1W8DA 5IKEA 1VXRA 1GRNA 2C97A 3HCBA 1GPAA 2WMDA 2A84A 4DR6B 1TIKA 3E82A 2QL7A 1K7FB 4JUAA 4U7PB 1FS5A 2ZIZA 3ZKAA 1MCZA 3DB1A 5KOHA 2HSEA 4NULA 3VU3A 3WA6A 1ZM9A 2R6AA 3FYHA 5IEJA 4QQNA 2UZIR 1KC3A 2ZJ2A 1T2DA 3HEBA 3M4NA 4BVLA 3H11A 3TL2A 1TUBA 3L1UA 4J1SA 4PO1A 2JLCA 3RAPR 5DDIP 1FS4A 1ML3A 2WI8A 4R16A 4RBNA 4X63A 5JJCA 3RU9A 3HCCA 5D5HA 3R7NA 4WKNA 1ORRA 3C6BA 1R50A 1LQTA 2M6LA 3OEWA 4YS6A 4AF6A 4HT3B 7MHTA 2AYXA 5PNTA 2WABA 4BPRA 4YC7A 4DLNA 5C1DA 1E1RA 4L6AA 2XLCA 2BEVB 2FPMA 4JVMA 4Q4HA 3GDFA 5A1TA 2D7DA 2WIJA 3C16C 1CB0A 2WE8A 3IMFA 4MEJA 4B09A 1EFDN 2YNMC 5H83A 4BNIA 1GZVA 4BNMA 4CYMA 2DHDA 1HOXA 1U0LA 1Y1RA 4GE3A 1IBCA 2NSLA 1B3BA 3D43A 2PMKA 3AUKA 1H1TA 1K5GA 1X80A 1LDBA 2D74A 3KEQA 1I2BA 4YRNA 2WSIA 3C3AA 5FR2A 5KMGA 4UXJA 3RS3A 4EG0A 4QULA 3BTVA 3GB9A 1XHFA 2RJNA 4HNAA 3T1YB 4QO8A 1NMQA 4EA8A 3PQEA 4D9BA 5IU6A 2PKQP 1FP6A 1AE1A 2NOAA 3HRKA 2BR5A 3QOFA 4O08A 1IEWA 1ZD3A 1TKBA 3P5BA 4EYGA 3GOHA 2IS4A 3PFGA 4AYXA 1UJ5A 1UIMA 5IZCA 1KI6B 1CY6A 4MAMA 2B5OA 1Q1GA 4O2LA 2GBIA 1SQGA 5IK2D 3PEWA 4F5EA 4UE6A 5F5XA 1H42A 3ND5A 4OSPA 1N7JA 2H7CA 2Z2XA 5ARCA 3ZKWB 4KFCA 4MKXA 5FOUA 1JG2A 3ZV6A 4F1JA 4J3FA 5GJVC 4R9VA 1YASA 2QRJA 3L7MA 3H9GA 2HI0A 4BV3A 5TQ2B 2NZWA 1U0HC 2HK6A 1GY8A 3LLMA 5JXGA 7ADHA 1GIAA 4O63O 2ZVQX 2TS1A 3FNGA 1T36A 1ZRHA 1RZRD 1CQJB 2X4GA 1I9CA 4AL4A 1OPRA 4N5NA 4G1MB 4CCYB 4QXQA 5JNWA 3HYNA 5LWQA 4DR2B 5KDLA 5HKAA 3HM9A 3DQPA 3EGIA 1Z5VA 3DCNA 2XQKA 1LU9A 3DEFA 3C7AA 3JYHA 4QYTA 5KWIA 2P3LA 3KV1A 2XEDA 1ENZA 3LFTA 5LB2A 1QYIA 2GDZA 1O5OA 7REQB 3OTGA 3PNQA 1D03A 2ASEA 4YCLA 3ITDA 3KVNA 4BU1A 2GYVA 3MWEB 3MHPA 3M9LA 4JD5A 3CINA 1ECLA 3HUDA 5LYJA 1XOIA 1T9GR 2DULA 4F4UA 4R1SA 1BS9A 4WCDA 4DFDA 4EY8A 4N0MA 5H3CA 5TVKA 4DV6B 2IS6A 4XOUA 1OFGA 4IY1A 4RIHA 2GEKA 2W2OA 1HTBA 1MOPA 2GK3A 4Y6LA 2BI8A 2XA9A 4FYMA 1JG7A 2HFJA 2QZZA 1J0BA 1U3FA 5BNIA 2BW0A 1CR6A 4LJAA 4MRMB 3CE6A 5HS6A 4E5MA 2FMTA 1Q20A 2DX7A 4GKJB 2H3EA 3P97A 1L4EA 1ADFA 1I8TA 1SUPA 2VDMB 3WIUA 2P0YA 4X3OA 4X8LA 3ZLVA 2R44A 3N8HA 2FPIB 4AJHA 4DIBA 2VR1A 1A69A 2VNKA 2ERCA 1SOUA 3L0PA 4L95C 1N1GA 3DQZA 4GYKA 5JJ5A 1NVMB 2OSVA 2ZB8A 3A4IA 2VH5R 3I6QA 1NQVA 2YZGA 4TS3A 1G6HA 3QVMA 3AUXA 3P96A 3G5UA 4JJFA 4J3JA 1QH0A 1SC6A 4U2BA 4XCXA 5KYUB 3VRHA 1XRQA 3P27A 5JAMA 3KSZO 3PNKA 3TD6A 1EX7A 4JI0B 2CLSA 1RW4A 2FY8A 1BJTA 1T26A 2DQ4A 3CUUA 4RD1A 3K3PA 1U8TA 3RT9A 1E7RA 2HA6A 2P79A 5LBIA 3SY8A 3AXSA 1KDPA 3ANNA 4MRVA 5KU1A 2Q5OA 3H9BA 4G2NA 2XDQB 2Z04A 3D02A 4MUMA 5BQPA 3RC1A 3C1AA 5K3EA 4M89A 2O1WA 2PY6A 2O9JA 2IHUA 3D8UA 4IXTA 3QX9A 3SX4A 3PQ5A 1I6MA 3W2GA 3OQOA 3IUBA 4UPVA 2HZBA 3RLFA 3ZS9A 3ORQA 4LF9B 2NYRA 1SKMA 2AMYA 2RI6A 3PTLA 5CLJA 3G0HA 1KETA 1LQUA 1KJJA 3AU9A 1Q2XA 1GNRA 2D7CA 5LIRA 2O3RA 2PKYX 4NBTA 1MA3A 5DHAA 2R62A 4IHQA 2HK8A 3L92A 2JHCA 3DP7A 5ADUS 4RTNA 2MCFA 4YV7A 3DQQA 2K87A 5DYIA 3L6DA 4MTCA 4D9IA 3H2YA 4J0QA 4Q15A 2FV8A 1E3DA 3DT9A 3AFMA 2DFTA 1RI3A 2CF5A 3DMFA 1XCGB 3N39C 4FGSA 4Q1EA 1Y9EA 5DP2A 3EX7C 1ZK2A 2PO5A 2OCXA 1RJWA 3EXFA 1YQWA 3AEQB 1NNI1 5F1YA 3WV4A 4CM1A 4YCJA 2CHEA 3LT4A 3ZLBA 3DZFA 4D1YA 4MQ6A 3FXAA 1NHGA 4I4NA 2H7VA 1CVLA 3NDPA 1T5OA 3TDKA 5CK5A 2V1UA 4KRFA 2MSLA 2CFTA 4JLKA 1JJIA 2IXAA 4N3GA 4V0OA 5D01A 5BYKA 3HQ4O 3ZHOA 3N6VA 1Z74A 1OYVA 4DM4A 5JALA 1E2GA 2Q5EA 1Z6PA 2VYND 1OF1A 3KSAC 2YOHA 4I1IA 4X7BA 4BO4A 1K89A 2O6LA 3NHUA 4OYRA 2AN4A 2IZ1A 1T8WA 3GA7A 4MLCA 1ZCBA 5COQA 4XRRA 2IOFA 4RLQA 3DEIA 3FF1A 4YJKA 4P3NA 4JVNA 1Z15A 4TWJA 3I01A 3RR2A 4D99A 3LDFA 3ESCA 2H1FA 5HGXA 3D3KA 4I9FA 2QN6A 2QB5A 1K7XB 2ZATA 4LGMA 3MGAA 2CLEB 2CL5A 1P2UA 1C29B 2D0IA 4ZYVA 5FPTA 2IPNA 3ZBPA 2G17A 4KG7A 4J07A 2HW8A 5DBEX 3AEXA 1RTKA 1HE1C 2NVUB 3FHLA 4X90A 5AI5A 1YS7A 4YJ3B 4Z4CA 3HA7A 2OWDA 5CT9A 1FTNA 1NJSA 3UGQA 4CMKA 4E5KA 3V7NA 3OLYA 1OT3A 4FMCF 1DXQA 5A4DA 3PGVA 3BD7A 4OSOA 2V7UA 3WMWA 1QG2A 4BWGA 1X8XA 5KQGA 4E30A 3OURA 2IZ6A 1NWCA 3AR4A 2NTVA 3IV6A 1DQSA 3KDAA 1R7RA 8ABPA 1EX6A 3A9SA 1PZMA 1JFLA 1G20B 1ZOSA 2QZPA 3EJWA 5SZIA 1QU3A 2JCSA 3SICE 4OFZA 3QKRA 1MB9A 4MRNA 4NU5A 2H8KA 4F5ZA 2I7DA 5B1HA 1PK7A 2ZDGA 2FJ0A 5LNK6 3GEHA 2ABWA 4L4RA 1HC7A 3KDPA 3H3JA 2FWAA 2G0TA 1LBSA 4F45A 3PPXA 5AUNB 2DY1A 3GGDA 4HJXA 1N77A 1K6MA 1NP3A 2BMAA 2BELA 3OPVA 2DUWA 4XVRA 5LZ5A 2A0YA 1N92A 4XVUA 1YR9A 1L5SA 2Q9AA 3A28A 3PUIA 4M0UA 4Q01A 5CPFA 4RY8A 2NQ8A 4MYHA 3QMVA 5IVIA 2UVQA 2UYCA 3F74A 4CE6A 5LZ4A 5JVDF 2QHXA 4YCSA 3HJAA 1Z68A 1IK4A 3B6ZA 1FSGA 1OMOA 4UM8B 5GV8A 2R25B 4I7EA 5JDCC 3AKZA 2OPHA 4HX2A 4NSNA 5L4NA 4AJ2A 1K27A 3SDSA 2ZR7A 1QFSA 4JBXA 4CODB 1GITA 4BUCA 4D81A 1V2GA 3U3XA 2V6GA 4PVCA 4UM7A 3NBQA 3TLBA 2C5EA 4KYUA 4P81A 4CEJB 4D7AA 1F9EA 1Z07A 1QO0A 1F0NA 2LNDA 1EXMA 1IOLA 3TRDA 4DG5A 4OQEA 1NKSA 3D8BA 3H19A 2IV7A 3SJ7A 5DN6A 2B98A 3DLCA 1PQYA 4JZYA 3TW8B 3T5AA 4MWTA 3SEZA 2VF4X 5K2OA 2FPPB 1XEFA 3S40A 2BVNA 3TOCA 3UV3A 3W90A 1WZCA 1GKYA 4FFBB 1YZLA 4YCMA 4CKWB 4FEYA 1NVUQ 1OR8A 2R96A 1LRLA 3I34X 5JIBA 4NONA 1M2HA 3QBDA 5T6BA 3HV2A 1B1AA 4GKVA 1XZPA 5CFZA 3U5TA 4Q18A 4MS1A 1D2EA 2C4HA 2CLLB 4L5AA 1KIMA 4M0FA 3NVAA 3SEQA 5KDDA 3OWHA 2QQFA 2AJBA 3L7CA 3F49S 3OZEA 5A4JA 2R00C 3HHPA 3ZJ4A 1XTUA 3DONA 2QV0A 2HD4A 2EW2A 1T0HB 1TKRA 3ZWAA 4BNNA 1VGVA 2BCJQ 4OYHA 3RB8A 1YHYA 4GOND 4F4DA 3UF0A 4N5LA 5EAIA 1PJCA 4REQB 2G88A 3V9AA 4CUJA 4FSDA 2A9QA 4RKEA 2QAGB 4PWZA 5EE1A 2XD4A 3BIFA 2P0EA 3ONFA 5CH8A 3VPDA 3AF4A 4MW2A 3PWKA 3X1MA 1BTOA 1C1XA 4Q3EA 1NJFA 1Y4UA 4BNYA 1WETA 2OBBA 3OLWA 4D6YA 1Q0ZA 1IY9A 2CNWD 1J8YF 2NG1A 2O2YA 3PHJA 5FCDA 5K20A 1FF9A 1G4UR 4EG3A 5EJ6A 3VR5H 3JD1A 2FMFA 3PNOA 4KBFA 3WDSA 1RE1A 2H1CA 3U3JA 3ETLA 2JJMA 3K6RA 5ABPA 2H1IA 5EJ2A 2VC2B 5TARA 4G07A 3TXXA 4ZZ3A 1P0PA 1C4WA 3QE0A 1UXKA 4JXXA 3I64A 4QICA 2FZ4A 2F43B 4G5SA 2VPIA 3H7IA 5BRJA 1CDEA 1X7XB 5GTDA 1UAGA 2QN3A 5KHOC 1C80A 1J00A 2G7ZA 4NQRA 3FMVA 4K9RA 3OD5A 4BEVA 1PNRA 1Y98A 1TFUA 3JD3A 1YNSA 2HIGA 4C0AC 5LOVA 1CF9A 3MQ4A 3VR6D 3OY7A 1IWBB 2JBWA 4DXDA 8ADHA 3U48A 3ZY3A 3CVVA 3R2JA 4I1YA 4IP0A 4N82A 5EC8A 3EYAA 1U9YA 5TX7A 2HN9A 1MF7A 3BFPA 3FB1A 1Q15A 4ILKA 1ESDA 1DKUA 1AUVA 1FVXA 1KJQA 3F73A 3CT4A 1RDFA 4ZV7A 1GUDA 1BWQA 2XOXA 4HTFA 2GA8A 4PSUA 2VPPA 3Q87B 3TX6A 1Y8ZA 3SHOA 3FCXA 1VYVA 4M9UA 4IIJB 4F5DA 4JL8A 2H1WA 5IKXA 2WPNA 1XALA 4DMUB 2GCOA 5B5SA 1TM4E 4X1OA 1LPPA 5KKCA 4TMXA 3IQXA 2ZCUA 1DPGA 3KAPA 2VIIA 4OXKA 2QUJA 3RAJA 4DY4A 4EHBA 1CQIA 3NTQA 3DXZA 4MGKR 4COKA 1FNSA 4I14A 5AVXA 1XVIA 3JSXA 4IL5A 3I9OA 5HCNA 3E6AA 2CSUA 3IUYA 1J0EA 1L7EA 3OZBA 1IJKA 3PDCA 4YYEA 1DQPA 2HNAA 2I2DA 4DLUA 4IGKA 4PQGA 4TV9B 4XPZA 1MT0A 1R8XA 1DAIA 2P2SA 1Y6FA 1TM5E 1BJRE 3R5KA 5BWMA 2QZ9A 3NJRA 1HQCA 2QRUA 2FSVC 5LXTF 4CQMA 1AGYA 2MJLA 3BORA 4WESB 3W5UA 2ZCJA 3S2EA 5I4BA 2XJ9A 1NE7A 4BQRA 2BZGA 2AUMA 3T52A 1DVRA 4CKCA 3B6KA 4PR0A 2Y76A 1HZZA 3HSYA 1H2BA 4QEZA 3FDFA 3TCKA 5IKPA 2FETA 4XLTA 2BFCA 3WMGA 4J1QA 2Y0EA 2UV8A 3TQHA 3WE7A 2PXHA 3K2EA 2IJGX 2RCNA 2Z6UA 2ZRLA 3VPCA 1R0XA 2YWFA 2UUOA 3HKDA 5A04A 1L5YA 2NNLD 3QLVA 3P4YA 2PRZA 1YB6A 3AW9A 1CRLA 2BC9A 3ECCA 2PX8A 3EVDA 1T0UA 3G5MA 4QNNA 4NG5A 2OOKA 3PFFA 5GOTA 2V9CA 3MBOA 3P2OA 3P9XA 1WP9A 4INAA 4JOQA 3SR4A 3ICEA 3NHYA 3OLVA 5T8KA 3S2FA 2HPHA 3BE8A 4G24A 1MGPA 1TU3A 3OCVA 1JJBA 4MVYA 4JJIA 3SYLA 2HRCA 3WL4A 2YWCA 1AUOA 1MA0A 2VJDA 3F3MA 3G2IA 1Y7TA 9ABPA 2ZRPA 2GZAA 4KQJA 1Q92A 1EP9A 3ZV3A 4F38A 5F9HA 2EP8A 2JIZD 3RWBA 3C8ZA 2CNLA 4FN5A 1XUOA 2AIRA 2E4AA 1U80A 3X1JA 4ARZA 3W8RA 1H65A 4JGBA 1UK7A 4WUTA 2CVOA 1WA5A 2EGUA 3F97A 3PFCA 2JANA 3VJRA 1V95A 4HEQA 5BSUA 1F3LA 1EWYA 4XYMA 3GRAA 4Q21A 3OIDA 3QVTA 3WZ2A 4HNVA 3ND7A 3V8EA 5J4VA 1LDYA 2IQ5A 2ID9A 2D5AA 1XRSB 2ZYUX 3U4MA 2WIBA 2CY0A 2EZUA 3OOWA 4PC2A 1ACMA 4L7VA 1C4XA 3GVPA 3TRHA 2JIPA 4EGFA 4Z1MD 4PNHA 1GPJA 2YJNA 3NUQA 3NATA 3ZOZA 4EKNB 1G4AE 2A4KA 4Y2UA 4NNJA 4UNPA 4HO1X 2W8BB 1I51A 4LYYA 3Q4GA 4IIBA 4BKMA 1SXJE 4KIFA 3LUCA 1U0RA 3LVQE 4CBVA 1CP3A 3DO6A 1JTVA 2XE4A 4D4KA 5EI5A 1JHZA 2GF2A 4ZT5A 2H16A 2RH8A 2IUTA 5HIIA 1U99A 1EB8A 1IG0A 2BHRA 2BJWA 2FYTA 2A94A 2B4RO 3AVQA 3D31A 4L9AA 4PAWA 5EJAA 3TOSA 3WGYA 3E8MA 3AR9A 4OD0A 4KFTA 1BVYF 1XRLA 4RVUA 3VISA 1JSXA 3X1XA 4AJJA 5CLQA 3S29A 2P68A 3THSA 4RY9A 2DH5A 2Z2YA 2ZI5A 3ROMA 1CJCA 3OC0A 4BDSA 1S5PA 2QLBA 4IJMA 4HDMB 3GYGA 1E1DA 4BX0A 2V3CC 1G3RA 1DU4A 4IF6A 1E0JA 1V3UA 2BONA 2W6OA 4DUGD 3BICA 1W25A 2XUZA 3BMQA 3WB1A 4B46A 1NLYA 1OAKA 3B8HA 4R2XA 5IAAA 1KK3A 1Z7WA 2E89A 1PQPA 2I2XB 5DCWA 5HFJA 5HP4A 1U8CB 2HFKA 4JBLA 4JUCA 1ULTA 3OEEA 3ISTA 3G2JA 4Q9HA 1A1VA 4X1IB 1IPHA 2Q46A 1UJBA 1IZ0A 4NRDA 1SMKA 5A1JA 3KHSA 1CIPA 1DIHA 4H0CA 1KVRA 2QUBA 3BZWA 2WV9A 4UUAA 3UATA 3BYZA 2XWBF 4JP2A 5JZMA 1V1RB 4FYWA 1A97A 2C7PA 1ZGCA 1UC9A 1ABFA 2HJVA 2TECE 1M2VA 2ZPTX 4HYTA 2R4UA 1M33A 3QMWA 2WHPB 4YGXB 3W5DA 1PEDA 3NWBA 3T3GA 4Q4JA 4F21A 3P9SA 3QFCA 3W1WA 3K4PA 1QGUB 1YRWA 2E49A 2VXBA 4PZUA 3W04A 3HK2A 1T4GA 4WT7A 2ORVA 3BWCA 2XOKA 1C7FA 2DQYA 3QSGA 4TQGA 5REQB 3TCNA 1AC5A 3V8MA 4E4YA 2GF0A 2IYTA 2NWQA 2QMUA 3MMPA 1E2DA 4GI1A 3HEMA 3CJTA 3KTDA 3B6MA 4G0YA 1HE3A 4ZICA 2XXAB 1RC1A 4MRPA 1QYWA 4PQYA 3RHTA 1Z5UA 3U4QB 1L8LA 2RBKA 2W2PA 3O8QA 2GFHA 3MJRA 5JZBA 1QRRA 3NETA 2OFFA 1JBKA 1NN1A 1W4RA 2Z4TA 3LK7A 4HUQB 4MO9A 1U7WA 1UPXA 2WOJA 3PQ3A 5TDHA 3RC9A 4DV7B 1JFTA 1W6RA 1YR2A 2EKPA 3CVXA 5AI0A 1PJRA 4UD2A 1KJ8A 2AOTA 6CHYA 5JXWA 2VTKA 5HIMA 1OT5A 4KQFA 3VZQA 3C3YA 2NO7A 1NZJA 2H57A 1U98A 3D7SA 2FVYA 2YFQA 2F59A 4G01B 4N65A 3RTBA 2QU7A 2RGCA 1JHVA 4IVPA 4UTXA 4HDKB 2B1QA 1PJ2A 4LV6A 3OT1B 5LFAA 3GLUA 3RYCB 4OSEA 3GLHE 2GM9A 2ZUUA 3PEVA 3VZSA 4C2BA 3E48A 3MT7A 1MXFA 3U31A 1CZRA 1BRMA 1A8HA 1MRZA 1ZH6A 4LBYA 1ZEMA 5FDFA 1M73E 2GUGA 1J1UA 1Q77A 2IYNA 2BAGA 2BKLA 2Q3FA 1WZNA 5BSHA 1DAGA 3KJHA 3G0GA 2I2WA 3HCAA 3Q9UA 1A98A 4AKGA 1DOAA 1ZD5A 2JKZA 2GZMA 1TTTA 4HXGA 1OA1A 4GX1A 4P98A 4PRYA 1V1JA 3HVHA 1YH3A 2HIHA 3NEAA 1P1JA 2FGJA 2CLDX 3NFRA 4R9RA 3CLRC 1VIMA 3ADKA 5G4KA 6ADHA 4PLTA 4B47A 1RWWA 3HV0A 3NONA 4OI2A 3T0GA 4GP7A 1H2AS 4YXWD 1BDBA 1RAGA 2VF2A 4RO0A 2ZS9A 4G65A 1OBVA 4MYSA 4K6HA 3UJ9A 3KBOA 1OC4A 3ENVA 5BSRA 2OCIA 4B6SA 2BGJA 1VE1A 3UMJA 2IPXA 1ZFNA 2VHZA 5L8VA 4HAIA 4LVOA 4IO0A 2QY6A 1HL7A 3QH4A 1PGPA 4FGZA 4FT4A 3NALA 1Q21A 5EP1A 2XX3A 1ZK0A 3PT5A 3OEHA 5KX5A 4DDTA 1GFIA 1W2WB 3DKPA 4LMPA 4TYPA 4B48A 5L40A 3RVMA 1SRRA 4W5JA 2AOWA 4HBZA 4MULA 2C99A 4KAXA 1XU7A 4RZ3A 1Y3FE 2Q41A 4CMBA 1CC1S 3KTAB 2R68A 3NT2A 3OFKA 4TXLA 3MWLA 4H3KB 5EGSA 4NHOA 4OHRA 2NUBA 1BD3A 2PQ6A 1U04A 3L6EA 4Q9JA 3LHKA 3WRYA 1Z34A 3ZDAA 3RAFC 4YRQA 4N6OA 2VA8A 3C5WP 3OJEA 3WKCA 1AY0A 1NMYA 1QRDA 1VLLA 3ZLUA 3IKMB 1K6EA 2VTEA 3NHBA 4QL3A 2ZG6A 4BNFA 1JR3D 2JFOA 3F47A 1E1RD 2B69A 1JVNA 2B6NA 2RCYA 4WSOA 2HPAA 3VNAA 1V1MB 4ZQGA 4IKEA 5GGXA 1CE8B 1QVZA 2ZJ0A 2WFAA 1NTRA 3MB8A 1V43A 1ZM2A 2DVMA 2LCIA 2GZRA 3Q10A 3E7XA 4NBWA 4YY3B 3G8CA 4F6LA 1XZFA 2J1LA 3BQMB 3FCAA 3UAVA 1GG8A 2OO5A 4YRTA 1G8FA 3TQCA 4CM7A 4IVNA 1P18A 2GSDA 3CTPA 5C8XA 3C45A 4Z4FA 3K9QO 2VHVA 5BPFA 3PEFA 2J31A 3CX4A 3KZMA 4FGWA 1SQ0A 1XZCA 3M9XA 3I5AA 5HZGA 1UK6A 4PSDA 3ROXA 3TBFA 2IBSA 2NT3A 2Z4RA 3MUFA 4G5GA 2F8TA 4QGHA 2QOEA 3AFHA 4QXOA 4LFCB 3SG0A 2P4EA 4CQJA 4RV9A 3L46A 1OZ0A 4UAJA 2H1OA 1UFQA 2AYZA 2O05A 3IVCA 4E09A 4KDCA 1K5PA 2DBYA 4KE7A 4IDQA 1U4SA 5AXAA 2UZ1B 4XARA 1AKEA 5E4FA 4E3WA 1C8VB 2Z08A 3JWEA 3B1YA 2OV2A 2XUOA 3NHZA 1BRTA 3T7TA 1PQ4A 1T0IA 3JARA 3MCWA 1IY2A 1GYQA 1RXUA 1SG9A 2WJ6A 3N7TA 1QIEA 3QBEA 4UCXA 3WHLA 1X19A 3B5JA 1G21B 5JUWA 2GAIA 3CMCO 4M8NE 3T5CA 3VBCA 3ZU3A 2A1TS 1E7QA 1DO8A 1RCFA 2ANBA 3BJZA 4IF4A 4R5HA 1ZJ4A 2Y3IA 3FWKA 4ZAVA 2I65A 1KSHA 2FSFA 3K9GA 4D0LB 1LCIA 3FWNA 2GLXA 4IZ6A 3L49A 1LX6A 4WLOA 1M1NA 1TW3A 4LF7B 1J5EB 3TLGA 1CUIA 2O59A 3RS8A 5CVVA 3SD7A 4XOIA 4G0UA 2Q2NA 3MSCA 2G80A 2LCFA 1GT6A 3CWCA 1MDFA 1MIOA 2E18A 4RK5A 2ZXUA 3UK0A 1GNVA 1CFJA 3I9LA 5HIAA 1HE8B 2MTBA 4XDGA 1CXZA 3LP5A 5B7GA 4BGDA 2XRFA 1VE7A 3B2NA 3KK0A 1TJ4A 4CM5A 2IQIA 1HDIA 2QY9A 4TV8B 1S8AA 1T10A 5KJCA 1RQ2A 3PIIA 4Z99A 5I9TA 2ZAGA 3HHEA 2AW5A 1DKOA 3KKLA 1Z4NA 1MB3A 1FDRA 1Z8NA 4NIMA 2P41A 3MOIA 4J2TA 4CIBA 3K92A 1LH0A 1WXIA 2WICA 4MVJH 4PX9A 5AKJA 4EHFA 4NBSA 5JRJA 1SKYB 3R7WB 1B8PA 1IY0A 4IM7A 2FX2A 4KO1S 1JLLA 2B36A 4F2PA 1M1UA 5FADA 1KJNA 4QNMA 3ZVNA 1C9MA 2UUAB 2WTEA 1TZCA 2GZ1A 1BIFA 1I1QB 4I5FA 4G37A 4MV9A 4MZDA 4FE3A 1XMSA 2I6QA 4F4IA 3PUWA 2OYSA 5DSZA 3RFCA 1VP3A 4BO0A 9MHTA 3LZ6A 4IWNA 4BN5A 2SKEA 4MV4A 3SHFA 2P5TB 3TD2A 2HF8A 1EQ2A 2Y1OA 2ZZKA 4IO1A 2FLVA 3PS9A 4NK5A 3OZXA 1JECA 2E4YA 3DV0B 1DZ3A 1JWBB 1WS6A 2ZWAA 3B53X 3HJUA 3P9RA 4LXUA 5E4TA 2NUTA 1XLTA 2ZRHA 5A4FS 2W7TA 1PJZA 4BLWA 4ITRC 3IOYA 2NAPA 4LJ7A 4DDVA 4KW7A 5K0CA 1PGOA 4EEZA 1AD2A 3BRWD 5FWXB 1R6AA 2G1AA 5KSWB 4EEKA 1V3TA 3QXXA 1M76A 2RH9B 1CJSA 3EAGA 2EKDA 3CNHA 5HSGA 2AMLA 2NU6B 4KOEC 1RWOA 5BOSA 2J3MA 3HYTA 3AL0C 3TLCA 4EJMA 1Z12A 1VPVA 3H1TA 3HS3A 4EO9A 1SOAA 1XEXA 3RFVA 3D3WA 1EVEA 4ZA2A 2M2IA 2FLKA 1EX1A 3Q9NA 3E3MA 5CBPA 4F91B 5HKKA 3TI7A 2J3HA 1I6KA 4YP7A 3WAJA 4HP8A 3WYFA 3ZXIA 3LKZA 2YWHA 5FL7A 3MS2A 3I6MA 2GKOA 2C20A 2ZJ3A 3EF1A 2WB2A 3ZCRA 2R8RA 3BXZA 4EAAA 2H00A 3O9ZA 4Z9YA 4E1AA 1ESNA 2RC5A 1OH6A 4OX9B 2AKAB 4NV0A 2W37A 5ECGC 5FR1A 3BMOA 1RRKA 3DYVA 2REBA 2C9MA 3ELDA 1U2GC 3EGVA 5KUTA 1CLUA 3AR5A 1ZUNB 3CH5A 2FRDC 4RK7A 5D6NA 3WGHA 5IC5A 2P5SA 4JSTA 3HY3A 4GMFA 5H4HA 1AO3A 3VR2D 5KI6A 2AFIB 2CZGA 1NATA 2VHEA 1WB9A 1Z5NA 1IBSA 1SCNE 2VDPB 1ECBA 5DT2A 2OG2A 2PFGA 5K8IA 3U16A 3DE4X 1MIHA 3A4NA 2PQ0A 4HB4A 4YFYA 1YCDA 3HU1A 1F2UB 1IB6A 4GMHA 1PTKA 4C6SA 4LKOA 5T5QA 1Q22A 4O4HA 1S2GA 1SPXA 3D4IA 3ZHTA 5AVVA 5BOVA 1QYXA 2X2FA 2BE9A 4O4IB 1EZ4A 1ZO8A 4QO7A 2SECE 3L02A 3P2JA 1P0CA 2VP3A 3EC7A 1QQTA 1TMOA 3K9FC 2X9LA 5YASA 1FP2A 1E89A 4R81A 1QQ5A 4AICA 1T1JA 2XTAA 3MZ0A 5T4EA 4MPTA 2QRGA 2Z57A 2P9HA 3GXOA 2P5YA 3V1KA 4NOMA 2C8KA 1ESEA 2Q5QA 3DEAA 3GRYA 4A6PA 3AEZA 1Q7RA 1VLQA 1LSOA 3E27A 2F64A 2E4WA 3LOQA 1VZ3A 2JGAA 4BAGA 1DIAA 2VP6A 3RIYA 2EFEB 1LD3A 3TZHA 3WK7A 2XZDA 2I4TA 3DUFB 1Y8AA 1LC3A 4H6PA 3VPGA 5NLLA 1EFAA 1MPXA 3QQPA 1JR6A 3BHMA 2B1IA 4LQLA 1R4MB 1FOEB 2IYSA 1IAVA 3JQCA 2OHHA 3PC8A 4OLHA 3IBGA 5TT1A 2VXYA 1WPQA 3LBIA 5DWVA 1W4ZA 3MCUA 2UYHA 3ADBA 4KN9S 1DTWA 3QWBA 4LWZA 4E33A 2V97A 2ZRGA 3PE3A 1XPOA 3NWOA 2BFEA 1R0CA 1N8KA 4PFSA 4IILA 3BH7A 1FUYB 5MHTA 4D5EA 4MA4A 3FH0A 3EG5A 4ZAGA 3D2AA 1OFUA 1XQ9A 3LYLA 1LBIA 1PL8A 1SA0A 3WP0A 4Q24A 1MG0A 2NSHA 3ETHA 3K1ZA 4NEQA 1QDEA 3ZNNA 4YRSA 3E3NA 5C5DA 3GEDA 4BO5A 5ELMA 2NSJA 3U40A 4AJKA 1NWHA 2PX6A 2JLVA 3OIYA 3HBFA 1NY5A 3ZWCA 2C7BA 2VOJA 5DCYA 2IRWA 4RX1A 5B1SA 721PA 5B36A 4DUZB 3LP6A 2ZM5A 2DQSA 3RUCA 1TZKA 2WV7A 4V0LA 4ESEA 2RHCA 1PF7E 1SIBE 1P29A 2AR9A 3W8FA 5GJBA 1Z4OA 1Z5GA 5IAGA 3UGTA 1U3VA 2JCYA 3QKTA 1RQPA 3ICOA 3PGLA 5FI1B 2VPWA 3PDIA 5ALSA 2G5PA 4K05A 4X44A 4NS1A 4IQFA 2O5CA 2ZB2A 5ALEA 4ZDJA 3RC7A 4ZK2A 1JG1A 3DVSX 2OK8A 2HREA 2OBNA 1HLPA 3AIMA 3DJFA 3ZI0A 1IUOA 2ZDQA 1W52X 5JAOA 1NNUA 2OPBA 2M6KA 4BGEA 2QW1A 4EG4A 2PFKA 3VR4A 4PRLA 5DN6D 1JEAA 3COYA 3T4XA 1WO8A 1GKLA 4FKMA 4KO8A 4QVGA 4CMAA 2VP2A 1GV1A 3MTGA 2OORA 3KD2A 3VBEA 4JCCA 2D0DA 1W96A 5AUQA 3B82A 5IARA 3D6FA 4K9QA 1G98A 1QK5A 2P7IA 1MPTA 3N87A 3ELBA 2XQIA 3R09A 1NJ5A 1KFCB 4W6QA 2P9TA 2FA9A 1JH8A 3TGWA 4FFMA 1UBMS 5LUBA 2HRQA 3K0AB 4C43A 3T7DA 1FTWA 1X7YA 3GJXC 3NBAA 1UPTA 4ND6A 1JEJA 3W2HA 4ZO7A 2DPHA 4EFLA 3WGIA 1J06A 1ZJ5A 2ZWVA 4O1HA 5EY5B 3O2QB 5CHYA 1M34B 3K8YA 5E2BA 3ESYA 3ZDXB 3QUQA 1D2HA 2OCAA 3LF1A 4KQXA 2ZJAA 1NVBA 5LZ8A 2L69A 1K4YA 1ZWKA 4QJ3A 1W4CA 1YCFA 2RGAA 5HOQA 1UZAA 3ML1A 1FFDA 2H31A 4EQZA 1U9IC 1AKRA 2ZRKA 4I5IA 4PAOA 4WY2A 1R8SA 3T7JA 5AKIA 5KWEA 3UMGA 2QD3A 2D1SA 1S3GA 2AR7A 2GCIA 2GZSA 4ZU6X 3JCZA 3FMGA 3OPYA 2QLMA 2CXTA 2YYZA 2A9KA 3SLRA 3L7LA 3AI1A 4BMZA 1NTOA 3ZEAA 2ORED 3QXSA 4XTRA 3SVTA 2FXVA 4XIJA 2OHOA 3A6GA 3PK0A 3ZNPA 3UMSA 4PZPA 2QTBA 4HLDA 4R2JA 2J6HA 5AWFC 3VUEA 2HSDA 1LUAA 1Z28A 2XODA 1A8UA 1R5OA 4GC5A 4J03A 2CHVA 2WUGA 3HR4A 3FOWA 5CCBA 5P21A 3R7LA 3IVGA 4DKJA 4GGPA 4U2DA 2EX4A 3MLBA 1ADGA 4JK3A 2X8AA 3X2EA 3ZWQA 1AK1A 1X7ZB 4AM8A 5G0VA 3TTYA 1IAQA 2P1ZA 3HP4A 4IIEA 2OCLA 1EM8A 3H0EA 3U26A 4M7WA 5EZYB 3JWPA 2EFDB 4KTVE 4KLAA 5ILQA 1REQB 2ZROA 1V7PC 3BMXA 3QUTA 1D8AA 2BUAA 3VSBA 1T25A 4UZSA 4YP5A 5M04A 4IRXA 3LQ4A 3AKYA 3HGMA 4IH9A 3HA3A 4AZWA 3OE5A 5JD5A 4RDCA 1A5AB 5EXPA 5JCOC 4YUXA 2OXEA 3B1FA 3H2ZA 5F76A 3SC2B 4LS3A 3K31A 4QU0A 2BFNA 3IP6A 3O03A 1EDDA 2JI9A 4LCBA 1PFKA 3AVOA 3EVNA 1WX1A 3NAZA 4Z49A 4ZKDA 1XRNA 3A36A 1NVVQ 2NPIA 1T34A 4GQIA 3N70A 4CMHA 4KMSA 1J0CA 2BBTA 1AZSC 1P1HA 1NDUA 2WBLC 4R8RA 5AICA 5HCIA 5BN5B 1Y8QA 1VM6A 2PVSA 2V0CA 3LC0A 4GPZA 1WP4A 3PEUA 2GBLA 4IXWA 1DS6A 4CDGA 4AF8A 1ENOA 5J4KA 2XGGA 1XYVA 1JLRA 5FL3A 3R5TA 4GI2A 3QPAA 1MV8A 1J39A 1MEOA 2JH8A 1NN3A 3QENA 1N2IA 2IGBA 2ZJ4A 3NFYA 1GPLA 3VR5A 2JA2A 5EHZA 1KEPA 1OZFA 2JVJA 4M1EA 4YXFA 4KACA 2XVAA 3U39A 3LRXA 5JMPA 3DKRA 5E7MA 1W0CA 1WAMA 4QOHA 4YREA 1CUZA 4ZC1A 2QTFA 3VTZA 3E5RA 2ATCA 3QIAA 1DX6A 2XYPA 2J07A 2QK4A 4PXSA 2GHIA 4RDHA 1GLGA 4MW7A 1B6RA 1YR6A 1OHHA 2WZBA 3FNFA 4G1CA 4Q9DA 4XWYA 4IJQA 3NH9A 4BMSA 3WWYA 1YKSA 3I1FA 2RSLA 4OQDA 4GM0A 4XJTA 5AM0A 2VK8A 3WNZA 3X2FA 2D4HA 4FBGA 4XCQA 5DYYA 5AM4A 1SBCA 2IELA 3C3KA 3ESBA 2QBYB 4AXBA 4BJ3A 1C30A 1KL7A 5EXTA 4MYTA 2GEVA 4WCFC 3GVHA 4JJ6A 4HNHA 3KYBA 1U0OC 2R3SA 3S2GA 4GMDA 5A7HA 3SCZA 4HVLA 5KX5F 4I3GA 4QASA 4BKPA 1S2LA 5JEDA 5HNKA 5I48A 4NBLA 1Y9JA 5IVPA 2J6CA 2I4OA 3PQ2A 5ALFA 3FKQA 5BSFA 1KS9A 1RWXA 4OL0A 3ADOA 4YJGA 1OLOA 4XM1A 3N7AA 1R0WA 2ILVA 2A5JA 4ND3A 1QK4A 4N8DA 4P32A 1JEOA 4PANA 5GMOA 1ZM4A 4Q3BA 1L4GA 2DYKA 3ZCXA 4AQ7A 4RD6A 1L9XA 3PGXA 4B87A 1SCIA 5C35A 5HR5A 2M1XA 1Z7BA 4M0MA 5BW6B 2AXQA 2V03A 4X8HA 4C6TA 3ER6A 3GP5A 2ADMA 2P4UA 4LYDA 1R5JA 4OHPA 3WKEA 1N2HA 1XKLA 2XBLA 3PJEA 4MDHA 2VTDA 4U6SA 3VDNB 4DCTA 4DADA 3EXHC 5LKAA 2PCLA 5AKGA 3K0BA 1NVAA 2ROQA 2OHJA 1PR9A 1DO2A 1RI4A 3PD1A 3R7SA 4AK9A 1AKVA 4O0LA 4B7CA 1L7PA 1ICIA 4HGQA 2N9UA 3KZKA 1RQ7A 1U0TA 5JCXA 1OY1A 5ESXA 3NMUF 3U62A 1VJTA 3I6YA 3VU9A 1N5OX 2B30A 3W3AH 4ABTA 2QX8A 1J99A 2J4DA 3KU4A 3EW7A 4MS3A 2FVXA 2DT5A 3IVAA 3GQBB 4IX1A 2C31A 3MAGA 2XECA 1O95A 5JCPA 2SCUB 2QTGA 4YJ2A 5C8YB 3K4QA 5EERA 4F0JA 5BPHA 4YASA 1CY1A 2B8JA 1E59A 3EXEB 2CUNA 4WBNF 5JFTA 3E05A 2PX5A 3H4TA 3LOUA 1EUCA 3R44A 1NPYA 1RM3A 3DLPX 1W94A 3T7IA 1UMBB 1WABA 1ZJJA 2A67A 3C5VA 3D4OA 4G97A 4Z5XA 3KUUA 5KTTA 1FXWF 1UZMA 2VEDA 2VP5A 1S3SA 4HPWA 4GICA 1MQ8B 2PZBA 1G291 4N5MA 2QPTA 5CVEA 4KVGA 5FBZA 1E7SA 4OXNA 2CLIB 5I5GA 2Q3BA 1N9KA 2GD0A 3KR9A 3I1YA 4JJ8A 4LHYA 4NR0A 4QUGA 3RODA 6PFKA 1R4ZA 4GZ6A 1F4LA 3WJ1A 1BO6A 4FW8A 3U44B 4I4CA 4EABA 1NUUA 3PWZA 4MUEA 1RD4A 4F3YA 4PPFA 4TTIA 2D2EA 1AB6A 1SVSA 3SSNA 4BBJA 3AEKA 3R5XA 4C04A 2Z0MA 5F4ZA 1FU7A 4HF7A 4Q3CA 3LPLA 4PYKA 1CEEA 1QR6A 3G7UA 4CF7A 1D9XA 5BNFA 1DKNA 2WMOB 5IDQA 1GWNA 5THQA 2OYRA 4AS3A 3F6YA 2VF8A 4LDJA 3BKXA 2R11A 3IPLA 1K9SA 4K2HA 3ZCUA 5HE9A 1NYLA 4O29A 2O2XA 1L5RA 2X0IA 2Y67A 3CS3A 3PXCX 3SJUA 4QYWA 1W0JA 2O1XA 2Y92A 4MUXA 4HTAA 3SSMA 1NC1A 4H7KA 2EYUA 3W78A 2PXXA 1UZNA 5BWCA 4R3NA 4HRXA 4LJRA 3M5WA 1CF4A 1TECE 2GPAA 3MT8A 4LQCA 2WINI 4DJEC 5LB4A 2XQGA 4YDRA 2BGNA 2W00A 2X58A 5B55A 2XUJA 4CKBA 5FTKA 3N07A 2YWDA 3TQIA 4ZOQI 1SBYA 2WUFA 5HQJA 5K51A 1PNOA 3Q0TA 2HV8A 4UFNA 5GWXA 3TG8A 4REMA 1YL5A 2W2TA 5MGNA 1GXSA 3NM5A 3KYDA 4TTSA 3V7YA 4YLYA 2B5VA 4PYJA 3WGOA 2WP0A 1H4QA 2X3FA 1AV6A 3NC0C 2FSPA 5LMZA 5EJGA 2RKWA 4ZFNA 4N6NA 5T3YA 4TMZA 5EE3A 4B17A 1MMFB 5B58C 2XUDA 1YS2X 3BMCA 4BIMA 3EIFA 3JQGB 4K2AA 3DVLA 4Q02A 4A2WA 2VYCA 1E4VA 3OTQA 5EKSA 3FYCA 1CUWA 1ZISA 3UGJA 1A0OA 5EWJB 4KN6A 3KEMA 2IDMA 1PWYE 1G4HA 1WSAA 2JK1A 1YBMA 3FW1A 2HYDA 1F1BA 2P9CA 4EMUA 1WUYA 4E15A 2FUG6 4YMSA 2HLDD 1YR8A 2AE2A 2BT4A 3L4SO 1X70A 3A32A 3CEMA 4MW1A 4PX2A 3G7NA 1PBNA 1C81A 3GPLA 1R0YA 4LDZA 2WLTA 3QKIA 4ZOCA 4D0NA 4YAJA 5AVWA 1M8JA 1ZC3A 1QOZA 2P1RA 3FSGD 1WZEA 4U2GA 4WAUA 2HHHB 1N4DA 4RL6A 5SV2A 3MGCA 4JVLA 2A9PA 3SF8A 1XTSA 4O1MA 2I7CA 3ZJYA 3JQAA 1OV4A 2H4XA 4IEEA 3MUEA 1F0KA 1QCZA 4LDRA 4WZ6A 1H2RS 1F48A 4AKTA 2WD9A 3LYHA 4M6WB 2I03A 1QOQB 1POWA 1MKYA 1FFGA 4BVGA 3S6JA 4IJUA 1E0SA 4WJZA 1VP9A 3LTNC 1MZVA 1ZG3A 2J48A 4H7JA 3PE6A 1ZXLA 4C7OB 1G20E 3KXLA 2EGHA 4L4YA 4C4AA 1KYWA 3ZOKA 5DBIA 3H2JA 1TUIA 5HQ3A 1ZY2A 5I9BA 5KJFA 1Y7HA 5KSPA 4B6QA 2W9XA 1IZ8A 4FZRA 4BLOA 2ORIA 2QL9A 4JLJA 4L51A 2JHPA 3ZV5A 4BTLA 4JWKA 3RYIB 1CUEA 4RTLA 4PSVA 1FMLA 3D3QA 4F4HA 3ME5A 4C4PA 5A5VA 4MHTA 1Y81A 2JFBA 1E0KA 3BL8A 4OB7A 4QOEA 2FZLA 1Q11A 1ZW6A 4WXYB 2G4CA 1XHLA 2IYPA 3TECE 4HX9A 2AFRA 3CE9A 3HDYA 1UKAA 2CMDA 2DHEA 2O19A 4ZO6A 1WM1A 3ORRA 1A9XB 4YAUA 3NTXA 1KIFA 4HB0A 2IEAA 2VLIA 2PD4A 4ROTA 1SVNA 3P2MA 1V47A 3DLAA 4NZOA 5LQSA 2AC7A 2ZBPA 2YICA 3LQKA 2XMZA 1PKXA 4I99A 5DTJA 4GKBA 3QNUA 1C3LA 4U7DA 2VNSA 3IUQA 3UICA 1FDTA 3W5VA 5CNMA 1N6LA 2GPNA 1CNEA 1I2MA 4FLMA 4N5HX 4S1WA 3OM8A 4O2AA 2JFFA 2QT1A 2WYWA 1QAQA 3WLJA 4LYAA 4MTLA 2X0KA 3HSKA 1W30A 2BDTA 1GAEO 1OUMA 3H83A 4EQ6A 4ZEOA 4J2HA 3KETA 4JBIA 4TT3A 1G59A 2EP7A 1KR2A 1GL6A 2FUEA 3M4ZA 5BV0A 1OB2A 4DA4A 1WB5A 5D87A 1GRRA 5K8UA 3C3EA 4YTEA 2QUIA 2WUVA 3B60A 2GD6A 1OJLA 3QEMB 1Q0LA 4PSCA 3WDLA 3ZIAD 2GAFA 1NW7A 3JS5A 4QFMA 1SUBA 4PYOA 3G8DA 3RVOA 1RXIA 2H0RA 4V0RA 4RYLA 3MNFA 4TTRA 3VPHA 1F60A 2ZIXB 4G0QA 3TZBA 2F00A 1QHNA 1E5XA 4MS4B 5CHEA 4RU1A 3IBSA 1EH5A 1H2ZA 1YZFA 3DF7A 1VYUA 2C9CA 3FDJA 4Y18A 5KTSA 1NAIA 1V4BA 4OXIA 1M2WA 3OCJA 5AUPB 4MKIA 4DEYA 1LSSA 1V26A 5DN9A 1KE2A 1FVHA 3D7LA 1T8RA 4BVFA 4UE2A 2G06A 4RORA 3LXMA 1KKMA 4R69A 2BHSA 1I5EA 3AVWA 2E85A 2F1HA 1CJVC 2BGTA 5IMBA 3NU1A 3NLLA 4ML3A 1THTA 4QDJA 1R0KA 5GONB 1SKUA 4QWMA 4TL9A 3U60B 4PYRA 5TLSA 1GSOA 3L6OO 4Y1EA 2D4AA 3DMRA 1QHFA 1SZDA 5E7JA 2JAWA 3RANA 2P9EA 1QH8B 1KE1A 1J9ZA 5DK6A 5H16A 1IUKA 4AYTA 2NO5A 5BXYA 1TZ2A 3WNVA 1NI4B 2X86A 4FFSA 1XTPA 5A3JA 1OZAA 3BDIA 2Z98A 3FLAA 3UM9A 1V16B 5BMOA 3GDOA 1TEVA 1H69A 1Z17A 2DR0A 2GYYA 3G8AA 1NT2A 5LQAA 3G17A 2XMBA 5G3YA 2WRZA 3IRUA 4KR6A 3QU4A 5M7EA 1R6BX 4UTVA 4R3WA 4E21A 4TUYB 2OT3B 4ED9A 1DC8A 2YIDA 1VCNA 3SPXA 1CVIA 2O3SA 4MSUA 3RYFA 4ALJA 1UDRA 3PFWO 3U49A 5LA6A 1TAQA 1UBOS 3U0VA 2Z5LA 1CG6A 5DEIA 1XTQA 1T5TA 1Z5OA 2BGKA 2BKEA 3SGLA 2L2QA 4LZZA 5CD1A 3LX5A 4RKWA 3S1AB 2NVBA 1P5FA 4EPXA 2WVJA 3SXPA 2PRYA 3UK1A 3BERA 1KMQA 1B26A 1Z4KA 4R7GA 1WPRA 4Y6GB 4NZ9A 3TL6A 4RTJA 3A31A 3LW7A 1DLIA 3STWA 5CCEA 3I9V1 4CHTA 1JFFB 3HXMA 3FX2A 3WYNA 2AVNA 2RGXA 4JDPA 4Z0PA 4U2FA 4CDRA 1OX6A 2B8TA 2C4WA 2GKGA 3OTHA 4ODIA 1IVYA 3UHAA 2FDCA 4Y9TA 3SYTA 3IMCA 2YJ5A 4O1IA 1Z35A 1RWQA 1TPZA 2C88A 4M88A 1RM0A 1FS6A 3D8TA 3WV5A 5FL7D 5CDYA 3I61A 1QX3A 1XX6A 4KWHA 1G9XA 4RE5A 2WU3A 4BNWA 4PYQA 1YS9A 2HQOA 2Q3LA 5AI9A 4Q66C 4CM6A 1FVFA 3QEAZ 1P75A 4P5EA 3RYTC 3EPHA 4TVBA 4J75A 4BL5A 3I9FA 3O8CA 1TAGA 3AG5A 2PZKA 4QM6A 2L0XA 3MEQA 4QELA 1KDZA 3H5OA 4E0BA 4XVCA 2XUIA 4BX9A 1W88A 2Z2KA 2V58A 2ZBGA 3BWBA 5KNLA 2FZKA 3HO1A 1CRPA 4FKZA 1EDZA 3HCPA 3O3MB 4C76A 4FCTA 1FMCA 2LKCA 3BBLA 3BF8A 2G9ZA 2ZI7A 4M9XA 5E3JA 3U17A 1ONNA 4MVJA 2Q29A 2RH5A 5ESWA 1D2NA 3VVLA 4F9EA 2Q5IA 4NE2A 2CXNA 5AXBA 5B7NA 4KV9A 4EIWA 3MINB 3IP7A 4DTIA 1D2RA 3SDZA 4OCZA 3OLCX 3EBOA 3TRJA 2RKBA 1J9EA 3MBIA 4ZI7B 1Z3CA 4A91A 2QW0X 1GUBA 1MAVA 1E9FA 3BEDA 3E4CA 3HA2A 1C7RA 3KSMA 1JR3E 1OI2A 3M5CA 3P94A 4UPDA 2WG1A 3LUAA 4KLCA 4WOKA 4XGNA 4KLNA 5IMSA 1RC8A 1UBHS 1YJCA 2HLNA 2HPVA 3FCYA 2XAUA 2EFJA 5IF9A 4KAAA 7YASA 4W99A 1FLAA 4K6CA 5ESRA 4G23A 2HWYA 4QUKA 1KDYA 3QLUC 3DBHB 3DZBA 1G5HA 2R87A 2XSZA 2E5FA 3OKCA 2VTBB 5FUXA 2PT6A 3I05A 3PI6A 3T4PA 1OFTA 1VLHA 1WULS 3CNEA 1FPQA 1UBEA 3CPEA 4OGWA 4OQXA 4PGAA 4ZOEA 3I0ZA 4NJMA 2BF4A 3R3VA 4X95A 5E6SB 3RF7A 3WXMA 5IWAB 3DT8A 4CQLA 1AB5A 3X1WA 2DFVA 5EEGA 2PSDA 2FQYA 3ZHYA 3DPIA 4DB4A 2I7TA 5KJEA 4A2CA 2GTHA 2FW6A 1G18A 2DBZA 2PRSA 3W5JA 1DOZA 4M0KA 1RSZA 3JVEA 4IRUB 1PJBA 3PV0A 1EG2A 3ENWA 4HN2A 3EA4A 1DE0A 1JL3A 2Z3ZA 4KQCA 2E2WA 1VYHA 2IT1A 4HNRA 4MHOA 1VMIA 2YV1A 2VCEA 4L5CA 2OO3A 4R7ZA 2VDWA 4U4AA 1FDOA 1UEJA 3RQIA 4ESOA 4YAKA 3Q9SA 3A6LA 5M34A 1YJ8A 2YC4C 3Q15C 5AI6A 1N7GA 1KNQA 4NZYA 3D1JA 4BVEA 4Q9IA 5C3MA 2HUNA 4JKYA 4MUJA 1YWGO 5E2IA 1JHRA 2P2GA 5BSVA 2I7XA 3SQNA 2VG8A 3DEJA 4D6PA 3LQQA 4Q4LA 2WAOA 3DD1A 5F77A 5CFLA 3SLKA 4YFVA 1YF3A 4OK3A 1HFKA 1H0SA 3KT8A 1CDZA 3PYMA 3PTZA 4FFLA 3DAYA 4TXMA 2NT4A 3AVPA 3DAPA 4D9JA 2GLUA 5JZOA 1N2SA 1O1YA 3PJFA 4JJ7A 5IDWA 2NTNA 5K0TA 4AS1A 4B6JA 2GWHA 1RYHA 3FVVA 4K8OA 2PV0A 4Q7EA 1QU2A 1ZD1A 2II6A 3NHRA 4JGIA 5DZSA 1AGXA 5ICGA 1H22A 2CJYA 3DWEX 2DXIA 3P9YA 2GEDA 2PJUA 3V97A 3KZOA 4B82A 5IF3A 4IIVA 5LMNB 1E60A 1VA5A 4J90A 5TPWA 4RFSA 4RYDA 1K63A 4XX0A 1PWZA 2JHAA 4M53A 5LSAA 1QSGA 4UARA 1IZ7A 1QGOA 1LV7A 3ZGYA 1E94E 1IEXA 3EZFA 1RWBA 3VR4D 4AF7A 5A6SA 1ULZA 2C61A 2G72A 4RAQA 4ZEWA 2C7GA 2B35A 5F1PA 2X13A 3EHEA 3FJOA 1CZNA 4XQ0A 1Z9BA 2FOLA 3QYAA 4IXDA 4XLLA 5AIAA 3OFSA 4YAFA 3CR8A 4PZZA 2Q0HA 2CJXA 3KJEA 5KC8A 4OPMA 1S9DA 3VPAA 1LRKA 1M1XB 5HFAA 2XMDA 3AKDA 4I6GA 3EBLA 4GMXA 4AZ0B 4BZXA 2WJVA 5CA1B 3OQHA 2A5DA 4PCVA 4RMIA 3HL0A 4NFSA 4UUBA 2A30A 4F6RB 4EJFA 3QTBA 1XP5A 3QYPA 1YS6A 3EIXA 4IKOA 4LJ9A 1BHO1 3N2GB 1XZBA 3CN9A 1EWTA 3GUUA 3ZIUA 2GHQA 1RYZA 4J91A 4N8EA 3U9SA 4ISBA 4EBBA 4P93A 4CRWB 4DR1B 16PKA 1MJGA 1U3TA 2H54A 2HRRA 2PO7A 2JZNA 1JVBA 1VLMA 4B1FA 1Q0TA 2IYOA 4ND8B 2O2HA 1DUVG 3CSSA 3MD0A 5EWMB 1IZ9A 3RK1A 3PDUA 4ZYUA 3D6UA 3LVBA 3FLMA 4Y9DA 3UYKA 2CLCX 3GROA 3WB9A 3L1JA 3SS9X 4X1KB 1GDTA 1RJDA 2B5WA 4KXYA 1VA4A 3BCSA 2KE5A 3DKIA 4DIOA 2V5UA 3L7JA 3MLAA 1IM8A 3INTA 4JP1A 4RZHA 2PRJA 2ZOSA 3ICCA 4YAWA 2J5KA 5DGDA 5ALRA 4ZYWA 2ZZNA 1EG7A 2CXXA 3N76A 3FYDA 3H2IA 3H86A 3TVDA 1WDLA 3IE0A 3RI3A 3M4YA 3WLEA 3S2YA 4KV7A 1VJCA 3EGDB 1B15A 5TF0A 4N41A 1G5QA 1A77A 1K86A 2FSUA 2JNWA 4R54A 2PKXA 4F3CA 4RTRA 2Y4NA 5LVAA 2WD8A 3ACDA 5HK8A 3FKSD 2YNMA 1DWUA 4L3OA 3RGGA 1U0JA 2PSFA 4QARA 4WA8A 4YT2A 3JQEA 3LAWA 4R0NA 1CPYA 1NW8A 4QFBA 1KVUA 5KTKA 4M1YA 4OYYA 2IYRA 2OGWA 1Q1NA 3GNLA 1X1QA 1Y9ZA 3JZDA 4U9UA 3RSFA 4A6EA 4E5DA 4EENA 2B1RA 3CX6A 4K5QA 1AV7A 2UVPA 4JELA 5FQOA 4Z4EA 4OUDB 1MD9A 1NM5C 1C0LA 2I6SA 3GH3A 1DNPA 3DULA 3KXKA 3RVKA 4Z4QA 1R4NB 3TSZA 3CF6R 3SVLA 4U9IS 2Z6QA 1M6VA 4WRRA 3THWA 1QIFA 2WQ7A 3R41A 3VQTA 3MXTA 4DMFA 4QT0A 1KKUA 2BCEA 4CMCA 4MP6A 4E12A 1HKHA 3O73A 4UOEA 1RPZA 1DARA 1NQ5A 3HGQA 5EINA 3VC1A 5MGBA 2Q2QA 4AJ9A 4BB6A 3W6NA 1RC0A 2P30A 4NESA 5AIBA 1QIJA 1NI3A 4CLRA 2Z95A 3LCJA 3DGFC 4N40A 4BMOB 3KZ1E 3KKZA 2QN8A 2WQZA 2HLHA 3BIOA 5JD3A 3OJCA 3A3PA 4AZ3B 5IFKA 4S05A 2JAXA 4MYRA 4LZLA 1J2TA 3VKVA 4BVHA 3RC3A 4P7BA 1O0BA 2R9VA 3M9WA 1FY2A 4X45A 4UM5A 4V0NA 1SXIA 4FXPA 1CUGA 1BMDA 3HKEA 4H7FA 2GDJA 4HS4A 3I52A 3DFFA 5FAXA 2NXCA 3BXXA 4HX5A 4OHXA 5FP0A 2BPOA 1JHMA 3BB3A 1CSEE 3T3DA 3U3DA 3OJOA 1HE2A 2R0QC 4P3XA 2BGWA 1KWGA 1P73A 3JRXA 4GLJA 4LNHA 1CUVA 4JNCA 1SUDA 3GPBA 1A9RA 1RXEA 3KV3O 5FO1A 3WRVA 4B5LA 4EDHA 4ZYZA 4BNLA 4BO6A 2R1TA 2P40A 4OJYA 1RYFA 5DT9A 2VYFA 3KXIA 4UTZA 3R5SA 2BR4A 3PQCA 3HFJA 4H6XA 3I12A 2BFBB 4OMCA 2EDCA 3LY7A 4X94A 5JJKA 2EEPA 3A1CA 3G79A 2V7PA 3PVSA 1YD7A 1Z0KA 1OBFO 3EVEA 1Y3AA 1B8OA 1FVOA 3ASZA 3O75A 1N6KA 3GFFA 1M5RA 4EKDA 2Y0DA 3LUPA 4TL7A 4EP1A 2J0UB 1UMCB 1SK9A 1P5HA 5C5CA 4BGVA 5CBKA 1U2TA 1DIBA 2GPBA 1ISIA 2P3OA 3Q3VA 1QE3A 2A6PA 4UC0A 5FT9A 1R6VA 3C24A 4KGZA 5B58T 1WQ1R 2P2LA 1YTUA 4LZWA 3AOEC 3FOFC 2LRHA 1XTTA 4GGOA 3W05A 5GJWC 1KBQA 4Q3DA 5GZ1A