1KRMA

Crystal structure of bovine adenosine deaminase complexed with 6-hydroxyl-1,6-dihydropurine riboside
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
349
structure length
349
Chain Sequence
TPAFDKPKVELHVHLDGAIKPETILYYGKRRGIALPADTPEELLNIIGMDKPLTLPDFLAKFDYYMPAIAGCRDAIKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVQAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDTTLYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of bovine adenosine deaminase complexed with 6-hydroxy-1,6-dihydropurine riboside.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords adenosine deaminase
total genus 118
structure length 349
sequence length 349
ec nomenclature ec 3.5.4.4: Adenosine deaminase.
pdb deposition date 2002-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1krmA00
2R1LA 2VM8A 3MSRA 3PANA 1RA0A 1YNYA 2Z7GA 3S4TA 4C6PA 4JOMA 4CEUC 1ONXA 1FKXA 4C6CA 4LAOA 4H9TA 1XRTA 4AQLA 3TN3A 2OOFA 4BKNA 4UB9A 4ERIA 4IFRA 4HK7A 1RA5A 3IJ6A 3QY6A 4CNTA 3TN4A 3BE7A 2PLMA 1M68A 3HPAA 2PAJA 4XAFA 3PNZA 4KQNA 4GX8A 1YMYA 4G7EB 4LCQA 2EG7A 2Z29A 4C60A 4M51A 4WHBA 5LXXA 3F2DA 3MTWA 1FWJC 3NQBA 3F2CA 3LSCA 1KCXA 5FSDC 4C5YA 2FTYA 2QVNA 1W1IE 4QTGA 4PE8A 4IG2A 1EJUC 1PSCA 4C5ZA 1K70A 2FTWA 4LH8A 1A5LC 4KEVA 2Q01A 2HQAA 4LAMA 1GKPA 2BGNE 4XD4A 4L6DA 2Z25A 3CAKA 4L9XA 2OGJA 1POJA 4IQJA 2PUZA 3S2JA 2QS8A 2OODA 4C6BA 3AUOA 3URBA 2P50A 4GX9A 1EZ2A 3IARA 2HBXA 1WXZA 4KEUA 4KIRA 2KAUC 4J5NA 3GUWA 1R9ZA 4KESA 1EJSC 1IE7C 3S2LA 3E38A 1POKA 3IV8A 2Y1HA 1EJRC 4ZSTA 1YRRA 3OQEA 1FWFC 3JZEA 1QXLA 1E9YB 3EWCA 3MDUA 4TQTA 4UBPC 2DVUA 4QS6A 2I9UA 2GWGA 3QY7A 2VC5A 4RDVA 3O0FA 4C6NA 3TN6A 2Z27A 1VFLA 2O4MA 3OODA 3E0LA 4XD6A 2VR2A 4H9XA 2PGFA 1A5KC 1GKRA 2UZ9A 3T8LA 4DI8A 3A4JA 4F0SA 1EJVC 1KRBC 3URAA 2D2GA 1NDWA 4G7EA 4BY3A 2ADAA 1V7AA 3B40A 3GIQA 4CQCA 4EPEC 1UBPC 4INFA 1ITUA 1XGEA 4B3ZA 1DPMA 4XD5A 1FWIC 3MVTA 3SO7A 3CS2A 4C6MA 3QGAC 4GOAA 2W9MA 3RYSA 3LSBA 3EGJA 3UF9A 1NDVA 3T81A 1A4LA 3T1GA 1PO9A 1FWCC 4C6KA 5HMFA 2Z2BA 3TNBA 4C6EA 4H9YA 3GTXA 3V7PA 3E0FA 3MJMA 4IFKA 1XRFA 2QPXA 4IF2A 1FKWA 5CH9A 3UR5A 3K2GA 2F6KA 3D6NA 1FWBC 4DI9A 5HMDA 3ORWA 3E2VA 4XAYA 5G4HC 3F2BA 1RJQA 4B92A 4H01A 2Z4GA 3DUGA 1RK6A 4NI8A 3UPMA 2WJFA 2ANUA 4GK8A 4RDYA 1R9XA 3UR2A 1M65A 1YBQB 4MUPA 3UBPC 1ONWA 1J6PA 4H9UA 3CJPA 3ISIX 4KEZA 3LA4A 1YIXA 2Q09A 4ICMA 4PBEA 4D8LA 4V1XA 3URQA 1FWGC 4H9MA 4KERA 3R0DA 4NG3A 4R85A 3WYZA 4IH3A 1J5SA 4V1YA 1JGMA 3DCPA 3LGGA 1RK5A 2FFIA 3MPGA 2WJDA 1V51A 4RDWA 2YB1A 4DYKA 1ADDA 1WXYA 4LAKA 2A3LA 3A3WA 2Z26A 4IFKB 2G3FA 2DVXA 2O4QA 2UBPC 3LS9A 1HZYA 1R9YA 4H00A 3GTIA 3GTFA 3URNA 4I6KA 2R1KA 3PNUA 2R1MA 3RCMA 4XD3A 3OVGA 4KETA 5AKQA 3C86A 1A5OC 4EP8C 2ZC1A 3SFWA 3G77A 3IGHX 3TN5A 4CQBA 4G2DA 3LNPA 1RJRA 3RN6A 3O7UA 3FDGA 2D2JA 4HA0A 4IG2B 4WVXA 4PCNA 3ICJA 2EG6A 4ERGA 4QS5A 2GZXA 2WJEA 1FWDC 2D2HA 1KRAC 2AMXA 3OOQA 3GIPA 4C6IA 4Z42C 1V4YA 3K5XA 1V77A 3GU2A 3IRSA 3DC8A 2WM1A 3FEQA 3EWDA 2AQVA 4LCSA 4DLMA 3HTWA 3F4CA 3LU2A 2E25A 1J79A 2PGRA 4GYFA 4QSFA 4KF1A 4WGXA 3ITCA 1FWEC 4OFCA 4XAZA 2HPMA 1K6WA 4R7WA 3OU8A 2IMRA 4PCPA 4LFYA 1P6BA 2EG8A 4DZIA 2HNHA 3A3XA 1A5MC 3FDKA 3OJGA 2XIOA 4F0RA 1E9ZB 2GSEA 3GU9A 1NDYA 2HBVA 4CNSA 4C6QA 3NEHA 1S3TC 4EPBC 2VHLA 1UMLA 3NURA 4GC3A 4RDZA 4YIWA 1EJWC 1FWHC 1NDZA 1O12A 2R1NA 4BJHA 3GRIA 2BB0A 4C6FA 4IFOA 4GXWA 4R88A 2YB4A 2RAGA 2AQOA 3F4DA 4HJWA 4P5UA 2DVTA 4F0LA 1XWYA 1UIOA 1PB0A 1J6OA 2VC7A 1M7JA 3LGDA 3ID7A 1V79A 1K1DA 4DIAA 4LEFA 1NFGA 4B91A 4CNUA 4C65A 4QROA 1PTAA 4GY7A 1A5NC 1ZZMA 1GKQA 2E1WA 1ITQA 1P6CA 4LANA 3S2MA 2Z24A 2FVMA 5FSEC 2Z2AA 3E3HA 3GTHA 4NP7A 3K4WA 1QW7A 3WMLA 2QT3A 2GWNA 4J2MA 3E74A 4QRNA 2YXOA 1I0DA 2Z28A 4H9ZA 4DNMA 4XAGA 4ZSUA 1P1MA 4RZBA 4I6VA 4PBFA 1FWAC 2CZVA 2HPIA 5E5CA 4LALA 4CQDA 1KRMA 2FVKA 3IPWA 4GZ7A 5A6TC 3AU2A 4GBDA 4C6JA 1RAKA 3IACA 3PBMA 3B0XA 3GU1A 1EJXC 1YBQA 3S2NA 2OQLA 3GG7A 4GY0A 3WZ0E 4CEXC 3HM7A 2OB3A 2YZ5A 4C6LA 4J35A 3MDWA 4HK5A 3LY0A 2R1PA 4AC7C 3N2CA 4ERAA 4GY1A 3KM8A 4IGMA 1EYWA 4IGNA 4LCRA 3AU6A 1KRCC 3RHGA 1RJPA 3MKVA 4C6OA 1BF6A 4E3TA 2Z00A 1EJTC 4HK6A 4DO7A 4RE0A 3MVIA 3QY8A 4B90A 4DLFA 3PAOA 2P53A 2VUNA 1O5RA 2ICSA 1UIPA 4C6DA 1A4MA 2I5GA 4DZHA 2GOKA 3QGKC 1I0BA 3B0YA 4EPKA 5HMEA 4H9VA 1EF2A 4EPDC
chains in the Genus database with same CATH superfamily
3MUXA 2BX7A 3JRKA 1HG3A 4PFMA 1RA0A 3S4TA 3SCPA 1E5NA 3MZ2A 4JOMA 3RXZA 1KR1A 1FHVA 1MXGA 4FXRA 3MUIA 1E4LA 4Y90A 3UZ5A 4UMCA 4UOQA 5CPSA 4XAFA 3PNZA 1QNRA 4NJHA 1A80A 4KQNA 4G7EB 2BV9A 2WV8A 3P82A 1YTEA 5HPCA 4RZ4A 5CQ1A 5IDZA 3EWYA 1HQTA 3PUDA 4D9PA 2B7PA 1TFVA 5M1TA 4JTEA 2ZUSA 1L6SA 1R46A 2J7DA 2PP3A 3V3WA 4KT2A 2CZDA 3HN3A 4XSLA 2PUZA 4L4PA 3H54A 4QBXA 2Y7FA 2P50A 3KAOA 4AEOA 3P81A 1SO5A 2WSYA 3JVAA 4JKKA 3E38A 1O6IA 2R14A 1UC4A 1VBRA 3P93A 1E0UA 5HNRA 4LS2A 2Y4SA 3CV1A 4DJDC 3DFOA 3K4AA 2VEFA 4EAMA 3EWBX 4KRUA 2QLYA 1EWEA 4BI6A 2QMJA 1JZ5A 2ZRZA 3U2EA 1EO5A 3AZRA 2ZX8A 2ZZ1A 3GK0A 3C56A 5DFAA 1KRBC 2D20A 2D2GA 4LY8A 4H6KA 4FZIA 1HJVA 1NOWA 4DJEA 4I7UA 2XM2A 4WGHA 1OK6A 1UWUA 3GIQA 3CB3A 3EPOA 2WZMA 1XC6A 4JAWA 4B3ZA 1US0A 2WNWA 2OO0A 4C6MA 2FFCA 1E9IA 1W1TA 1A5CA 4NNCA 2QCDA 5AYXA 2F2HA 2VEKA 3GXDA 2Q8LA 2PSNA 2B4GA 2NT0A 3DGBA 1TWZA 1HVQA 2CLMA 1E6RA 2XH2A 1FXPA 1XRFA 4S3KA 4CN4A 1FKWA 3KDOA 4WF7A 3WUBA 3L2LA 1MEIA 4PL2A 3U4FA 1I45A 4JIHA 2W66A 1RJQA 4LB4A 1QHZA 4K3ZA 1HTIA 3HGOA 3ZVHB 4O8AA 1JULA 4H01A 1HJXA 4JTHA 1EO7A 3G0XA 1LT7A 1XGZA 3ONCA 3UPMA 4WJ8A 3EB2A 3GQYA 3QQWA 1KM1A 3S5OA 1HO1A 4JDBA 4YS1A 1XBZA 3ISIX 3LA4A 3VGGA 3VILA 2ZICA 4DUXA 4KCVA 1Z69A 3TFCA 3BAWA 3SQMA 2PP0A 6XIAA 3RX3A 3K46A 4DEFA 1T5AA 3USZA 2BG5A 3QTPA 3MI6A 3LCWA 3V1HA 1I1XA 4GE8A 3NO3A 1ADOA 1XPGA 5AYIA 5A6BD 4D71A 5A6MA 2WKJA 1WV2A 3U5UA 3FW6A 1DORA 3PBWA 4MWAC 1QI0A 2V3DA 2PWDA 3R5EA 9CGTA 4HB7A 4A8NA 4L4OA 3FYYA 3RCMA 2PEVA 5AKQA 1JZ8A 3VCRA 1OX4A 2X41A 2QJGA 4G2DA 4K8GA 1OT1A 2PDKA 1S2TA 1KTBA 1SW3A 2CLFA 4PR4A 4N9DA 1QI5A 5AOUA 1KRAC 4W7WA 3VINA 3GIPA 4C6IA 2ZYFA 4WD0A 1KFWA 3DX5A 3QLDA 1CXHA 4FALA 1H7RA 5CSYA 3CBWA 5CZTA 4AF0A 3E2QA 2AQVA 1XGDA 1OX4B 2YDSA 2DP3A 2NSXA 2XYLA 2A0NA 2ZADA 1RR2A 1LM1A 1LCOA 3AXXA 5KEZA 2V2HA 3TOYA 4AZIA 2D3NA 4LFYA 6A3HA 1DV7A 4EKJA 3C0SA 3L4TA 4GRSA 3FFSA 2BOEX 4CNSA 1EP2A 4MKNA 4IOTA 1XYFA 1V03A 2QUMA 3BURA 2J7HA 3UZWA 3WJZA 4R88A 2DH3A 1S38A 1JDEA 1H4PA 4Y6GA 5JXQA 4Q33A 1ONEA 1TX0A 3LBCA 1MUMA 4XG1A 1IZCA 1T96A 3QTGA 4LEFA 1US3A 2VFDA 5D9MA 4GUGA 1PTAA 4GY7A 1NSJA 3W53A 1V3IA 2PODA 5CSUA 4KRZA 3UCCA 4TV5A 2J78A 4IPJA 3VDGA 3EA2A 3CEPA 1RALA 4TTGA 3UNDA 3QPEA 3QM3A 4NSBA 4KMQA 1F6KA 4P7NA 5I23A 3BLIA 1DJNA 1MW0A 5A6TC 4DZAA 2PBOA 2NQLA 3WFLA 1C9DA 3KHDA 2E5BA 3LCLA 5HA7A 2ALDA 2CZEA 3W2NA 3I68A 3HPFA 5I3JA 3LCGA 3A21A 5JU6A 2YZ5A 3G6MA 3CLWA 3VM7A 3WDJA 5C55A 3WN6A 3HF3A 2HS6A 1GCYA 1OABA 2YCIX 1U2YA 3EKGA 1WAUA 4C6OA 4ENLA 1BF6A 2WWCA 4FOKA 2PU1A 1YPIA 3B4UA 1H7WA 3F5KA 4PC8A 3W1RA 3EKZA 4FEZA 4DLFA 4C7DA 1M6JA 3NQGA 1UIPA 4LYPA 4GI9A 3UERA 2WKLA 3IVTA 4AWUA 3B06A 3UA3A 2A2IA 5HR6A 5HMEA 3ATYA 1BYDA 4EPDC 3PUGA 3O63A 5C2GA 5TNVA 5CAHA 4JIIX 5F1UA 1ONXA 2QHAA 4AQLA 3W83A 4ZENA 3LRKA 4HKPA 2Q3RA 2YIHA 3RJYA 2V2CA 4NHVA 4FX7A 3AIUA 1OT2A 1EHNA 5I77A 3GYEA 2W92A 1DTNA 3QFWA 2PRHA 1IV8A 3CPGA 1KM3A 3N9RA 1UW9A 1UWAA 4H1ZA 2VC6A 2DFAA 1K02A 5FSDC 5I3GA 3CLMA 5E0KA 2XDFA 1O95A 4UFMA 4E4FA 1M3UA 3WF3A 3AAMA 4LBRA 3PS7A 4NYYA 2BGNE 4JGDA 3SJNA 4BF7A 4TXEA 1W9UA 4RNIA 1JZ7A 4Q4OA 3HURA 3GXNA 3U7BA 2A7PA 3NG3A 4WXYA 4KCTA 3SUSA 1M01A 3AIQA 2ZDSA 1FWWA 3DERA 4EXAA 1Q85A 1H09A 4BHYA 4JN8A 1P7TB 3RJXA 3TSDA 2C1HA 2OZ8A 4OWGA 4C91A 5IRPA 4G8TA 5A8QA 2L5HA 4LRTA 3I3EA 3MANA 1MNSA 4QS6A 1DP0A 1U5JA 3JZUA 3TN6A 1OFOA 2D73A 1TPDA 3CV6A 2Z27A 4XD6A 4CCCA 2VR2A 2DZUA 3XINA 4AD1A 5A69A 1BVZA 3LCHA 1BPLB 3BSHA 4S3EA 3GW0A 4X22A 1P43A 4NJKA 1KNWA 4IX2A 2X0YA 2PDHA 3A12A 1LLZA 4ICCX 4HBKA 4G6CA 3G18A 4ZOEA 4DXKA 2XGBA 3GY1A 3BQ6A 3FGCB 3RYSA 4JDYA 4JKMA 1YEYA 3PB0A 5HXMA 2HE8A 2GPTA 4DQWA 5DT5A 4MG4A 4DXVA 3W2LA 3MJYA 2Z2BA 2GVGA 2PPGA 4WJXA 3MKCA 3OGRA 3GTXA 2V5JA 4M7SA 1BGGA 3WLHA 4NU7A 4HNNA 4AH7A 3OHIA 4GMEA 1E1FA 2YL6A 3ABXA 1NAL1 5HMDA 1Q6RA 3HG5A 4HZMA 3IK2A 1U1JA 5FI8A 4YPJA 4M8UA 4Z08A 4NNBA 1VR6A 3ALGA 4UR8A 3A4AA 4MUPA 4UTJA 3KBWA 4ZZ9A 1UP3A 3EEGA 5LXEA 4IXXA 4RLIA 2WWDA 3CAVA 4RNHA 1V3LA 1VJIA 2G8ZA 4DBWA 4V1XA 1L6WA 3JS3A 2Y88A 1DJXA 3AOFA 3XIMA 1RBAA 1Q4NX 4V1YA 4JYDA 3G6LA 4LUSA 4GCXA 4XZLX 4K1WA 1PDZA 3GC4A 1ADDA 4DAIA 3LHVA 4AAJA 2IKGA 3DHFA 2DVXA 4ZBCA 3V5FA 2ZA2A 2PGWA 2YJQA 2QJHA 5G4WA 3P6LA 3W6YA 2WW5A 3TK7A 3GTFA 2CWNA 3URNA 3S6TA 4Q8TA 3PNUA 4IHCA 1U1UA 3S2CA 1V02A 3V35A 4JFUA 1O1HA 4BS0A 3L21A 4WSKA 5D2VA 2C18A 3L4ZA 3FOKA 1DJGA 1VFHA 4ERGA 2GZXA 1P4CA 1F3WA 2AGTA 4IMEA 3WCZA 1M04A 3UWVA 3I10A 4DN1A 3CPRA 2PDLA 4O0ZA 4KF1A 4N9EA 5CPNA 2Y8UA 3TA6A 4OFCA 3VZZA 3GVQA 3W28A 3G8RA 1DXEA 4HNOA 2CLOA 4GUHA 1LYXA 1R0MA 2WC7A 3VUPA 5HR7A 1RBLA 1FWTA 1W56A 2ACUA 2O55A 1L8PA 1TRDA 4RDZA 4CD6A 4BJHA 4A35A 1HFBA 4E6MA 3BPWA 4MZYA 1CB2A 4UQBA 4GXWA 1UD2A 1WYIA 3AQUA 4A3UA 1IIGA 3W1UA 4EANA 3BH4A 2D1ZA 4UTTC 4PUNA 5AC4A 3CASA 4E0CA 1YDOA 4H3DA 1TIMA 5D2WA 4LUJA 1K1DA 1Q6LA 4W89A 4Z17A 1DHPA 1HN1A 2WCAA 3MCOA 2NW0A 1ZU8A 4QROA 3W87A 1I2PA 1Y5VA 1TMQA 4RE2A 3BAYA 5A2BA 1SZRA 4HOXA 4TIMA 1E6ZA 3GTHA 1JXKA 2G3NA 1E4MM 2XN2A 4FX6M 3E74A 4ZXOA 2Z28A 4H8VA 4ZSUA 3M6DA 3O6CA 4GYJA 1E3XA 3R25A 1SMDA 3LM3A 1AZ1A 3CQHA 4HCDA 1L2UA 1TV2A 4MDOA 5FF7A 2Q71A 3Q65A 4EXQA 1BRLB 4YL2A 5GVJA 3N2CA 3T09A 3N2BA 2IXVA 3HGSA 3SI9A 1XBVA 4PMQA 4PODA 3NQFA 4LCRA 4HPHA 4E8DA 5AHLA 3MBDA 1ZQ5A 3M0VA 3QC3A 3QY8A 3N11A 4AVNA 4A2RA 2PBGA 1VHCA 3BOFA 1F6YA 1O5RA 3N19B 3ZT6A 3G3DA 2QKFA 1UJPA 5BOOA 4K7YA 5LKYA 3R79A 4J7RA 2ZUNA 2ZTKA 4GUIA 2OKTA 1JPKA 1UH4A 4H9TA 3JUGA 2WSQA 4GPNA 4WX2A 3W7IA 4K2SA 3HPXA 1KFJA 3EZ4A 3HMJG 1Q3NA 1SFLA 2A21A 1PDYA 1OADA 2OZTA 3WK0A 4KW2A 1EF3A 4WHBA 4AVOA 4TVUA 5HUOA 4QTGA 3GNXA 1PSCA 3GFXA 3UCDA 3H4GA 4V2XA 2D0FA 5BROA 4TR9A 1TJPA 1WDQA 5CG0A 5GJNA 2YLLA 5E93A 3W1TA 2IW0A 1H41A 3BMVA 4MPQA 3M4HA 1UMYA 5I79A 1TMHA 4HA4A 1DE5A 1EA0A 2OOGA 4KESA 1JDDA 2IUZA 4FLQA 1YRRA 2LLEA 1TTPA 3EDJA 4PN2A 2PDXA 2W79A 2PTWA 4JNYA 2GWGA 3QBUA 1NFPA 2VGIA 3WJYA 5C9UA 3LLFA 4O1EA 3QKEA 1SW7A 1FRBA 3P8IA 2OMAA 3IVUA 3LNMA 2DZXA 4BY3A 4XO7A 1IEVA 3S47A 2QCHA 2DGAA 1W1ZA 1KW1A 3ABRA 3VZXA 3LXCA 3CS2A 4O4WA 3LSBA 1LBFA 4QQUA 2OLHA 2VNCA 4AWTA 3IJQA 3N4AA 5J5DA 3TNOA 3K1GA 1KFEA 3BSGA 3DYMA 4NZJA 1OSEA 1TPB1 3V7PA 1QUMA 1X38A 5DXYA 1JUKA 3CAQA 1V8EA 4JFTA 5EMUA 4G1NA 2O9PA 3N4EA 1O7AA 2J9XA 4K37A 2HROA 4UMAA 3SRHA 3KP1A 4QIUA 1BGAA 4Q8VA 3GG1A 3U7VA 1R9XA 1KGUA 4M19A 3W4RA 4OUIA 1QPRA 3UR2A 1XYCA 3UG4A 1TZZA 5CAKA 3UBPC 4E8CA 3U48A 3ANUA 4OU1A 5LA1A 5CBJA 1TPH1 4JTRA 1SM9A 1FWGC 5CPQA 3SGGA 1V5XA 3ZLHA 3ZT7A 1QBAA 3GDBA 5I78A 1AMYA 3A13A 2QV4A 3IJ7A 4M0XA 3UGRA 3NJ3A 3VC6A 3NQCA 2Z26A 4IICA 1XW8A 2IPFA 2FZ8A 2R9RA 4QX4A 4UZSA 1GEQA 3W7EA 3ABSA 2OO6A 4HZ8A 2IXUA 1DE6A 1Q4WA 1H7PA 1WKDA 3OLIA 2INZA 7XIMA 4LUSB 1E5JA 2VFGA 4V33A 1R2RA 3W82A 4JXCA 3G2GA 5FJUA 1G94A 1DWAM 4MY9A 2WJZA 2DJXA 3GZAA 4AUBA 2GQ9A 4V28A 3TLLA 4Z42C 2RKXA 3N25A 5HMSA 2MUCA 1X8FA 2BLEA 4Q8UA 3EWDA 3HGRA 4CCEA 5BWFA 1R3WA 1BSLA 5AZ0A 2I9EA 1J79A 4ZVJA 2G4FA 4P7OA 4Y7EA 2EG8A 3VKJA 3EOLA 3HV8A 3UPWA 1ZS2A 4N0RA 1A5BA 3VOJA 4XISA 4PA8A 2V67A 4E38A 1JPHA 4IIBA 1TV4A 3FVDA 5AY7A 4HHHA 3M9YA 1P0DA 3N2OA 2HSAA 4AHQA 1W3IA 4GVGA 3GBEA 4Y9OA 5FF4A 3CL6A 1SFTA 3NO1A 1K7XA 4PUUA 1ZLPA 1MXDA 3VKKA 3W2KA 3P67A 4UFHA 4DIAA 4J1OA 3PBGA 2GGIA 4UR9A 2AKMA 3WK2A 4GUFA 3IVSA 1A50A 4D6HA 2JIWA 2DT1A 1E55A 4S3BA 4MOZA 3PUEA 3BLFA 4OBTA 3RNDA 3WLNA 2E68A 3L5AA 3PPCA 4MSSA 3UW6A 5K9CA 3O8AA 2XVKA 2GJPA 1PAMA 1JYNA 4OHQA 4GQBA 1E6SM 2QUTA 4MGGA 3SW6A 5DCDA 1TWIA 3PZNA 1XX1A 3PFRA 1EA9C 1UASA 5ABHA 3H21A 4F40A 1G69A 3FJNA 4DF0A 5D8ZA 3PY2A 3W2MA 1AH3A 2NQJA 4HSHA 3ZO9A 2W27A 4MVAA 1K9DA 3LY0A 2BS9A 4MWAB 4ERAA 3LBOA 2X42A 4WDUA 3HQOA 1BWKA 1R86A 3CWNA 1XIFA 3P62A 3WF2A 4MKVA 1HJSA 3RUBL 4N6FA 2HCVA 3CYJA 3QF0A 1XDMA 3VIJA 2PDFA 3D47A 1EJ7L 2NZLA 2ICSA 2NV1A 1W54A 4HPNA 2EF9A 2DQXA 3W81A 1EP3A 4JTIA 2KZHA 2XJ7A 3EAUA 3PZIA 3RDKA 5DEZA 3W70A 4B3KA 1B3OA 2G96A 1ZHAA 4AWSA 3L4YA 3LTSA 2WZTA 1GHSA 3AALA 2OZ3A 3K13A 1WE5A 4FXSA 4UTLA 3T08A 3WQDA 2Y5SA 4U5KA 5BRPA 5KMYA 3B9EA 2ZQ0A 1MZHA 2P10A 4QEHA 2WO5A 3NOEA 1YHTA 1XXXA 4O57A 4GX8A 4QEEA 3K8MA 3THQA 2XGZA 2Z1KA 3UWEA 1DKWA 1R85A 1OZMA 2X40A 2I16A 4NUWA 1GQKA 3OZMA 4IG2A 3H7UA 3WMBA 2NQHA 3VGEA 4JS3A 4L6DA 3O05A 2DJLA 4IQJA 3GHUA 2DU2A 3URBA 4US6A 4QJ1A 3B9DA 1KBBA 2ZXAA 5I5RA 4PMYA 5DBUA 1QU4A 4KEUA 4DYJA 3AICA 4NJGA 1I60A 1R9ZA 1Y8BA 1W3HA 1JCMP 1FWFC 2YSWA 1QK0A 3KFTA 3MDUA 3QC0A 3VFLA 2GL5A 3SGZA 2CFFA 2Y0FA 4W7UA 1E1CB 2G37A 3DG6A 4AD4A 3GUGA 2GSJA 2XH7A 2ZZ6A 3QW4B 4C6NA 3LI1A 1UOKA 2ZUTA 3CUIA 3CV7A 4PSPA 3U57A 1Y65A 5KITA 3F4NA 1ZJHA 4WCJA 2VYOA 3R0UA 3R7MA 1FCVA 5DQPA 3L4UA 2DT3A 2ADAA 1ESWA 3KBMA 3F4WA 5IBXC 1ITUA 3W29A 5AHMA 2ZUWA 1TO3A 3G1YA 2CXGA 3PSVA 3NA8A 3EGJA 4AB4A 2VCCA 4FNPA 1VBJA 4K68A 3TJ4A 2ATSA 2V8ZA 3L2MA 3EPNA 1FVPA 4HHPA 3NTYA 3EYPA 3UJRA 2X1RA 2DEPA 1IYXA 1JD9A 4H6EA 2ISFA 4IGSA 2YBVA 1YTKA 3Q37A 3OLDA 4KWOA 5CGQA 4GVFA 1Z3NA 1ZY9A 3OBAA 5CBIA 2GVYA 3O15A 1V3KA 3LBMA 1XH2A 2OEJA 2J66A 4S3AA 4D72A 4RDYA 1VFFA 4JTUA 1K8CA 1I75A 2BY1A 1J2WA 3ZJ7A 1XSKA 3M44A 3N34A 4X61A 4PUKA 2X09A 2E9LA 1N82A 1ZAHA 1QNSA 4GI4A 5IHRA 2V3GA 3VOGA 1V6YA 2OVLA 4IH3A 5CGTA 4PUMA 1K7FA 4HSNA 4M1RA 2Y7DA 4FLRA 3WQ4A 3KL5A 1QR7A 4ILSA 1PE1A 1FUYA 4E2DA 2WJDA 4P2VA 4JPGA 2GGGA 2FQIA 1MQPA 3KVLA 3O06A 5KZEA 1XPYA 2DT0A 3RLUA 4D6JA 3KRBA 1LP6A 4OIFA 4YXGA 1S2VA 2G3FA 1H5VA 2O4QA 4P7QA 1ZBWA 2VWSA 3P84A 1OX6A 3LK6A 4IUGA 1JNDA 3EXTA 4U5IA 4RXGA 1UH3A 3JU2A 2JKAA 2PTDA 1OY0A 4XD3A 1HJQA 2ZWYA 3L2IA 4IP7A 5DELA 1VPXA 3U6WA 4WVXA 2C6QA 1P48A 1MEWA 4BEUA 3MUZ1 2PZ0A 1GVFA 1V4YA 2Q3OA 3OIXA 5DCEA 3VKAA 4JIPA 2ZXQA 1E15A 1AH0A 1H2JA 3GFZA 1XCWA 4EF8A 5T9CE 3WDHA 3AHTA 5EMKA 1T99A 1QASA 5DX7A 4XAZA 2NX9A 2BOGX 4YTSA 2C79A 2EO7A 2PDGA 3B03A 1REQB 1IT7A 2Z7KA 2XIOA 3D3AA 1E0VA 1C8YA 3AYTA 3TYAA 2JBMA 3UWYA 1FWNA 3DYPA 1X6UA 2R1NA 5JMUA 1CLVA 2Q02A 4C6FA 1TX2A 5BCAA 1BVNP 1SJCA 3ZMRA 3KBNA 2J9YA 4UQ9A 4DUOA 1S1PA 3L68A 3O9NA 1TE6A 4HJWA 4NYUA 4TX9A 2OGYA 3DG3A 5AYZA 1CECA 4MFEA 2E7FA 1VBGA 2NUWA 3ID7A 2BVWA 4B91A 1V08A 4ZO7A 1HJWA 2EAWA 3ZOAA 3VIMA 3IS4A 1ITQA 2ZRXA 2CIPA 2BFGA 2NV9A 4W4QA 2QDEA 1P5BA 2Y8KA 4LV9A 1LWJA 3KX6A 2E77A 3M07A 2WQDA 4JKLA 4NZ1A 1L9WA 1D7KA 1F3TA 1I8JA 4QRNA 4JQ2A 4DNMA 4XAGA 4GGHA 2FPYA 4ZCWA 3WD0A 5AECA 5C9WA 1KGWA 4B5WA 4KGJA 1KRMA 4IQEA 3W7DA 3WQWA 4GBDA 3B0XA 1PXGA 5HK4A 4HNTA 4GKLA 2JIEA 5I3HA 2D23A 1KXQA 3A6OA 1K9FA 2OB3A 1EKOA 1JCTA 3CHFA 1W9DM 2W6RA 1DJWA 4NVTA 1GPWA 2GFTA 1TPC1 3WD1A 2VX4A 3OA5A 3AU6A 1NFBA 1NJJA 3UZXA 1EH9A 3QV6A 1MEHA 2OU4A 3VA8A 2P53A 2HWGA 1EEXA 3TUUA 1VBUA 1GPFA 2J8GA 2ZX7A 3PR2A 3L65A 5JBEA 3W07A 1OD0A 1T8XA 3WLIA 4LUIA 4RL3A 2VRKA 2R1LA 1R2TA 4JL1A 5BXRA 3OZOA 3TN3A 2XISA 4GO8A 2WZEA 5HNTA 2W4XA 3GR4A 1V93A 3BE7A 2FGLA 3HPAA 3BGJA 4LF2A 5DRCA 1RD6A 4PRWA 2XH0A 3PAJA 2Y7EA 4C60A 7TAAA 2BOFX 1RPXA 3UXLA 3MP5A 1B4KA 5LXXA 2PB1A 1UKSA 3W6MA 1S39A 1TA3A 2ZZ7A 2Q01A 2HQAA 4PMOA 3WLKX 5I7GA 2HJPA 4XD4A 1R30A 2J8FA 4DWSB 1XD1A 1K9EA 2WHJA 2C1GA 5I24A 1WUEA 3IGUA 4GX9A 4BF9A 1JDAA 1WXZA 3UFYA 4JTDA 1UZDA 1WQ5A 2OSWA 1IE7C 3ITOA 2VX7A 3II1A 4WY0B 5GPRA 4FAMA 1NWRA 4ZSTA 2FGZA 3WSUA 2MNRA 3ARQA 4JFWA 2ATMA 5I0DA 1VENA 3NCOA 4QGCA 5JIPA 1EOKA 4TTUA 1H51A 3EX1A 4GYKA 3NWRA 1E0TA 3ZT5A 3T55A 1QI2A 3BICA 5GNZA 3T0CA 4PUJA 1XYZA 4V15A 4INFA 4K7VA 3N18A 4D1JA 3BL3A 2BMBA 1E40A 1IEXA 1KB3A 5LIKX 4W8BA 3DDMA 3HFYA 3FSTA 5CBBA 3KP0A 3OB8A 4E2VA 4GHRA 2Z2UA 3GX9A 2J8TA 5HAOA 1IGWA 4O1CA 1CW2A 1H49A 1JZ2A 4UTFA 3LG3A 1EX5A 7A3HA 4POCA 1KLZA 3D6NA 1XDLA 4XAYA 4QCFA 1HGWA 1SJDA 3WL0A 1OQFA 2Q8XA 1XIBA 1MFVA 1CWYA 4L4LA 3UWWA 1WAWA 3CK5A 3RM8A 3VX0A 2ANUA 3SR7A 3NFUA 1OYCA 2QJIA 1XLKA 3GAYA 1YBQB 4PEEA 3NEVA 4QDPA 2JGYA 1NU5A 1OFPA 3G8EA 1M5WA 3W27A 3P8JA 1VCFA 4D8LA 3HJZA 3EOEA 5BMXA 3KCJA 3RGTA 4PH6A 3VDHA 1BD0A 3LLXA 1RZMA 9RUBA 1VYSX 3WYZA 4FMVA 5IM51 5DMMA 3DIPA 3LGGA 4MWAA 3WO8A 5U7SA 1XIJA 3HBLA 3GG8A 3M0XA 4DYKA 2XSBA 5K4ZA 3PJWA 3EDEA 1YPXA 4LF1A 3PVFA 5H91A 4IFKB 1SZEA 4H8NA 2PURA 1ZUAX 3QYSA 3M43A 1HKIA 1US2A 2HE5A 4MNJA 4WK9A 3W1QA 3R0KA 1OYAA 2WNZA 4RE3A 2YA2A 4U28A 3T9PA 1XIEA 4WKAA 1Q8AA 1PKLA 4UQEA 4U10A 3GXFA 3SFWA 4UC5A 1JQVA 1RSCA 3AC0A 3SN4A 2XZ7A 1GW1A 2VP8A 3M5VA 4F0HA 3C2EA 5PTDA 3R8GA 3PZTA 3LRMA 4LC6A 1KTCA 4G56A 4R27A 1NWUA 4FHAA 3NXLA 3A4WA 2B7NA 8XIAA 3G1SA 1J0JA 4FF7A 4Q8QA 3WQCA 1TRIA 2VWTA 3WH6A 4QSFA 2PMQA 5AYBA 4RCXA 2YW3A 4DZIA 2DSVA 5C0QA 1OF8A 1KTNA 1KM4A 4IPPA 1B9BA 3LUTA 1C9WA 2CITA 3RFAA 2GJRA 3SIMA 2E6YA 1ZB5A 1JUEA 9XIMA 1BKSA 1EHAA 4R53A 1QMLA 4YMZA 4KFOA 4Z1YA 3FAWA 1P0BA 1JZ3A 3M47A 4PTVA 4DJEC 4DBUA 4F0LA 2DW6A 3VNJA 1XLHA 3Q67A 4H6RA 4O12A 2BY3A 2AGKA 2VDIA 2XVNA 1BTCA 4C65A 4Z1BA 1P6WA 4JIEA 1SU5A 3L12A 4QAIA 5E9XA 2X8RA 2Y62A 2RDXA 5I02A 3PULA 3SSZA 4IXHA 3CHVA 5ABGA 1TMLA 4FS9A 4K6AA 1O5QA 2QT3A 3MS8A 4ZQNA 3WMLA 3UQNA 2J7FA 4W5UA 4Q6XA 1LTDA 4UFLA 4YN5A 2DSZA 1W9BM 4RZBA 4I6VA 4O28A 3QHNA 2J9ZA 4F2UA 4AFYA 4TVCA 4JY8A 3AZSA 1X7FA 1TREA 4DBEA 5G2HA 4IP5A 1A0DA 3SCQA 2JK2A 2XIBA 1TR1A 1RAKA 2O7SA 5EFFA 2C1IA 2ZZ3A 6CGTA 2V82A 4RKAA 3GWQA 4NZ3A 1XP3A 5AB3A 1E0WA 3AMCA 2VXNA 4IGMA 4N42A 4H6QA 5D30A 1XISA 2VURA 3S0CA 3CZEA 4NI3A 1M1BA 2HXUA 3B0UX 2EHHA 1M7OA 3AROA 1TWWA 1L6YA 2DH2A 2PFHA 3Q2DA 3W01A 2RGLA 1DEDA 3NVTA 3NSXA 4CCDA 4OKDA 3SUUA 3P14A 1ENUA 3VNYA 3SY5A 1YTDA 4TOQA 5D9OA 1K77A 1QI4A 2QJJA 4C6PA 4AU0A 3NL3A 2BVDA 2WXDM 2NXGA 1DWFM 2B31A 1JD7A 4XZWA 1KKOA 1N55A 4HTBA 2J25A 1PYFA 1AJ0A 1RA5A 1AZ2A 1PS9A 3HFTA 3SY8A 4GG9A 6REQA 1B2YA 3VMPA 3S5SA 2EXOA 4PCFA 1H7XA 3W71A 1O5XA 3W6LA 4FSAA 4B5XA 1Y5WA 5A6SA 2VFHA 4XSMA 3ZR4A 5I3DA 3DXIA 3F2CA 2EGZA 1KCXA 2BY0A 1JYVA 1K70A 3UJFA 3FYOA 2YW4A 2P0OA 1RQHA 4LGXA 4IIHA 3AS1A 4L9XA 4UFKA 4CU8A 4P61A 2B81A 2OX4A 3EDFA 2WK2A 5B80A 1RLDA 2HZGA 2KAUC 1FXQA 2QCGA 3E2RA 4JTTA 3THCA 5EL1A 3VABA 4Z2JA 1QPNA 2JKPA 1VPYA 4TQTA 2WYSA 2BASA 2QDDA 4CLMA 3NQ2A 4MJZA 3PZMA 2ON3A 2JEPA 3UNTA 2VC5A 4RDVA 2BTMA 1TPWA 1DIDA 7ODCA 1JDCA 4RR4A 1VFLA 4ZOAA 3AO0A 3KCLA 3KHJA 1J2BA 3N1AA 4H9XA 1OBAA 4J27A 3IWPA 1L2QA 1VCGA 1Y7VA 4PFHA 1ME8A 3LENA 5HBFA 4K39A 3TX9A 1BYBA 1ZPTA 4CQCA 1JL8A 4C1LA 3W84A 2QIWA 3OYXA 5F2LA 4N9BA 2RDUA 4AD5A 1L8NA 3PZQA 3NM3A 2O0TA 2GQ3A 2OYLA 3AMGA 3UF9A 3WH7A 5DMNA 3T81A 3B05A 4AZ7A 1ZJIA 4LC8A 2CXEA 3H26A 4H7CA 4C6EA 3W7KA 2PDNA 8TIMA 3W76A 3C5QA 2YLAA 1UC5A 3VNIA 4D8AA 1H50A 4B5SA 3GDRA 5CH9A 3WBAA 3C2FA 4L80A 3LMYA 1WOAA 3MZNA 4RNFA 4GQGA 3MSYA 1XICA 3W26A 1C3FA 1SJAA 3NR0A 4XKMA 1DBTA 1OFQA 4Q4SA 2WSRA 5D9PA 2WOQA 1Q13A 3C4UA 3WF4A 1UA7A 5A6KA 1HX0A 4Q22A 4GI8A 1D3GA 1QO5A 1XSJA 3STGA 1VD6A 1HP4A 4HT3A 4G5DA 4ICMA 1CTNA 1IR2A 3A3HA 5A6BA 3NQVA 3K30A 1UP2A 2XFFA 3Q94A 1J5SA 3DHUA 4MAZA 2IS7A 3W7LA 3KVMA 2X0HA 1TTQA 3GTNA 3I7QA 4D6IA 1WDRA 2XTKA 3HG4A 3N14A 1GNXA 2V6AA 3S1GA 3MCMA 1BFNA 1OINA 3GHSA 1F8IA 1OFEA 4O8RA 2V5DA 1AVAA 3BMWA 5H8MA 5EKYA 2R1MA 3CWOX 2BXZA 3WMSA 5KETA 4MYXA 3PPGA 3VIIA 1QWGA 3G77A 3V0UA 1TR9A 3PPFA 3KOYA 3WQOA 1MNZA 2G41A 4RK8A 3NDYA 4HA0A 3ICJA 4LS0A 3LB0A 1ZCCA 3TYUA 3ZVHA 5ABTA 3DC8A 3UVIA 2XWEA 2AL1A 1A5AA 3NGJA 3LU2A 3M5YA 2GQAA 4IM4A 3U9IA 1LOQA 4UCFA 1E9LA 2HPMA 2YL5A 2IMRA 3A5FA 4MFDA 3ZLFA 1LOSA 1JIBA 2DZWA 1EDQA 3CAWA 5CG7A 3AS0A 5HQMA 4CQ9A 8RUCA 1I2RA 1FWHC 2YR1A 3DESA 4DWSA 1XCXA 2BB0A 3LPOA 2F84A 2BBFA 4HGXA 3DGRA 2TPSA 4K8EA 3RLHA 4O10A 3ZVIA 2CESA 1NM9A 1IR1A 2YYUA 1VFMA 2Z1XA 4FNUA 1E1EA 2R24A 4GH1A 3N9SA 1GVQA 1AW5A 1W9PA 3WUEA 2G0WA 2GJXA 5FEPA 1YE4A 3TTOA 4DBSA 4HIBA 5H8UA 2BHYA 3VGFA 3WNNA 2PWVA 4UIOA 4NP7A 2YPIA 1T40A 1VP5A 3LCFA 4LVAA 1TTIA 1IEIA 2YDQA 1UP0A 1KC7A 2YCJA 1LBMA 2CZVA 4GQRA 2X1TA 2WPGA 3UVAA 1J9YA 4JICA 3I4KA 1PWLA 2YOCA 2AAMA 4Q3MA 4C6JA 5L9FA 2AL2A 3GM8A 3GG0A 4Q8MA 3IGSA 1OGGA 1SSDA 3CWHA 2QF8A 3WQPA 3WH5A 1W3LA 4NJJA 1F76A 2R1PA 1H5YA 4GJJA 1XFBA 3TQ0A 3QOMA 1A53A 5LHEA 1UWTA 2ISDA 4AYGA 3H55A 4JQ4A 5AHIA 3AYVA 1JGIA 3RHGA 3MKVA 3KBSA 3S9ZA 3W7RA 3DYOA 4NY2A 4HK6A 7PTDA 1N2VA 4MB1A 4O0KA 2PA6A 5CSSA 1EPVA 2VRJA 3KL3A 4D2JA 3WLRA 1U22A 4EIVA 1RXOB 4DPPA 3LMZA 3W00A 2ALRA 4UMBA 3B0YA 3M41A 1LRQA 2FGBA 4N4QA 4HTYA 2GDVA 2G97A 1EUAA 1GVYA 2GUBA 3C52A 4WDTA 3PANA 1ADSA 1CXLA 3L0KA 1P1XA 4GYPA 3QRHA 3UG8A 2ABBA 4C7FA 1GOIA 4UB9A 5JH2A 1UZ4A 4GLEA 4J2PA 1N8WA 2NT1A 4Q32A 2EPNA 4UNLA 3BG3A 3VMNA 4HU0A 1F7BA 3NL5A 4GUJA 1X98A 3EX2A 1GT8A 4PTXA 3ZWTA 5BW6A 3EMZA 3MI2A 4CUCA 2FTYA 2QVNA 4ZQCA 1QAPA 1EJUC 5HJLA 2JGQA 3FN9A 3WD4A 4S3FA 3AWNA 1FY6A 2W91A 1W5QA 3DEQA 1PTDA 3VTRA 2QCCA 4TUFA 3KWSA 3IAQA 3VZYA 1WPCA 4DRSA 1WZAA 5HWNA 4U33A 1EL3A 3IIXA 3W7HA 3R10A 2HBXA 4PMNA 3GUWA 4HPJA 3S2LA 1POKA 1XD0A 1EJRC 1QK2A 2DZTA 1YLVA 3LHZA 3EB4A 3E02A 4UBPC 1W8GA 2EQDA 2V3EA 2YXGA 2FPVA 3T2PA 1M7XA 2YCLA 2WHMA 2PGFA 3PHAA 4O15A 3CZKA 1Q6FA 3ALFA 2P3EA 3M7WA 4Z2GA 3N3MA 2GOUA 4RV3A 3TYZA 3NIYA 2VZOA 1V7AA 1GJUA 1U83A 2EPOA 3WKZA 1C8VA 2ZBTA 4ZO8A 1DPMA 3HMCA 3RU8X 4XD5A 5JUVA 2WMFA 1WO2A 1MUCA 3BUVA 4FI4A 2XPKA 1NDVA 2E6AA 2J7EA 3AIWA 2RDTA 3EWXA 1TJ2A 1RY0A 1TPUA 1WDSA 5M03A 1E73M 1KQZA 3VDCA 3SRKA 2PDUA 5FKYA 1CENA 1IGSA 2WVSA 4Q4RA 5A3HA 4MHBA 5EFDA 1QOPA 4ZQMA 3S1XA 5D02A 1ZGDA 3W0KA 2J77A 4G1KA 1G4SA 1UD5A 1JRCA 4XBJA 3I4EA 1YDNA 4UQCA 1RK6A 2PDMA 4GK8A 3LXBA 1AODA 4PCSA 1FHDA 2TAAA 3TQVA 1M53A 3EKLA 1T0OA 1XIHA 3T4CA 3UP8A 4H2CA 4QJ4B 1M41A 1O4UA 4IJRA 3TQKA 5DBTA 2XZ9A 1SGJA 3TR9A 5M17A 4R85A 2XFWA 1Q45A 1JGMA 2WC3A 3KLLA 4KFNA 4Y8FA 3NPXA 1V6VA 2FHFA 1WXYA 3DOPA 2A3LA 1H63A 1S3HA 1JFXA 2Y8VA 2Y2WA 3G1FA 3EOOA 2C0AA 3DU0A 2HS8A 3I7SA 1VLWA 4REQA 3ZS4A 4A8LA 3OVGA 3VCCA 4AHOA 1AL7A 1JI2A 4GD0A 3IGHX 5F4XA 3SEPA 1RV8A 3R8HA 4ZXLA 3QV7A 1H0GA 4QLKA 2OWCA 3RITA 2E3ZA 4PL1A 1BYAA 1H7OA 4FX8A 3O7UA 4IG2B 3BARA 3S1UA 1GTEA 1M7PA 1FCUA 3N6HA 1O66A 2WJEA 4QS5A 4O1DA 4Z2LA 1V3MA 2JF7A 4B4FA 1VIZA 1UD6A 1S5MA 2X05A 2E5DA 3W25A 1QPKA 1WBHA 1GTHA 4TX8A 4GYFA 4Z0JA 3HOJA 1TVNA 1CGUA 3ARXA 3OU8A 4PCPA 3QMRA 5TQLA 5T26A 4AX7A 4WRHA 3K4DA 3PJXA 3DFTA 2YBUA 1E1CA 3A22A 2GSEA 1NDYA 2GDUA 4JNMA 2CETA 2QAFA 2VHLA 1UMLA 4XVEA 3TYEA 5LGXA 1NDZA 4DO4A 3KWXA 1PCWA 1Z41A 1P0NA 3V0SA 4AIEA 1W1B1 5D2YA 3QGVA 1XCFA 2TRSA 4JD4A 1ECQA 1KR0A 1KBLA 3OHMB 1K3UA 1UOZA 1XLIA 2DT2A 1HKVA 3S6OA 4Q4QA 1L0PA 1V79A 1NFGA 1D3HA 3E0WA 4HZ7A 3SDOA 1NP0A 1JF6A 4HNVA 5LSMA 2BWGA 4RX0A 1ZZMA 3WK3A 3QVQA 1OGSA 1TKKA 5CC6A 4IMCA 4UTKA 1EOMA 1XYAA 3SCUA 1OHLA 2TODA 4Q8WA 4FOJA 4OJYA 3TU9A 5DMLA 1F4AA 1WP6A 1BWVA 3OLEA 3DHPA 1TWSA 1W0MA 1W3NA 4XV0A 4H9ZA 3FX4A 5TBOA 4KH2A 1YQ2A 4O1AA 3HPZA 1X8CA 5E5CA 5FF2A 3NZQA 1VRDA 2V0TA 3VIOA 3BK0A 4W7VA 5E0FA 5FACA 3LHYA 3CQ0A 3WDRA 3G22A 2WVTA 5HULA 2BHUA 2P0IA 3IRDA 3WNMA 2X2YA 3NYDA 4Y96A 3WZ0E 2YFOA 2Y5JA 1A0CA 3C2RA 2CKRA 1E71M 2D0HA 1FHLA 3BAIA 3KE0A 3KZSA 3HQPA 3WENA 3MV11 5LNRA 4JFVA 1SPQA 2WCGA 3ATZA 2XH4A 1XINA 4E4UA 4CU7A 4OECA 1BXNA 3LPFA 4ZB2A 3V5CA 5BRBA 4R7OA 2J88A 4O11A 5DCBA 1QPQA 4DZHA 2QJMA 5CPLA 3WBWA 1I0BA 1W1PA 3KTXA 4IT1A 1DIKA 4JYEA 5I07A 1UWQA 1IWAA 4MM1A 1ZENA 3MW7A 2Z7GA 4CEUC 2A5HA 1XRTA 3E49A 2NXHA 4HYRA 5AHEA 2H3DA 4IFRA 4B4HA 4YVVA 4FB7A 3IJ6A 3QY6A 1ODUA 3ANVA 1WKEA 3KRUA 3ITTA 2W62A 3BW4A 2YCLB 1PWMA 1L6FA 4QG9A 3TAKA 4JTLA 3BV4A 5A8NA 1Q7QA 2Z29A 1FOBA 2VFIA 4DELA 4ZFMA 1GOKA 3H53A 3S42A 2WMGA 1PPIA 1XLBA 4C5ZA 4LH8A 1W2PA 3H2OA 3OVRA 4OV4A 4DO5A 4LAMA 2WMIB 3S3GA 5MF5A 2B7OA 1N8FA 3QPYA 1SYTA 3IIVA 3CXOA 3VU2A 5ABEA 5LA2A 2QF7A 2WANA 5BMWA 1XLJA 8XIMA 3IARA 3P80A 5C2XA 1A47A 2EPMX 4HNLA 2SFPA 1UR8A 2JEQA 2Z6JA 3M0ZA 4HNUA 3F7JA 1XIMA 2UWFA 5KSWA 1QFEA 3TQPA 2O4MA 2VVNA 2F6XA 4DI8A 4A3YA 3FHAA 1AMKA 3FY1A 1NDWA 4LT9A 2X30A 4Z2IA 1KGXA 3VE9A 3KS6A 2QYGA 1WOBA 3MVTA 3S83A 3CZ8A 5EMMA 1ZRQA 3UD6A 4PTDA 3F4VA 4US5A 3WQ6A 2CLPA 3VD5A 4K1GA 2C3ZA 1EDTA 1W3JA 2WNQA 2Z1BA 3VYLA 3EOUA 1ZALA 4JQ1A 4ZE5A 4DJED 2NVAA 3W24A 3OG2A 1P7TA 4JEQA 1EWDA 1R3QA 1VB9A 4KKXA 1XH0A 4LVBA 1J96A 5I6SA 5C9ZA 2R82A 4MADA 3TE9A 4NJIA 4GQ0A 1Q2SA 1B5TA 4ATWA 1M9HA 2FKPA 1FH9A 4NI8A 4LNCA 4DJFD 1MZRA 3E96A 4AWEA 4P8XA 2QCMA 4M6UA 4O13A 1TWDA 3B8TA 1ONWA 3H4WA 4H9UA 1W5OA 2BNJA 3TAOA 3NGFA 4KPLA 3B9AA 4JHZA 4AD3A 3L5MA 1TPEA 3STFA 1BRLA 5G1TA 1AG1O 2X1UA 3LQLA 1DXFA 1NEYA 2VL4A 1DWHM 1DHKA 4F2TA 4FK9A 1U1HA 1PIGA 3LZ5A 4IZGA 3RR1A 4Z1CA 4L64A 1GORA 1UKTA 2FFIA 3C0JA 3H8AA 2FZDA 4UTTA 4LAUA 4ML4A 2A3BA 1FDZA 3WUFA 1ZL1A 2YX0A 5HUPA 5HNNA 2ACQA 3FEMA 4MUZA 1SO3A 1VJSA 5E6ZA 4P8UA 5LIUX 3BGGA 2OEMA 1CEOA 4OQVA 1GWJA 3C86A 3BAKA 3N2TA 3TVAA 4MB5A 2FB3A 1PV8A 3QQ0A 4H19A 1NTHA 3ZIZA 3ZJKA 3BLPX 1TCMA 1KFCA 3GDLA 3Q4DA 2EG6A 1XI3A 4O4VA 2FLIA 3QR3A 5D09A 4D6GA 1GQJA 2OSXA 1SFSA 1Q7MA 2VFEA 3BLLA 3LI0A 3F4CA 3S9IA 1TZ9A 3WJWA 1WA3A 3NAVA 2GLKA 3BDKA 4R7WA 2X16A 3H2NA 2PDYA 4JX4A 2Y5EA 4OGZA 3A24A 2VELA 1KO0A 3V75A 1QNQA 5F7UA 4HZ6A 7TIMA 4DX3A 2RGMA 4NZFA 3MHFA 1X6NA 2OLSA 5AHFA 2C7FA 2CKSA 3ENLA 5HDRA 2WPBA 3ITYA 1DXIA 2WVVA 1LRNA 1Q65A 4S23A 1UIOA 2QPSA 1IZKA 2J62A 4XUYA 1K8XA 4DPQA 1JF5A 1LWHA 1MUWA 1OC6A 3VD4A 3V1PA 4IIFA 2A4AA 3TWBA 4AISA 1FQ0A 3LTYA 3TXVA 1W5NA 4LEQA 4AHPA 2E0PA 5D03A 4AIBA 1I0DA 3WD2A 1EXBA 3QV9A 4HMCA 1B57A 1EB3A 1OCNA 2HPIA 4D1IA 1TQXA 4ADSA 3GNRA 4RZ5A 1MDLA 1WDWA 4DZ5A 1GGOA 5EB8A 1TSIA 1UHVA 3EMCA 4ATDA 4R34A 1UD3A 3ZM8A 3PP7A 1VYRA 5AN7A 3M0HA 4S3GA 5DANA 3SN0A 3L23A 3PUOA 4HK5A 4AY8A 3KUMA 3BXWA 2QGYA 3UU0A 3NQMA 2FJKA 4IGNA 4N9CA 1I6NA 4J3UA 3P0XA 1OFBA 1MVYA 4M6PA 2CBIA 1KRCC 4HYWA 3QMSA 4KWUA 2VX6A 2NLYA 3CHEA 4WZHA 3BCFA 1EJTC 4DO7A 3TCSA 3CHCA 2OWXA 1B1YA 1IXQA 3W22A 1CI1A 4O16A 4EXBA 1CXEA 2A3HA 3T2OA 3STEA 1FX6A 1XLEA 4C6DA 4EE9A 1KV5A 1P0KA 3PBUA 4IWWA 2G50A 4GGBA 4H9VA 1ISVA 4FXFA 1UR9A 2W5FA 5C7HA 4C6CA 2GK1B 3V0TA 2EPKX 2VD8A 2J6XA 1LJYA 5DN1A 3V5OA 2F7FA 4JQAA 3NO5A 3L67A 1ZSXA 3DBNA 2VGGA 2O56A 2P76A 3S46A 1QBBA 2GVLA 4D6CA 3FKRA 4BWLA 2GK1A 1V7YA 2PC4A 3L0NA 3BV7A 3CUXA 4JY9A 4JX5A 4H8HA 4AG0A 5JIWA 2WSPA 2IQDA 3R94A 3H7RA 1YADA 3B0VC 2OT0A 1AD4A 2XN1A 3CNYA 3E5PA 1TV7A 1POJA 1GG1A 3EA1A 1CZ1A 3NZGA 5BWAA 1OYBA 2KX9A 3GXMA 3ZSSA 2ZXDA 3CUFA 1EJSC 3L4WA 1NOUA 3IV8A 1LL7A 4I7VA 4J4KA 3JZEA 2YGYA 3WQGA 3W7JA 1AJ2A 4A4AA 2G5WA 3C3NA 2ZXBA 4ATLA 2PD5A 3D5HA 3OODA 1RUSA 3BANA 3T8LA 3WEOA 3H23A 2XM1A 3GDMA 4YCOA 3TR2A 4Q4MA 3ARSA 4QCEA 3H2AA 3MHUA 5I03A 4G7EA 2OG9A 1X1ZA 3CQKA 4LXFA 3APTA 1UR4A 5GJPA 1TPVA 1PX3A 5AC7A 3JR2A 5H8PA 1F05A 1GVIA 4LQ1A 4XZNX 3SCWA 3OPSA 4S3JA 3UZZA 1ML1A 1LQAA 4NAEA 4HVXA 4I3GA 1ZFJA 1S46A 1BYCA 1QVBA 1V02E 1PO9A 1JEZA 3W1LA 2POZA 2BODX 5REQB 1I2OA 3CGTA 1IXNA 3N9KA 1DJYA 3K2GA 5ABFB 3ONBA 1DJQA 4MF4A 4QG8A 4IMAA 5DMYA 2PTYA 4YYCA 4PMRA 3BQ5A 2ZUUA 1PKNA 6PTDA 3H2EA 4YVPA 4PULA 4JBRA 3QHOA 5KZ6A 3UZYA 4WIWA 3R12A 2OPJA 2IPGA 1TA3B 4UTIA 1J6PA 3P5ZA 3GC5A 4CU6A 2QCEA 2OELA 3UXAA 2DV0A 5DF0A 2C91A 1LOLA 4L9ZA 3AS2A 3PWGA 3LPGA 4H9MA 5D33A 1E43A 2TMDA 3KVKA 2XINA 5G5IA 1GQNA 3I6TA 3VE7A 3DFNA 3MPGA 2HVMA 1XQLA 4WXZA 3QH2A 4GVIA 1FFRA 3H70A 3IV3A 1R2SA 1O60A 1E4IA 2W0UA 2Z0IA 5LZLA 4K38A 3VIKA 1R9YA 2EJAA 1DQXA 4B3LA 1PZ0A 4B16A 3CIWA 1CGYA 3B8VA 1R7OA 3MI3A 1JRBA 1JCLA 3ABZA 1EC7A 2FMNA 4CQBA 3E12A 4KFPA 4Q4KA 4IIEA 4J9JA 3KEHA 2D2JA 2XIJA 3UY8A 3WDQA 2A7RA 4FPSA 4ROQA 3VM5A 1F3EA 3M0JA 3IRSA 3FEQA 3OIHA 4LNYA 3VI2A 2ZUVA 3D46A 4JCMA 3CL8A 1ITCA 3PG8A 4FOUA 1U5VA 5BZAA 3AHXA 4MNMA 4QDWA 5GJMA 1MRAA 4QE1A 3WY1A 1XLFA 4AXNA 4LX4A 2J47A 3FK4A 1UJQA 1FDJA 3OW1A 4LOCA 3SCRA 2E8ZA 1AQFA 1JPDX 5CC3A 3MU7A 3DN5A 3CUZA 4I9MA 1H61A 1AL8A 1EJWC 4O50A 5L6UA 1XYMA 3U5YA 2X0SA 2V5CA 1FP8A 3N6QA 3O16A 2WCSA 3MBFA 3NQ6A 3EEZA 3M0IA 1YPFA 2VR4A 3QQ1A 3BAXA 3OLGA 1CGXA 3SSJA 4AZGA 1I9CB 3S1VA 3BGAA 4S2BA 3TJXA 2ZC8A 1VFSA 3DFPA 5C6MA 1SQ7A 2E1WA 3C2OA 1K03A 1H7NA 2V5KA 1DQUA 3GHRA 1UBSA 1PBGA 4NQ1A 5B7YA 1QW7A 2O7QA 4J2MA 4XTDA 2YXOA 1DJIA 1L6GA 4JTKA 3EBVA 3NVDA 4KBXA 3ZXWA 3THUA 3AXKA 3SQLA 1FWAC 4HPGA 4XBSA 3MP4A 3SCTA 2CZ5A 1UWRA 3PTQA 5D8WA 1W1A1 1IHIA 4WUIA 5FJOA 4PMVA 3TDFA 4MZ1A 3WLQA 3GU1A 1YBQA 1KD0A 5ECVA 3VKBA 5MKGA 1GQIA 3NZRA 3WH8A 3AUJA 2UV8G 1FWRA 4GY1A 3B97A 3B04A 3I3BA 4NNAA 1LROA 4I8YA 5DY2A 3EOSA 3OZPA 3PJUA 2ISVA 4HMEA 4A3HA 5A2AA 5ECUA 4DJDA 2GJXB 1Q6QA 3USBA 3E0IA 4MJ2A 1S2AA 2PDPA 3RF9A 3GVRA 1DWJM 4HPXA 3OGVA 3T07A 1R3YA 2VCBA 1ME7A 4LU0A 2YL8A 5AC6A 4XX6A 2WBGA 1UA3A 4GNJA 1RP8A 4ZO9A 2H8ZA 1BEUA 2INEA 4MZ8A 1C29A 3M16A 3LX9A 3DECA 4IQLA 2Z1WA 5FL0A 1PZ3A 2CLHA 3VGDA 4ERIA 4BFAA 2NQ9A 2VFFA 1G4EA 4RPPA 3C2YA 4JHOA 3A9IA 2PAJA 4ML9A 4AF0B 1PKYA 2XWDA 1OM0A 3WQ8A 4OBSA 3GKAA 4ACYA 1C7TA 3GXTA 1YXYA 1LUCA 3THDA 4HU8A 4CN1A 3VDBA 2X7VA 1LORA 2QMKA 1W31A 1KM5A 2QQ6A 5CLWA 4IL0A 2OYMA 3WJSA 2OODA 5FJTA 1PTGA 4AZ6A 3QFEA 3CV2A 2PE4A 2TYSA 5GQBA 3WLMA 1Z6KA 2YL9A 3AYRA 1NQ6A 3VX1A 4W86A 1E72M 4CKQA 2Y1HA 3VKCA 6XIMA 5BNKA 4YTQA 2ISWA 4GO9A 3OP2A 1D8CA 4DF2A 1XV8A 4HQVA 4FR1A 2QVHA 1ITXA 2ZVRA 4LRSA 2F38A 5CXPA 1B4EA 3E0LA 3PZVA 4W84A 3P0WA 4LYKA 1GKRA 3ITLA 1B54A 3URAA 3PBYA 1GK8A 1AFSA 3AWOA 3L66A 4NIRA 5K7JA 3B40A 3QSRA 2CWXA 1CBGA 3QSTA 1LDCA 2J27A 1PX4A 3HB9A 3FA5A 2R91A 5TAOA 3WEMA 5A8MA 5EU9A 4U3CA 3U3HA 5K3VA 4IUOA 5RUBA 3W9ZA 4BCEA 3HO8A 4U3AA 2Z6IA 4H9YA 3BG5A 4REQB 3CZGA 5J5RA 4U2YA 4KWSA 3W75A 1MXSA 1T8QA 3APGA 4YNGA 1W5MA 1Y0EA 4Y2WA 2BHZA 2F6KA 5HQLA 1UWIA 5DLCA 4JQ3A 1N7KA 2PF8A 2PDCA 3G5EA 1PKMA 4IJCA 3UJSA 2C14A 2I7GA 1JQXA 3SADA 1VEOA 1BSIA 3V18A 4LUYA 3MHGA 1R3SA 3RR4A 2NLIA 1CPUA 2GYIA 2ACSA 1ISXA 1TVPA 3C2VA 1HUVA 4DY1A 1Q6OA 1YIXA 2Q09A 6TAAA 3PZ9A 4J3SA 3VDAA 3HQNA 4KWWA 1XUUA 4O52A 4CD4A 1YYAA 1GJWA 2QCNA 2WNNA 4KWVA 1LF1A 2VQTA 3LEPA 1NF0A 3N6JA 1MW1A 2G3IA 5TF0A 1KBIA 3T44A 3GHTA 4DVOA 2ZZ2A 1BHGA 3VAVA 4W5ZA 1U30A 3L9CA 4LAKA 5D32A 4FIRA 4GIYA 5JBFA 4CNNA 1C8QA 3RPTA 5C70A 4QE5A 3GDTA 4LSBA 5I3FA 4QAWA 4QQ3A 2VEPA 3LV6A 4CD5A 5AFDA 4IIGA 4EP8C 3FXGA 1QOQA 2ZRVA 4W88A 3R58A 3TIMA 3FVMA 1JYXA 1KCLA 1X1NA 4O19A 3ZFHA 4NZCA 3RN6A 1FFQA 3IUDA 4CNOA 4R7JA 3CUHA 4QJ5B 3QYQA 3EWUA 1KFLA 3LGEA 5A8OA 2HRWA 4HNCA 1LRTA 4LVGA 2HEJA 4RV8A 5DRIA 1VEPA 1E56A 4PEKA 1XLMA 1WKYA 2PGRA 3AXHA 1G1YA 5C7VA 4NX0A 4K8HA 3W7CA 1J0IA 3L4VA 2ZOXA 2GDQA 4FNSA 4QDMA 1PUDA 2VUYA 3L4XA 5FF0A 2ZWZA 1E9ZB 3FHQA 2HBVA 3P7YA 1J11A 4JX6A 2WLZA 3UR8A 4IISA 4W8AA 4C6QA 4AW7A 2BVYA 1S3TC 2FH8A 2Y70A 3NURA 3SCSA 3LHUA 4AVFA 2QCFA 5FJJA 1W8SA 1VLIA 2AKZA 3EWZA 3CL7A 4Z2HA 1JI1A 2QAPA 1RCXB 4OOUA 4P5UA 3E0VA 4PMUA 1B3XA 1XIDA 3FGCA 1M7JA 5HJYA 1X97A 4M1BA 4CQ8A 1RLCL 1YXDA 2PTZA 4X63A 5HANA 1KCZA 1A5NC 1XC4A 2XFYA 4GZEA 3U8GA 2PCEA 3BVJA 3WQ5A 4ASTA 1Q5MA 2NQZA 4XVDA 4AZCA 4HCHA 5EMYA 3DFYA 3M5ZA 2XIIA 5MKGB 4LW7A 4W93A 3T40A 4Q7BA 4TX6A 1EBGA 2AMGA 3NSMA 1UWSA 2B7QA 2V81A 4C90A 2ZIDA 4P7LA 1GZ1A 3PBMA 2P5NA 3UWQA 4YYFA 2DIEA 3NQEA 4ACZB 2B0MA 1TELA 2H6RA 2ABAA 3GB6A 3N12A 2XSXA 3SRDA 8A3HA 1K9TA 5C8BB 4ORMA 4DUVA 5CJNA 4RW5A 4LVDA 4XZIA 3UESA 4WQ6A 1HKMA 1TV8A 2BVTA 4B90A 2BGSA 1C92A 1BQCA 5BU9A 1EBHA 4MJ4A 1A4MA 2I5GA 4FP1A 1JJKA 3O2LA 1X6LA 1TCDA 3SCVA 1TV5A 4PB4A 5EBAA 5C5YA 2YZRA 3IJ8A 2VM8A 4X2RA 2ZZ5A 3WLTA 4UXDA 3OYZA 3TMLA 1VKFA 1O68A 4R33A 3GYCA 1CGWA 2EPHA 3HG2A 2WMIA 2WZHA 1NQKA 2DUZA 3T6CA 2OTDA 3QJAA 3SB0A 4F4RA 4XQ6A 3CC1A 5FJPA 1TQJA 4CQAA 5GNYA 2X2GA 1EXPA 3MTWA 1AW1A 3W7PA 3H24A 1EYEA 2C19A 1W1IE 3S1WA 1K8ZA 1A5LC 3VK5A 3ARZA 3BOXA 3TSMA 1OCBA 1UD8A 3Q58A 4F0KA 3CAKA 1JPIA 3SY1A 4AD2A 4HHMA 3O6AA 3S2JA 3N15A 3TTEA 3ELFA 2E8YA 5LGZA 3W1AA 1QW8A 4PMZA 4XKYA 5CC5A 1OD8A 2H9AB 3IJ9A 4JTCA 3VNMA 1VEMA 4KRTA 4H8UA 4B5UA 1QDSA 4PUEA 3N73A 1IZJA 2BXYA 3EWCA 1WDPA 3DZ1A 3UA4A 1W1VA 3VKDA 3W86A 4UR7A 3E9AA 3KBVA 3SRFA 2CEQA 4M80A 4MAVA 4FR6A 1W1YA 3SN1A 1CYGA 1FHUA 2VEMA 4KIEA 5IHSA 1S5WA 3VNKA 1UB3A 4RE4A 1WNOA 2VEIA 4MKSA 2XFRA 1XM3A 4JTQA 5D4YA 1QPOA 1F74A 4NAFA 3CZLA 1MSSA 1UROA 4EPEC 1UBPC 1FWIC 1J01A 1R3VA 3SO7A 1J8VA 1QNOA 3QLLA 2J7CA 2HK0A 3S5ZA 4TVDA 2YCEA 1NH6A 3W2JA 5FD0A 3I7RA 2CHNA 3SFKA 1GEHA 3GNOA 2JE8A 1SR9A 4IFKA 4GQQA 4MLJA 6TIMA 5G2IA 3ZR5A 3UR5A 1EIXA 1TTJA 1W9VA 3KLKA 3NUKA 1FWBC 2ZKMX 3LCIA 1Q2RA 3NSNA 3M0KA 3REQA 3VIHA 4UCGA 3WK1A 4J3WA 1R3TA 3UG3A 4OUEA 1FA2A 3T78A 3DH7A 2ZUMA 2X1IA 2UY5A 3CJPA 3KOZA 3PTMA 1B9ZA 4S39A 1PJ9A 2A6NA 3W1XA 2CBVA 3DFSA 5I00A 3REQB 1XH1A 4NF7A 4NG3A 2VVSA 1VBHA 2I5QA 4IPIA 3DCPA 5E70A 4WEVX 4U4MA 3STPA 4BEQA 4B5TA 2FIQA 4JEJA 1TIWA 1D7FA 4KGLA 1OZQA 4EACA 1UKQA 4GH3A 2WAGA 1E6QM 3NPUA 4GJIA 3GXPA 1DJHA 1H0IA 1HZYA 1UUMA 2YKKA 4Z0SA 1TZ7A 1ELSA 4QHRA 2R1KA 2BZNA 2OQYA 2HVNA 3DFHA 4C7GA 3GC2A 2ZC1A 3M0MA 1Q6GA 3P5YA 1UKPA 1A3XA 3TMQA 2CYGA 3RMEA 2A3AA 2WMJA 6ALDA 2AMXA 3WLOA 2XVPA 1HF6A 3K5XA 3SIZA 1Q8JA 2VKZG 4R5EA 2NSOA 3TH6A 3DI0A 5FOOA 6REQB 1ME9A 4J3VA 2XHYA 4DO6A 2RJHA 2C71A 1CXKA 3H2CA 3S9YA 1D2KA 2IKJA 1THFD 4R9XA 4UTUA 1KCKA 3UT0A 4ZQOA 2C15A 1E3ZA 1K6WA 3UWZA 1P6BA 3K8LA 3VD3A 3LHTA 1BWLA 4GFIA 3W1PA 4L9YA 2ZA1A 3TYDA 3WFAA 3CPUA 2VCAA 5GNXA 3W85A 3MCNA 2VOMA 4GC3A 1FCBA 2I14A 1AH4A 3HGJA 1JVNA 4QXIA 2PS2A 2DSUA 2FVLA 2VO5A 1F6PA 2QZRA 2YB4A 1NY1A 1V0KA 4XAPA 1F8MA 4DUWA 3WQEA 1PB0A 1J6OA 2VC7A 3P74A 1PCKA 2A7NA 2FB2A 4DNHA 3LHWA 1G5AA 3VUSA 3NYZA 4D8ZA 3GNDA 1MW3A 5LNSA 4ZODA 3GSMA 3BAJA 3MSGA 1BKHA 1PHWA 1Z89A 2P1FA 3G1XA 1GYMA 1V3JA 2AOSA 4I5XA 4F66A 1VFOA 5E0CA 1EZWA 3E3HA 5AVNA 5I3KA 1U5HA 1A5SA 3BJFA 2W67A 3M64A 4MTVA 3T0AA 4B5VA 1FBAA 2WC4A 3UZJA 2G95A 4PMDA 4ZMGA 4CD7A 4XIMA 1KWKA 3M5XA 4GACA 1R87A 4MLRA 1Y5XA 2VGBA 4Y9MA 4GZ7A 1OCQA 4HHLA 1LLWA 1XHGA 3V4BA 4LYQA 1NVMA 3G24A 1WB0A 4XO6A 3AISA 4LVFA 1EYWA 1W9XA 3RU6A 4M5PA 4I90A 1K6AA 3MB9A 1RVKA 4L61A 1YDVA 1ISYA 4L1XA 5J8LA 2RHGA 1GUVA 5FL1A 3PSWA 2Z00A 3MVIA 3TROA 1HGYA 4PMJA 2CZFA 3F5JA 4GYPC 3DENA 1ZCOA 2NV2A 3QKZA 4LB3A 3UYIA 1Z48A 1PZ1A 1OCJA 1OIFA 1MQRA 4US5D 1R3RA 3C0LA 3NPWA 1WCGA 1VF8A 2JF6A 2WZIA 1Z8AA 1PL9A 1YNYA 2NVDA 1GVOA 5HATA 4WR3A 1EDGA 1Z7AA 3C6CA 3VNLA 2VZTA 1VQTA 1GJPA 1M68A 2YA0A 1I4NA 4GVHA 3IANA 1A3WA 2OFJA 3GD6A 3HJEA 1MDRA 2WHKA 1YMYA 3IIOA 1PX8A 4LS1A 3BCJA 2E09A 4LTSA 3GVWA 4DBDA 2GGHA 2X1SA 2ZVIA 2PLCA 4C5YA 3WF0A 3AS3A 2FTWA 1HKWA 5LIXX 5DY3A 4YCPA 3VPLA 3ARRA 2OGJA 3SQSA 4NILA 3CEUA 1HT6A 2I5IA 4ZE4A 2BP1A 4Z1DA 2PWUA 3V36A 3VVGA 1I1WA 2YCKX 3CUGA 2DORA 4X9YA 2BDQA 3OQEA 4R3UA 3CT7A 3ARYA 1SFJA 3HZ3A 2DVUA 4ADUA 3MUAA 1TB3A 2C16A 2ASHA 5HPOA 5C9RA 4JR5A 5D9NA 3AI0A 3BJTA 2VR5A 1UG6A 3G0SA 4F0SA 4PB3A 1ZJBA 4FO4A 1XL9A 1MMFA 1ZTVA 3FLUA 4UQDA 4UUIA 4GABA 4MB3A 4E2BA 4GIRA 3F5LA 4UTWA 4Z2KA 2W9MA 4M6VA 4FIQA 3FA4A 1J4EA 2PD9A 4UZUA 4M24A 1T7LA 1FWCC 3TNBA 1KM0A 3AZTA 3NQAA 1FCQA 2D0GA 4PBGA 2GUUA 2QPXA 3B9OA 2OR2A 5HNUA 3O0KA 3GIYA 3I65A 1RHCA 4AZCB 3ORWA 3MO7A 3MUCA 4N4PA 5BXPA 2OKOA 4MWAE 5D04C 3RM4A 1WUFA 4IPLA 4Y9PA 2RDWA 1XG4A 1HNYA 4I5RA 3BZJA 2J74A 3W2UA 2PLJA 2AL2B 4QLJA 3RIKA 4GNKB 3GW3A 1XR2A 4JTJA 1XBXA 4H2HA 5CZJA 2D22A 4BF5A 1RP9A 1W17A 4GKTA 1RK5A 4G9PA 4DM1A 2YB1A 3EMQA 2QV5A 4EOUA 2CU0A 4RJEA 1CNVA 1RVGA 3HIJA 1OX5A 4QITA 3PFMA 4O14A 4QSHA 4EAYA 5ABFA 2ZTJA 3MWCA 1K7EA 1LLOA 1XF0A 3GTIA 5CPTA 4Q6JA 2E9BA 4JNZA 1ICPA 3CMFA 5REQA 3UJEA 2DIKA 4S38A 5BRQA 3R1ZA 1A5UA 5T9BG 3APYA 3OGSA 5E6YA 3TN5A 2QUNA 2V3FA 1IT0A 3VFCA 3O6DA 2GSHA 1HJUA 3QOKA 4DXXA 4OV9A 2XVLA 4I9JA 5C2CA 5K2ZA 3OOQA 1GOXA 4K36A 1YXCA 2IKHA 1GVRA 3A47A 3TW6A 3WBEA 3TXZA 2WM1A 3MKKA 1V0LA 1SSGA 5U4NA 4UOJA 1XLDA 1RH9A 4WGXA 4UWMA 5FAJA 4FF5A 4OTKA 1LZOA 4A05A 5TD4A 2E67A 1XYBA 3TONA 1B31A 3MSDA 2YBTA 4H41A 3FDKA 1NWSA 2CHRA 3GDKA 4JZ5A 4TMBA 1F61A 2BXVA 1R5YA 1V6UA 5EGRA 4TV6A 3EX4A 1E6XM 1Q6EA 3E1F1 2W3ZA 3RG6A 3TJIA 4PZVA 3RPDA 1Q6DA 1KM2A 4BQ4A 2J6VA 1C91A 2P8BA 4NAFB 5IOBA 4MB4A 2ZZ4A 2DVTA 3GZ3A 3QEZA 2HTMA 1Z32X 4ZQPA 4ICNA 1BXCA 2Y7GA 2WB5A 1SMAA 3KL0A 1JAEA 2CCRA 3W1NA 4S1FA 4LANA 1VFUA 1WBJA 4JYFA 2WVVB 5E1QA 5C54A 1BG4A 3QZEA 3ECQA 3C8NA 2NUYA 1F3XA 2IQ0A 2VT0A 4KEMA 5A94A 4FA3A 2D3LA 3IIZA 3BJSA 1B3WA 2FTPA 5HOSA 3H2FA 4GXPA 5DXXA 1ZP4A 2WMKA 1OFRA 1NF7A 2OCZA 3CQJA 1REQA 4MPKA 3K8KA 3DAQA 2O9TA 1H1YA 5M2FX 2MANA 3PWAA 4M82A 1P0EA 1TJ0A 5CLTA 2HVOA 1FWSA 4CEXC 3HM7A 2PRLA 5E9AA 4RPQA 4XBKA 4S3CA 3M7SA 1CCWB 2GVJA 2QW5A 3W73A 5CJ5A 3G1VA 1RJPA 4XZHA 1W37A 3OEXA 3PZGA 2V68A 1B3ZA 4AZHA 1HKKA 4RE0A 1VHNA 2VUNA 1Z9AA 3W7OA 1GQLA 4PTMA 2RUSA 4AZBA 3I3DA 4N2YA 2TSYA 5FF3A 3VNZA 3BLDA 3NPVA 4GZIA 4EPKA 2E6FA 1VZWA 3ABQA 1UKOA 4YU1A 3S5NA 4E3VA 3NZ1A 2NUXA 5BXSA 4NRSA 1GYLA 3MSRA 3GR8A 2WBKA 3B8SA 4HOZA 1DIOA 1FKXA 2DZAA 2FZ9A 4YJ5A 4LAOA 3TC7A 3IGXA 3FJ6A 2C0HA 4JTAA 3ABOA 3RM9A 4HK7A 1YE6A 2GJNA 4E2OA 3L5LA 3ARPA 3TN4A 3EB3A 1UCWA 5IDIA 1G0CA 2VRQA 7CGTA 3GS6A 4H7ZA 4NX5A 4M56A 5H6HA 3WX7A 1RQBA 5TIMA 3UCQA 2FHBA 3FCPA 1FWJC 4DB7A 1ICQA 3KTSA 4M29A 3UY7A 4CN6A 2PF0A 4U2ZA 2Q6ZA 4HN8A 2FMOA 4URIA 3W7QA 3R4IA 4KEVA 3WBYA 1E51A 4ZOBA 4BQ3A 4C6BA 2A3CA 1QJWA 3W3OA 4EWJA 1EGZA 4KIRA 3GR7A 2ZX9A 4XB3A 1AJZA 2VENA 4PYSA 4NZ4A 3QXBA 3DC0A 1LQ0A 4OT7A 3QY7A 3FA3A 5I3IA 3CTLA 2E28A 3M0LA 1OG0A 3ARWA 4R9OA 2DDXA 1XUZA 1HVXA 1H3GA 3JW7A 4LBSA 2WMHA 4B9YA 2CLEA 2UZ9A 4PUDA 3LCXA 3WLJA 2I17A 2DIJA 3WDIA 3FJLA 3KBJA 1G01A 3NM1A 3A4XA 3W7GA 4ZQRA 5D37A 4TU1A 1QHOA 3AHZA 1C93A 1Q66A 3OVPA 1XGEA 3N17A 2RJGA 1PHQA 4GOAA 1KWGA 1DIEA 4J3XA 1VAHA 1UR2A 2QJNA 3OTRA 3PM6A 2P8CA 4HA1A 3VIFA 1LBLA 4C6KA 3TC3A 4Q7IA 3RAOA 3NL2A 3E0FA 1KA9F 4ZFCA 3N2XA 5A5WA 1KXTA 1JXJA 3SECA 2I1OA 2XG9A 4C1KA 2FHCA 2Y61A 5CPOA 4EF9A 4B5NA 2DZVA 1G6CA 1XRSA 3F2BA 3OBKA 3BLKA 4QM1A 3UXKA 1KV8A 3LERA 5BOFA 1XS2A 3AXMA 1GVEA 2WM0A 3FYPA 1KLYA 1SW0A 1JZ6A 4I9TA 1ZJAA 4YTRA 3V16A 5AHNA 4L1GA 3RO6A 3WLSA 2J4GA 4UNIA 4BQ2A 1SZFA 3W72A 4PBEA 5B7ZA 3EDKA 4ORIA 2G4JA 2HMCA 1R47A 3IUIA 1HL8A 4L7ZA 3B8DA 5DO8A 1ECEA 3ARUA 4RDWA 4MJMA 3LRLA 3AYSA 5D2XA 5A2CA 4A3QA 3SUVA 3PPHA 2P3ZA 5I06A 4HMDA 2OT1A 2UBPC 4QP0A 2HV5A 7ENLA 3TLQA 3P3BA 4F9JA 1E4NA 4GA8A 1EX1A 4EVZA 5BU6A 4DHGA 1BLIA 1XLCA 3EXRA 5LA0A 4GJ1A 5G4EA 4L5ZA 1OC5A 2DY3A 1KM6A 1WZMA 3RMJA 1VJZA 3KTCA 1MO0A 4PRTA 5CPMA 3FDGA 2IKIA 1XLLA 3H7VA 3KVJA 3CO4A 3R11A 3CZJA 2EKGA 3M0YA 1QNPA 1UD4A 3GH7A 3N3TA 2FJUB 2PTXA 1V77A 3VOFA 2EBNA 2GJLA 3ARVA 3HTWA 1WX0A 3W02A 4GINA 2E25A 4N02A 2R94A 3WIJA 4DJDD 1AK5A 5T91A 4S3DA 4EWND 3ITCA 3MMTA 3TEVA 3WJXA 3LM7A 3AFBA 3BTNA 3BLOA 1WZKA 3PZOA 4F0MA 3GU9A 3S5YA 4XUGA 3NQDA 3CB8A 1J12A 4A3RA 1CXFA 2ONEA 4IFOA 2YDRA 2PWFA 2CLIA 3S6DA 4A8RA 3GFYA 4DM2A 1E0XA 2AQOA 1RBOB 3QV8A 3KDNA 4I5UA 3HG3A 3FXYA 3K1DA 1PEZA 3LXAA 1VYPX 1ALDA 1JNEA 6ENLA 4OE7A 3CMGA 1F07A 4CNUA 4RNJA 5M5DA 4RXFA 2XSAA 2PWGA 2PDIA 1LUCB 1QNVA 3GNPA 4Y9AA 2DZPA 4MYAA 5FJRA 3ZWSA 4DWSD 3PK7A 2E6DA 3K4WA 4WY0F 4A2SA 3A5VA 2GWNA 1BF2A 5AZ1A 1CLXA 3KCOA 3LN3A 2VD9A 4HCLA 1EGMA 1TPFA 1P1MA 4GCAA 3H4XA 3RCYA 2J24A 4I7WA 1JFHA 2EJ1A 5M3WA 1R7AA 3HA1A 3B4YA 3TV8A 2PGEA 2GUYA 2NX1A 4UTWC 1FTXA 3ARTA 3AU2A 2D2OA 5AC5A 3PTKA 4BQ5A 2NQ5A 3TTQA 3ME3A 3GG7A 4WDWA 1CX9A 4JN7A 4KS0A 2WQPA 2A1YA 1YX1A 4UTMA 3TTSA 4YHEA 1JUBA 3R89A 4FLSA 3POHA 2ZDRA 1LG2A 1KQYA 1TUFA 3GBDA 4E3TA 4EK7A 1R38A 3LDVA 3WLLA 3U2CA 4LPCA 1GONA 2OZ0A 2DQWA 5C71A 1V6WA 1EUNA 1H62A 3PAOA 4AX6A 2E40A 3WNKA 1OK4A 3GVVA 3AIVA 3NDOA 4E4PA 2C13A 3QGKC 3MWAA 1GVSA 4XK2A 1VH7A 4O18A 1QOXA 4BR1A 3GO2A 3AMLA 1EF2A 2DUAA 4WSJA 4BI5A 4JCLA 5A95A 1K4HA 3UEQA 4W9TA 3M1ZA 2PDWA 3O1NA 3R13A 1JCXA 4BKNA 3E5BA 2GGJA 1MYRA 3CHDA 5FCZA 3RX4A 1MRQA 2FH6A 3ZR6A 3G1HA 2PLMA 4CVWA 3BCDA 4S2CA 5K4XA 7REQA 1HIZA 4X60A 4E8GA 4W8LA 4M51A 4OBRA 3DKLA 3PB2A 4PMXA 1XIGA 1UR1A 4QG6A 5CZ0A 4MNLA 4ZTYA 4PE8A 1QW9A 4GI6A 3BG9A 2VQUA 2VZUA 3U2ZA 2J79A 2NXIA 4PGLA 2Z25A 5CZSA 4B9ZA 1FP9A 4FNQA 1H1ZA 1B30A 4V27A 3AUOA 1S5TA 4XZ9A 2R8WA 5EMJA 3WEZA 3AXIA 3G1RA 2ZFAA 1O94A 4ES4A 2PDJA 2XUCA 3BLEA 1CGTA 2DUXA 1Q6CA 3P60A 1JDFA 5SWUA 1QXLA 1W6TA 3MMWA 1X39A 2I9UA 2A3EA 3RRAA 3ZZ1A 3RLVA 1Q7ZA 1X96A 3SZ8A 2AAAA 1UQYA 1I2QA 2CW6A 3WH9A 4AZ5A 4ZA0A 3TA9A 2X7WA 5JH1A 1A5KC 2VEGA 5CSRA 3B8IA 3EX3A 3RLGA 4QLLA 2ISSA 3IUHA 3VCNA 3WMCA 3VXGA 4WDXA 1TJRA 3KXQA 3SAZA 3EWWA 5HWJA 3B8WA 3E2SA 5EYWA 3LD5A 4X9SA 3QGAC 2A6LA 3AIBA 1DWGM 4IGHA 1W32A 1A4LA 2VZSA 3T1GA 2IQTA 4XKYB 3WUGA 1IEWA 4A21A 1SZNA 3NDZA 3N04A 4AEEA 3YPIA 3W88A 4L6OA 1HP5A 3FIGA 1TJ1A 1B3VA 1HXJA 3OA3A 1W3KA 1JCYA 2H3BA 3VOHA 3CIVA 3QR0A 3C0QA 3EXSA 3TOPA 5EY5A 3R2GA 1BTMA 3CO8A 4ZO6A 2Z4GA 1UPMB 4AYSA 1RCOB 1AA1B 4M3PA 2PCQA 4KEZA 5A1AA 1XDJA 1UR0A 4PUWA 1LQ2A 2QDHA 4HSOA 4JIQA 3MO4A 1S2CA 4PSRA 3MT1A 1UH2A 1SO4A 4XIAA 3CU2A 1V51A 4XZMX 3G3MA 2BSLA 3T2QA 4JHMA 1ODZA 3MP3A 4O17A 3T0DA 4MY8A 2F9RA 1UZHA 5I09A 1Z42A 2ZRUA 1F4HA 5A6JA 2GQ8A 2V63A 3LS9A 4NKCA 2F6UA 4H00A 3RPMA 3ZJ6A 2PU0A 3VMOA 1M03A 3ES8A 1YW1A 3KRSA 4KETA 1A5OC 4QFUA 3BW2A 1ZBVA 1RJRA 3TFXA 3W74A 3DG7A 3NOYA 2NWRA 2DZSA 2REQA 1TYGA 3WF1A 2PDQA 1V6TA 3WNPA 4I8DA 3J7HA 3BZGA 3BC9A 4M6QA 5D05A 1GG0A 4AY1A 2PLKA 5BOEA 4ZB0A 5K9XA 1D3CA 4ECLA 2ODOA 3FAXA 2EPLX 3FV9A 1FWEC 3WLPA 3NZPA 3EA3A 3ZLGA 3NL6A 4HMNA 1AD1A 3CMJA 2XIQA 1B90A 4AD0A 3WL1A 2HNHA 4YLWA 1A5MC 3OJGA 3O3RA 3TCEA 4BI7A 1IQ8A 2NWSA