1KRMA

Crystal structure of bovine adenosine deaminase complexed with 6-hydroxyl-1,6-dihydropurine riboside
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
349
structure length
349
Chain Sequence
TPAFDKPKVELHVHLDGAIKPETILYYGKRRGIALPADTPEELLNIIGMDKPLTLPDFLAKFDYYMPAIAGCRDAIKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVQAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDTTLYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of bovine adenosine deaminase complexed with 6-hydroxy-1,6-dihydropurine riboside.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords adenosine deaminase
total genus 118
structure length 349
sequence length 349
ec nomenclature ec 3.5.4.4: Adenosine deaminase.
pdb deposition date 2002-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1krmA00
1J6PA 1K6WA 2Z26A 2Q09A 1J79A 2PUZA 3URBA 3QY7A 4C5ZA 4F0LA 1R9ZA 2D2GA 1EJSC 4C5YA 4HJWA 2HQAA 3URQA 2Z00A 4KETA 2VC5A 2DVXA 4INFA 1EJVC 3GU9A 4WGXA 3UPMA 4QSFA 1XGEA 3TN3A 3MVTA 4XAGA 3MPGA 3IGHX 1ADDA 4C6IA 4LCQA 3RYSA 3ICJA 1HZYA 4LAOA 3SO7A 3MSRA 2O4QA 1JGMA 1KRAC 4NI8A 3PBMA 3S4TA 1FWCC 2WJDA 3IARA 1FWIC 2Z29A 4R7WA 3OU8A 2UBPC 4G2DA 2QT3A 4LH8A 5CH9A 3PNZA 1KRMA 4NP7A 4ERAA 1A5KC 4XD5A 4GZ7A 2D2JA 4IFKB 4RDWA 3LGDA 2Z25A 2YXOA 1E9ZB 1BF6A 3S2MA 4ERGA 2OGJA 4QS6A 4BKNA 4DI8A 4H9MA 4EPBC 4J2MA 3LSCA 4UBPC 4C6NA 4IQJA 3ISIX 1UMLA 4H9XA 3LY0A 2ICSA 4F0RA 2XIOA 1FWGC 1YRRA 3QY6A 1PSCA 4M51A 3EWDA 2R1NA 4E3TA 4DIAA 2ANUA 2D2HA 2P50A 4GX8A 1A4LA 3DC8A 2VC7A 4C65A 1FWJC 3PAOA 3GTHA 4GOAA 4KIRA 2F6KA 3IV8A 1FWHC 4ICMA 4LEFA 3IJ6A 4PCNA 4KERA 3S2LA 3QGAC 1EJWC 1KCXA 2GWNA 4QRNA 2Z2AA 4JOMA 1UBPC 1A5NC 1GKPA 2HBVA 1YBQB 4C6BA 4C6FA 2GOKA 1ONWA 2WJFA 4L6DA 4LCSA 4GY7A 3LNPA 2KAUC 2I5GA 1VFLA 2IMRA 3URNA 3WMLA 1RK6A 3B0YA 4C6DA 4IG2A 4G7EB 4CQCA 2Z27A 4LAMA 1A5OC 3D6NA 5HMFA 1RAKA 4QTGA 4CQBA 1EJRC 4IG2B 2VM8A 1ZZMA 1WXYA 1POJA 4IFOA 4IGNA 1DPMA 1K70A 4LAKA 4DZHA 1I0BA 4RE0A 4BJHA 3F4DA 1GKQA 1PTAA 1UIOA 3NEHA 3LA4A 3F2DA 4H9YA 2OB3A 4DZIA 2GZXA 1A5MC 3UF9A 1J6OA 3FDKA 4J5NA 1R9YA 1UIPA 3O7UA 4WVXA 3GU2A 1YNYA 3PANA 3QGKC 2FFIA 4KF1A 3IPWA 1NDVA 3DCPA 4GK8A 4C6LA 1R9XA 1RJRA 3GTFA 5HMDA 4C6CA 1XRTA 4LANA 4UB9A 2ADAA 2FVKA 4CQDA 4H9VA 1EF2A 2OODA 4ZSUA 3E38A 3ITCA 3RHGA 4GY1A 4RDZA 1FKXA 3EWCA 4KEVA 4GBDA 4RDVA 3PNUA 2W9MA 4RZBA 2FTYA 1PB0A 4C6OA 2P53A 3GIQA 3K4WA 5E5CA 3E0LA 2PGFA 2Q01A 4MUPA 3T1GA 1QW7A 2BGNE 2BB0A 2AQVA 3GRIA 3MDUA 4PBEA 2AQOA 4EP8C 4KQNA 2R1KA 5FSDC 3F2CA 2FVMA 1ITUA 2HBXA 4F0SA 5HMEA 3B40A 1GKRA 2EG6A 1ONXA 2YZ5A 4CEUC 3JZEA 2YB4A 4XAZA 4KEZA 4DNMA 4CNUA 1EJUC 3MTWA 4D8LA 3S2NA 2R1MA 4B91A 1QXLA 3AU2A 3A3WA 3TNBA 2O4MA 2R1PA 3OJGA 2Z2BA 4LCRA 1EJXC 4XD3A 1V7AA 4CNSA 1KRBC 3A3XA 4CEXC 4ERIA 2PGRA 2R1LA 1P1MA 3WZ0E 4Z42C 1V4YA 3CS2A 2Z24A 2UZ9A 2AMXA 3EGJA 2WM1A 1YBQA 1FWBC 3HTWA 3K2GA 1V79A 1RJPA 3T81A 3O0FA 4C6EA 3OODA 4C6JA 4PE8A 4L9XA 4KESA 1POKA 3UBPC 3URAA 1J5SA 2OQLA 4C6QA 4DI9A 3R0DA 5G4HC 3K5XA 3RCMA 1PO9A 3LSBA 3HPAA 3HM7A 1XWYA 2CZVA 1M68A 2HNHA 3IACA 4GY0A 4LFYA 1P6CA 1WXZA 2QS8A 4IFRA 4DLFA 4DO7A 4GXWA 3WYZA 4XD4A 1RK5A 3QY8A 3FDGA 1ITQA 4IH3A 4H9ZA 3RN6A 4RDYA 2HPMA 3NURA 3UR5A 3E2VA 1O12A 4YIWA 3GIPA 1M7JA 1EYWA 3LU2A 3CAKA 1RA0A 4C6MA 3F2BA 3IRSA 3GG7A 3BE7A 4PBFA 4R88A 2DVTA 1FWDC 2G3FA 3GTIA 3F4CA 4IFKA 3DUGA 4CNTA 4XAYA 1NDWA 3CJPA 3OOQA 4H01A 4EPKA 3T8LA 3C86A 3AUOA 4C6KA 1XRFA 5FSEC 4V1XA 2A3LA 3G77A 4TQTA 4HK7A 1RJQA 4DYKA 5A6TC 3UR2A 4OFCA 2PAJA 4C6PA 1NDZA 1M65A 2Z28A 2GSEA 4H9TA 4H00A 4KEUA 1KRCC 1V77A 5LXXA 2EG8A 3A4JA 2EG7A 2I9UA 2VR2A 3E74A 4P5UA 3E0FA 2YB1A 3LS9A 3E3HA 1IE7C 1V51A 2GWGA 5AKQA 2RAGA 4HK6A 1FWAC 4IGMA 4GYFA 2VHLA 3TN4A 4PCPA 4EPDC 1EJTC 3ORWA 2Z7GA 4NG3A 3GU1A 1A5LC 1K1DA 1FWEC 3AU6A 3MDWA 3OVGA 2E25A 3GTXA 3GUWA 1YMYA 1S3TC 2PLMA 4BY3A 4EPEC 3B0XA 4QROA 4IF2A 3ID7A 4V1YA 4DLMA 3MKVA 4GX9A 4XD6A 1E9YB 1FWFC 1NDYA 1FKWA 4GC3A 2VUNA 2WJEA 3N2CA 4AC7C 3OQEA 1O5RA 4I6KA 3SFWA 4B3ZA 1YIXA 4R85A 1I0DA 1NFGA 4H9UA 1P6BA 4I6VA 2OOFA 2E1WA 2QPXA 3TN5A 2Y1HA 1EZ2A 3NQBA 4HA0A 4LALA 4AQLA 4HK5A 4G7EA 2ZC1A 1RA5A 4WHBA 4J35A 2HPIA 2QVNA 3LGGA 4B90A 1A4MA 4XAFA 2FTWA 4QS5A 3S2JA 1W1IE 2Z4GA 3V7PA 4ZSTA 3MVIA 2DVUA 3TN6A 3MJMA 3FEQA 4B92A 3KM8A 4C60A
chains in the Genus database with same CATH superfamily
4UMBA 2OJPA 2PRMA 5AC7A 3WLSA 1AVAA 1LBMA 3OG2A 1R9ZA 4MJMA 3GTNA 3WQFA 2A85A 4S3FA 1D2KA 1BYDA 2J24A 4WDWA 3M16A 3HQOA 1B30A 2C14A 4XVDA 3UPWA 4Z0SA 3Q67A 4DWSB 3MKKA 3PFMA 3W24A 5REQA 1FH8A 4D6IA 4AZIA 1TWSA 2WCGA 3CZLA 4XZLX 4LPCA 3BJSA 2ZXAA 2J7HA 4DF2A 1VENA 1GK8A 2PGWA 3B3DA 4X2PA 4GZ7A 3KOYA 2D2JA 1D8WA 5DF0A 5BWFA 3CK5A 3GNOA 1NM9A 3OO2A 3GD6A 1MW2A 5F4WA 3LGDA 2OYLA 1TZ7A 3QXBA 1KKOA 2GVJA 4M6VA 2ZC8A 2QIIA 4TIMA 1W6TA 1O5QA 1LYXA 4QCFA 3FLUA 3P93A 3BXWA 3WEOA 4ZOAA 2A3AA 2GQ8A 4H9XA 2DT2A 5F2MA 4UTTA 3SEPA 1E56A 2PD5A 1XLEA 3O6CA 1GYNA 3Q94A 5F2GA 3GTHA 2UV8G 3RAOA 3KUMA 1VKFA 3UZ5A 1YDOA 1G6CA 3WFLA 4L4PA 3FKRA 3AALA 3UZZA 1OYBA 3GC4A 1U1JA 4H3DA 3ARQA 2WJFA 4L6DA 4EXQA 2BY0A 1OG0A 3TYEA 2PD9A 5D9OA 1XICA 3W1NA 1HO4A 2BOFX 1SJBA 4MY1A 3IJDA 1XJBA 3XINA 3KVLA 3HB9A 2QHAA 3WQ6A 1JCLA 3SR7A 1GYLA 4M3PA 4NRSA 5HMFA 5HANA 1ZBVA 2QCEA 3AICA 2FGBA 2PDJA 3STCA 2QCFA 3GK0A 6A3HA 4AWEA 4D1JA 2E67A 4LV4A 4F66A 3F2DA 4X63A 3WD1A 3VGDA 1EA0A 1WQ5A 1W37A 1J6OA 4O1CA 4EWND 3M47A 2E8ZA 4LANA 1SO6A 4AD5A 1EF2A 4L7ZA 2QCDB 4JAWA 4Z08A 1W1A1 2VRJA 4MFDA 4UNIA 3JS3A 4LVFA 4N6FA 2P53A 3WD2A 3BARA 1DXEA 3QZAA 3QV6A 3QH2A 1X39A 1W1PA 4D6JA 1PKLA 1AQ0A 2FVMA 5I78A 4F0SA 1GKRA 4HNNA 3CMJA 4W88A 4QFUA 3NQ6A 3FJNA 3PY2A 4DNMA 3IAPA 4M0XA 1KO0A 5ECVA 1NOWA 9RUBA 2HZGA 2R1MA 1EHAA 4DXXA 4XD3A 3DBNA 4TU1A 3DEQA 3CZJA 4DQWA 3W3OA 5A8OA 1F2JA 1A3XA 3CS2A 4KPLA 2DT3A 1OM0A 3R12A 3SY8A 5A5WA 1ZJBA 1POKA 3FX4A 1KFCA 3MUY1 4M80A 5LHEA 1I1XA 3DG3A 2HNHA 4RZ4A 1P6CA 4NQ1A 4CUCA 1EIBA 3UU0A 3G0UA 3VFCA 4MPKA 3WNNA 4IH3A 3I7RA 3KBNA 1Z48A 1WDPA 1QK0A 2O92A 2WQDA 3H54A 2C1GA 5KZ6A 3NZPA 3DDMA 1RPKA 3ZJ7A 3MT1A 3BAKA 1HP5A 3NQVA 4A8NA 3CAKA 1H7RA 3NZRA 2V2DA 5A2BA 4MAVA 3GG7A 3UT0A 3NCOA 3AIWA 4R88A 4OV4A 4CU8A 1OJXA 3OG3A 3NUKA 1W9XA 2QVHA 3DG6A 3G0XA 3MB9A 1HKMA 4DYEA 2OPJA 3MCOA 4KRZA 1DJGA 1LP6A 1F5ZA 1PUDA 4HYVA 1WA3A 4E8CA 3BK0A 3CC1A 3M0KA 2BLEA 4FF7A 3W84A 1H2JA 1KRCC 3I3EA 1EGMA 2VZUA 2GUBA 3BPWA 3E74A 4P5UA 4PSRA 4HHPA 1EBGA 3BSGA 3FGCA 3MV11 2BWGA 3VD5A 2GWGA 5HNTA 4HK6A 3VUPA 3TN4A 1WUFA 4DXVA 1EJTC 2DZSA 4XZ9A 1A5LC 3W7EA 1V6VA 1LWIA 2VZTA 4X9SA 1LRNA 2C79A 2XUCA 3SCTA 1SSGA 1TMQA 3SRHA 3TXZA 4QROA 1H3GA 4IF2A 1W0MA 4R9OA 2V5KA 1GOXA 1Z41A 4GZEA 3N13A 1HGWA 2ZA1A 4G6CA 2CWNA 1E9YB 4JX6A 4AXNA 4S3EA 5HA7A 1VPQA 4AHPA 2Y8UA 3ALGA 3PVFA 4DVOA 4ATWA 3N2CA 3V16A 3T44A 1ZJAA 3DI1A 3FHAA 3TIMA 5H2ZA 3LPFA 4AZGA 2VX6A 1CXEA 1C7TA 1I0DA 2OMAA 3H55A 3S2CA 1YYAA 1T96A 1TWIA 5AYYA 4LF2A 4HT3A 4HA0A 5E0KA 2WHJA 3ABXA 4PODA 1U5JA 2NX3A 3Q58A 2NT0A 3RFAA 2ISDA 1EWEA 1JCMP 4J1OA 1PZ3A 4XAPA 1W1B1 3MSGA 2QPSA 3WF0A 1EPVA 1CYGA 3LB0A 9XIMA 5CPOA 1JG9A 2DZAA 2BVYA 3O3RA 1W32A 3L4ZA 3MO4A 1K6WA 2ACSA 4W89A 3CAVA 4RE4A 3HJEA 3QY7A 2RJGA 1XPYA 3H2CA 4LVDA 4WRHA 5EFFA 1E1CA 2DZWA 7REQB 1TRIA 4M5PA 1XLHA 1HZYA 4F9DA 3B8DA 5CG0A 3SO7A 1Q6CA 3UJSA 2BX7A 4A3QA 3WBXA 1MO0A 5K7JA 3WLKX 1M1BA 1UR2A 1EUAA 1NELA 4WXYA 4Q8NA 3TSMA 4ROPA 4YU1A 4JFSA 1FVPA 4B5TA 3NYDA 1A5KC 3W29A 1FUYA 3B9AA 3ARVA 3OBEA 2YXOA 2IQDA 1JCNA 4Z17A 5E9AA 3TV8A 4QS6A 2ZE3A 1W5MA 5KSWA 3WF4A 3KTSA 4HZMA 3QLLA 1OFRA 2BY3A 3W87A 3SM0A 3P8IA 2D2HA 2VC7A 1E71M 4AVOA 5D9PA 5K9CA 1F3EA 1SFJA 1XS2A 4UTJA 4IUGA 5KZMA 1V6YA 1V0KA 1KFJA 2XVKA 3CQJA 2F9RA 3IJ7A 3O06A 3OLEA 3TW6A 4ZXLA 1YW1A 1R30A 1JVNA 2G3MA 4I8DA 3MI3A 2NW0A 1H7OA 1XQKA 4J3UA 2ZWZA 5A8NA 1VF8A 2QDDA 1OF6A 1OGBA 1OCNA 4HNLA 3S83A 3OGVA 5MKGB 2XWEA 4H2CA 1RAKA 3LI1A 5A3HA 3RO6A 3TVAA 1TPB1 1EL3A 1DEDA 2FKPA 5CSUA 3CL6A 3TCSA 4YL2A 3M5XA 4UNLA 1VFUA 5A95A 4P7LA 7TIMA 2PCEA 3QHMA 4B5NA 4H7ZA 1D9EA 4IISA 1RJRA 3QMSA 1H61A 3PG9A 1VGAA 3RU8X 3GO2A 4ZSUA 1OGGA 3BQ6A 3SRDA 3WLQA 3ITCA 2E6DA 1XR2A 3TOPA 5E0CA 1ZPTA 3V4BA 2CXGA 4MUPA 4QJ5B 2POTA 3CZEA 1GOKA 3VUSA 1NSJA 1QW7A 2WK2A 1MMFA 3ZR4A 1ZCCA 2BBFA 1A3WA 1BKSA 4JNMA 1XHGA 1E43A 4TX8A 1FP9A 2R94A 4Z2HA 3HGJA 2FMNA 2FJUB 4K7VA 1DORA 1UH2A 4HJFA 4X9YA 5EMLA 3UWVA 1TSIA 1LG2A 2NX1A 4W8AA 3MP3A 4PMUA 1XFBA 1HW6A 4OGZA 3EZ4A 1HJUA 1KRBC 1QVBA 4HQVA 5CSSA 4TV6A 3BCFA 5IRPA 4GVFA 3CUFA 2FVLA 1S3HA 1BVNP 3SRFA 3QOKA 2CBUA 4IMAA 1DYSA 4M29A 2QF8A 1BD0A 2D0GA 2AQWA 1N8FA 3W1AA 3URAA 4XKYA 3BLKA 4JX4A 4BR1A 5AFDA 4O57A 1PO9A 1GZJA 3P2VA 3IACA 1WXZA 4Q8WA 2OO6A 1E9IA 1TX2A 3WDJA 1RK5A 3U9IA 2E1DA 2E77A 1D3HA 3PUOA 3HV8A 1TV2A 3GIPA 5HQMA 1C7SA 4MLRA 3QVQA 3UXKA 3RM8A 1CLKA 1H7WA 4YVPA 3ZT7A 4DJFA 4HPJA 2XWDA 5HPCA 4YYCA 3SQSA 1QNVA 1UZ1A 3N2XA 2J77A 4WOQA 3VIOA 2V3GA 4MKSA 2XN0A 1QOQA 4MUZA 2J47A 4M7TA 1E4NA 3UY7A 3UXAA 2DZXA 1NOFA 1KWGA 2D20A 2UY2A 1L9WA 4ZODA 4MM1A 4Q4MA 2YL8A 2X1SA 4I9MA 3T8QA 2PAJA 3REQB 5I5RA 1XW8A 3DESA 5EMYA 1VR6A 1MZRA 3G1RA 5LNVA 4HCHA 4KEUA 4A29A 3VILA 3QYSA 1MI3A 1I1WA 3UETA 3W28A 4BF9A 3SCSA 2RAGA 2INFA 3W74A 4QP0A 3WKZA 3E5BA 4Y90A 1CBGA 1B9ZA 1GCYA 2VVSA 1E5JA 2YCJA 3L4TA 3GHRA 2FDMA 3P6LA 3LPPA 5EMUA 1LCOA 1GWJA 1GOQA 1CENA 2PLMA 3CIXA 5H8MA 4OTKA 4XZIA 3ABQA 1Z44A 3M0VA 3OBAA 2WLYA 3JU2A 3NQAA 3WD0A 4LUSA 1IV8A 2XM2A 5HDRA 3T7VA 4BF7A 3VNYA 4PCFA 3CWNA 2GDVA 1FKWA 2VUNA 1EH9A 4UTIA 4YHGA 2DJXA 3CL7A 3SFWA 3W0KA 2DW7A 2Y88A 1NAL1 4R7JA 1YIXA 4U5IA 3KOZA 2TSYA 2X09A 3W6YA 1YLVA 3FYPA 4XSMA 2JIWA 6ALDA 2GGGA 4D6HA 4BS0A 2QDEA 3CTLA 1PEZA 2XHYA 4G7EA 2F6UA 4KH2A 2HXUA 4DBEA 2E6FA 2GK1A 2PI6A 3R8GA 3W1TA 3K8KA 4P8VA 1B9BA 4E4PA 1OC6A 4LX4A 2DVUA 1TB3A 3OZMA 3U57A 4GKTA 1J96A 3JRKA 2XINA 4C5ZA 2D2GA 1REQB 5AVNA 1XISA 1A53A 4KETA 3P8JA 3N1AA 1ADOA 3TA9A 4JTUA 3SURA 1C9DA 1HJXA 5D04C 1Z42A 4ZQCA 3WL1A 3LV5A 3MSRA 4D1IA 1FWCC 3IV3A 3FA5A 4W7WA 3C4UA 4JTIA 1TO3A 4Q4OA 4OT7A 4L9ZA 1VD6A 3LRLA 2NX9A 3U3HA 1SZGA 3WNOA 2AL2B 2DZBA 1NH6A 2YCEA 3TLLA 4PUUA 4Y8EA 4NIRA 3STPA 4IXXA 3H4GA 1KFWA 2VVNA 4WY0A 4EPBC 4J2MA 1WZLA 4WKFA 2QYGA 4JEJA 1DWFM 1UMLA 2HROA 1G67A 2ICSA 4JTJA 1IT8A 4U28A 1OD0A 2ANUA 3DC8A 3R43A 4H6QA 4DEFA 4S3GA 4GQRA 5FEPA 4LUSB 2ALRA 3VC6A 3SUTA 1TPUA 3WG6A 3DFPA 1EP3A 2Z2AA 4I90A 3AIBA 7REQA 3KOWA 2DIJA 1ONWA 2J8TA 4JKKA 2W67A 4GY7A 1AUSL 1IXOA 4HA1A 3THCA 4RV3A 3IIZA 3TW7A 1PS9A 5FJIA 1I60A 3QKEA 4WK9A 2C91A 3H2NA 2EPHA 2PTXA 4QTGA 4JIRA 3WQOA 1FP8A 3TH6A 4CD4A 3TFXA 5BCAA 2X1IA 5M17A 3U2EA 1RPXA 4LUYA 5AHMA 4LAKA 2PP0A 2TODA 3QEZA 4ACZA 3BG3A 2ODOA 1XPGA 4E4UA 1OWQA 1BKHA 3VIHA 3NZQA 4BA0A 3CWOX 3OW1A 3O7UA 4XO7A 3E12A 4Z1YA 1RP9A 3QC3A 5A2CA 1QI4A 2YW4A 3MV01 1NDVA 4U3CA 3DYMA 3VMOA 1XRTA 2JQXA 4MSSA 1OFBA 1X1OA 1EYEA 4AHOA 3T40A 1XLBA 4HN8A 4KIEA 3A4AA 3BTNA 5ECUA 4ZTYA 4HNUA 3E38A 5D30A 1CWYA 4LWWA 1OCJA 4LS2A 2FTYA 1DV7A 1S2WA 3E0LA 4FNSA 4U33A 3MKCA 1VBGA 1HF6A 4UFIA 1AZ1A 3GRIA 3WDQA 1P1XA 4PBEA 1E6NA 2PLJA 3ARTA 4WEVX 1V0NA 2OSXA 4MDPA 2I16A 1DXIA 3EKZA 1D3CA 3TZFA 1C29A 3SQLA 2EGZA 1T7LA 3W22A 4E4FA 1FDJA 3BVJA 2HE5A 2ZKMX 3KBSA 5K4ZA 1PVNA 1X6LA 2NVCA 1VCGA 1JGIA 3B05A 4GJ1A 2P0OA 3TMQA 1Z7AA 3IANA 4PE8A 3P5YA 4DUOA 3UYIA 1LQAA 3I68A 1NFBA 1MQQA 1WDSA 1A5CA 2DGAA 1JPKA 3LCLA 1UWRA 2WMIA 3P82A 3A24A 2QS8A 4M56A 4EF8A 3TJIA 1PAMA 3BANA 3RPTA 4L6OA 1X98A 2C6QA 4BWLA 1DE6A 1WYIA 2NUXA 2QJNA 4GI8A 4OHQA 2HPMA 1NVMA 3C0SA 5LNSA 2G41A 1ICQA 5EMJA 3ZJ8A 1DTNA 5HR7A 4O0ZA 1A49A 4A2RA 1UR8A 4PRTA 2C0AA 3B9DA 1TUXA 4PMVA 1EYWA 4G7FA 3EXRA 2RH9A 5J5RA 3RCNA 3R1ZA 3HMCA 5CSYA 4TMCA 2Q71A 2BHYA 2I17A 1NWUA 1W1TA 3SRKA 2PTZA 1WDRA 1ICPA 5CPTA 3S1XA 3F4CA 4RE2A 4XAYA 2NWRA 4EPKA 3SIMA 4BQ2A 1Q6DA 1A0EA 1S2AA 4NYUA 3UR2A 4NAEB 5CC3A 5H8UA 4L1GA 4C6PA 2P8BA 1NDZA 1UR9A 3NL5A 1JRCA 3FJLA 1VRDA 1RQEA 3R13A 4TVDA 1TTQA 1H7NA 3CUZA 4GUJA 5AKQA 1E0TA 1QPKA 3POHA 1GQLA 3PUEA 1AL8A 3AC0A 1XYLA 4GCXA 4Y9AA 5A6JA 2CHRA 3G1VA 4IHCA 4GFIA 4XWUA 3GHUA 5D4YA 5HPOA 4GIRA 3AYSA 1TPEA 1G1YA 1XLAA 2FZ8A 5EB8A 3RM9A 4JGDA 2A21A 3ZFHA 1JI1A 2NV1A 4G9PA 2PEVA 1OQFA 5D03A 3SUWA 2VDGA 4HSNA 2ZOXA 4KKXA 2PB1A 2OQHA 1XGZA 4LTSA 5C6MA 3AZTA 1W5OA 4MKVA 2TRSA 1MWOA 4IQDA 1UR0A 3H23A 4GJIA 3SCOA 3I4EA 3T2PA 4FIQA 2E68A 1ITCA 2J7CA 2V82A 2I7GA 2FTWA 4HMCA 3W53A 2X0HA 5CGQA 3O07A 3UGVA 1JAEA 3S1UA 2WM1A 4OQVA 3EKGA 2QUNA 4AIEA 5GJMA 1J79A 3AXIA 3AMDA 5DO8A 1BXNA 1OIFA 3HOJA 4C1NA 3EB4A 4JY8A 2WBKA 3LM7A 4LF1A 1XG3A 2QNEA 4HN4A 4V27A 3WJSA 1Q4NX 1F9CA 2BHUA 2A7PA 1OBAA 1UWAA 1V8EA 1EA9C 2BTMA 1WB0A 2B7NA 4KRUA 3SW6A 3VA8A 2OZTA 5DMLA 3OU8A 1SUXA 5CH9A 3FVDA 2FZ9A 4CNNA 4B3LA 2XIBA 1EKOA 3O8AA 1MYRA 3V36A 1TPFA 1VP5A 5AC8A 3EX4A 4FAMA 3VIIA 1XRVA 5EBUA 3GDBA 1VEMA 3EDFA 2V3EA 1PHQA 2YKKA 3CZKA 4NT0A 1K9EA 1AG1O 4YMZA 1FFQA 1XYFA 3PFRA 1FCBA 1K8ZA 5HNUA 1XP3A 2VDIA 3BMVA 1YRRA 2AGKA 2BSLA 1JZ2A 5U4NA 4ICNA 2VFDA 1DWHM 5FJOA 4AZCA 2ACUA 4C65A 3S8HA 3M7SA 4ZO8A 4AD2A 3LZ3A 2P5NA 4AY7A 3GDMA 3GG0A 2B0MA 3IUDA 1BQGA 3GUGA 3WUFA 1PL9A 2CZDA 3A5VA 4O0QA 2CIPA 1HN1A 3H2AA 2JKAA 4XZNX 3WNMA 2WCSA 3ANVA 4PCTA 2YIHA 2GOKA 2XDFA 4LJ3A 3SCPA 3DI0A 4LCSA 4LYKA 2VTFA 2R91A 4Y6GA 1E70M 3FJ4A 1EGVA 1EJ7L 2RUSA 3HFTA 1MEHA 4UMCA 1GEQA 4C7DA 1FBAA 1GJUA 2DPEA 2J6XA 3VIMA 4GI6A 4DO6A 3LM3A 1WE5A 1RBAA 2X40A 1BG9A 4A21A 3UJRA 1ZNNA 5REQB 4CNOA 4RLIA 3NG3A 4PCSA 3LQLA 3L2MA 1YNYA 3CQHA 4S3AA 4ZFCA 4YCOA 2CLKA 2G50A 3IPWA 3QPYA 3TYUA 3GTFA 3NQMA 2V9DA 3PS7A 1MXDA 3PF3A 2DZPA 3CL8A 4AMCA 1F73A 3NZ1A 2PDHA 4HA3A 1TR9A 1OCBA 2Y5SA 1K02A 4AH7A 3GC5A 1FHLA 4RDVA 2C0HA 2C16A 2W9MA 4W7VA 1UPPA 1E0UA 2PWFA 3WBYA 3AXHA 4S2BA 5TF0A 4KFPA 5BOFA 4FI4A 2ZFAA 1XF0A 1NFPA 3TKFA 4B2DD 3FJ6A 4A05A 1CI1A 4B5XA 3IS4A 3BGJA 1DTUA 3WQGA 1QRQA 3BAXA 1E0WA 3B0UX 4G56A 3C0QA 4XZHA 1ME7A 3GXPA 2IQ0A 4LCRA 1I9CB 3VX1A 2Y8KA 3TYDA 3CAWA 5DXYA 1P1MA 3TR9A 3SAZA 3N14A 1OX6A 3RLUA 2CLMA 3CQKA 4GACA 1G01A 3OLGA 5IBXA 3VE7A 3CEPA 3WLMA 1V0LA 3FS2A 4PUWA 2QGYA 1ISZA 2O7QA 3MHGA 4JL1A 1EC9A 1XDLA 1TIMA 2VGFA 4UOZA 4GXPA 8XIAA 3QY8A 3TWAA 4O53A 4RDYA 4MLJA 1JZ8A 3WQDA 1O5XA 2CHNA 4ZB5A 3U2ZA 4IWWA 4R53A 4IL2A 1CGTA 3GYCA 3GQYA 4DJED 1PX3A 3LU2A 2PODA 4Y96A 2CFFA 5A8MA 3GFYA 3T6CA 2H9AB 5F7UA 4HPHA 3UWWA 3C0LA 4MB1A 3H2FA 3MJYA 3N9SA 2V68A 3TQVA 2VR4A 3VYLA 1OD8A 3UW6A 2QJMA 2VJXA 1HKKA 1NWTA 1PZ1A 5A6TC 3TW9A 2PBGA 3H2OA 4GGHA 2GSEA 1A47A 3UCQA 1S5NA 5TNVA 2HDJA 1O95A 1UYQA 5JH1A 3APGA 2JALA 3VVGA 5E6YA 1NF0A 3GLCA 4MPQA 2A4AA 2DW6A 1RHCA 4Q7IA 3SGGA 1K1DA 2JGQA 5M1TA 3CH9A 1LOLA 2C18A 1P48A 1V3JA 4YNGA 4UNKA 4JYDA 4X3ZA 3QBUA 5C71A 1W91A 2CLEA 5FF2A 2GJXB 4HZ7A 2OZ3A 3M0JA 4QDPA 3GH5A 5HJLA 2QUUA 4L4LA 1IIHA 5LA1A 3E0VA 2PF8A 3H22A 3NNTA 1GJWA 3BLIA 1DIDA 2PDMA 2X42A 2WO5A 2WSKA 3DFOA 3WDHA 4EX4A 1ZQ5A 4IPPA 4WGHA 4I6KA 1JCXA 1PXGA 5CC6A 3VNDA 1CXLA 2BODX 1P6BA 4HPXA 2QPXA 2Y4SA 1WOAA 1UR1A 2Y1HA 4H6KA 3TSBA 3VKAA 3WDIA 4L80A 3PZOA 2VQTA 4GVGA 2WB5A 3WENA 4Q8PA 1XQLA 4PTMA 4FNRA 5BWAA 1A0DA 3ZR5A 4U2YA 4C91A 1JF6A 2EKCA 2BXZA 2XGZA 2R8WA 3THAA 4IGSA 5BMXA 4C60A 3PWAA 2Q09A 1MDRA 4DBUA 1PPIA 2X05A 3IGXA 2HS6A 3ECQA 3U2OA 2OKTA 2RHGA 1MFUA 4GC4A 4YTTA 1HQTA 3I4KA 3TDFA 2X8RA 3ZR6A 2Q8LA 4C6IA 2NQ9A 4IL0A 3E6EA 4RW5A 3COTA 1QI5A 3S5OA 4C1KA 4NL1A 1AH3A 1EDTA 3PZNA 1JPIA 2JK2A 3THDA 1LRTA 2PZNA 2FDSA 4KCVA 3W1LA 4YS1A 1HXJA 4YN5A 4MB3A 3SCNA 4U5KA 3DYOA 1W17A 2CLLA 3ARSA 3H8AA 1KLZA 2OEMA 1YPFA 2VFGA 2C3ZA 2CNCA 2YGYA 1LUCA 2E7FA 4ZENA 3S6OA 1AMKA 4AFYA 1IEWA 3K46A 3KEHA 1V02E 5FKYA 1VHCA 4A3RA 2P50A 3ABRA 3NJ3A 1ISWA 1IEVA 2KZHA 3C2VA 4OWGA 1XIBA 3RIKA 5C9ZA 4PUJA 4H8UA 1NF7A 1XIMA 2I14A 2ZUTA 4GO8A 3W7PA 4LS0A 3EWWA 2OG9A 1B2YA 2NXGA 5CPLA 2D69A 3EDKA 2Z6JA 2WW5A 1Y5WA 1L8PA 5DBUA 4DYJA 3FV9A 4U2ZA 2BDQA 4J3ZA 3GW0A 4PL1A 1R8LA 2P1FA 1F3XA 3MUZ1 1CTNA 5LIKX 4C6DA 6REQB 3WQVA 3DFHA 3H12A 3TWBA 4L9YA 1KM6A 4DJFC 1UA7A 3P80A 4MYAA 3H7UA 3WLOA 4LRSA 3MYOA 3WELA 4P61A 3MUXA 4IGNA 1BFNA 3P0XA 3QZEA 4NILA 3F4DA 1UIOA 4HHHA 5I79A 3W6LA 1ZLPA 4PRWA 3WLRA 3EDDA 4A8IA 1SQ7A 5JUVA 3NM1A 3PZTA 5AB3A 1LDCA 1B54A 3TX9A 2H8XA 1Z9AA 4LXFA 4MWAD 3LTPA 3VDBA 2EJAA 4M81A 1H51A 2HNEA 4LQ1A 3UERA 2I57A 4NY2A 2Y8VA 4Z2LA 5IFTA 3MI6A 3KL3A 1DXFA 1F4HA 3BG9A 4GBDA 3EX3A 3SCQA 2QJIA 5C9WA 4XVEA 3T1GA 2BGNE 1H7XA 5HWMA 3UNDA 1V6TA 1TTJA 3M0YA 4A8LA 1SGJA 6TIMA 2BVWA 2EPMX 1JYVA 1IWBA 1LL7A 2EG6A 1ONXA 2ISFA 2V8ZA 4S3CA 1S2UA 4BI6A 1DJIA 5JIPA 2CLFA 2QW5A 3W4RA 4NNCA 1TKKA 3P62A 5FJRA 2R1PA 4TVUA 3CMFA 5D37A 4GJJA 1B3VA 3VD9A 3MMDA 3WZ0E 1I2QA 1V03A 1VYPX 3VOCA 2VI0A 4MY8A 5GNYA 2IS7A 1TJPA 3HTWA 3GNXA 3NYZA 1E15A 1T41A 7PTDA 3SY5A 1BRLB 4ZFMA 3W2KA 2G37A 3UBPC 1EFZA 1F7BA 2OQLA 3IUIA 3K5XA 1RBOB 2Y5EA 1VH7A 4U10A 4AHQA 3M0MA 1HO1A 3VNIA 3TSDA 4IMCA 1JXJA 3NXLA 5C9XA 4TOQA 2QUVA 4AX7A 1O12A 1ZY9A 3B8UA 3WX7A 5CGMA 5BU6A 1K7XA 1HNYA 4ACZB 1ZL1A 2FLIA 4MAZA 3SCUA 3N73A 4NUWA 1EDGA 4FLQA 1J0IA 4JR5A 1WO2A 1UKQA 4S3KA 2BOEX 3A13A 3NVDA 3GSMA 8CGTA 4JICA 5D33A 4K6AA 4A2SA 5RUBA 1KBJA 1UQZA 2VZSA 5I2UA 5LA0A 4E0CA 2BZNA 1EQCA 2B81A 1HFBA 2HCVA 3RR4A 5FD0A 2R9RA 3PPGA 5HMSA 4Q32A 2GVGA 4A35A 4K37A 4CN6A 2W62A 2ZWYA 2YFNA 1VQTA 4FX6M 5T8GA 1O94A 1KXTA 3MDWA 4NNAA 3A9IA 3BL3A 5DFAA 2YDRA 4CN4A 1TFVA 4FXRA 3T42A 3V5CA 3C0JA 3BOLA 2ISSA 3P7YA 2OR2A 1J12A 3RM4A 1FWFC 1PIGA 3FA3A 4HSHA 1NDYA 3ABSA 3SI9A 1B3YA 2WJEA 1RP8A 4JFVA 3VIGA 2X1UA 3SUUA 2IPJA 2VRQA 4DBDA 4GWEA 5JU6A 4CNPA 1GHRA 2EEXA 3EPNA 4DWSD 2WXDM 5DQPA 3HG5A 3SY1A 4LYPA 1Q8AA 3ZVIA 1SYTA 4DAIA 3VE9A 5M2FX 2YDAA 3G2GA 5CJMA 2XSAA 3CM4A 3PWIA 4WR3A 1A5UA 3QPZA 3KRZA 3PK7A 1XSKA 4PB5A 1XYBA 1FTXA 1IZJA 7CGTA 4DM2A 4JTEA 3OTRA 1GZ1A 4Q4KA 4HMDA 5BRPA 4L56A 3ATYA 3WK3A 4FR6A 3LMZA 4HCLA 2PDXA 1WX0A 2PC4A 3STEA 1JCTA 1SO5A 2WJDA 5A6BD 2HVOA 4NZ1A 4K3ZA 3LCIA 2B7OA 3HPZA 3G18A 4XIMA 5E0FA 3WF3A 1KRMA 1XC4A 3BGGA 5CBBA 1N8IA 2ZUNA 2DSWA 3L2LA 4FNQA 3KLLA 1ME8A 4IFKB 2Z25A 1UKSA 1BEUA 3C3NA 3AHZA 1YTKA 3ITGA 4WDUA 2PE4A 3L66A 4GE8A 1FXPA 3AHYA 3UEQA 1R3WA 2OX1A 3WBAA 2GGJA 1E5NA 1V3LA 1JDDA 1IQ8A 1GVEA 1Y0EA 4Z2IA 4DIAA 3V3WA 1BSLA 1YPIA 3N04A 2JEPA 4EF9A 1WZAA 3C5QA 1Q6OA 3H70A 1MRQA 3NGJA 4MYXA 4S3BA 3G1HA 4FLRA 4FS9A 5FA5A 2FQIA 4GIEA 1W8SA 1KCXA 4UR8A 1IGSA 5B7ZA 4K39A 2OFJA 3LCFA 2NQHA 2HBVA 2Z0IA 4C6FA 1CGWA 3T0BA 1VZWA 3WUEA 3L68A 3LDVA 5U7SA 2CKRA 4JQ1A 3WMSA 3K1GA 2V63A 2CLHA 3AYTA 1N2VA 5FJJA 3ENLA 1PKMA 3NGFA 2WSPA 1QNOA 3NPUA 2J9XA 3OYZA 2E9MA 2PRHA 5TBOA 3G8EA 3W7GA 1TMHA 1M3UA 3CB8A 4O52A 4JN6A 2VT0A 1ZGDA 1ENUA 4UTHA 4MADA 3W1UA 2PTWA 2HV5A 4AB4A 5IXEA 4K2SA 4J5NA 1F8IA 1E6QM 1KBBA 1XIGA 3WBEA 1DJYA 1YDYA 4PULA 4R34A 1V93A 4ZOBA 2PA6A 4D9PA 8RUCA 3BJTA 2VYOA 4O1FA 3UVIA 2WVSA 1JQXA 1ZBWA 2GFTA 2WZHA 2XG9A 4H9VA 2RKXA 3SFKA 4WY0B 2G8ZA 2CLIA 4IX2A 4QE4A 3BW4A 4PFHA 2WHLA 3USZA 2PWDA 3KS6A 3V35A 2HE8A 2ZXQA 2D3NA 3GIQA 2E5DA 4JFUA 1UWTA 1IEIA 3ITXA 4UQBA 5HOSA 3RG6A 1E6RA 3HV9A 2R1KA 3IUHA 1B31A 4JIQA 5AVHA 3TTEA 3ARZA 1XLKA 1WKFA 1QJWA 1GOWA 4Q4QA 3F5JA 3T55A 3BLOA 4D6GA 1QMLA 3A3WA 4O1BA 3AIVA 5HUOA 1HUVA 2CWXA 3A3XA 1KCLA 3IIXA 3T05A 4S1FA 3IEBA 3MCMA 5FEXA 1HJVA 3FKKA 1C91A 3VGBA 3NO1A 1B5TA 4R3UA 1RJPA 3O0FA 1VIWA 2XIJA 1ZENA 1ZHAA 2DUXA 1WKEA 4KCTA 4LRTA 5G2IA 4F0KA 3AMLA 2WWCA 2OU4A 1ITXA 4PEEA 2WNNA 2HS8A 4IFRA 4QEHA 3FNDA 4MWAC 1U30A 2JKPA 1ITQA 4H9ZA 3TYZA 3EKLA 1J10A 3UGRA 4UTLA 7A3HA 2XH4A 2ZX7A 1QHZA 3KBJA 4EK7A 1ZCOA 5KEZA 4FLSA 4B4FA 3MS8A 1YNPA 4ZR8A 3UFYA 5C7VA 3IRSA 4P7OA 2PDUA 3C2FA 1PX8A 1MDLA 1P0NA 3WD4A 3NFUA 3TTYA 4KWVA 2QXWA 1OABA 2VELA 2FTPA 4WKAA 3F5KA 4Z1DA 3UZXA 1ZALA 1DQXA 1XDJA 3MP4A 4HZ6A 4NAFA 1V77A 2X41A 2J27A 3UPBA 4UTMA 2I9UA 2VR2A 4RNFA 1DWJM 4MFEA 2YR1A 4ML4A 1VFOA 4DRSA 3CHCA 3CXOA 2VHLA 3CV2A 4PGLA 1O7AA 4XBKA 2F7FA 2VL4A 4NG3A 3GU1A 3QTPA 4L6HA 3R8RA 5DCEA 1GPWA 3PM6A 3RDKA 1YMYA 3I10A 2WOQA 2ZX8A 3S9ZA 4B15A 4TXEA 1YEYA 4ATDA 2OWCA 4RZ6A 2QUMA 1MW3A 1XIIA 4E2OA 1OX5A 5AY7A 3VOIA 1EDQA 3T4WA 2G4JA 4ZE4A 4Q8UA 1EXBA 1KNWA 4NHVA 4N02A 2MNRA 2WWDA 1UKPA 4HHLA 1GVIA 4H8NA 1I2NA 2CBJA 1TPDA 3U2CA 2GDQA 2E1WA 3F4VA 4UOQA 2GJPA 3WF2A 3PUGA 5JIWA 1Q66A 1UUMA 2BASA 3DFNA 3MA8A 1FOBA 3W27A 3DXIA 4PL2A 5I09A 3KW3A 4P8XA 5ABHA 1DJXA 1R3YA 1QAPA 4FR1A 3UJ2A 2QCNA 3A22A 1OFAA 1JIBA 2Q02A 3V7PA 3IJQA 3OVRA 2CLPA 5C54A 4NZ5A 3ITLA 3M07A 3BURA 2P76A 1ELSA 2GUUA 4NASA 4FXFA 4ADUA 3BAWA 2Z26A 3I3DA 3RUBL 3F7JA 4JTCA 4F0LA 1YADA 1J4EA 2HQAA 1WKYA 1C8YA 2VWTA 3GR7A 4GH1A 2ISWA 4WGXA 4CQ9A 1JYWA 1LOSA 2CETA 4WOZA 3INPA 4LAOA 2W66A 4CD5A 1VYRA 2O4QA 2PC8A 4FXJA 4UMAA 1IHIA 2J75A 5CC5A 3U4FA 2ZUVA 1YXDA 4GNKB 1LT7A 2WV8A 4GUIA 1FWNA 2O7SA 3BDKA 4JZ5A 3N15A 1V02A 5IDIA 3WD3A 1LQ2A 3FSTA 4FPSA 3GKAA 1ZFJA 2GQAA 3CWHA 3RMJA 3EB2A 2FHFA 3EEGA 3BLPX 2O0TA 1EC7A 2HSAA 4HU0A 4C6NA 4JY9A 2AGTA 5AHEA 2NV2A 1XDMA 4MNJA 2E0PA 3FXYA 1RLDA 3QY6A 3DKLA 1KM2A 5CAHA 1FCVA 4E3TA 3M6YA 3T07A 1MNZA 1J8VA 1FWJC 2E3ZA 4KIRA 4QM1A 2AKMA 4MG4A 4H41A 2E28A 3BMWA 3EA1A 4JEQA 3EDJA 3IJ6A 3W7MA 4KERA 4WSJA 3ZO9A 1XLDA 4I7VA 1AD4A 5D05A 1QW9A 5I77A 4NZCA 5KZDA 2E9LA 5D2TA 1PX4A 2G0WA 4N4PA 3VPLA 3CPRA 1QR7A 4O1EA 1ISXA 4MF4A 2WBGA 5E6ZA 1FHDA 1R2SA 1PV8A 1GOOA 5DY3A 1I75A 1XBVA 4G7EB 1EO5A 4RPPA 3PP7A 2P8CA 4IFOA 2QCGA 3ANUA 5D32A 4UZSA 1S5MA 1W3NA 1RY0A 3NEHA 3FAXA 1H5YA 1GVOA 4LSBA 2YCLB 4POCA 2GZXA 3W76A 1O4UA 4WCJA 2PLKA 1A5MC 3BICA 2QF7A 3CASA 3ME3A 3Q2DA 4AMAA 1MQPA 3AMKA 3KRBA 1J01A 4YPJA 4K7YA 2OODA 4FHAA 3QV9A 2BNJA 4RR4A 2I56A 1XGDA 1YDNA 4M6QA 2OWWA 4TVCA 2NQJA 2G3IA 4AG0A 1ESWA 3WQCA 4FSAA 1FWSA 1S1PA 3H24A 3WH9A 1LM1A 2RDXA 1WZMA 1OIMA 4V2XA 4XQ6A 1T40A 4H8VA 2QKFA 1GGOA 2PWHA 4ZQPA 4JNZA 3L4UA 5FJUA 3CZGA 2EF9A 2FZMA 1B4EA 3MCNA 3TC6A 4Q22A 4XAZA 5HNNA 4KFOA 4ASTA 2REQA 1EJUC 3MTWA 1RD6A 3Q4DA 3QHNA 3QYQA 1GEHA 9XIAA 2O4MA 3OJGA 3SJ3A 2RFGA 4LNYA 4PMDA 1RQHA 2ZVRA 3ARYA 3N29A 3TQ0A 5EU9A 3KS5A 3R89A 4XBSA 2Z24A 3GXFA 3SCRA 1K8CA 2Y7EA 3F03K 4Q3MA 3KXQA 3M4HA 3THUA 5L9FA 3K8LA 3N19B 4KT2A 4C6QA 1H1ZA 5EY5A 5BXRA 1RUSA 3KHDA 2ZX5A 4Y8FA 1TVLA 3K4AA 4G1KA 4QLKA 1THFD 1O5KA 1KGWA 4XD4A 1P6WA 3N9RA 2OZ0A 3TQKA 2Y89A 3NURA 3UG4A 1XL9A 3DBPA 3R0UA 3RPMA 4AU0A 3TR2A 5KINA 1GONA 2VO5A 5K9DA 4LT9A 7XIMA 1JZ5A 1I8JA 2QMJA 3K8MA 3N9KA 1QBAA 1PIFA 4J3WA 5C2CA 4PBFA 3UXIA 4O8RA 2XVPA 3UD6A 4FP1A 2OX4A 3NL2A 2VUYA 1ME9A 3AQUA 4QNWA 4UTWC 3CHVA 2HRWA 4C6KA 2D23A 3ZXWA 3G22A 4DYKA 1X7IA 2O9TA 5I23A 2V5BA 1M65A 3VKBA 3S42A 2VR5A 3L5MA 1C93A 3S5SA 3AXKA 4E8DA 2YB1A 1X38A 2BY1A 1SM9A 3HQ1A 1K4GA 5C5YA 3DN5A 4ZB2A 3L4XA 1I45A 1ZSXA 4DO5A 3GUWA 4AF0A 5EKYA 2D3LA 2CZFA 4AZCB 1O66A 3K13A 1Q5MA 1YKWA 3NSMA 4GO9A 4GX9A 1KV8A 5A6SA 1D8CA 3Q65A 4V33A 2PDLA 3LCXA 1TX0A 2JEQA 5DT7A 4HOWA 5CJNA 2NXHA 3GB6A 5XINA 3NDOA 3RRAA 2CERA 3R7MA 2VENA 1O5RA 4GKLA 2C13A 1W3LA 1F05A 3VIFA 1OK6A 1KM4A 4UTKA 2NSOA 1R3TA 3F4WA 3PJXA 5JH2A 4ZTXA 3A3HA 5D9MA 4MHBA 3BLFA 3N6HA 4O18A 1C8VA 1PBGA 3RJXA 4NJGA 1QI2A 1QBBA 2XFRA 2UY4A 4LUJA 1TWZA 1N7KA 3NAVA 1TPC1 2E09A 2A3HA 2XFWA 4IZGA 2RGMA 1GOMA 3OLDA 4B92A 1GJPA 5I3FA 3GHSA 3S9YA 1J0JA 1KFLA 4QHRA 1AJ2A 3HGOA 1FDZA 3P84A 2DSUA 1GT8A 1MUMA 2YBUA 4G5DA 1B3ZA 4INFA 2DEPA 4FX7A 2GJRA 3E2RA 3T2QA 1LOQA 1TWWA 3RYSA 2ZTKA 1E9LA 4Y9PA 5EL1A 1IR1A 1I2OA 2VX4A 3HZ3A 3KP0A 3VFLA 1WBJA 4UQDA 5A6AA 1ZRQA 5DRIA 5J04A 4E6MA 3WF1A 4JPGA 2UY3A 2OWXA 5I3HA 3M0XA 3KTXA 5CCZA 4XD5A 1GNXA 5A69A 2CZEA 2QAFA 1S5WA 4IJBA 2XSXA 2D73A 5CPSA 4D71A 3VIPA 2KX9A 1E9ZB 1LWHA 3SECA 4BKNA 5A8QA 2W5FA 1FA2A 2GUYA 4CVUA 1PDYA 2DIKA 1H0GA 1GQKA 3H2EA 1FX6A 3EYPA 2BV9A 5AECA 2DSZA 3OVQA 5HATA 3VIJA 2R1NA 4AVFA 3VMPA 4ACYA 3G24A 4I9AA 2O9OA 3HPSA 3NXFA 4LYQA 1S2TA 2FYMA 3O05A 1LBFA 4C7FA 1EJWC 2L5HA 4KCUA 3R94A 1A5NC 3CO8A 4W7UA 1CCWB 3W26A 4IX0A 3CMGA 3KCOA 4P8WA 2ZQ0A 1A80A 4BK9A 3SSJA 2ZUWA 3FCPA 3EPOA 3ONCA 3TU9A 1LLWA 4IG2A 4PTDA 4QIUA 4CQCA 2Y70A 2ZXBA 2OKOA 1H0IA 3E2SA 1WXYA 1POJA 2A7NA 4PH6A 1E3ZA 2VGGA 6XIAA 1I0BA 4RE0A 5MKGA 5D38A 1GG0A 2PDYA 2XIIA 1W5PA 1UH4A 1SJCA 1S39A 3CUHA 4H9YA 3W70A 3ZVHB 2PWUA 2YBTA 2OYKA 3WJZA 3CUJA 3PBVA 5LIWX 1A0CA 3T2OA 3PANA 3ZJ6A 4KF1A 1BTCA 5A6MA 3H7VA 1UPMB 3JUGA 1XXXA 3KRSA 4HA4A 3W7RA 4CQDA 1NARA 4F2TA 4EOUA 2FH6A 1LWJA 3DKJA 3JR2A 5F4SA 2MUCA 2X1RA 3G3MA 3TAKA 4F40A 4RDZA 2GLKA 1UKTA 2BMBA 1OINA 5G4EA 2V6AA 1CGVA 1RBLA 2A3EA 1K9DA 4Z0JA 1G69A 2BFGA 2ESCA 3LTSA 5EMKA 1UR3M 1F3WA 4F4RA 3O9NA 4EP8C 4E5TA 3UJFA 4YHEA 6XIMA 3A47A 2VXNA 5HMEA 1P4CA 4UTTC 2YZ5A 2P3ZA 3N4EA 2ATSA 1Q63A 3AHTA 2IQTA 5KMYA 3W25A 4PZVA 1TA3B 2DH2A 4DUVA 4QX4A 2Z2BA 4MY9A 1SO3A 1XI3A 1OG6A 4ERIA 2R1LA 3QTGA 5FF4A 4Z42C 1WKDA 4DJDD 1CNVA 4O17A 2WANA 3N2OA 3N11A 2INZA 1J93A 4ZOCA 3J7HA 3QRHA 1ZBCA 1VEPA 3T81A 3NO5A 3QMTA 1LLZA 5DANA 4FIRA 4PUDA 4U3AA 1QHPA 2J9YA 1LORA 4JDYA 4DXKA 1M68A 4F0HA 4DO7A 2EO7A 1UCWA 4DAFA 3WEMA 3FY1A 3FOKA 5DELA 1Q7QA 3WMBA 3LHYA 4UWMA 3MQTA 4MWAE 3RGTA 2XVLA 1JXKA 2PLCA 3VCNA 3BE7A 5CG7A 1LBLA 2G3FA 1X1ZA 3FSUA 2Y6ZA 4GUGA 3LCGA 4GQ0A 4MB5A 1XRFA 3W6MA 3KDOA 2Y7DA 1VJZA 3CBWA 5AYZA 3I7SA 4HK7A 3GDRA 1TTIA 5BXPA 3V5OA 4IIHA 2OSWA 4MZ1A 4PC8A 1JDAA 1EQPA 1DP0A 4W8LA 2CITA 1R85A 2EG8A 4B9YA 3A12A 4IIDA 2ZXDA 5CC7A 1QPRA 3TYBA 1W3TA 3E3HA 1R3RA 1R6WA 3W7KA 1FWAC 1WUEA 3SSZA 4W84A 1HL2A 4KW2A 1FWEC 5CPMA 1M9HA 4WJ8A 3B0VC 1QK2A 1KBLA 5DY2A 3CU2A 4BY3A 3RR1A 3GC2A 1JNDA 4O11A 4JTTA 2C19A 4Y7EA 6ENLA 3O63A 4L65A 1PWMA 2C1HA 1WAUA 3IJ8A 3HIJA 4ZEPA 1BVZA 1ODUA 4FEZA 1W31A 4PMOA 3WIJA 3STGA 4LU0A 3CNYA 2P0IA 3QR0A 4CU7A 2ZUUA 1JCJA 3BW3A 3GBEA 5AN7A 1ZS2A 1JZ7A 1VLIA 1ALDA 3NQBA 1XSJA 1MUWA 1NIUA 1MVYA 4QCEA 1PKYA 3KBWA 5BZAA 1E6ZA 1IT7A 5D2XA 4WLCA 1WAWA 1OFDA 3V0TA 3O16A 4BFAA 2Z4GA 3VM5A 2FZBA 2VFEA 3OP2A 1TVPA 4JTRA 3SN1A 4X0NA 3AZRA 1SW7A 3MYPA 5M5DA 5LGXA 3IAQA 2PUZA 3WCZA 4AWUA 2GSHA 3T4CA 3N2TA 4HKPA 4CD6A 4NU7A 2YOCA 2VGIA 1EJVC 2J79A 4DELA 5GJNA 4FA3A 1HKJA 2ACQA 1XGEA 1GVYA 3HF3A 1KXVA 2PURA 3NPXA 2JE8A 3ICJA 5EMMA 3C52A 4EE9A 4CCEA 1KRAC 1IXPA 3W71A 4OOZA 3REQA 3FW6A 4O13A 1IR2A 1ZAJA 3N4FA 2X2GA 1LJYA 2G96A 1M5WA 3GDKA 2Z29A 3VCCA 4O54A 5CPNA 3HGRA 4LH8A 2J7EA 4GMEA 4PTXA 4QG6A 3UR7A 5FCZA 4IQEA 1Q6FA 1KR1A 3AIEA 5D2VA 1OY0A 3EX2A 3GS6A 2W4XA 4PR4A 4AUBA 3TC3A 2PU0A 4IP5A 1MRAA 3AMCA 4N6EA 3WBWA 3WQ5A 2YSWA 4W8BA 4DZAA 3NL3A 4JHOA 4AW7A 2OGYA 1FWGC 1Q6QA 4UUIA 2V2HA 4WDXA 1QU4A 3RX3A 4ZB0A 3AXMA 3PAOA 4OU1A 4DUWA 1P0KA 3ALFA 3FK4A 2J7GA 3QZ6A 2OELA 3B03A 3ZIZA 4AAJA 4YVVA 3T08A 3S2LA 4JKMA 1I6NA 3FEMA 1N55A 1HKIA 3VDCA 3DGRA 1EOKA 5CZTA 1ONEA 1YBQB 4U31A 1NEYA 2YA2A 1KTBA 1XFCA 3SB0A 2I5GA 2IMRA 4JHZA 5FJPA 2IKHA 3UZJA 5C70A 1BGGA 3B8TA 4YLWA 2DT0A 1R2RA 1VIZA 1HP4A 4ZZ9A 3HQNA 4MVAA 1QO5A 1OZQA 5CLTA 1XYAA 4E8GA 3HO8A 2VM8A 2Z1WA 1P5BA 1E0XA 5LIYX 3I7QA 1KM3A 3QQ1A 3VNJA 1PTAA 3C8NA 3U8GA 4QLJA 2DSKA 1SZFA 1YTDA 2V38A 4TO8A 4P8UA 2WHMA 3UQNA 3VDAA 3V0SA 4J9JA 4W5ZA 1E6PA 3GW3A 4KRTA 4QEEA 4WQ6A 3TMLA 1GG1A 2F2KA 4FX8A 4OIFA 2AMGA 2FFIA 1UD2A 2GYIA 4K8HA 1K7FA 2C71A 3FVMA 3ARUA 3BGAA 1ECQA 1ZB5A 3KVMA 1OK4A 1C3FA 3NDZA 3RHGA 4L5ZA 1H1NA 2GQ3A 3WQPA 3A21A 1H62A 3LPOA 4LC8A 2QCDA 4LYRA 1PYMA 1L6YA 1PB0A 3KLKA 1NQ6A 1KGUA 3NWRA 5E5CA 2ZA2A 3W2JA 3POCA 2PWVA 3HPFA 3IVTA 2E40A 4D2JA 3PJUA 1GVFA 2YJQA 4Y9NA 3S47A 2YL5A 2F6XA 3TCEA 5A6BA 3CPUA 4HMNA 3RCYA 3K30A 3KBMA 4CEUC 2DV0A 1VS1A 2WJZA 2XJ7A 3GNRA 2JBMA 2WMJA 2VMFA 3NIYA 1IZCA 1Q6GA 4BI5A 4P2VA 1VCVA 4CEXC 3WH7A 3LCWA 3IVUA 1MQRA 2Y63A 1RQBA 4PN2A 5HK4A 3P5ZA 2XGBA 2XH2A 1A5SA 3L65A 1UH3A 2CCRA 1J5SA 3TJLA 4DI9A 4OOUA 3VDGA 3D5HA 2OOGA 2TPSA 4BQ3A 4GY0A 1SZEA 5T91A 1XC6A 3P0WA 4BQ4A 4H1ZA 3WYZA 4PFMA 3SDOA 2CXEA 3RN6A 1G94A 4K36A 1DIKA 1E55A 5KITA 3S5NA 2FB2A 4RJEA 3FYYA 3CZ8A 2FMOA 4W9TA 2W6RA 2NLYA 2ZE0A 2VEIA 2PDKA 1JL8A 3STFA 1FWDC 1A50A 1TV3A 3VXGA 1DJQA 3OGRA 1UD5A 1OGSA 2DIEA 2HWGA 2VDHA 2HISA 1BGAA 1W3KA 4DX3A 4J3SA 3W85A 1VC4A 4GYPA 5CKSA 2H8ZA 3AIRA 5ABGA 1BTMA 4Z1CA 1KLYA 3GAKA 2DP3A 3PWGA 3MI2A 3VMNA 1XKJA 1VBJA 3GZ3A 2BVTA 3V1HA 4K8EA 1EP2A 2Z2UA 1QPOA 3BLEA 1XBZA 3TE9A 5CPQA 5D2YA 4AZ7A 3CLWA 3S1VA 1HL8A 2ZA3A 5AOUA 3O6YX 3B0XA 3ID7A 1NWSA 4V1YA 5XIAA 4L4OA 2D0HA 4QE5A 5HINA 4M1BA 4JIHA 4IICA 1JR1A 2G3NA 4GNJA 1BYBA 2GDUA 3VIKA 4RV8A 1TV7A 3SGZA 1SFLA 1Y65A 3AUJA 3KX6A 2PDQA 1S1RA 1ZJIA 2AL2A 5BRBA 2O9RA 3O2LA 4F48A 2FHBA 4BF5A 3HN3A 3L67A 1EZ2A 3KWSA 5KETA 3R58A 5LIUX 1RY8A 1X97A 4Y9MA 3TJ4A 5GJPA 3DH7A 3DZ1A 3CYJA 4IP7A 2ZCGA 3BV7A 4HHMA 4DZ5A 1QNQA 3W7OA 3GNDA 1JZ3A 3CPGA 4LBRA 3TN6A 4WXZA 1TV4A 1M7PA 3W7HA 1XYCA 2NLIA 3VOGA 5C9RA 2ZRWA 4C5YA 2ACRA 5AZ0A 1UKOA 2C1IA 2DVXA 4GUHA 1TE6A 3IGHX 1MZHA 3PJWA 2QIWA 3AMGA 5SWUA 4QAIA 4RL3A 1Q6EA 1JCYA 4MIMA 2A7RA 5EBAA 1JPDX 1BYCA 3HA1A 1C9WA 3OEXA 3IARA 1FWIC 4R7WA 1YTEA 1IT0A 4XUYA 3QOMA 4Z1AA 4Q4PA 3ARWA 1KQYA 4JHMA 3R4IA 1XIHA 1F6KA 3RX2A 2I5IA 1OEPA 2X30A 4UQAA 1B1YA 3EOOA 3QFEA 5G5IA 2OGJA 3W1QA 4P7RA 4HOXA 3PG8A 2XISA 1ADSA 3FHQA 3BAJA 2X0YA 3L7RA 3EX6A 4QNEA 1TV5A 3V5FA 5M3WA 1TR1A 4ALDA 2VWSA 2XIOA 3BJFA 1PSCA 3QV7A 1T5AA 3K4DA 1UWSA 4HGXA 4BCEA 5XIMA 4RNJA 4O1DA 4DN1A 2WVVA 4GOAA 3MW7A 1UBSA 3EWZA 1DIOA 3M44A 3DFTA 4LEFA 1DBTA 4L4MA 1KCZA 4IIGA 1P0DA 1W9PA 2OZ8A 2YDSA 4IMFA 4RZ5A 3SGUA 3EBVA 1AL7A 2W79A 1IXNA 3H53A 3LUTA 1HVXA 1V6UA 4F3HA 5FIPA 1VJIA 3B8IA 4JQAA 3ELFA 1LLOA 4QJ4B 2WCAA 4ENLA 1XIJA 1ZU8A 3ITVA 1XH2A 3D46A 3M5YA 3T0TA 3DU0A 1HKWA 1LQ0A 3OA5A 3DGBA 1V3MA 1J0HA 1ZZMA 1SO4A 3G5EA 2W63A 3NQDA 4XZWA 4ZE5A 4BJHA 1EZWA 1Z6KA 1IYXA 1MXGA 2D1ZA 2OB3A 3W7CA 4JNYA 3FDKA 1BF2A 1WNOA 3QGKC 1EF3A 4UTWA 2PDWA 1U2YA 4UR9A 4KWOA 3AS0A 4NXSA 3BG5A 3GWQA 3R25A 4AEFA 4FZIA 3KZPA 1E6XM 2DH3A 4OKDA 1EX5A 4GY1A 1ODZA 1VPXA 4RE3A 4RKAA 4DB7A 3R5EA 1Z3NA 2ZZ7A 4N0RA 2V3DA 3W2MA 2W91A 3AJXA 3YPIA 3UG8A 4Z2GA 3EOEA 3W75A 3WUGA 1E3XA 1Q6RA 1K3UA 4X2RA 5ABFB 2VRKA 4AWTA 2ZZ2A 1RLCL 4J27A 3TONA 3HURA 3NO3A 1R7AA 3EAUA 3U5UA 3HQPA 5CZ0A 3TUUA 2CYGA 3KTCA 4XBJA 1QI3A 4OBRA 4MJ4A 4KWWA 1QHOA 2PDFA 4B91A 1W3IA 1PYFA 1QUMA 5K2ZA 5G1TA 1UQYA 4URIA 2XZ9A 3W2UA 3I6TA 4AEOA 1SMAA 4HIBA 1W56A 4AZHA 2Y85A 2P10A 5AC5A 1V4YA 3SBFA 3D3FA 2RGLA 3NR0A 2AKZA 3LK6A 4K38A 4Q4RA 3MMUA 2QV5A 3LV6A 1DHKA 4NVTA 3HFYA 1TCMA 5I6SA 1U5HA 1JF5A 3HM7A 2OVLA 5C9UA 4XKYB 3BH4A 3VCRA 1MUCA 3M5ZA 2BGQA 1H11A 1K6AA 2QUTA 3FDGA 4M24A 3M46A 4JQ2A 2WQPA 1XINA 1RVKA 3PJTA 4JQ4A 4R27A 1DE5A 3LI0A 4DF1A 3WQWA 4JCMA 4Q7BA 3BSMA 3QMRA 1ZAHA 3IRDA 4FOJA 3NPWA 3KVKA 1X6UA 5LNUA 1DQUA 1PDZA 4N7QA 3GNPA 1OF8A 3GXIA 5EPDA 3QJAA 3UXDA 3L0GA 2J25A 2NV9A 3NQFA 3LYEA 8A3HA 4JN8A 4B5SA 2VEGA 3ARXA 2Z28A 5C8BB 4PTVA 3R2GA 3DFSA 2HXTA 3B0PA 4PSPA 1CZ1A 2H3DA 2QR6A 3UESA 4JQ3A 4JL2A 1C90A 2MANA 3G6MA 4EPDC 4IMGA 1WDWA 2V30A 1V6WA 2J4GA 2YCIX 4MDOA 2IPWA 4LNCA 3ZLHA 4GYJA 1J18A 1GQNA 3WSUA 1FXQA 3TROA 3M0LA 4TR9A 1DWIM 5E93A 1E40A 3M0HA 1UP0A 1XIEA 4GG9A 2QJJA 1OFPA 1KB3A 3KP1A 1UOKA 4KGJA 1AW2A 4JIPA 2Z1BA 3G6LA 1LL6A 2YXXA 3FGCB 4UC5A 5CEWA 2NZLA 5HQEA 4HYWA 1TZZA 1YPXA 3BMXA 4H9UA 3FFSA 1YX1A 5AHNA 2OOFA 3OHIA 4X61A 4F2UA 4AQLA 2TYSA 4UFLA 1F6YA 4HK5A 1JJKA 2Q8ZA 1A5BA 4WHBA 1LL4A 1RV8A 1DOSA 2ABAA 4REQA 5JVLA 4XAFA 2E5CA 3MSYA 1WZKA 4J2PA 3IJ9A 2CKSA 4Z2KA 2VEMA 4JTQA 4N2YA 3DX5A 2J66A 1AK5A 3KM8A 4OE7A 5AZ1A 1M41A 2FPYA 2X7WA 5C2XA 1XV8A 3DHDA 2GVYA 2FPVA 1BVWA 4Q8TA 1REQA 3RLHA 5DCBA 2GJNA 4LCQA 4CQ8A 4ZA0A 4FOUA 3LBOA 5FF3A 3L4VA 4AZBA 1OYAA 2PS2A 2A6LA 1DVJA 2ZRZA 3WQEA 2I5QA 3QQWA 3GG8A 3S1WA 1KBKA 3CGTA 4N9EA 1US2A 3WQ4A 5B7YA 1K4HA 1W5NA 3DOPA 3U5YA 1H7PA 3VOHA 1VPYA 3P67A 4UCGA 1PE1A 4Q8MA 4D8ZA 4WKHA 3ZMRA 5H91A 3NOYA 4HBKA 4DJDA 1L6WA 2CU0A 1MFVA 2JKEA 2ZX9A 1R3VA 2XVNA 1UUOA 2QULA 1UOZA 4HTBA 1FWWA 4MKNA 1V7YA 4LOCA 2HMCA 1AW5A 1J11A 1V3HA 1OSEA 3C56A 4UXDA 1Z8AA 2J8GA 4FOKA 1PWLA 3CEUA 3QR3A 4IIBA 2ALDA 5I02A 3QLDA 4QDMA 5LHFA 4JOMA 3BV4A 4A6GA 1GKPA 4JTHA 1SR0A 5F2IA 4PUEA 4I3GA 3OHMB 1QDSA 2VFFA 2KAUC 3L21A 1RK6A 3VOFA 2VX7A 5TD4A 1VBUA 1WDDA 4JYEA 2VURA 1CXIA 4MGGA 4LAMA 5A8PA 2WNWA 5DLCA 4K8GA 8XIMA 4GD0A 2DSVA 1XRSA 1W54A 4GI9A 1DPMA 1CXFA 4LW7A 3MUIA 1L6SA 4MJ2A 2WLZA 1KXHA 1UA3A 4C7GA 1CECA 1CLXA 3E02A 1R0MA 3KHJA 1X1NA 2CESA 1KTNA 3ARRA 1UIPA 4WVXA 2YLLA 3BSHA 3EMZA 1TWDA 3OA3A 4IQLA 3OYXA 1VCFA 4M8UA 2VZOA 3PB2A 5HMDA 4Y9OA 2EPKX 3TFCA 2FVKA 2V5JA 1J2BA 5I0DA 1P0EA 1OT2A 1G0CA 1GW1A 5CQ1A 3WH5A 3ITTA 2NVAA 2ON3A 3B97A 3EWCA 3WEZA 3KBVA 1Q6LA 4RZBA 2WHKA 1QNRA 3PZ9A 1WP6A 2F2HA 1J9YA 2J88A 4ICCX 4UFHA 1WPCA 4GHRA 1U1HA 3TK7A 1KQZA 1Z89A 2PFHA 1HTIA 2H3BA 3I3BA 4GGBA 4YTUA 1MEIA 1S2VA 4TV5A 3NQGA 1C8XA 3W1RA 5M03A 2WZIA 3S2NA 1QXLA 2W92A 1CGYA 3AZSA 2FZNA 3DAQA 4YVXA 1VJSA 3B9EA 3H2MA 4ZO9A 2G4FA 3LXAA 3KOFA 4OZOA 4W5UA 5I3GA 4AYSA 2Z1SA 1ZP4A 5B80A 2AMXA 3EGJA 1NU5A 1FWBC 3BOFA 3TAOA 3N4AA 1RVGA 1I2PA 3N6QA 1XYZA 5E09A 1AW1A 4HB7A 1TPH1 3OZYA 5G4HC 3RCMA 4GA8A 2XH7A 3GXTA 3GVRA 3C3UA 2V0TA 2V5CA 3NDYA 2CZVA 2IPFA 3GR4A 1VLWA 1ZP3A 3PSVA 1O68A 1KKRA 1UP2A 4KWSA 3NQ8A 3UR5A 2P88A 3VZYA 4ZL1A 3DYPA 3MU7A 3R11A 2J8FA 2WNZA 4ATLA 3GBDA 3PZQA 2XM1A 4GXMA 5DX7A 3IJIA 2HEJA 5ABFA 2EPOA 4LAZA 5FEZA 3BUVA 4CNTA 4H7CA 2ZZ3A 4AIUA 2Y7FA 2WSQA 1OX4A 5GPRA 2A3LA 4IPLA 3ZWTA 4HNVA 2NQZA 2RDTA 2GVLA 1UD8A 3F5LA 3NQCA 3W37A 4YWSA 4CVWA 2GVEA 3MBDA 1F76A 4QG8A 4ZVJA 3MHUA 1R5YA 2PWEA 3B8SA 3UYCA 3E0FA 2DQXA 4EAYA 5HXMA 4IGMA 1H49A 4C1LA 1Q65A 5DXXA 2V81A 4KS0A 4PTWA 3JVAA 3QN3A 1RH9A 4IMEA 1JD9A 1CPUA 2JF7A 3ANYA 1JPHA 4GVHA 3E49A 1QNSA 3BQ5A 1XCFA 3C2YA 2A3BA 2VQUA 1L6GA 1VFSA 3TJXA 2C7FA 3GM8A 5I3IA 2WVVB 3CUXA 4ZO7A 2P3EA 4AD3A 1KC7A 3LRMA 5HR6A 1Y5VA 4O4WA 1OC5A 6CGTA 1HIZA 1IWPA 1PKNA 2WKLA 3GR8A 2A6NA 5IBXC 1GHSA 3D0CA 4XV0A 1PHWA 2QGHA 5T26A 3P61A 3TN5A 1UMYA 3U7VA 3KOXA 4PEKA 1BWKA 3LLXA 3WJYA 1JFXA 2GQ9A 3E96A 1HKVA 3KL5A 5LXEA 2ASHA 1ZBKA 2QVNA 1A4MA 4Q6XA 4B5VA 2J13A 3CTTA 3H7RA 4ZXOA 1T0OA 4RPQA 1XKYA 2ZICA 2NXIA 1R46A 3IIOA 4QGCA 3VNLA 3RU6A 5LA2A 1AMYA 2CHOA 1TELA 1XUZA 1L2QA 1QPNA 1ZTVA 1W1VA 1DJNA 2PDCA 3CHEA 1BXBA 1ADDA 3BWWA 1GZGA 3PBUA 2X0SA 1EHNA 4PRRA 1ONRA 1ZUAX 1WDQA 4MJZA 4AIBA 3CUIA 4NI8A 4PMRA 3PBMA 3S4TA 2OCZA 3Q37A 4HU8A 1F74A 1L6FA 1KM1A 3IIPA 4NAEA 4J4KA 4G2DA 1B4KA 5DMYA 3PPHA 4RUBA 1BG4A 3WFAA 1QCWA 1LTDA 1PZ0A 4NP7A 3QM3A 3QR1A 4M7SA 3LENA 1TCDA 1JYXA 3BC9A 1LT8A 4RDWA 2AAAA 4J28A 2O56A 4GIAA 3U4AA 3S2MA 1NOUA 5HAOA 2YA0A 5BXTA 5JMUA 4N9CA 3VNZA 3TP4A 4P7QA 2RJHA 4W87A 4W86A 3B8WA 5CAKA 1RALA 3M5VA 5G2HA 1QW8A 4R7OA 3CIWA 1E0VA 4L64A 2PZ0A 1XH0A 1GOIA 1XX1A 4PTNA 4UTUA 4O19A 4EWJA 3KDNA 1W2PA 1FH9A 1CIUA 4DO4A 3M41A 4L1WA 4BI7A 2WPGA 4I5XA 2JF6A 1HJQA 3HG4A 3V75A 2ZDSA 5A1AA 1C92A 3CV7A 2DZTA 3EDEA 4UQ9A 4WUIA 4FO4A 3WMLA 3URNA 1GTHA 1BQCA 2WZEA 3LTYA 1E4MM 1OCQA 4HOZA 2FHCA 4H8HA 4DWDA 3SN0A 3PB0A 2BY2A 1EWDA 2DFAA 4R9XA 2Z27A 1M7XA 3A5FA 4NKCA 1AJZA 1ML1A 5HJYA 1EJRC 4Q33A 3BLDA 3ZM8A 4NF7A 1H60A 1XD1A 2ZBTA 3QQ0A 4JYFA 3VO0A 1CGXA 1VFMA 3LA4A 3AAMA 3C8FA 2B4GA 3NEVA 3GVWA 3UVAA 3MMWA 3L0NA 1JI2A 3K1DA 4K68A 1BYAA 1R9YA 3FXGA 3G1SA 3WLJA 1KGXA 3IIVA 3LHVA 4M1RA 5CJ5A 2H6RA 3RMEA 1R9XA 1M03A 3BW2A 4JTAA 4LVGA 3B4YA 4WY0F 4IT1A 3R10A 2YLAA 1YNQA 4LEQA 2WYSA 4BEQA 3PPCA 3KAOA 3F4NA 1Y7VA 2BVDA 4GNVA 5CZKA 4TMBA 1VBRA 2WSYA 1EEXA 1OX4B 3W7IA 2PGFA 2QJGA 5E1QA 4Q8QA 1SZNA 7ODCA 3ABOA 4E3VA 3RF9A 3LMYA 3PN8A 4NJIA 4ZQOA 4A3HA 2AQOA 2DJLA 2ZX6A 4KQNA 2CBVA 5AHFA 3XIMA 3F2CA 1MEWA 1G7UA 3T0DA 2CZ5A 3WLHA 4O14A 5F1UA 2ZDRA 4AD0A 2VEFA 4WDTA 1G4PA 1TQJA 4I5RA 2VP8A 1AH0A 4D8LA 1KM5A 2JFEX 3UWZA 3TNBA 1F07A 1F8MA 4MTVA 3A4WA 3VKJA 2ZUSA 2I1OA 4PUNA 3PHAA 1DJHA 3K2GA 4K1WA 4CCCA 3OODA 5HBFA 1V08A 4TX9A 1R7OA 5FACA 3S1GA 4AC1X 4V15A 1DJWA 3LSBA 2XZ7A 3MUCA 2WNQA 4EXBA 5HQLA 4YTSA 4PB3A 4E38A 1TJ0A 4QG9A 2WMKA 2H90A 1SR9A 4LBSA 3VINA 1OT1A 3VKCA 4BZYA 1J2WA 2PCQA 5LGZA 3MO7A 3UA4A 4EANA 4DF0A 1R3SA 4ORIA 7TAAA 4BEUA 1NDWA 3CJPA 1UD3A 3G0SA 3RLVA 2DY3A 4XG1A 5C55A 2DZVA 5A2AA 1QATA 4TX6A 2YL6A 3NQEA 5C0QA 1E72M 2QDGA 2EXOA 4DJFD 4O8AA 3UCDA 3ERPA 3I65A 1B0IA 4H6EA 4H00A 3O6AA 2PP3A 4JTSA 4NX0A 5D8WA 2OSYA 3HU7A 1BLIA 2PPGA 4ZGYA 3GXDA 3TYCA 3WK2A 3ORWA 3M6DA 1GVSA 4ZMGA 3OGSA 4GZJA 4XSLA 3SQMA 1XLJA 1LF1A 4NZJA 1Q8JA 4EPEC 4HMEA 5DT5A 2ATMA 3W7NA 4O16A 3UR8A 5IM51 2HTMA 4XD6A 2VEKA 3W7QA 2WAGA 4GISA 4WX2A 6PTDA 4Q8VA 2YYTA 4FALA 4D6EA 3EWYA 5DMMA 4C90A 3SN4A 3M1ZA 5FAJA 3DFYA 3ZYZA 4IIFA 5I03A 4K1GA 1H5VA 3OQ8A 1IXQA 5LIXX 1E73M 4LB4A 4AXKA 3GVGA 4AD1A 1EPXA 2J7DA 1DWGM 3HPXA 2PU1A 4QS5A 3PZUA 3S2JA 4NJJA 2VCAA 2XIQA 5FF0A 3AYVA 4B9ZA 1SJDA 5ENLA 4KMQA 1HX0A 3ZT5A 2WKGA 3EOLA 3WLNA 3RLGA 1J6PA 5FOOA 3H26A 2GK1B 2WVTA 3NZGA 5AHIA 5HWNA 1M01A 3KWXA 1OADA 4HJWA 3VAVA 1MNSA 1FHUA 3ZT6A 2PGEA 3GZAA 1W5QA 2VC5A 3UPMA 2DU2A 3WUBA 4NZ3A 4MNLA 2W61A 4XAGA 1JZ4A 2GOUA 3ZSSA 1U33A 3GYEA 1RD5A 3C61A 3ZZ1A 3LN3A 5K4XA 4DJEA 4JDBA 1TPVA 4F79A 3ABZA 3BZJA 3WLPA 1TQXA 3AJ7A 4XZMX 4JS3A 2UBPC 3II1A 4AD4A 2C8NA 4DNHA 4I5UA 3FIGA 2XU2A 4HD5A 1UW9A 4FMVA 1JEZA 4PMJA 3EMCA 5F2LA 5FEWA 3L2IA 3PTMA 4PA8A 3NL6A 3LSCA 3M9YA 3EWXA 4ROQA 2NQ5A 1XG4A 3ISIX 1XLCA 5I06A 1JULA 1LUCB 4AWSA 1K77A 4M51A 4EAMA 3A64A 3EX1A 3AFBA 2EPLX 3CIVA 2QCHA 1F4AA 4JBRA 4UOJA 3UJEA 3U0HA 4D8AA 4LC6A 4ZO6A 4ICMA 1BXCA 2Y7GA 5ABTA 2ZYFA 4X0VA 3LHWA 2PDIA 4JX5A 3AISA 3VGGA 4QRNA 4DJEC 5J5DA 1H41A 4FK9A 5A8GA 2EJ1A 4C6BA 3Q45A 3W9ZA 4QSHA 4DM1A 3E1F1 3P60A 1QT1A 4MNKA 3AS1A 3LHUA 3AHXA 4B4HA 3B0YA 4B5UA 1G9HA 1TG7A 2O9PA 4B16A 2EKGA 3VD4A 2Y2WA 3TZNA 3BAYA 1UROA 1D7KA 5LKYA 1XLIA 1OHLA 1K70A 3WY1A 2ZVIA 1GKQA 3DG7A 5AHLA 1WBHA 4S39A 4DBWA 1IWAA 1P0BA 1T8XA 4DZIA 1TV8A 3AWNA 3LCHA 3GAYA 3LLFA 3CT2A 2NVDA 1ISVA 1FFRA 2BOGX 4HZ8A 4GH3A 1V6XA 3E0IA 1X7FA 3S3GA 4CCZA 1TREA 4UB9A 2ADAA 1XD0A 3MZNA 2OEJA 4ECLA 1XH1A 3L4WA 2TAAA 4QE1A 4FNUA 1QNPA 3RRXA 1EIXA 1X6NA 3PBGA 3T0AA 3PNUA 2J62A 1TUFA 4LUTB 4FB7A 4NSBA 4NXKA 3K4WA 4OBTA 3UWQA 1SW0A 5AYXA 2WZMA 3S6DA 5K9XA 3NSNA 2AQVA 2REQB 2NT1A 3G3DA 3NPVA 3VOJA 1UR4A 2FZDA 1ITUA 2GPTA 4W4QA 3W82A 3ZJKA 4R33A 1JUKA 1N8WA 5DRCA 4WD0A 1NJJA 4IM4A 3NQ7A 2J6VA 3VTRA 5A6KA 5BU9A 3CYVA 1DJZA 4GCAA 3B04A 3O6DA 4CLMA 1VAHA 3LD5A 3QW4B 4D6FA 2UZ9A 1UB3A 3O1NA 3G1FA 4C6EA 3LLDA 1E1EA 1QOXA 4L9XA 1VEOA 3PTDA 2NQLA 3R0KA 4MWAB 4MNMA 1K7EA 1KV5A 2XYLA 3SCVA 3B8VA 3VM7A 1HT6A 3WNPA 1T6MA 4HU4A 1AFSA 4DLFA 3N12A 4Z2JA 3W23A 3NM3A 3W2NA 1FY6A 2VCCA 1M04A 3L4YA 3QSRA 1VB9A 5HNRA 4LUIA 1GQJA 4CD7A 2IUZA 3IK2A 1PJ9A 3IK4A 3ITOA 2OO0A 4C6MA 3JZUA 3IJLA 3F2BA 2FGLA 2VOTA 3RXZA 3NTYA 2Q8XA 1UC5A 2DVTA 2NUYA 3WFZA 1G4TA 4HVXA 5D2WA 4O28A 3WH8A 5GQBA 2D2OA 1KTCA 5E9XA 3G77A 2QPUA 1L0PA 3L9CA 4TQTA 3USBA 4YTQA 4H9TA 3M43A 4NJKA 4OUIA 3CV6A 2QQ6A 1O60A 1HGYA 3A4JA 4WSKA 1R87A 4NNBA 1TJ2A 3LXBA 3WLLA 3LBCA 3LS9A 4PMYA 1IE7C 1TYGA 1TIWA 5FAGA 5L6UA 2DDXA 1W3HA 2R14A 3RK8A 3TA6A 3HG2A 4MZYA 2YFOA 2Z7GA 3EWBX 1WOBA 4KBXA 4KWUA 1EOMA 1S3TC 3ZQ9A 3VKKA 2PMQA 3WQ8A 1H09A 3GFXA 5I24A 2VX5A 1EC8A 1XLMA 4REQB 3AS2A 3HG3A 5JXQA 4JXCA 4GC3A 1JYNA 1PZ2A 4H7VA 4JIIX 3WO8A 2G95A 2PBOA 3PULA 4B3ZA 3AROA 3BZGA 4V28A 1ZJHA 5LZLA 1NFGA 2X2YA 3TYAA 1H50A 4MB4A 1R2TA 3W1PA 3W83A 3D3AA 4NJHA 1K9FA 1M6JA 4QLLA 4LALA 4PB4A 1KFKA 3MZ2A 4EXAA 3WNLA 4KEMA 1UJQA 1QOPA 4GZIA 1RA5A 2V2CA 3KCJA 4IMDA 1EX1A 1YE4A 4US6A 1W1IE 2PF0A 4ZSTA 4OV9A 4BQ5A 1KWKA 1KA9F 2VNCA 1C8QA 1YXYA 4US5D 3I6EA 3UWYA 1Z69A 2ZTJA 3MJMA 4EACA 3B06A 4I7UA 3QV8A 2HK0A 1NP0A 2HVMA 5FF7A 1P7TB 2V3FA 2Z00A 3C2OA 4O10A 3MPGA 4B3KA 3QSTA 1E1CB 3GFZA 1IZKA 3ARPA 2XVGA 2A0NA 4QISA 2VC6A 1QWKA 3EOUA 3APYA 2BXYA 3LQGA 4S3JA 4DJDC 4N9DA 3L5AA 5IHSA 4E2DA 5BMWA 3UG3A 2BS9A 1E51A 2PDGA 2EQDA 1WXJA 4GBUA 4LGXA 2ZZ4A 4I9JA 1R3QA 3RJYA 1K9TA 4D72A 3DFQA 2ZADA 2OT1A 1CX9A 1S46A 4DWSA 2XIMA 1HJWA 4RCXA 4F0RA 2OLAA 3BCDA 7ENLA 4EKJA 4HP5A 2WPBA 2YYUA 1W8GA 3E0WA 1TA3A 2NUWA 2F6KA 5KTLA 2CW6A 4BHYA 1GVRA 4MOZA 4JTKA 1CT5A 1CDGA 3O0KA 4NZFA 1U22A 1UP3A 1BPLB 4PUMA 5LYRA 3ZS4A 1SFSA 4AEEA 5DEZA 3WL0A 4J3XA 1RCXB 3E2QA 3GE7A 2UY5A 4MMWA 3GH7A 3ZSTA 4PMZA 3SZ8A 3C2EA 5IOBA 1M7OA 4O0KA 3MWAA 1QASA 2CLOA 3MHFA 4N4QA 3GHTA 4E2VA 5D02A 2JGYA 3BOXA 2GGIA 1BAGA 2PDBA 4RK8A 4Q4SA 1A5OC 1VFTA 4CQBA 1TMLA 1PCWA 4XB3A 4ADTA 3N3TA 1KFBA 4PUKA 2E6AA 4XTIA 3UP8A 5JQ9A 3VX0A 2SFPA 3AWOA 1V0MA 4H6RA 5IDZA 2AL1A 5G2WA 4QAWA 3M64A 2I9EA 3W72A 1Q85A 3KE0A 2QDHA 1TJRA 5CLWA 3UF9A 1B90A 2FIQA 2QZRA 2W3ZA 4CD8A 2INEA 2A5HA 3QC0A 2WMGA 4R5EA 3VZZA 5CGTA 3DENA 2R82A 4ML9A 4C6CA 4PMXA 4JD4A 4IIEA 5PTDA 2Y0FA 1YHTA 2QEZA 4U4MA 5EA9A 4UTFA 5EFDA 3RITA 2F61A 1J0ZA 2XPKA 1DL3A 4X60A 4KEVA 5DN1A 2PDPA 3KFTA 3TOYA 3W88A 4XIAA 1N82A 2E9BA 4CGTA 5C2GA 1XIFA 5FSDC 2IW0A 2WMFA 1UUQA 6REQA 2YX0A 1PTGA 2Y5JA 2G5WA 4AZ5A 1S38A 1US3A 1LRQA 1JNEA 4OUEA 2PDNA 3AU2A 2EAWA 5I3KA 1G4SA 3P14A 4A3UA 2Z6IA 4IPNB 1W1ZA 3MMTA 4N9BA 1EO7A 2WVUA 1EXPA 2BP1A 1R47A 4ZQMA 2HK1A 3WLTA 1YQ2A 1OVDA 4C6JA 3BAIA 1B3WA 5F1VA 2Y61A 1JDFA 1QO2A 4LAUA 3W2LA 3R0DA 4D6DA 4M19A 1DKWA 1J0KA 1FRBA 3HPAA 1XWYA 3CO4A 1UJPA 2OEKA 4GXWA 4GYKA 3ZLFA 1A3HA 4UIOA 1IEQA 3TNOA 4F9JA 3E2VA 2VGBA 4I8YA 4YIWA 1D7FA 1FCQA 1M7JA 3G1AA 1RCQA 2OYMA 1CLVA 3TTOA 3WJXA 1RCOB 3H4WA 3LHTA 1MW1A 2A2IA 5D09A 4ZCWA 1U83A 4JFTA 1HG3A 3L23A 1BSIA 4H04A 3TXVA 3SUVA 4YXGA 4PMNA 4QJ3B 4H01A 3T8LA 4QQ3A 3C86A 4V1XA 4IOTA 1UHVA 5T9CE 3OZPA 4QR6A 1XBYA 5GVJA 3TC7A 3CQIA 3A4XA 2EG7A 3W7JA