1KRMA

Crystal structure of bovine adenosine deaminase complexed with 6-hydroxyl-1,6-dihydropurine riboside
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
349
structure length
349
Chain Sequence
TPAFDKPKVELHVHLDGAIKPETILYYGKRRGIALPADTPEELLNIIGMDKPLTLPDFLAKFDYYMPAIAGCRDAIKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVQAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDTTLYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of bovine adenosine deaminase complexed with 6-hydroxy-1,6-dihydropurine riboside.
pubmed doi rcsb
molecule keywords adenosine deaminase
molecule tags Hydrolase
total genus 118
structure length 349
sequence length 349
ec nomenclature ec 3.5.4.4: Adenosine deaminase.
pdb deposition date 2002-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1krmA00
1ITQA 1VFLA 4YIWA 4MUPA 4DO7A 2GWNA 4IGNA 4J35A 4HA0A 1XRTA 3URQA 3WZ0E 1UMLA 1HZYA 2ADAA 2YB4A 1RK5A 3ISIX 3PANA 2Z27A 4IFRA 2HPMA 3K4WA 4H9ZA 3A4JA 3LSBA 1E9YB 4C6NA 4B91A 2GSEA 3QGKC 4ERIA 2HBXA 4GY7A 1FWIC 2Q01A 2BGNE 4H9UA 1ADDA 3PNUA 3E38A 2R1KA 2ZC1A 4CNUA 4ERAA 4RDYA 1QXLA 2HPIA 1YNYA 1W1IE 4F0RA 4DI9A 1O5RA 3LSCA 3K2GA 1ONWA 4XAGA 2D2HA 2D2JA 3MKVA 4ZSTA 3S2JA 1FKWA 3F2DA 2Z26A 4LCRA 3E3HA 1V4YA 3NEHA 4C6FA 1FWDC 3S2MA 1UIPA 4XAYA 4QS6A 3MVIA 1FWEC 4Z42C 4EP8C 3B0YA 1YRRA 2QVNA 3GU9A 3NURA 2VHLA 4RDVA 2ANUA 3GTXA 3IARA 3GRIA 3KM8A 3WMLA 2YB1A 4B3ZA 3DCPA 2CZVA 3DC8A 2DVTA 3EWDA 3F4CA 3AU6A 4H9YA 3OOQA 4GBDA 2YXOA 4C6LA 4R85A 1YIXA 3OQEA 3PAOA 4RDWA 4DLFA 3GTFA 4KESA 3QGAC 3DUGA 4L6DA 1NDWA 1POJA 2O4QA 1P6CA 1A5MC 4DZHA 4QRNA 1K70A 2Z4GA 2FTYA 2OODA 3LU2A 2Z24A 4KETA 1J79A 2I5GA 3E0LA 4IFOA 2Z7GA 4LAMA 5HMEA 4AC7C 1A5NC 2BB0A 4CNTA 3UPMA 3LY0A 3URNA 1JGMA 3QY8A 1M68A 2VUNA 4C6PA 2PGFA 3UR2A 4H9XA 2A3LA 2Z29A 4EPEC 2PLMA 3GUWA 2OGJA 3UR5A 1NDYA 1S3TC 2DVXA 1R9YA 4C6MA 3O7UA 4P5UA 1A5LC 1I0BA 5HMFA 3AUOA 4H9TA 3TN3A 2UZ9A 4KQNA 1FWHC 4ZSUA 3LS9A 1P1MA 1ONXA 4PBEA 4C5ZA 3IRSA 1KCXA 4I6KA 5E5CA 4C6QA 1A4LA 4WGXA 1M65A 5CH9A 1NDVA 3HPAA 4C6BA 2PUZA 4LH8A 3GTHA 3S2LA 3CAKA 3URBA 4LEFA 1KRMA 3MVTA 2D2GA 4EPDC 1FWCC 2IMRA 1EJWC 3SO7A 4EPBC 5LXXA 4G7EA 1GKRA 1WXYA 1EF2A 4NI8A 1J6OA 1FWJC 5G4HC 4LALA 1RA0A 3PNZA 1EJRC 1RK6A 2WJDA 1IE7C 3MJMA 3S2NA 4GX9A 2EG6A 5FSDC 4H9VA 4IG2A 4PBFA 4UBPC 3TN5A 1EJTC 3OVGA 4HK7A 3TNBA 4C6JA 1E9ZB 4BJHA 2ICSA 2P50A 4E3TA 3IV8A 3A3XA 1RA5A 1XWYA 3QY6A 1K1DA 1RAKA 3R0DA 1YMYA 2QPXA 2Z28A 3MSRA 4J2MA 4LAOA 1WXZA 3UF9A 3F2CA 1EJSC 2E25A 2QS8A 3B0XA 4PCPA 3GU2A 4V1XA 3C86A 4DYKA 2W9MA 4D8LA 2VC5A 2FTWA 4DLMA 4V1YA 2QT3A 1DPMA 2UBPC 3LA4A 4XD3A 4C6KA 3GIPA 4BY3A 3IACA 2XIOA 4G2DA 4F0SA 4GYFA 3RYSA 1P6BA 2F6KA 2WJFA 2Z2BA 4LFYA 4KF1A 3MPGA 3GU1A 4IH3A 3GTIA 3RCMA 1EZ2A 4F0LA 2FVKA 2YZ5A 1KRCC 4DIAA 4XD6A 4C60A 4QSFA 4GY0A 2R1MA 3CJPA 2KAUC 1XRFA 1EJVC 4RE0A 4XAZA 4C65A 4LANA 2OB3A 1O12A 4DNMA 4GY1A 1NFGA 1RJPA 4G7EB 3F4DA 1PTAA 3LGDA 2O4MA 4M51A 4JOMA 2OQLA 3A3WA 3RN6A 4DI8A 3LNPA 4UB9A 4IG2B 5HMDA 2GZXA 3OU8A 4CEUC 4KERA 3URAA 5A6TC 2FVMA 1RJRA 1XGEA 4GOAA 2DVUA 2RAGA 2VC7A 1QW7A 4GZ7A 4B90A 4AQLA 3FEQA 3IPWA 4XD5A 4QS5A 4EPKA 3F2BA 2GWGA 4ICMA 4C5YA 4R7WA 2HQAA 3OJGA 4IGMA 3MDWA 3T1GA 4INFA 3GIQA 3FDGA 4LCQA 1M7JA 2PAJA 3O0FA 3ORWA 1V77A 4CEXC 4TQTA 3BE7A 3HTWA 4IFKA 4IF2A 1KRBC 4GK8A 4OFCA 3OODA 2R1NA 5AKQA 1BF6A 3B40A 1UBPC 4PCNA 2E1WA 4LAKA 1PSCA 3D6NA 1EJUC 4BKNA 3MDUA 4KIRA 4ERGA 2HBVA 3E74A 3MTWA 4LCSA 3IGHX 4IQJA 4CQCA 2OOFA 3ID7A 4C6OA 3CS2A 1K6WA 3N2CA 2AQVA 5FSEC 4B92A 2G3FA 4QROA 3EWCA 4CNSA 4C6CA 4WVXA 2WJEA 1GKPA 1PO9A 1V51A 4XD4A 1R9XA 1YBQA 3PBMA 2VR2A 1UIOA 4GC3A 3E2VA 3HM7A 4KEZA 2EG7A 4KEUA 1PB0A 2R1PA 1GKQA 4RZBA 1RJQA 4J5NA 4C6DA 1FWFC 3IJ6A 2FFIA 1V79A 2GOKA 3SFWA 1FWGC 2AQOA 2I9UA 1FWBC 2AMXA 3AU2A 4NG3A 4HJWA 4C6EA 4WHBA 4CQDA 1J5SA 1A5KC 2Q09A 2Z00A 3NQBA 2PGRA 4I6VA 2HNHA 1J6PA 4HK6A 4L9XA 1EJXC 4C6IA 3T81A 2WM1A 4IFKB 4XAFA 3V7PA 2VM8A 1NDZA 4KEVA 3S4TA 4PE8A 4CQBA 1A5OC 1KRAC 4GXWA 4R88A 1POKA 3WYZA 4NP7A 1A4MA 1ZZMA 2R1LA 2P53A 3LGGA 4QTGA 3QY7A 1FKXA 3T8LA 3ICJA 1FWAC 3TN6A 3JZEA 4HK5A 4GX8A 3EGJA 4H00A 1I0DA 1V7AA 4H01A 2EG8A 3TN4A 1EYWA 1R9ZA 4H9MA 1YBQB 1ITUA 3K5XA 2Z2AA 3GG7A 4RDZA 3RHGA 2Z25A 3ITCA 4DZIA 3G77A 2Y1HA 3UBPC 3E0FA 3FDKA
chains in the Genus database with same CATH superfamily
4QJ1A 5I23A 4RCXA 4ICCX 2QCNA 3CV1A 1FFQA 1XM3A 4BI5A 3FJNA 4HA0A 1JPDX 1M1BA 3ABXA 3CEUA 2YB4A 1ZCCA 3T44A 1XCXA 1EO5A 4IMGA 3RILA 4MVAA 1E6RA 2GDQA 4LSBA 1THFD 3CIXA 4HZ8A 5D33A 1P7TB 3H70A 5I79A 4B5XA 1E40A 5HINA 1ELSA 4X3ZA 5HQEA 4TUFA 2NX1A 3AZTA 2J7FA 1XYLA 3GNDA 1Q45A 1B3YA 4LBSA 3WF0A 5LIKX 5C55A 5CGTA 1FKWA 1SW0A 4PTNA 4PZVA 3E3HA 4KCVA 3JRKA 3TSBA 4AD5A 1EQCA 3VNKA 1DL3A 1FWEC 4E3VA 5IOBA 3HFYA 4L9ZA 2NLYA 3OGVA 4O4WA 3U2CA 4UMAA 1JPIA 1LLOA 2DH3A 4Y2WA 3LV6A 3WF4A 5CGQA 3WF1A 1KV8A 1ZTVA 1DV7A 3SQLA 4EXQA 4FLQA 4FX8A 3H53A 2GSHA 1JCNA 3GTFA 4NKCA 2JF6A 1W3IA 2FQIA 1MUMA 4XZLX 3MI6A 1XIDA 3IJLA 4QAIA 1UASA 4IX0A 1XXXA 4R33A 4GJ1A 1XG3A 3MV01 4KH2A 4TX6A 2J4GA 2QZRA 2I16A 1LJYA 3WLTA 3R79A 2X09A 1E6PA 2XFYA 5F1VA 4FXFA 1PZ0A 4DUVA 3ONBA 2V82A 1T8XA 3EX4A 5LIWX 1UWSA 1PE1A 1LTDA 1KCXA 2R14A 5EMUA 5E5CA 2OMAA 3HMJG 1UWTA 5D30A 1IZKA 3HFTA 4R5EA 4EKJA 3VK5A 1OT2A 4UTUA 4O1EA 5LNVA 3A4XA 1LT8A 1OX5A 1UR0A 1VAHA 2ZUMA 2Y5JA 1E4MM 1M7XA 3FN9A 1A53A 1EF2A 1BFNA 1E9LA 1Q6RA 1RA0A 3TXVA 3Q94A 2P0IA 1XYFA 1I60A 5EMLA 4H9VA 3BSGA 1TUFA 1H7WA 3LPFA 4ADSA 2QCGA 3T78A 3WLHA 2PDNA 1UMYA 2ZYFA 4XKYB 1L6SA 1VPXA 2QCHA 2YFNA 5IBXA 2QF8A 1YMYA 3MO4A 2XSXA 5EL1A 5TD4A 4M5PA 1AJ0A 2QV4A 2J88A 2V68A 3ARTA 4JN7A 1K8CA 3P0XA 3UPBA 2XINA 1IXPA 5BU6A 5IRPA 4DJED 1GVEA 1DPMA 2JFEX 2UBPC 2E40A 2GGGA 3KCOA 4HPGA 4AZCB 3BG9A 3FGCA 4JFSA 4ZOCA 1G6CA 1HL8A 3DHDA 2OLSA 4JY8A 4HBKA 2WKLA 5CJ5A 1JVNA 2QMJA 3WJSA 3PJUA 4BS0A 3CWNA 2VVNA 4Q8PA 1LCOA 5AECA 4HHLA 4W7WA 3C0JA 2DJXA 4B15A 4F2TA 1WBHA 5IHSA 1SFLA 4GY1A 4FLOA 4UNLA 3MY9A 4O1AA 3PZNA 3F4DA 2A0NA 2A1YA 3PF3A 1ME8A 3WLKX 1V3JA 3HQOA 3B0PA 3H22A 3TU9A 2P0OA 3M0YA 4NXKA 2DT2A 8XIMA 3TKFA 3Q58A 4NYUA 1E71M 1RJRA 1VLIA 2ZVIA 3OB8A 2B7QA 2GGHA 4J27A 1TIWA 1E6XM 2QAPA 1R2RA 4IGMA 4C7FA 1A49A 1KM3A 1V3KA 3O0FA 2PAJA 3RK8A 1RR2A 3N6JA 4XZIA 2QCLA 4IF2A 1KRBC 1QNRA 3EPMA 1UBPC 3W26A 1JDDA 1W31A 4BKNA 4DBDA 1M53A 1P0NA 2O7QA 4ZQOA 3STFA 4XUGA 2NQZA 4YLWA 4JQ2A 2NZLA 4WSJA 4HQVA 5ABHA 3S1VA 1WYIA 3QSRA 2VDIA 5C9XA 4YVVA 1BGGA 2Y85A 1EFZA 4XD4A 1XLJA 3SBFA 5A6MA 1TPWA 2NT0A 4NX5A 5T26A 1W9PA 3SRFA 4RNIA 3PWGA 1W1ZA 3STPA 4KW2A 2EG7A 3ARVA 1BSLA 3DESA 1XKYA 2BASA 3MZNA 4FI4A 5FL1A 3IK2A 1UR3M 1ISVA 4FR1A 3AU2A 1TQXA 4XWUA 3CMGA 2F2KA 5CJNA 3B8UA 3NQDA 3VE7A 2WKGA 3DERA 1XIIA 4L4PA 2XISA 1FXPA 3GXIA 3TFXA 1OBAA 5DX7A 1OVDA 4M81A 1RALA 4GWEA 4IIEA 1SW3A 3GG0A 3F1QA 4NZ5A 5HNUA 1GVSA 1ECQA 2QJHA 1K7XA 2Y7FA 4JKKA 4GUHA 3B04A 1F05A 3FEMA 3JZEA 3DU0A 1PBGA 2XVNA 1V7AA 2DQXA 2XIQA 3ZLFA 1KNWA 3LBMA 3HA1A 1F5ZA 1ZBVA 4CGTA 2O9PA 4HGXA 4G1NA 3K1GA 5CCZA 1NAL1 1DIKA 4C1NB 1ITQA 1F73A 3RUBL 1XS2A 4AZ5A 1OHLA 4IGNA 4UNIA 4JTJA 4OBSA 2DGAA 2DT1A 5DELA 2FJKA 4M0XA 1HL2A 1QOPA 1JDCA 2PLKA 4LTSA 3KS5A 1SSDA 3QOMA 2HVNA 3I6RA 1GTHA 1RZMA 3TYBA 1HT6A 1Q6CA 1PWLA 5E93A 4RDYA 3EWZA 3G0SA 1KTBA 4F0RA 3VNJA 5BMWA 4HA1A 2AKZA 5KZMA 2B0MA 1Q8JA 3HU7A 3WQ5A 3W7GA 3F5JA 1WP6A 3QHNA 1BKSA 3QEZA 4LVAA 1NQKA 4JIQA 1HW6A 4NILA 4IMDA 4C6FA 3R4IA 1GUVA 3EA2A 3NVDA 1RHCA 1RPXA 4XUYA 2A21A 5T8GA 2VHLA 3WUGA 3GTXA 4LUIA 3KM8A 3VDAA 3GNRA 3NOYA 1Q5MA 5JUVA 1DE5A 3UG3A 1UR4A 3BL3A 3BARA 3O6DA 4PL1A 4RDWA 4JTSA 4N7QA 3HGJA 3S2CA 4GFSA 1T7LA 3LM3A 5HNRA 4JYDA 1Z9AA 5CGMA 1SR9A 3KBWA 2OODA 1GOWA 2I5GA 2XTKA 1CYGA 4IFOA 4LS2A 5KSWA 5G1TA 1YDOA 1VPQA 2YDQA 3H7UA 3URNA 4TV6A 4TMBA 3QY8A 3GC4A 4HA3A 1JAEA 5E6YA 4EACA 1TPB1 4O52A 4V28A 2E4TA 3DBNA 2ISSA 5C9RA 3O7UA 2PF8A 3AUOA 1NWTA 1C93A 3WUFA 2J9XA 3L5MA 5SWUA 3KOWA 1F3EA 5CZTA 5BOFA 1QOQA 4QDMA 5AHEA 3IRSA 3L67A 4MJ4A 2ABBA 3AALA 8A3HA 3W88A 3VX0A 2RH9A 3V18A 1R86A 1NFBA 4IICA 3FFSA 6ALDA 2QF7A 4FLRA 3VFCA 5G4HC 5GNYA 5BYWA 3S2NA 4NNBA 1JZ5A 1JXKA 4GYKA 1MW1A 1HKVA 1TCMA 3RU8X 3VD7A 2GJXA 2V3EA 4XVEA 1VBGA 3CUZA 5D02A 2YLAA 4W7VA 4JDBA 3U3HA 1XH2A 2VRJA 3R12A 3F2CA 1W1VA 3E6EA 3UF9A 2XJ7A 3LV5A 1BLIA 2O9TA 5IDZA 2ZRUA 4NAFB 3PC0A 2C19A 1F6PA 3OA5A 3AMCA 3DBPA 2VFFA 3MHGA 3PG9A 2OYKA 3ZJ7A 5BXTA 2EF9A 3BLLA 1IF2A 3E02A 1JEZA 4REQB 4UOQA 3GVWA 1AQFA 4MLJA 3GIPA 1EIXA 1QK0A 2F6KA 1WZKA 4IZGA 5A8OA 1XG4A 1IWPA 4LPCA 4D6IA 2CBUA 3WX7A 2GGEA 3KWXA 2BSLA 1KFEA 4BA0A 3RJYA 4XAZA 1E3ZA 4TTGA 4G7EB 1DTUA 2REQA 2ZZ5A 1ZQ5A 4LUTA 1KM6A 2QGHA 2C8NA 3WIJA 4Z1CA 5AVHA 1IGWA 4KBXA 3A9IA 1NWRA 4W88A 3M0MA 3F5KA 1XLIA 4PSPA 2GGIA 3H7RA 2DVUA 2VRQA 1JRCA 3IK4A 3V0SA 4Q8TA 5A8NA 4W9TA 4XD5A 4QE4A 3H4XA 2P10A 3L65A 4NAEB 1XICA 2XZ7A 3W7JA 1B57A 3D46A 4D6HA 1DQXA 2PDKA 1RUSA 4IPIA 4WJ8A 4JTIA 3VGHA 3B40A 2KX9A 3U48A 3KX6A 1Y7VA 1ZCOA 2WMJA 4FX7A 1X8FA 4DJEA 4XBSA 2CU0A 2VEGA 3HB9A 3PPHA 2V2CA 1NQ6A 1CB2A 4WCJA 5A2CA 1VCFA 6REQA 4JQ1A 4IXXA 3W7CA 1M5WA 4C6CA 4LXFA 4AZHA 2DT3A 5I07A 3IIPA 3IUHA 3ENLA 4AC1X 3CQ0A 2HJPA 1YQ2A 4UXDA 1KLZA 1ZGDA 1F76A 2YDSA 1MRQA 1OINA 1O5KA 4GC3A 2YA1A 2XSAA 3DYOA 3LDVA 3WF2A 1EF3A 1TSIA 2E5DA 3MC5A 3UY7A 5H8MA 1GVQA 2QHAA 4WIWA 2WNQA 3TZFA 1N82A 3A13A 1AJ2A 2CXEA 3SFWA 3MHFA 1H7NA 1JUKA 2VURA 3R94A 4C6EA 4WHBA 1TRDA 4NJKA 4J3XA 4XKMA 3LCIA 5C2GA 8RUCA 2Z1SA 2HNHA 1EUNA 4FF5A 2PURA 2Y2WA 3TC7A 4NZ1A 5CZJA 3W37A 3SAZA 3O8AA 2VENA 4U2YA 1HFBA 3CGTA 3M5VA 4Q4QA 3QFEA 3ZVHB 2W66A 3REQA 4GUGA 4IPPA 4HYWA 2CNCA 1RQBA 1PX3A 3H26A 1HJUA 1BRLA 1IXNA 4J3UA 4CCZA 2DSWA 3G1RA 5JH2A 1DJIA 5ABTA 4GVFA 1YPFA 4PRRA 1F6YA 4Y9MA 4K1WA 2X1SA 4WLCA 4PRTA 3M0ZA 3UJSA 3G22A 1DEDA 1OADA 4PN2A 3K5XA 5D05A 3G77A 3NPVA 1FWWA 1JPHA 2V3DA 1GQIA 5CZKA 4NXSA 1W5OA 2ISVA 2DDXA 4AYSA 1HUVA 1S1PA 1CXKA 2QR6A 2OZ3A 5CPQA 4XO7A 1VQTA 5T9CE 2ZC8A 3KVKA 3QQ0A 4IFRA 3A24A 3LOTA 2NV2A 3LSBA 4O8AA 1S1RA 4QNEA 1YKWA 4NZ4A 3A9BA 4BF5A 1OC5A 3MKKA 3N04A 1FCBA 2BGNE 3EDDA 4YN5A 4DVOA 1HKKA 4M6PA 5AC5A 2ZA3A 1L8NA 1JGIA 2VJXA 3DXIA 4W87A 3U7BA 5M1TA 1MXDA 4N6FA 1RBAA 3WH7A 3ARSA 1TPUA 3BWWA 3SUTA 3KHDA 4M56A 1UIPA 2F8QA 3V0UA 3QRHA 3GH7A 1J8VA 5CZ0A 4GG9A 3I3DA 4HD5A 3W1RA 2ANUA 3R10A 4MNKA 4OUIA 1Q6FA 4RL3A 3GTNA 1WKDA 1K02A 3MZ2A 3I6EA 1S2AA 2E68A 1ZBCA 2OT0A 1F61A 4B9ZA 4GQGA 3PULA 4DM1A 1JD7A 2ZZ4A 3DUGA 2Z0IA 5F7UA 1OYBA 4WQ6A 2AMGA 6ENLA 3HPXA 4FR6A 2OELA 4R9XA 4MJ2A 2NQ9A 3F4WA 3UPMA 2ZADA 3GB6A 1R7AA 4B2DD 4LB4A 1M68A 4O12A 1D8CA 2W79A 1H4PA 3FXYA 1ZENA 2WZEA 1TO3A 3M0LA 1LUCB 1H7PA 4GHRA 3VKBA 2X7WA 5D04C 2WHMA 1BQGA 1V3LA 1YDVA 5AYXA 2DEPA 4Q32A 2EEXA 4AY7A 2EPLX 1P1MA 3PBYA 5HMSA 2E77A 3WJZA 8XIAA 1TPH1 3KLLA 5G1MA 3PY2A 3ZXWA 2ZDSA 4E8GA 4L56A 4MPKA 4C6BA 3L66A 1J93A 1E0TA 2PWVA 3KRUA 4CU6A 1FWCC 2QCEA 1EJWC 4YTUA 3D0CA 1LL4A 1W0MA 5KEZA 2YBTA 4DX3A 3G1AA 2V81A 3S46A 1ZPTA 1ZUAX 1BWKA 1J5TA 3L4VA 4G7FA 3W01A 3TN5A 4JHZA 1AH3A 3VIMA 2E9BA 2OTDA 4CVWA 2ATMA 1W1PA 1V6VA 2VVSA 1CGVA 3IUIA 2HE8A 3R89A 1KFCA 4ENLA 4RKAA 3CZKA 3GQYA 1MQRA 1DWHM 1HGYA 2ZX7A 4WEVX 1V6UA 2IPWA 3B0XA 3V75A 4IT1A 4D6GA 3QV7A 3FA3A 4HZMA 5AB3A 4JX6A 3M64A 3VOJA 3GVVA 4C6KA 3IACA 3CAWA 1F3XA 1C8QA 4A3QA 3LBCA 3A4AA 2X05A 1GOIA 2OX1A 3M5ZA 1ITXA 3KVMA 5M03A 3M0VA 1XRFA 3E9AA 4P8WA 2BGQA 4C1KA 2OLAA 1RJPA 4DHGA 1K8XA 3LPPA 4NJGA 4Y9OA 3CUIA 1A5SA 2F38A 2X0HA 4JDYA 2UV8G 5EFFA 5I77A 2OQLA 1JQVA 2YL9A 3TJ4A 2BVYA 4AEOA 1CENA 5LHEA 3WCZA 4GZ7A 2PP1A 1QI3A 2GVYA 3STEA 3NTYA 3CUJA 4AWUA 3AQUA 1GZJA 4LAZA 1NEYA 1D8WA 1M7JA 1V77A 1MYRA 3ZZ1A 3C6CA 3LQGA 1SZFA 4I9AA 1AG1O 2E1WA 2YCJA 1PSCA 1EJUC 3GR7A 1TYGA 4DZ5A 3TYAA 4XX6A 3DFTA 1XLKA 2YL6A 2JF7A 2ZXAA 3B4UA 4IXHA 3WL1A 3N6QA 4PUMA 1VEOA 3CT7A 1LOLA 3B9OA 5B7YA 1Z41A 2D23A 3NPUA 1QNPA 3GAYA 3N9SA 8TIMA 3W84A 1R85A 1YTDA 1XIHA 1T40A 4BZYA 3IJ7A 3CMFA 4GRSA 1R9XA 1R3QA 1YBQA 4NNAA 4NI3A 3EKGA 3STCA 4ECLA 1B3OA 1UC5A 4RZBA 1Z69A 4H41A 4XISA 4F2BA 3WLNA 5C71A 3QLDA 3KUMA 4HOWA 1EDTA 3BMXA 3QPYA 1FWBC 1TR1A 3FNDA 4Z2LA 3SN4A 1WX0A 2VCAA 2ONEA 4OHQA 1JR1A 4QDPA 3T09A 3QZ6A 4HK6A 4TMCA 1PIGA 4A8IA 3R7MA 4D1IA 2ZUSA 2IUZA 1IZCA 4NIRA 4ACZB 2C91A 1SUXA 4GO8A 1FDYA 4DQWA 2NVDA 2AL2A 4CKQA 4WJXA 3WYZA 1QNOA 1QI5A 4J40A 1DHPA 3BW2A 1U83A 5FF0A 3CV2A 3RLGA 3CNYA 1NIUA 2ZKMX 1WV2A 4HSOA 1P43A 1G4TA 2X0YA 4RV3A 1SO6A 5H91A 3ECQA 1SMDA 2PDJA 2ZE3A 4Y6GA 4YU1A 1Q8AA 3MANA 1ITUA 4QEHA 4RDZA 1CTNA 3P61A 3CHEA 3ZO9A 1JF5A 4OU1A 3QOKA 4PYSA 1EPXA 1LRTA 3LMZA 1XHGA 5XINA 1NOFA 3MP5A 2RDWA 4GI6A 4OE7A 1MDRA 1DXIA 1AD4A 2XIBA 2GJNA 3PBVA 2HPMA 1P0EA 2VX4A 1K7FA 1CZ1A 4I9MA 4FXSA 1QNVA 4D72A 4GXPA 1ONEA 2YSWA 5DY3A 1L6YA 2UY2A 1W5NA 3JW7A 5A8PA 4LYKA 2VP8A 3BLEA 1SM9A 3NSMA 2JALA 4LUYA 5DRIA 3TTEA 4XZWA 4R7OA 4HN4A 1QHPA 3QPZA 3GFYA 3RO8A 3M6YA 1YYAA 4LCRA 5FA5A 3CQKA 3NEHA 3G1HA 1V0LA 3O6AA 4D9PA 3OO2A 4ROPA 2ZZ7A 4H04A 4LF2A 3LBOA 4Z42C 2QVNA 5GNXA 1WDWA 4JTCA 1ICQA 5GJNA 4N9EA 4UTLA 3V5CA 3TXZA 1GGOA 1HO1A 5D2WA 1HP5A 1MSSA 2J7DA 4DLFA 3AYTA 3W7IA 1QO5A 1XSIA 4HOXA 2CHOA 7XIMA 4YMZA 4B4HA 2ZRXA 3OVPA 2O56A 2WV8A 5I5RA 1REQB 2ZTKA 2O9RA 2V5BA 1M3UA 2PD5A 3N3TA 4ZCWA 1U2YA 3SURA 1ZB5A 1OX4A 5IXEA 5C2CA 1HTIA 3O9NA 4ONVA 5IDIA 1TWWA 4IP4A 2Z29A 2PLMA 3ZS4A 3C61A 4O1BA 3B8VA 4L4OA 2NSOA 5A2BA 1J11A 4JIHA 3B8WA 1S38A 4NZCA 1QVBA 1S46A 3QHOA 3G1SA 1ONXA 4PBEA 4DY1A 4M6VA 4DB7A 3VGBA 4KGJA 3KRBA 1BQCA 2NUYA 4DO5A 4QISA 2DZVA 4I6KA 1LORA 1W6TA 2VFHA 4A3HA 5AC6A 2OXNA 4CD6A 3LD5A 4LH8A 4AG0A 3FSUA 1QJWA 1ZAHA 4WRHA 2TSYA 3WLQA 3FSTA 3IJ9A 2IMRA 5G4WA 3FHAA 2INZA 1C7SA 3TYDA 3UD6A 4UTTA 4E2VA 3CB3A 5FEWA 3VA8A 2EKCA 2R8WA 3FK4A 1IE7C 4L61A 2DW7A 1RBLA 3KDNA 1F4AA 5AC7A 3WFAA 1W1TA 2ZRVA 4UFMA 5LZLA 5REQB 3EXSA 2ICSA 1RA5A 4BWLC 3JS3A 1E4LA 1JRBA 2A2IA 4MKNA 1WXZA 3QZAA 4IL0A 4PCPA 2FHFA 3B3DA 4IGSA 3R1ZA 3EMCA 1QW8A 2I14A 2AAMA 3ZOAA 4QG6A 4ZQMA 3POCA 1OCJA 3PPGA 5ECVA 1BWLA 1WKFA 1O7AA 4IHCA 4JS3A 3CK5A 3LENA 1CDGA 2FMOA 3CM4A 1A0DA 3SQMA 3M0XA 2CEQA 3SIZA 3VD5A 1UH4A 1SJAA 4N42A 4I8YA 1OIFA 1JJKA 4UZSA 1Q13A 4J3VA 2ZX5A 2O4MA 1GEQA 1SPQA 4LVFA 5HPOA 5FI8A 4MDOA 5E0CA 3GXNA 3GH4A 3OU8A 3CZJA 3S5ZA 1JIBA 5JBEA 1HN1A 3CO8A 3HGSA 3PJTA 2VI0A 4KMQA 3ZMRA 4WDUA 2XVGA 3DYMA 1LG1A 4F0MA 3F2BA 4QQUA 3BLPX 3MWAA 1C9DA 3U7VA 1QI4A 4INFA 2PDMA 4DJDD 5FJTA 5F2LA 2Y62A 2ZXQA 4IISA 1UZ1A 3OZPA 1W5MA 2XH0A 4PMQA 4K37A 3BLKA 3GDBA 3QXBA 3AHTA 1Y5WA 3K1DA 4LCSA 1CNVA 3SCSA 3R58A 5D9MA 3SRDA 1WDRA 3H4GA 4G56A 1XPGA 2VDHA 4C6OA 3B03A 3N2CA 3WQFA 2IQ0A 3K13A 4DJFD 4ZO9A 5IFTA 3M43A 3ABZA 1H1NA 2VEPA 2XGIA 3TA9A 4WSHA 1GQJA 3B4YA 3HZ3A 2OEMA 2J8GA 3VILA 2EPHA 1PVNA 3C56A 3L0NA 4NZFA 3UJRA 3M0KA 3KFTA 4MFDA 2L5HA 4KS0A 4P2VA 1XUZA 3LHTA 2VELA 3AUJA 2B7NA 1MFVA 4E8CA 4F9DA 4AZIA 3WNPA 3H2MA 1M41A 3B8IA 1S2VA 5HUPA 4P8VA 2QDDA 1UR1A 2A7RA 3VOFA 3NG3A 3RM8A 2YX0A 3UZJA 4C6DA 4YJ5A 1KO0A 3VNZA 1FHVA 2C1HA 5HQMA 1UKTA 3R43A 3IAQA 1WOBA 4AD2A 1H1ZA 2QDHA 3KVJA 2Q09A 4C91A 4JTRA 1KC7A 2PGRA 1IV8A 1E1CA 3KL5A 1IR1A 4A2RA 2XPKA 4DXXA 4C6IA 2XM2A 3UPWA 2OSWA 4PUWA 1EJ7L 1MW0A 1M7PA 2GDUA 3W4RA 2XH2A 3HMCA 2X1IA 2QEZA 4NX0A 2E5BA 4UMCA 2P53A 5D8WA 4Q8UA 4JTFA 4U3CA 3SRHA 4LS1A 5LIYX 2FFCA 3UT0A 3HURA 2I17A 3NQGA 4KPLA 1R2SA 4JX4A 1F3TA 3W1NA 2GL5A 2YA0A 3BCDA 2BX7A 1GT8A 1TV2A 2FGBA 3G3DA 3LX9A 2Q6ZA 3CQJA 1RVGA 2PCEA 4NASA 2PDBA 4O0KA 1GQLA 3GNXA 5IHRA 2Z27A 3K4WA 3TLLA 1J18A 2RKXA 4WKHA 4S39A 1BYCA 3CTLA 4YWSA 4PUUA 5KITA 3QR3A 4S3EA 1XI3A 1ZFJA 1BVWA 2VKZG 3E38A 3L5LA 9RUBA 1RP9A 5J8LA 1AL8A 3O16A 5I02A 3CBWA 4LW7A 2POTA 1QW9A 4AX7A 1VYPX 1JYXA 2GJPA 4ZSTA 3UCDA 1DIEA 4I8DA 2QIIA 4NJIA 3VMOA 1EL3A 4V2XA 3B9EA 4ZB0A 4QS6A 4ZOBA 3W1UA 3B0YA 1YRRA 4ZQPA 1P48A 2TMDA 3U4FA 3GRIA 1XFBA 4ZGYA 1PTDA 5BXSA 5LHFA 3CB8A 5DN1A 1XD1A 1XC4A 1DJXA 3ARXA 1Q85A 3F4CA 1KLYA 2BODX 1Z3NA 1VRDA 4R85A 3E2QA 3QMSA 1I8JA 2G97A 3AS0A 4OECA 4P61A 4PCFA 2CW6A 4KESA 3QGAC 1TA3B 1HVQA 4ICNA 4G9PA 4KWOA 1HF6A 4A8NA 2JEQA 1JAKA 2V5DA 3N4AA 4E4PA 3SFKA 1GVOA 1Y5XA 2FTYA 4KETA 3M1ZA 3BH4A 1J79A 1LWHA 2WMIB 1KR0A 1UQZA 3JR2A 5HMEA 5DT5A 1XSKA 3NQEA 5AHNA 4B16A 3LRMA 3BSHA 2PODA 3H6OA 4Q4RA 3SJNA 3MBFA 3GLCA 1UD6A 4RW3A 3D47A 3TW6A 2BY1A 5EMMA 1A5LC 1KXHA 3VOCA 4K3ZA 1GW9A 1WAWA 5A8GA 2PE4A 3ZLHA 1Q3NA 3DDMA 4TVDA 3ELFA 2E0PA 3CAVA 2A6NA 4X2RA 1Z7AA 1OD8A 3N34A 4IMCA 1G67A 5CH9A 1XX1A 5JXQA 4JTAA 3CAKA 1B9ZA 1M01A 3MVTA 3WG6A 4GACA 4AZBA 3FKRA 2C18A 3A23A 1DJHA 4CD4A 3EXTA 1QWKA 1V02E 4B5WA 5JH1A 3RLHA 4V33A 1EDQA 2G8ZA 4DBWA 4PMUA 4UTWA 3GFXA 3WLJA 1TCDA 2W92A 5I7GA 1UUQA 2DPEA 3WJYA 2BXYA 1TELA 3MYPA 1EUAA 1K9FA 1UQYA 2HWGA 3V1PA 1NWUA 2LLEA 1CB7B 3WUBA 3OVGA 4HK7A 1TV5A 2PTXA 2MANA 3RITA 2QNEA 3EX6A 1VBJA 3TMLA 3UJFA 4IQEA 2FH8A 1IEXA 4CCDA 3V16A 1PPIA 3UZ5A 3ZWTA 2Y61A 5AC4A 2QS8A 5LIXX 5FJRA 3BLFA 2H9AB 2H3BA 3GY1A 1R3VA 5H8UA 1BVNP 4FSAA 1TB3A 1OC6A 1HNYA 1T5AA 3OQ8A 1FDZA 3VYLA 1EP3A 4DJDC 4F0SA 3RYSA 4J3SA 1QATA 2X1TA 1GORA 1I2RA 3VM7A 1WQ5A 4IMEA 2BBFA 2WOQA 5PTDA 2OU4A 4GY0A 4C1LA 2CKRA 3THUA 4PTDA 1HKMA 1W3LA 5AN7A 3R8GA 3EWXA 1XJBA 2PC8A 4L1XA 4HU0A 1UWQA 4DJFC 2OT1A 1RY8A 2BFGA 4HP5A 3CYVA 4L5ZA 3LERA 3PTMA 5JBDA 4DWSB 4AUBA 5C0QA 2WKJA 3OIHA 2NWSA 3UJ2A 1WUFA 4LYRA 3MP3A 2OZ8A 1JD9A 1NF7A 3NZGA 1OK6A 4MWAB 1G1YA 1EC7A 1EX5A 3LPGA 2OJPA 3ORWA 1PHQA 4QE1A 4FX6M 1AL7A 1OK4A 1SYTA 3CWOX 2NX9A 3C4UA 2WAGA 1ISWA 3VPLA 4JEJA 4ROQA 3GSMA 3M16A 2GK1B 2DW6A 2WLYA 2CBJA 1TJ0A 4ZB2A 2B4GA 3WDPP 4FPSA 3S1UA 4W8BA 4UMBA 4H4IA 4BEQA 2W4XA 5H6HA 3ITTA 3QM3A 1FH9A 4M6UA 2C79A 3TDFA 1SVDA 4MG4A 3FS2A 4MB1A 3S1GA 3KZSA 4O10A 3RPDA 1K9TA 3W72A 5M3WA 2GPTA 3NUKA 1UIOA 5HULA 2QCDB 1MWOA 2KZHA 3M0IA 5CBIA 4HOZA 1GKQA 1OF6A 4A29A 4WSKA 3O2LA 2ZUUA 3RM4A 4AWEA 4O16A 1PTGA 1YW1A 3HGRA 1GOOA 1FWGC 1K8ZA 4B3KA 4AYGA 3VIFA 2C16A 1CLVA 4JTQA 1H11A 1B3XA 4YPJA 2H8ZA 1XUUA 4IFKB 7PTDA 1ISYA 4XAFA 4A6GA 1X1NA 4U2ZA 4OKDA 4PE8A 1MQPA 5I00A 1I4NA 2INFA 1QBBA 3DFSA 3BZJA 1W32A 2OPJA 5CPNA 5D2VA 2V2DA 1K9DA 2VOTA 2A79A 3N2XA 3F4VA 3GC2A 1FWNA 1V6XA 2PDWA 1G7VA 3IJQA 3MUXA 1UPPA 5I3DA 5FF2A 2Z2AA 3GG7A 3RHGA 3KBMA 5AYZA 4U31A 3PZTA 3WD4A 4RXGA 3KL3A 1A3XA 4MKVA 3P62A 3T9PA 4BF9A 2VEMA 4FP1A 3PVFA 4MUPA 4I7VA 1M03A 3IJ8A 1ITCA 3QMRA 3BGJA 4I5XA 4W93A 4AHOA 4B4FA 3TA6A 2YCLA 1H09A 5TF0A 1XINA 1MUWA 4WJEA 1RXOB 1FCUA 4ZL1A 4GINA 1H7RA 1AODA 2PRHA 1Y8BA 3CXOA 3LCXA 1VFMA 5C9WA 3HN3A 4ERAA 4AD0A 4MNMA 3UWEA 1G69A 4BQ3A 5M17A 3UA4A 1JDFA 3QR1A 1GOQA 3VZZA 1WAUA 3U5YA 3WUEA 2CLLA 1W37A 1VD6A 1WBJA 4XIAA 3EBVA 3TSMA 2GQAA 1T0OA 3GKAA 5K7JA 2PWUA 4B5SA 5HOSA 4JCMA 1UOKA 3N19B 4EP8C 1FP9A 3NQ2A 3OBAA 2CZDA 5HJLA 3IARA 3TJIA 3UXDA 3WMLA 3SZ8A 1MW2A 3WENA 4MY1A 2ALRA 2VGIA 2XHYA 4UTFA 4C6LA 5K3VA 3W02A 3D3AA 2Z7KA 3E2RA 3H8AA 3FW6A 1HO4A 4DM2A 5HR7A 2DZAA 1A0EA 3ZR6A 5EBAA 4Q7NA 3QSTA 5FEZA 1A5NC 3LY0A 4FK9A 3KHJA 3EOOA 4N6EA 5GNZA 1E6ZA 2QUUA 3R13A 4KRTA 3BAIA 4TIMA 3CPGA 3AYSA 3KBJA 1SZRA 2V3FA 2PDPA 1R9YA 3T0AA 3GBDA 3TC6A 3FJ4A 2YPIA 1UP3A 4B9YA 3OTRA 2FB2A 5TAOA 4CN4A 4O1DA 4RE2A 3SQSA 3AXXA 1GVRA 3OVQA 1A4LA 1UCWA 3GKFA 4DWSC 2CLHA 3QKEA 1RQEA 3CIVA 2WNWA 1QMLA 3GE7A 2VXNA 1KFLA 3MCOA 2IPJA 2JQXA 4AY1A 5FF7A 4JTLA 5I09A 5LXXA 1DJWA 3MUCA 1RH9A 1DWGM 1GKRA 3OLGA 2DV0A 1KGXA 1XLCA 4MZ8A 1KCLA 2PDXA 1UROA 4R53A 4MWAC 1KXVA 3PBGA 2P8CA 4EK7A 4PTWA 1RCXB 1W2VA 4BJHA 3ARWA 1TWSA 3EOUA 5DMYA 7A3HA 1LZOA 2C0AA 2PZ0A 2CXGA 4M1BA 4L6HA 4MOZA 1GPFA 2VGGA 4F3HA 1DXEA 4ZE4A 3W6MA 3GXDA 4JHMA 4LAOA 1YNQA 4OOUA 3N11A 1XDLA 1XIFA 4B5UA 2WHKA 3EEGA 1KKOA 3W7DA 3C86A 4DYKA 4F0KA 1UD3A 1GYNA 3GDLA 3IIOA 4HSHA 4AF0B 2ZCGA 1N7KA 5FJUA 3H24A 2VFGA 2GJLA 4J3ZA 2VT0A 2BY3A 1IEWA 3MPGA 3GU1A 1A5AA 3WQWA 1KBKA 4R7JA 1B3ZA 4RE0A 3THCA 5DFAA 4NZ3A 2NXIA 4XO6A 2F6UA 5CPLA 1XISA 4HU3A 2YBUA 2J27A 1ZP4A 1CWYA 3MI3A 4Z2KA 5A6SA 3KEHA 3E5BA 3PTQA 3HGOA 1MXGA 4W5UA 4WY0F 1E0WA 1RCQA 3LNPA 4GE8A 3W70A 2V63A 2CLKA 3W27A 2YCKX 3OYXA 4A3UA 3KDOA 4HNOA 3CHVA 3TROA 4HNLA 4QJ4B 4LYQA 4XV0A 3GFZA 3TQVA 4GMEA 1VH7A 2V2HA 5DCDA 3EKLA 2FGZA 5EGRA 2OYMA 1GZ1A 2A85A 2TPSA 2BY2A 4YTSA 4EWND 1XIEA 4LV9A 1EBGA 3UG8A 3K4DA 3VCRA 5GJMA 2WBGA 2WHJA 2CLIA 2E67A 5CSRA 1PZ1A 1HKWA 1XYBA 4K8HA 3EWBX 2PWDA 4B5NA 1WXJA 4X63A 4Z17A 3QFWA 3GC5A 4JIRA 4V15A 3UCCA 3NL3A 4YYFA 4FA3A 1DJYA 3G24A 5E0FA 4BQ5A 1BG4A 2Y5SA 1DORA 2G4FA 2EQDA 3EWCA 1PDYA 4X60A 5FKYA 4CNSA 1HJWA 2VWSA 2YZRA 3HG5A 3FYOA 4U10A 1UA3A 4ZO8A 3WQDA 2WCAA 1GTEA 4UR7A 1TMLA 1UHVA 3CUFA 1ENUA 3MSYA 3I3EA 4DYJA 3ME3A 1RP8A 4HVXA 3LI0A 2YJQA 1FWFC 2HDJA 1XL9A 1MI3A 2GOKA 3CASA 3BJTA 1GJUA 1N8IA 2FZ8A 3TSDA 1UP0A 1SJDA 5JIWA 2PB1A 2VZTA 1J6PA 3ITGA 1KQZA 4YS1A 3KBNA 1I2PA 1EZWA 3G1YA 4CQBA 1A5OC 1EHNA 3W6YA 1KBLA 3UXIA 2RJGA 5C7VA 2FH6A 1S5VA 1PJ9A 2G0WA 1XDMA 1A4MA 5B7ZA 2G3JA 1TVPA 3O15A 4U3AA 2A5HA 1PDZA 3TN6A 2Q3RA 4RJEA 2I57A 4O8RA 4IJRA 3L68A 2WO5A 3QW3A 4I5UA 1EQPA 1KTCA 2EG8A 2QQ6A 3EOEA 3QV6A 5KINA 5A94A 4CVUA 3BG3A 5E9AA 3BAWA 4DZIA 4E2DA 3NWRA 1BSIA 2SFPA 5D9PA 7REQB 1GPWA 3WY1A 4GABA 2BLEA 2ZBTA 4DNHA 3WEMA 3PN8A 3VDBA 2RGLA 1WDSA 2ADAA 3VUSA 3ISIX 2W6RA 2ACSA 3UG5A 4GIAA 3PBUA 3PFRA 4UWMA 3I3BA 4GCAA 3W7KA 3QGKC 1KGUA 3VC6A 4GY7A 3CC1A 3UGVA 1TPEA 3LEPA 1I2OA 1KM5A 2ISWA 3UFYA 3E0IA 1JYWA 4RUBA 5HJXA 3DI0A 2IPGA 5TNVA 3AHVA 4RW5A 4XG1A 1S2WA 3C2EA 3MUY1 1RSCA 4ALDA 2Q8ZA 2UY5A 1EB3A 2BZNA 3WQGA 2CERA 1ZAJA 5E0KA 5AYYA 1VFHA 2WVUA 4W8AA 1E6QM 3MVIA 5G1YA 1W5PA 1T99A 2Y7EA 2Z1KA 3C52A 4UCFA 4PMZA 3SADA 1Z44A 4QLJA 5AY7A 1JUBA 3QYSA 3LNMA 2D0FA 4Q6JA 1UWRA 3YPIA 2OWCA 3UP8A 4PMNA 4S3DA 4ZTXA 4QITA 1Z6KA 1VCGA 1NDWA 1ONRA 1JCMP 5HPCA 3G6LA 4JQ3A 2EHHA 2CITA 2Y8VA 2QJMA 2O9OA 3GG8A 3UWWA 1EKOA 1W54A 2VTFA 2E6AA 4L80A 3L4YA 2WSKA 3COTA 2TODA 1WNOA 2Y24A 2NT1A 3LTYA 4L7ZA 4XTDA 2YCIX 4FIQA 4PCTA 4H9TA 3VDHA 1UD2A 1GEHA 1KM0A 1LDCA 4C6QA 1TV3A 1YXDA 5FF4A 5DXYA 1BTMA 3W86A 4C90A 2GQ8A 3URBA 1JPMA 1VLWA 3DFOA 2XIJA 5BNKA 1C92A 1I45A 2G41A 3EPOA 5LA1A 3QF0A 4LUSA 3MJMA 2G5WA 1F9CA 2E1DA 2ISFA 3TWBA 2OZ0A 3CL7A 1ESWA 3T6CA 2EJAA 2EXOA 3DKLA 1W2PA 2YR1A 1BTCA 2AGKA 4J2MA 1AZ1A 3NYZA 4AIUA 2E8YA 3AS3A 4MZ1A 3AMDA 2HK0A 1E1EA 3RCNA 4O54A 4K8GA 3CZ8A 3B9DA 1XR2A 4JXCA 3O6YX 3VUPA 2X0SA 1KM4A 3P8JA 4KKXA 2QJGA 3W87A 2FTWA 2PBGA 1NELA 4LAUA 4OT7A 3LA4A 3W07A 5D09A 3KBVA 4PTMA 1G5AA 1EBHA 3QVQA 3LRLA 5BOOA 3PSVA 4S3GA 2YW4A 5MHBA 1DXFA 4HMEA 1AJZA 4MUZA 1J2WA 2QMKA 2OB3A 2PU1A 3FOKA 3WQOA 4AIOA 4S3JA 2B81A 4K68A 1R2TA 4PMXA 1R3WA 4JOMA 3WO8A 2I5QA 1CGTA 3R2GA 4A8LA 3GO2A 1XW8A 5EB8A 4RV8A 3NSNA 5BRBA 3AHYA 1MNZA 5J5RA 1G4PA 1VP5A 4PB4A 3FEQA 1OG6A 1H0GA 4JTDA 3VXGA 4EPKA 4M1RA 3TP4A 2IKGA 2GWGA 2JK2A 4PODA 4R7WA 1B9BA 1CT5A 2ZDRA 5DANA 3C5QA 2HSAA 3VD3A 2CZEA 3JUGA 1T41A 3VO0A 3P14A 1OT1A 3E0VA 3IIZA 4LAKA 9XIAA 1U5VA 1TV8A 4RE4A 4CNOA 1JCYA 5DBUA 4AB4A 2NUXA 4JKMA 2QUVA 2WYSA 4CQCA 1LRNA 4MJMA 1JI1A 1P0DA 1MUCA 5FSEC 3EA3A 5A3HA 4Y8EA 3BW4A 4JNZA 4AAJA 1Q4WA 4ZE5A 2XGBA 3L4XA 3CPRA 4KWVA 3KOXA 1M6JA 4HPHA 5MKGA 3NQFA 2WLZA 4S3AA 1E51A 4KEZA 3DECA 4GUFA 3UWQA 1L2UA 4A22A 4KEUA 1PB0A 3WNNA 3T0DA 3U2OA 8CGTA 5CG7A 3ITYA 1CGYA 2DU2A 1K3UA 3SCUA 4ADTA 3BJFA 1XV8A 3W3OA 4US5D 5HWJA 3TCSA 1SW7A 2HVMA 1UPMB 3VKAA 1CGXA 4P8XA 3JVAA 3C8NA 3WNLA 5ABFA 5E1QA 4YL2A 3BMVA 1DTNA 3THDA 1H3GA 3HJZA 3LB0A 4Q8MA 3BTNA 1XLHA 3WK0A 3BAJA 4H83A 3C2FA 3P0WA 3RMEA 3A5VA 3BCJA 5DCEA 3UA3A 4H2CA 1FX6A 4JNYA 2D0HA 2PRMA 4FXRA 1Z32X 4NHVA 1VYRA 4PGLA 4QGCA 5FACA 3WQPA 2FZDA 2PGWA 3L4WA 1Q65A 3CTTA 1V0MA 3RLUA 3A64A 1G7UA 3AXMA 3NL6A 1B5TA 1XPYA 4BK9A 3R6IA 3GW3A 1V6WA 4O57A 2GWNA 3WZ0E 5D8ZA 3TZNA 1W3KA 3H2FA 3G1VA 1QNQA 4AX6A 2DZBA 3B97A 3IWPA 3PANA 4GH3A 5TIMA 1XLLA 4PC8A 5HXMA 4YCPA 1GVIA 1JCJA 2HXUA 4PL2A 1SZEA 4UTIA 3VMPA 4AIBA 4JY9A 3UG4A 1E6SM 2WQDA 3VNDA 2GJRA 3AIUA 4Q6XA 4CNUA 4ORIA 1YEYA 3LXCA 3WLRA 1VBUA 3WK1A 3WQEA 1IYXA 4GC4A 3WQ8A 2FZMA 1SR0A 5JVLA 4GZIA 2YBVA 4Q4KA 1L2QA 3FIGA 1E0VA 1J0ZA 1DYSA 2QPSA 4JR5A 1Q7QA 1IIHA 1ZAIA 1W3NA 3NURA 3U0HA 2FLIA 1EOMA 4RZ4A 3L5AA 3W7MA 2BHZA 1BYAA 2DVTA 4G8TA 3EWDA 3LCHA 4PBGA 3OOQA 3R0UA 3NXLA 2PTYA 1GOMA 1C3FA 1O4UA 1QT1A 2GLKA 4H1ZA 2XYLA 5KZ6A 5LNWA 1VJZA 2O4QA 1TV7A 3GD6A 4UOZA 4PMOA 4QRNA 2ZWYA 2ZZ6A 3BQ5A 3E0LA 4J2PA 1QR7A 3N2MA 4GUIA 1H50A 2PU0A 5KZDA 4M3PA 4GIEA 4HCHA 3SSJA 1WA3A 3TX9A 1JNDA 3UR2A 2W3ZA 1G9HA 4OUEA 1ZBWA 3CZEA 3HBLA 4PTVA 4E6MA 3LCFA 3QJAA 4UTHA 4MAVA 4EE9A 3AXHA 5I3IA 2IQDA 2O92A 3IANA 3M41A 3F7JA 1UWUA 2QCCA 4E38A 1QHZA 1JFHA 3SUWA 3TAOA 1JDAA 1KRMA 4Z2GA 1ZALA 4FNSA 2Y4SA 1PX4A 2BHYA 3WQCA 3LXBA 3AWNA 3SCWA 4I3GA 3XIMA 1F7BA 4JYEA 4JTGA 3AMKA 2CFFA 4WKAA 4H7VA 4LEQA 1CEOA 1XLEA 4WGHA 4IG2A 3TNBA 1M7OA 1EXBA 2C71A 3KOZA 1SO5A 3P7YA 3UR7A 3KBSA 1HP4A 1YDNA 5DY2A 1HJSA 4M7SA 5HNTA 2E25A 3PTDA 2DY3A 3I10A 1EIBA 4AD1A 4WZHA 3GU2A 1JXJA 3L7RA 3DHPA 3RG6A 3KRZA 1O60A 3APYA 3P2VA 4HIBA 1K8YA 1CECA 4G2DA 3CLWA 4GYFA 2YFOA 3OBEA 5ABEA 3A22A 3MUZ1 1OZMA 2FVKA 1FH8A 4L4LA 4C60A 2I56A 1AW2A 5FEPA 2R1MA 2C13A 2KAUC 3SUSA 3AZRA 4RR4A 3WFLA 1O12A 4DNMA 1U1UA 2V67A 4A4AA 2VEKA 2NWRA 4GPNA 3OIXA 4HMCA 3W25A 3GG1A 1SSGA 3AI0A 2FB3A 1D7FA 3M47A 4I7UA 1T8QA 3PBWA 4LNCA 4UB9A 2ASHA 4X2PA 3ZJKA 4MM1A 4EF9A 1Q66A 3DEQA 2EBNA 3EMZA 1V5XA 1SZGA 3U8GA 1XQLA 4QFUA 1US2A 1UYQA 1O5QA 3HQPA 1V03A 2PC4A 4A3RA 2XN2A 4CD7A 5I3GA 1ZJIA 3N6HA 1EP2A 3NZPA 4PB3A 3ABRA 4TO8A 2GYIA 4PUJA 1PYFA 4PMVA 5FJIA 1FH7A 5BXPA 4ES4A 3VIPA 1ME7A 1UUOA 2NUWA 4IL2A 2JGQA 4JQ4A 5AHMA 1LYXA 3MUIA 4N9DA 2NX3A 5AC8A 1IWBA 1S2UA 3E49A 3S8HA 1E0UA 1OC7A 2OOFA 3PG8A 4MF4A 2Z1XA 3CS2A 4OOZA 1ICPA 3M07A 5ABGA 4E0CA 4HU4A 1V6YA 3NXFA 3TTOA 2FYMA 2NXHA 1ZP3A 5KMYA 2E09A 1TJ2A 2G50A 3VD9A 1VHNA 4BR1A 1KBIA 2QULA 3BAYA 2BOEX 3SUUA 2YYTA 3DHFA 3C3UA 3BGAA 1WUEA 4J5NA 3KTSA 3PS7A 4ZQCA 3BOLA 2FFIA 3M46A 3N13A 4NG3A 1KCKA 4E2OA 3W2KA 1OFPA 3LG3A 3DIPA 1XKJA 1MNSA 3LUTA 1S2TA 4I6VA 3JU2A 1Z89A 1P7TA 3HO8A 4HJFA 5CC7A 3W2NA 1WB0A 1BYBA 1AUSL 5K2ZA 3PJWA 3HOJA 2BGSA 1E72M 2VNCA 7ODCA 1OFDA 2D69A 2V3GA 2BOGX 1X39A 1CI1A 1NH6A 3WH9A 4MYXA 1TE1A 4WKFA 4HK5A 4X9SA 2DUZA 3SY8A 5FOOA 1V3IA 3B9NA 3GHUA 3P6LA 1XGZA 2E9LA 4NYYA 1O94A 2GDVA 3AJ7A 4KEMA 4Q3MA 1VJIA 2Z6IA 4LJ3A 4IIFA 4Z1YA 3UNDA 1UMLA 2VX7A 3PB0A 4D6CA 2HTMA 1R30A 2F7FA 3MHUA 3W7QA 5TQLA 4HB7A 1TVLA 3TWAA 4M80A 3OZOA 4A21A 3WFZA 3KL0A 3KLKA 2ZX6A 3WQ4A 2CPUA 4N0RA 2JGYA 4UZUA 3QKZA 4MJZA 4US5A 2WXDM 2Q01A 1UD4A 4FNQA 3ARQA 3ANYA 3OHIA 3MMUA 4LBUA 3FA4A 5CC5A 1QXLA 4Y9NA 3EB4A 5BZAA 3CZGA 2G37A 1VIZA 3VIGA 3NQAA 1I9CB 1TX2A 2WWCA 3LCWA 4UFKA 3WD2A 4FO4A 2X41A 2EO7A 3SY5A 4ZODA 4JN6A 3F2DA 3E1F1 1CXHA 1NP2A 5L6UA 3PHAA 3W76A 3WLIA 3IGUA 1FHLA 4Z08A 1ECEA 1SJCA 1J0HA 3U9IA 3CIWA 3W53A 1OG0A 5A95A 1PEZA 4QE5A 1YTKA 3PAJA 3R8RA 1BEUA 3TTYA 1HJXA 3TVAA 1D3HA 1S39A 2PWFA 5A6KA 4QP0A 4YTQA 3B0VC 1UKSA 3RMJA 3QTPA 1PCKA 4JTKA 2VD9A 1POJA 3VKDA 2YXXA 4FOJA 1A5MC 3PFMA 4AD4A 3TOPA 2J9YA 3NVTA 5A2AA 3GNPA 4ILSA 2ALDA 4XKYA 5F4XA 3CHFA 1K03A 4IMFA 4AC7C 1ZL1A 3RRXA 4IQLA 5CC3A 4C6PA 3F4NA 4RNFA 1V6TA 1ZS2A 3C2RA 2E6YA 2G3MA 3A3HA 3NQ8A 3VIHA 3UR5A 2G95A 3Q67A 4GZJA 3HG2A 1P0KA 4HHPA 3R8HA 1GQKA 1YX1A 4MPQA 4XB3A 3S9YA 3W0KA 3GDKA 4AZCA 4ZSUA 3LS9A 3RU6A 1BGAA 4O14A 4JTEA 3T42A 3AHZA 1HL9A 5DMMA 1U1JA 3NDOA 3S5SA 2AAAA 2IS7A 2WB5A 2RJHA 1WPCA 1CLXA 1EGVA 1OX6A 1C8VA 2EAWA 5K9DA 3AXIA 2C6QA 2J8FA 4XZ9A 4DPQA 1TV4A 2D73A 4LALA 3LN3A 1CBGA 4CCEA 1RK6A 2ZZ2A 2WJDA 1JZ8A 1BG9A 2OZTA 4GX9A 1N8WA 3W71A 4H6KA 1E9IA 3A4WA 2V5JA 3IJIA 1VJSA 3MUAA 3EA1A 2GVEA 3LZ5A 4LY4A 1CIUA 2W27A 4DBUA 2F2HA 7ENLA 1VPYA 2BXZA 2INEA 2Y8KA 4L65A 4RPPA 2WM0A 2WJZA 3QQWA 1D7KA 2AOSA 3KTCA 1ZU8A 2EGZA 3LXAA 4QIUA 3DI1A 3UGRA 1QI2A 1A5BA 1FRBA 4DLMA 4V1YA 1H7XA 1Q6GA 1X97A 3QC3A 2DZXA 3NL5A 4W86A 1H51A 3EOLA 1IQ8A 3VCNA 1QBAA 4Y90A 5LNSA 2NQ5A 2J25A 1KRCC 2P3ZA 3WH8A 2ZXBA 1QCWA 2VFIA 1EJVC 2R6OA 2VZOA 2XM1A 4FB7A 3OG2A 4LANA 2DUXA 4AWTA 2A3BA 3EMQA 3G0XA 4Q8OA 2PCQA 1TREA 4DUOA 3PSWA 2G3NA 4EWJA 2PWGA 2DZSA 4ML4A 4M51A 1GQNA 3RN6A 4HNNA 4DI8A 1IEVA 4KERA 1NVMA 3B8DA 1TMHA 3EX1A 4RXFA 3SEPA 2VMFA 1NOUA 2OEJA 1JCLA 1G4SA 1WKEA 1B3WA 1UB3A 3GIQA 3FDGA 5D38A 3FAXA 1HVXA 3EYPA 4RLIA 3BV4A 5M2FX 4FZIA 4UCGA 3FGCB 1BKHA 3N2OA 3NQCA 4NU7A 3MTWA 2PF0A 4KCTA 2Y0FA 3V3WA 2DZTA 3ID7A 1K6WA 3CUGA 2VZSA 4QG9A 2WZTA 2YA2A 1HIZA 5AHLA 4Q4SA 3MSGA 1TKKA 2B7OA 1W1B1 1WZMA 1WO2A 3FYYA 3GR4A 3C2VA 3SGUA 4NF7A 3G1DA 3TYEA 3I7QA 4GVGA 4GUJA 1M04A 2DIEA 1UR9A 4C1NA 4E8DA 4JFUA 1JF6A 3KOYA 5FJJA 1YTEA 3NL2A 3RR4A 3IJ6A 1H63A 1EGZA 4M82A 4CQDA 1AZ2A 4RX0A 4YXGA 3U2ZA 4U4MA 1R6WA 4WXZA 3QYQA 1W56A 3W9ZA 5F4WA 2ZTJA 5EFDA 4XQ6A 3NEVA 2NSXA 5BOEA 4FOUA 1WOAA 1KA9F 4LGXA 2X42A 2XVLA 2QJIA 4ATDA 4S1FA 4R27A 1YPXA 1KRAC 4GYPC 1E15A 5T9BG 3LTPA 3AIEA 4IP5A 4NP7A 1XIGA 3WL0A 3DGBA 3MSDA 3LGGA 3QY7A 3G1XA 4HNUA 3ICJA 6XIAA 1UJPA 4GX8A 3HV9A 3EGJA 3QC0A 4DZAA 1I0DA 1XYCA 4H01A 1EYWA 2PGEA 4HNCA 4DAFA 1VFTA 3I65A 5I3FA 1C8YA 5AHIA 1KCZA 1EEXA 3MCMA 3MA8A 2I7GA 3GIYA 3FDKA 1TJ1A 1VFLA 4YIWA 1MVYA 5I3HA 3BAXA 5BCAA 4A8RA 1SZNA 3B06A 1XRTA 3SRKA 2FZ9A 4DAIA 3UXLA 3QBUA 1RK5A 1NJJA 3R11A 5HNNA 2QCFA 4H9ZA 1JZ6A 3TQ0A 3VVGA 3G8EA 4C6NA 3N3MA 2HBXA 4Y9PA 1XRVA 4XBJA 1Z48A 1KTNA 4AEFA 4TXEA 3AXKA 2WVVB 2PD9A 1A5UA 4FS9A 2J78A 4XAGA 5A8MA 1VGAA 3MKVA 3UWUA 4UQAA 3DG3A 5AZ1A 4Y96A 1LF1A 4JKLA 4OTKA 1O6IA 3E2SA 3P84A 1NFPA 4HPXA 2FHBA 5G5IA 2BTMA 2XG9A 3QR0A 5HUOA 3IVTA 5CZSA 1OFAA 2VZVA 4FMVA 3N73A 4B3ZA 1OFEA 3W7EA 3A21A 4ZQNA 2J79A 2J7BA 4K6AA 2W63A 2E8ZA 2OFJA 4ML9A 4BI7A 1ODUA 3BLIA 2DIJA 3MKCA 2QKFA 4UIOA 1TPC1 2ZUNA 3SCQA 3W23A 4CNNA 5HQLA 2W0UA 1K70A 3AIWA 1Q6OA 2Z24A 4F48A 3WBWA 4JTHA 5FJOA 4JEQA 3B9AA 4OVXA 5J5DA 2VUNA 3TQPA 4JFVA 2J6XA 4MADA 4NAFA 2XZ9A 4H9XA 4WX2A 2E7FA 3NZ1A 2ZIDA 4J28A 1PKLA 4C6MA 2W91A 4REQA 1XIJA 4J4KA 3FY1A 5H2ZA 1B30A 1F07A 3EKZA 1OGGA 1OJXA 3UZXA 1V7YA 1IHIA 7CGTA 4WF7A 3VINA 4GJIA 2MNRA 1Z8AA 5G2HA 1MEHA 4G7EA 2QGYA 1VZWA 1H5YA 5IBXC 1P6WA 3N4EA 1J6OA 4AFYA 4GCXA 2VX5A 3BMWA 1EJTC 1S5TA 1SO3A 1GWJA 4ATLA 1DWIM 2VUYA 1C90A 2J47A 3T2QA 2WBKA 2FTPA 2DFAA 1VR6A 2WSQA 2P1FA 1J12A 4B5VA 4NAEA 5I06A 2FVLA 3QHMA 1AW1A 4V1XA 2UY3A 2VC5A 1Q6QA 1OCBA 2QV5A 2WCGA 3VI2A 3WEZA 1TPVA 1B3VA 4H7ZA 4XSMA 2XVPA 1KM2A 1QTWA 3BANA 4KF1A 3RCMA 3EDEA 6TIMA 3LLXA 4GKTA 3GVRA 2YZ5A 3M4HA 4DELA 4MIMA 2J74A 1GOKA 2XU2A 3U2EA 4M24A 1NF0A 4O0QA 1KFKA 4JCLA 4L1GA 4O19A 3KXQA 1NFGA 3LLDA 2QJJA 1DKWA 5C9UA 3RX3A 3MI2A 4EANA 1XGDA 3KCLA 4JHOA 5CSYA 1AD1A 4HKPA 2GJXB 1S5NA 3WDRA 4HTBA 1NWSA 4D6JA 2PS2A 1QW7A 3LI1A 3NA8A 3H21A 5I2UA 2VR5A 5CQ1A 3VMNA 3SCRA 1PKNA 1XD0A 3T1GA 3A6OA 3ZSTA 3KAOA 3TR9A 4TQTA 1LT7A 2ACRA 4DRSA 3D3FA 4LF1A 1BF6A 3W74A 1XLFA 2PTZA 4LVDA 1L6WA 4QAWA 4ERGA 1X7IA 3VIJA 1QPRA 3TFCA 3ZVHA 4IQJA 4Y8FA 2NQJA 2E6DA 2J13A 2VD8A 4PMJA 3BOFA 1OY0A 3WLSA 4LV4A 4RNJA 1H7OA 1E56A 1GKPA 1PZ3A 2REQB 3ZSSA 2NQHA 3M7WA 4LUTB 1TWDA 1W9DM 1B1YA 1XBZA 1B90A 3T2OA 3L0GA 5KETA 3P82A 5F1UA 1AFSA 2R1PA 2E5CA 3RCYA 5CPSA 3K8LA 3LPOA 4PMDA 2ZUVA 2FZNA 4QEEA 1V79A 3EB3A 3DZ1A 4CQ9A 4X0VA 3R5EA 5EMKA 1QWGA 2CCRA 3FX4A 2AL1A 4L9XA 5A1AA 2E3ZA 1OSEA 3TJXA 1CGWA 1UR2A 3VOIA 3V7PA 3H23A 1J0JA 3ABSA 4OIFA 3ARYA 1XLAA 1X6NA 2CYGA 1PHWA 7TAAA 2ZRZA 1XLBA 2DSZA 1FXQA 1EA0A 1TX0A 2NW0A 5LKYA 1BWVA 2VEFA 3UZYA 3WD3A 3RIKA 4JL2A 4AU0A 3EPNA 4JICA 4OWGA 4GIRA 4PA8A 3VTRA 1DJGA 6REQB 5IM51 4BI6A 2ZOXA 2PZNA 3RXZA 2RDTA 2WMHA 3CHCA 1R9ZA 2A7NA 2HMCA 4LC8A 4H9MA 2ON3A 3P74A 1R46A 1BHGA 1VC4A 2Z1BA 3WBYA 4MWAE 4I90A 3VOHA 2F84A 2Y88A 4K2SA 2XH7A 5CJMA 3C3NA 1IT8A 3S6TA 2V5LA 1BF2A 2GFTA 1ZRQA 3GXPA 3ZR4A 1KXQA 1UZ4A 2HS8A 3EDFA 1PKYA 4EOUA 1RD5A 2GSEA 1TZZA 3QTGA 3K8KA 4Z2JA 3NO5A 3TQKA 3OYZA 3P5ZA 1DJNA 2BVDA 4EXBA 2ZC1A 1ISZA 2HPIA 4XTIA 3S1WA 4HMNA 2DJLA 2VWTA 1O5RA 2E9MA 2VOMA 3LSCA 3K2GA 1TTJA 1A5CA 1LUCA 3REQB 2D2HA 1PKMA 1UKQA 4MB4A 2D2JA 3G5EA 4IX2A 3S2JA 4BFAA 1H5VA 1BRLB 1H62A 2X40A 3ZT7A 3BVJA 3ABQA 1WE5A 3OLEA 1LLZA 3S2MA 3WJXA 3PTKA 2V5CA 2XWDA 3RDKA 1CPUA 4ZQRA 4H8UA 2HK1A 4RDVA 1K7EA 3BZGA 4S38A 4B2DA 1HJVA 4K36A 1I2NA 1SU5A 3UWYA 1LWIA 2CIPA 2ABAA 2QDGA 1IGSA 3MMTA 4GBDA 3WKZA 4I7WA 4TVUA 3GHSA 1XBYA 2WVVA 4JZ5A 1SJBA 3WJWA 2E6FA 1ZJHA 3A47A 1P6CA 1WDPA 2PPGA 3VE9A 6XIMA 2Z4GA 4AY8A 3GM8A 5HAOA 5FAGA 2Z7GA 1VEPA 4O1CA 4IPNB 3LHYA 2QUTA 2BB0A 1YNPA 4TU1A 1W9XA 3L2LA 5LA2A 5DCBA 5FCZA 3H2OA 3EDKA 3S6DA 5BU9A 1EHAA 4FXJA 4P5UA 4J9JA 2V30A 3TN3A 3NO3A 3WEOA 3L4UA 3VGGA 5CLTA 3NQ7A 4Z1BA 3A5FA 4AW7A 1NDVA 4GGHA 1D3GA 3EWUA 1S2CA 5BXRA 2RDXA 1CLKA 3BW3A 3VGDA 5TBOA 1W3TA 5RUBA 2JBMA 2GOUA 5G4EA 2GQ3A 1UP2A 3O63A 2EG6A 4YVPA 4CUCA 4GJJA 2FGLA 2XH4A 3T4CA 4NNCA 1RLCL 1K1DA 2CWXA 2R9RA 4LVBA 1W1YA 3UCQA 3ZJ6A 3R0DA 1DJQA 4HCDA 3UXKA 1FWTA 4EAMA 4LB3A 2VO5A 1C91A 2VGBA 3XINA 4QNWA 4HHMA 6TAAA 2PWHA 2W9MA 4GZEA 3ITLA 3W29A 4D8LA 3A12A 3OPSA 4BWLA 3W85A 3TW7A 1NTHA 4QQ3A 3KP0A 3G3MA 3T07A 4LT9A 1P6BA 3IUDA 3WLLA 3ARUA 2BHUA 1E5NA 3WDJA 3THQA 1MMFA 3RLVA 1J0YA 4IM4A 3OLIA 4LWWA 4O18A 4C65A 4UQBA 1QI0A 2PDIA 3ABOA 3KZPA 1FHUA 2GUBA 3W1XA 1Y5VA 3A3WA 3PM6A 2IKJA 2UWFA 4HTYA 4TR9A 4P7OA 5E70A 3SCNA 5B80A 1LQ2A 4D2JA 4GVHA 5CSUA 4YHGA 3LQLA 1C7TA 2RAGA 2VC7A 3TEVA 2BXVA 1PIIA 4DJEC 4PR4A 5XIAA 1TRIA 5AVNA 3IIXA 5LNRA 2YGYA 1GHRA 2NQLA 4JYFA 4GI4A 2EPNA 3N25A 2GVJA 1CW2A 4J1OA 1OF8A 3WMBA 3BLOA 1ZJBA 3OODA 1XLGA 4ACZA 3QN3A 4JIEA 3W2LA 1QAPA 5J04A 1PWMA 1ISXA 4L9YA 5GJPA 3IGHX 3EZ4A 4NJJA 9XIMA 2ESCA 1UR8A 1FWRA 3QV9A 4JGDA 3FKKA 3WBAA 5GVJA 1JNEA 4HCLA 3T7VA 4P7NA 3KRSA 3V35A 4CCCA 1UWIA 9CGTA 3G1FA 1MXSA 2PEVA 3KE0A 4EVZA 4ADUA 1VEMA 1A3WA 4KRZA 4MKSA 3W81A 3ARPA 2AQOA 1YLVA 1UD5A 1NARA 3OHMB 5CSSA 1A5KC 5AZ0A 3NQBA 4W7UA 3TOYA 1CXEA 3CH0A 4Q4PA 2NV1A 3ZYZA 1US3A 3T81A 3MP4A 5U7SA 3W2UA 4GH1A 2W62A 2C7FA 2P3EA 4FEZA 1E3XA 3IVUA 2QDEA 2EPMX 1VFUA 4L6OA 5CPOA 2OWXA 4W4QA 3DX5A 3W2MA 5CPMA 1YDYA 4FHAA 4S3KA 1LWJA 1MEWA 2DH2A 3W7LA 1OZQA 4AVOA 4FIRA 4UC5A 4J7RA 4QG8A 4MTVA 1KB3A 1TJPA 3P93A 4UTJA 5D9OA 2EJ1A 5EY5A 4N02A 2QLYA 4P7QA 3GUGA 3W2JA 4UFHA 1O68A 1ADSA 4ZBCA 3ANVA 3CL6A 1TE6A 1YBQB 1J4EA 3GDTA 2FJUB 3GZAA 3NZRA 3ES7A 1OEPA 2XVKA 4LX4A 2CWNA 4IIBA 1L6FA 3HIJA 3WDHA 4UFIA 3NYDA 3BQ6A 5IFPA 1HX0A 4Q4OA 3ITXA 4AEEA 1BPLB 1V0NA 4MSSA 1DJZA 1GZGA 4DO6A 5EYWA 2VCCA 3ANUA 2X2YA 3MO7A 4B91A 1REQA 3MCNA 3SN1A 3PZUA 2OKOA 4XZBA 1F74A 3ZJ8A 2R1KA 1A47A 5C7HA 5HR6A 4WY0B 2D3LA 1EC9A 3VKCA 1GJWA 4AHQA 1V3MA 1YNYA 2XDFA 4EAYA 3UQNA 4DI9A 3BPWA 2UY4A 5LGXA 3FAWA 2AL2B 4X0NA 2QAFA 4QBXA 4AH7A 3UR8A 2F61A 4ZEPA 2P5NA 4F40A 4IPLA 1XYZA 1EP1A 1TQJA 2ISDA 2OYLA 2YW3A 3L4ZA 3W24A 2H3DA 3WBEA 1ZLPA 3RGTA 4US6A 1GVFA 2YB1A 3GDMA 5DO8A 2CZVA 4URIA 1OFRA 1MO0A 1DWAM 1E0XA 2PDLA 4XVDA 4H9YA 4RK8A 2YXOA 5GPRA 4DWSD 1YADA 1EH9A 3OQEA 5LIUX 5A8QA 3TYUA 1EGMA 5FIPA 1EWEA 1UJQA 4CD8A 1GOXA 1OGBA 1IXQA 4HHHA 4LU0A 5REQA 4CQ8A 4GQRA 3FV9A 4YCOA 2J7CA 3WDQA 1TTIA 1E43A 3RJXA 4MWAD 3W1AA 2P88A 4WOQA 1IT0A 1KGWA 3ZIZA 1LRQA 2WZIA 5K4XA 4EPEC 3GUWA 1J01A 4ZENA 3ZM8A 5HMFA 4FF7A 4BQ4A 1AVAA 1FOBA 1DP0A 1X96A 2J6VA 3NDZA 4Q7BA 2I5IA 3ZFHA 1OCQA 1QU4A 3HV8A 1UG6A 1EA9C 1CXFA 1KWKA 3HPZA 1OB0A 4HT3A 1XSJA 1O5XA 4UQ9A 5DMNA 1XH0A 4ZR8A 4WD0A 3NIYA 3NM3A 3PUOA 2D22A 2Z1WA 5BMXA 1JQXA 3SIMA 4W5ZA 1TJRA 2C0HA 1M9HA 3H12A 3ZQ9A 4QLKA 3ITVA 1XP3A 4KWUA 4UQCA 1EDGA 1ADOA 2BWGA 1B0IA 4CU7A 3GS6A 1ODZA 4AXNA 4ZOAA 3PR2A 4PBFA 4H3DA 4IJCA 4GVIA 1LBMA 4WXYA 3I7SA 1GYMA 1LBLA 1XYMA 2P50A 3M6DA 1DWJM 4E3TA 3BUVA 3WH6A 2YDAA 3L4TA 4A35A 1UH3A 4B5TA 4K7YA 3PB2A 3L12A 4KCWA 1C8XA 3VC5A 1JI2A 3V5OA 3NZQA 1OX4B 3RM9A 4K39A 4O11A 4H8NA 3V4BA 1NP0A 1QPKA 3VU2A 4Y9AA 4DF2A 4S2BA 3ATYA 2OQHA 3PWAA 2D0GA 3OGSA 1U22A 5LSMA 1QPQA 4GLEA 1WDDA 4LFYA 1Q2RA 4IH3A 1GVYA 3S3GA 4DIAA 3NPXA 5CG0A 2H90A 4QSFA 1VHCA 2MUCA 1Q4NX 1IEQA 2OSYA 1BD0A 1T6MA 2YCEA 4PMYA 3T2PA 1XFCA 4F4RA 4DJDA 1ML1A 1PIFA 5E9XA 3LGDA 4BCEA 2GZXA 3NM1A 5CEWA 2WSYA 3URAA 3M7SA 4FOKA 1EEPA 5JIPA 5K9XA 3ERPA 4DJFA 5HK4A 1L6GA 4EIVA 4B90A 2OG9A 2QCMA 3VNIA 1F8MA 3KWSA 5I6SA 1NOWA 3U5UA 4RNHA 4O28A 3W6LA 4UTMA 2WNZA 3MMWA 5AHFA 3CZLA 2OO0A 4CEXC 3GDRA 3G6MA 3BE7A 3CEPA 4GK8A 2R1NA 3GYCA 3MS8A 3D6NA 4D8AA 1LG2A 1TPDA 1N55A 3VAVA 2XIIA 4JN8A 3UVAA 1UW9A 5A6BD 4B92A 4M6QA 2HV5A 4QROA 1RQHA 5LNUA 1EYEA 1XC6A 4WVXA 3AZSA 4K1GA 2WZHA 1V51A 2PWEA 4GXMA 4KIEA 4M19A 5BW6A 1MEIA 3CYJA 3C0SA 1RD6A 4FLSA 4UQDA 1TUXA 4WOZA 3VKKA 1BAGA 5CKSA 3HM7A 4Q8QA 1JYVA 1U5JA 1W91A 3M44A 1DIOA 2YL5A 3L23A 5L9FA 3JZUA 1TWIA 2A7PA 3NFUA 1A80A 4AZ7A 2GUYA 2AQWA 3MMDA 1QNSA 4Y7EA 1V0KA 2CHRA 2Z1VA 3S47A 1X8CA 3MB9A 5LYRA 1QOXA 2ZA1A 3AAMA 4QR6A 1PUDA 4AMAA 3W83A 1B4EA 3T0CA 3GK0A 1JPKA 2ZWZA 1IZJA 1E5JA 2B31A 3TE9A 2Y8UA 1S5MA 1GCYA 4ACYA 3NPWA 3P80A 1OM0A 1POKA 4JTTA 3LCGA 4W8LA 1ZZMA 3UNTA 2J75A 5DXXA 1O66A 3O06A 4YHEA 2G3IA 2FIQA 2I9EA 3H4WA 2W61A 4KWSA 1BXBA 1FWAC 1SGJA 3TK7A 4KT2A 4JL1A 4H2HA 3IAPA 1X6UA 3SN0A 2WVTA 2PDFA 4W85A 3CH9A 4HNTA 1CX9A 3K8MA 2ZA2A 5CLWA 3T0BA 4QCEA 3L21A 4HU8A 4UFJA 3IRDA 5AYIA 4DO7A 3HJEA 4KFPA 4M29A 4A3YA 1HZYA 3B8TA 1KM1A 1TA3A 2J7GA 3CL8A 2ZZ1A 2VCBA 4DYEA 1X1OA 3TUUA 2PBOA 5D2YA 4ZZ9A 1E9YB 1E1CB 2DZPA 2WMIA 4IJBA 1FWIC 2Q8LA 3N4FA 4H9UA 1D2KA 1DBTA 3W7NA 2YXGA 3T0TA 4CNPA 1R5YA 3SJ3A 1XRSA 4ZFMA 3TLQA 3AMLA 3LTSA 1ONWA 1RLDA 4R34A 1FWSA 1H2JA 3WNMA 1UA7A 4XZHA 2HCVA 3AWOA 4LS0A 3S5OA 4IGHA 4GFIA 3GX9A 3DG6A 4K8EA 4OQVA 3LRKA 2PLCA 3VKJA 3AYVA 2TYSA 4XZMX 4GQBA 4QX4A 3AS2A 5ENLA 1LOQA 5EMYA 3PP7A 3EOSA 4AVFA 3K46A 4CQAA 3NAVA 4HA4A 4WY0A 4BHYA 4Q8NA 3H7VA 3ZT5A 2BMBA 2FPYA 4ZO7A 3AHXA 4JX5A 4I5RA 3OZYA 1VB9A 3OEXA 4DZHA 5I03A 1X38A 4LRSA 1JZ7A 2D3NA 1I6NA 1MQQA 2BVTA 4JAWA 3CMJA 1H49A 1UBSA 2NVCA 1XQKA 2PGFA 2RDUA 3WH5A 1J2BA 4F2UA 2CLPA 2H9AA 5D2TA 3VNMA 1R7OA 3ONCA 2DVXA 1PX8A 3GVQA 4X9YA 1I0BA 3PZQA 5CC6A 1CCWB 3LHWA 3RX2A 3UJEA 1MZHA 3VNYA 3DFNA 4UTTC 3WQ6A 1SMAA 3TMQA 1U1HA 2W67A 3I68A 4C5ZA 3MU7A 3ALFA 3HG3A 2V8ZA 3NQMA 3HPAA 3N12A 3RPTA 4QJ3B 3MJYA 4AZGA 3GHRA 2PLJA 3IV3A 1JULA 3HQNA 3I4EA 4H8HA 3BXWA 3DHUA 3POHA 4EXAA 4ZXOA 3WSUA 1FWJC 4FNRA 4PFHA 2HNEA 4GO9A 3VZYA 1VCVA 5A69A 2ZVRA 2PDUA 2VL4A 4DWSA 1GHSA 3C2OA 5KZEA 5EMJA 3SGZA 4C6JA 1IIGA 3O3RA 2WSPA 2PSNA 1XYAA 4LUJA 4OV4A 3A3XA 1R8LA 3XISA 1XWYA 3QY6A 4TV5A 2IXVA 3WF3A 4AISA 1TMQA 2X2GA 4G6CA 2WMFA 4PMRA 1KFWA 4MWAA 1E4NA 3G0UA 4FALA 4MMWA 3LK6A 2ZICA 2JIWA 1O95A 5EBUA 2WPGA 1LQ0A 2OR2A 3BDKA 6CGTA 3KTXA 1GONA 1ZNNA 3B05A 1Q6EA 4XD3A 2GK1A 4AHPA 5BWAA 1RBOB 4PTXA 1SFTA 3NO1A 3GTIA 4OGZA 2J7HA 1C29A 4ZA0A 1K4GA 4DF1A 4GQQA 5EA9A 1FBAA 2A3EA 2PFHA 2DIKA 1UH2A 3NOEA 4D6EA 5A6AA 3AIBA 3KCJA 4D6DA 3EX3A 2BVWA 3PJXA 2VEIA 3MW7A 3ES8A 1YPIA 3PUEA 2PP3A 3N15A 1VFOA 4MDPA 1KXTA 2QCDA 2VQUA 4ZOEA 5JU6A 4DN1A 3V1HA 2NXGA 2BP1A 5A6TC 4O1FA 2FVMA 2A6LA 2X30A 1QK2A 1WDQA 3T55A 4MB5A 3CT2A 4TOQA 3CQIA 5FF3A 1N2VA 4QS5A 1JFXA 3P5YA 3H2EA 2HQAA 4PULA 3NCOA 3EAUA 3SM0A 3HTWA 4IFKA 3H2NA 2Y6ZA 5AKQA 4Z1DA 1MW3A 2RUSA 3TYZA 3FA5A 2ODOA 3E74A 5HWNA 2YOCA 2FHCA 3AIRA 5D2XA 3GXMA 4UNKA 3CPUA 3IVSA 2FDSA 1OCNA 2GVLA 3RAOA 3T05A 1TVNA 2G3FA 3AISA 1U33A 3R25A 3WMCA 3VGFA 3MWCA 3Q4DA 1V93A 2WJEA 3PZMA 1PO9A 2X1RA 3CAQA 4WR3A 4GQ0A 4F8XA 2Z2UA 1DQWA 2CZFA 3PBMA 2J77A 3I4KA 5HDRA 2VR2A 1W8GA 4LNYA 3RO6A 4NZJA 1DIDA 3AYRA 3AC0A 3W73A 1L9WA 3INPA 3PZVA 5AYBA 3TR2A 3WBXA 4I9JA 3UYIA 2I9UA 4MYAA 3RFAA 1WZLA 2CLEA 5CAKA 4UUIA 3GZ3A 2NV9A 5ECUA 2J8TA 2HEJA 4Z0JA 3U6WA 2A3AA 1FDJA 2WANA 2VM8A 3W7RA 1NDZA 1VFSA 4GGBA 3SGGA 4CN6A 2WC3A 1F4HA 5LGZA 3GVGA 5CBJA 1S3HA 1YHTA 3SCTA 3DOPA 3N14A 4MY9A 3L0KA 4DO4A 4QTGA 1AA1B 1EX1A 1J9YA 5D37A 4GD0A 7TIMA 3M5YA 2WCSA 5A6BA 4RPQA 4M7TA 1NU5A 3WN6A 1VRXA 1IT7A 5AOUA 1ZJAA 3PZGA 5K9CA 2Z25A 3ITCA 3L2MA 4XZNX 4FNPA 4B3LA 1AH0A 4J3WA 2D20A 3UBPC 3DKJA 3PUDA 3TTQA 3E0FA 3C2YA 4PFMA 4AD3A 1Q6LA 2ZRWA 2WPBA 2DSUA 4PSRA 2GQ9A 5XIMA 3URQA 3IGSA 1QUMA 2CLMA 2ZXDA 4ATWA 4WDWA 3QQ1A 1P5BA 5D9NA 5BRPA 1E73M 5CXPA 4HPJA 2GGJA 1MRAA 5F2GA 4PH6A 2ZQ0A 3M0JA 1V8EA 2FZBA 4ERIA 4MZYA 3W28A 5DLCA 2O0TA 4F9JA 1OYCA 4Z2IA 1ADDA 3C0LA 2X1UA 2XIMA 4NUWA 3CUXA 5JBFA 1DWFM 4Q33A 4LOCA 3FJLA 3BLDA 4DF0A 4QJ5B 3SDOA 3W75A 5C8BB 3N9RA 4NQ1A 2XUCA 3OLDA 1BXCA 3DFQA 4G5DA 1JG9A 4S3CA 3SCPA 1LBFA 3SUVA 2JKPA 3ZVIA 1FUYA 4P7LA 3GU9A 2X16A 2XFFA 4FAMA 4FNUA 3CV6A 3WK2A 2VR4A 1H41A 3R0KA 3AU6A 5BROA 4KWWA 4S23A 1NSJA 3IJDA 2WZMA 3QW4B 1YIXA 1R3RA 5FJPA 3VGEA 3EWYA 3VABA 2CKSA 2AGTA 2WK2A 1HJQA 5E6ZA 3P60A 2YCLB 3DFPA 4F0HA 1L0PA 1CGUA 3M0HA 6A3HA 2C3ZA 1PZ2A 1F3WA 5C54A 5U4NA 1SO4A 4U33A 4Q7IA 1GW1A 3RPMA 3AIVA 2JKAA 3F5LA 1Q63A 1LQAA 1F6KA 1JGMA 1AH4A 3M9YA 2D1ZA 3T40A 1TG7A 1TIMA 3APTA 4GNKB 3NJ3A 3VOGA 2V38A 4XK2A 3OW1A 4AF0A 2BV9A 2ZX8A 4KQNA 3SCOA 1VKFA 1XBXA 4ZFCA 3UU0A 2Y89A 2J24A 1JZ4A 3NNTA 4UTWC 3O6CA 3EWWA 2VDGA 3FHQA 1IXOA 1UC4A 3S2LA 3E96A 2QW5A 2OLHA 2TRSA 3BOXA 1E1FA 1W3HA 4IP7A 2FMNA 4EPDC 5FESA 3I6TA 2V69A 3SCVA 4ASTA 4QXIA 4UR9A 5C9ZA 4NI8A 3W1TA 3S42A 4YYCA 3H55A 1EJRC 3UERA 3V36A 4PUEA 3SY1A 3W7HA 3DC0A 1R3YA 4ZTYA 4X61A 5FSDC 5LXEA 5C70A 3AROA 3Q45A 2CBIA 3IV8A 2C14A 3SSZA 3MBDA 4NL1A 4U5KA 4HN8A 3VFLA 3EDJA 3CO4A 1FY6A 2QPXA 2Q71A 1EJSC 3OA3A 3Q65A 5FEXA 2V9DA 4X22A 4JFTA 1PS9A 1DHKA 3M5XA 1QO2A 4N2YA 4GNVA 4JPGA 4IPJA 2WVSA 1A3HA 3B8SA 3FVMA 3N2TA 3HQ1