1KRMA

Crystal structure of bovine adenosine deaminase complexed with 6-hydroxyl-1,6-dihydropurine riboside
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
349
structure length
349
Chain Sequence
b'TPAFDKPKVELHVHLDGAIKPETILYYGKRRGIALPADTPEELLNIIGMDKPLTLPDFLAKFDYYMPAIAGCRDAIKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVQAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDTTLYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords adenosine deaminase
molecule tags Hydrolase
publication title Structure of bovine adenosine deaminase complexed with 6-hydroxy-1,6-dihydropurine riboside.
pubmed doi rcsb
total genus 118
structure length 349
sequence length 349
ec nomenclature ec 3.5.4.4: Adenosine deaminase.
pdb deposition date 2002-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1krmA00
2G3FA 4CNTA 3UPMA 2DVUA 3K4WA 4KF1A 4QROA 3URQA 4UBPC 2R1MA 4KERA 2HNHA 1RK5A 1GKQA 1XRTA 3D6NA 1FWBC 4IGNA 2P50A 3DUGA 4F0SA 4Z42C 3HPAA 2Z29A 2D2HA 1EJXC 4IG2A 3GU9A 4I6VA 3RCMA 2DVTA 3N2CA 4C6IA 4NI8A 4INFA 3BE7A 2Z7GA 2Z00A 1VFLA 3WZ0E 2WJEA 4CEXC 2E1WA 4C6FA 4CQDA 2VUNA 1K6WA 1K1DA 1V77A 3PANA 4GXWA 1YRRA 3ID7A 2WJFA 1NDWA 3S2JA 3OOQA 1EZ2A 4EPKA 4JOMA 4IFOA 1XRFA 4XD5A 2YZ5A 3GIQA 1ITUA 3OVGA 2GOKA 1A5LC 4EPBC 3E74A 2KAUC 1O5RA 3GU2A 4LALA 4B92A 3MPGA 4CEUC 3URAA 2YB4A 4CNUA 1YBQA 3EGJA 4XD4A 4R85A 5FSDC 4B90A 1QW7A 3F2CA 5FSEC 3AU6A 1FWFC 4DIAA 4CQCA 3DCPA 3F4DA 3AUOA 2R1NA 3MVTA 1DPMA 2UBPC 1M65A 4KEZA 3WYZA 2PUZA 2R1PA 4H00A 4XD6A 2Z4GA 2QT3A 4DYKA 4BKNA 3LSCA 4GY0A 1A5OC 3PNZA 4GC3A 4C6EA 3ORWA 1W1IE 3A3WA 2Q09A 1FWAC 3IRSA 3GU1A 2D2JA 4BY3A 3URNA 1RJRA 4P5UA 1YBQB 4QRNA 3ICJA 3IV8A 4KESA 4C6QA 5AKQA 1J5SA 2Z24A 3NQBA 2ZC1A 4GBDA 4HK7A 4C6PA 5HMDA 3LY0A 4M51A 1RA0A 4G7EA 1RJQA 1J79A 3JZEA 4GK8A 4GY1A 3GTIA 1EJVC 2WJDA 1FWCC 1P6BA 3MDWA 1EYWA 4F0RA 4RZBA 4ZSTA 1I0BA 1GKPA 1FKWA 2AQOA 3MSRA 3SO7A 4CQBA 1NDVA 1ONXA 4HK6A 4D8LA 2I5GA 2FVMA 1A5MC 2VHLA 3MTWA 2FFIA 2FTWA 3OQEA 2WM1A 1PB0A 3NEHA 1ONWA 3TN5A 1KRMA 3RYSA 4B91A 1E9ZB 2EG8A 1KCXA 3PAOA 4WVXA 1JGMA 4DZIA 3LS9A 3RHGA 1R9ZA 2QPXA 2R1KA 1HZYA 3OJGA 4KEVA 2VC7A 3LGGA 2QVNA 3HM7A 4TQTA 3B40A 4F0LA 3S2LA 4YIWA 4GYFA 4DLFA 4QSFA 1V7AA 1V4YA 2HPMA 3SFWA 4H9XA 2YXOA 4H9UA 4HK5A 4H9TA 4LCQA 4CNSA 2ADAA 4H9MA 2Z2BA 4B3ZA 3EWDA 1P6CA 3E3HA 3LGDA 4QS5A 3ISIX 4GZ7A 3FEQA 3R0DA 3URBA 4J2MA 1FWJC 3E0LA 1UIPA 1FWDC 4XAZA 4ZSUA 4C6NA 4PBFA 2Z28A 4RDVA 2VR2A 3UF9A 3LNPA 1S3TC 4GX8A 1P1MA 2HBXA 4C6KA 1V79A 1XWYA 1WXZA 2DVXA 1FWIC 3GIPA 4OFCA 1UMLA 2E25A 4PCPA 4C6BA 1FWEC 4R88A 1NDYA 3LA4A 3GG7A 2P53A 3F2DA 2FTYA 2PLMA 1FKXA 4XAFA 3UR2A 1R9YA 3B0XA 2F6KA 2Y1HA 4ICMA 3WMLA 3KM8A 4C6MA 2GSEA 2EG6A 1EJUC 4QTGA 1A4MA 2AQVA 4H9VA 1KRBC 4EP8C 3S2NA 2I9UA 4RDWA 3OU8A 4H9YA 4DI8A 3IACA 1FWHC 2VC5A 4I6KA 4LH8A 2GWGA 2BGNE 1V51A 1KRCC 4LAMA 2RAGA 3IGHX 3PBMA 1K70A 2QS8A 4H01A 2ANUA 3LU2A 1QXLA 3FDGA 4MUPA 3UR5A 1GKRA 1J6OA 4AC7C 4J5NA 3C86A 4IFKA 4C60A 3CAKA 2Z27A 4BJHA 2AMXA 3G77A 1A5KC 4ERGA 1XGEA 2FVKA 3K2GA 3QY7A 3T8LA 5A6TC 1EJTC 1EJWC 4C65A 3GRIA 4IH3A 2ICSA 3O7UA 1A4LA 3B0YA 4IG2B 1UIOA 4G7EB 1BF6A 4LCSA 1IE7C 4LEFA 2HBVA 4DO7A 5LXXA 2OGJA 4GX9A 3GTHA 4L6DA 4C6CA 1E9YB 4ERIA 2R1LA 2OQLA 1J6PA 3TN4A 2YB1A 3T81A 4C6OA 4DNMA 2OOFA 4AQLA 3CJPA 3F4CA 3O0FA 4XAYA 1POKA 2O4QA 4C6JA 4LANA 1RK6A 4UB9A 3QGKC 4IF2A 4IGMA 4NP7A 1RJPA 3GTFA 3EWCA 4WHBA 3IARA 2OB3A 4V1XA 1YNYA 5E5CA 1UBPC 3QY8A 4PE8A 4IFKB 4HJWA 4HA0A 5HMFA 4DI9A 1WXYA 1R9XA 2Z26A 1EJRC 4KQNA 3PNUA 4IFRA 4LFYA 4R7WA 2VM8A 1KRAC 3A3XA 3CS2A 3IJ6A 4RDYA 3MJMA 4DZHA 3IPWA 3QGAC 4ERAA 4WGXA 3GUWA 4RDZA 4H9ZA 4C5ZA 3RN6A 1M7JA 1RAKA 4KETA 1PSCA 2O4MA 2HPIA 2BB0A 4RE0A 2PAJA 3AU2A 4E3TA 1ZZMA 3FDKA 3OODA 3DC8A 3TN6A 1PTAA 4J35A 1YIXA 2CZVA 1I0DA 3E2VA 4QS6A 3T1GA 1PO9A 3MDUA 1EF2A 1FWGC 1NDZA 3UBPC 4DLMA 4XD3A 5CH9A 3K5XA 2GZXA 4V1YA 3ITCA 2Q01A 4EPDC 3V7PA 3QY6A 3E38A 4C6DA 4G2DA 5G4HC 4IQJA 2IMRA 4L9XA 1O12A 1ADDA 2A3LA 4KEUA 4XAGA 3LSBA 2W9MA 5HMEA 3MVIA 4GOAA 3F2BA 4C6LA 3TN3A 1NFGA 1A5NC 4LCRA 2PGRA 3S4TA 1POJA 2Z2AA 3S2MA 2XIOA 3NURA 2HQAA 2EG7A 4GY7A 1RA5A 2UZ9A 1EJSC 3TNBA 2PGFA 2Z25A 4KIRA 4LAKA 3HTWA 1M68A 2D2GA 4NG3A 1ITQA 4EPEC 3E0FA 4PBEA 4LAOA 4C5YA 2OODA 3MKVA 3GTXA 4PCNA 2GWNA 1YMYA 3A4JA
chains in the Genus database with same CATH superfamily
3G6LA 2V3FA 3A6OA 2G37A 5FL0A 2XFYA 2W61A 2Y89A 3W7CA 4O0ZA 3U4AA 2Y62A 3WELA 3U48A 2ACRA 1WB0A 1RK5A 5EA9A 3TTYA 3W28A 4FNSA 1KM2A 3LNMA 2J62A 4D8ZA 4IG2A 4YVPA 2WHJA 2XH4A 4HA1A 4B16A 3RCNA 1RH9A 3AYSA 3H54A 2GJPA 4E2BA 5AC8A 2ZZ1A 2Z1SA 4MWAA 5E09A 1VBGA 5B7ZA 1VIZA 3VNYA 1BYBA 1LOLA 3PG8A 3VUSA 3RIKA 4BEUA 3NSMA 4H3DA 5J04A 5JQ9A 1JG9A 1AZ2A 5AY7A 2C0HA 3WQ4A 1F6PA 1O5RA 3GU2A 1XSIA 2ZUWA 1EO5A 3PF3A 1UD5A 3GDRA 2I9EA 1DOSA 4B9YA 2Z1VA 1U5HA 3N13A 1W54A 1L6SA 3TU9A 1V6XA 2NQZA 1XL9A 3UXAA 2FZNA 3OYZA 3LTSA 2R1NA 2GJRA 1N7KA 2QR6A 4JTSA 1VS1A 2DSKA 5FOOA 4DJDD 2VEIA 2QT3A 3L0KA 4PUUA 1BRLA 4C6EA 4WEVX 3PPCA 2WMIB 4C1LA 3SURA 3R7MA 1V3KA 3O6YX 3T40A 3URNA 2AL1A 1W5NA 2BFGA 4MZ8A 3GDMA 4MLJA 2CKRA 4ZO8A 3TR9A 4GVGA 5E9AA 2JE8A 3Q65A 4Q8MA 3AWNA 1KNWA 1OC7A 3APGA 4GY1A 1FWCC 1TMQA 3AI0A 3HGJA 3HQNA 1NQKA 3HFTA 4IXXA 5KMYA 1FRBA 4ASTA 2EPLX 1HJSA 3TNOA 1M1BA 1ZNNA 1A3XA 1E0WA 4HIBA 2Y8KA 2GGGA 2FFIA 7A3HA 1WNOA 1CWYA 1EC8A 3KP0A 3AS3A 2UY5A 1OGGA 4GQGA 2WANA 1KCXA 3N29A 6XIAA 4A2SA 4JQ3A 1UWIA 5DT5A 1CTNA 4AIUA 2G97A 3ITGA 4Q8NA 4UWMA 3L4UA 1RV8A 2WNNA 1EUNA 2XH2A 2IXUA 5K9DA 3PWAA 4J3ZA 4AEOA 5FJPA 3EX2A 3AXKA 3LN3A 3PBUA 4B3ZA 3TC7A 4H8UA 4JQ4A 1XIIA 5BMXA 4D1JA 4UTTC 2DUXA 1JPIA 4J3WA 4DJEA 1IT7A 3AYVA 3FGCA 4HHPA 1DTNA 2BOGX 5HANA 5D03A 1U1UA 1VFTA 4V2XA 1V0LA 1Q65A 4WKAA 1PWMA 4ZVJA 1XWYA 3UJEA 1FP9A 1KKOA 4UXDA 5FEPA 3TJ4A 4R34A 2ZUTA 2NV9A 3W2NA 3B4YA 5RUBA 3W6YA 4O50A 4ADSA 1AQ0A 2ALDA 1S2VA 3FCPA 5CC5A 1R9YA 3NPWA 3W74A 1V8EA 4IJCA 4QAWA 3SY1A 3P7YA 1V03A 1EO7A 3BMWA 3OBKA 4DWSA 1UBSA 3LLDA 2ZZ3A 3S2NA 3VNLA 3CZ8A 1HVQA 3ZLHA 1CIUA 2CCRA 3FXYA 1ICPA 5T9BG 2X2GA 1K8XA 4N9BA 1UWUA 3M44A 4JDBA 4EIVA 1KQYA 1SJBA 1PX3A 3MB9A 1GG1A 1BTCA 1MW1A 3QVQA 1MEIA 3EOSA 3WBXA 2P8BA 4BJHA 3NPUA 3OB8A 5A8NA 4PN2A 4MJ4A 1TELA 3QY7A 5A6JA 5HULA 4L1GA 6PTDA 4R7OA 5I77A 3B0YA 2E1DA 3OPSA 1UIOA 4G7EB 5C9WA 1KXTA 1IR1A 3GNPA 4PB3A 1I75A 3RPTA 1EPVA 3C8NA 4CCZA 1UKQA 3QXBA 3VGFA 3BW3A 3CZJA 5BCAA 4ERIA 3T07A 2OQLA 4Q32A 3TX9A 4OKDA 1T40A 2OEMA 4NZJA 1T7LA 1FCQA 1V6VA 3T81A 3B8TA 4DNMA 2OOFA 4M82A 3S5YA 3EMCA 3OHIA 3UWYA 2Z1XA 4PTWA 3SCRA 5I78A 4JIEA 1DORA 3KVLA 2CERA 4GG9A 1P7TB 3S9IA 4WHBA 1TA3A 4OOUA 4V1XA 3HGOA 2ZIDA 4GPNA 2PMQA 3SECA 1XSJA 3LCGA 3ELFA 1IIGA 4A8NA 2Z1KA 1VHNA 1J96A 4ZGYA 4MJ2A 3SCTA 1VIWA 4XKYA 5HAOA 3S5OA 1ENUA 4WGXA 3FHAA 1CEOA 1D7KA 5A6KA 4HGXA 1OEPA 3EOOA 3WQFA 3RN6A 4J3XA 3EX4A 2HPIA 1V3MA 2ABAA 3TW9A 1JD9A 5I02A 3HA1A 3QW4B 3UY7A 3AXMA 3NZ1A 3QJAA 3IWPA 1K7FA 1UA7A 2OZ3A 3WD2A 2J77A 3E2SA 3NYDA 3T78A 4U10A 3SADA 2WMFA 2FDMA 3MI2A 3L9CA 4L9XA 3SCOA 4GHRA 3KL0A 2GOUA 1C92A 3CV7A 5D33A 4MAZA 2DIEA 1HJWA 2R91A 1RQHA 4F66A 5FAJA 2C7FA 3AHXA 5AVHA 2DGAA 4TVUA 4XAPA 1IWPA 2HQAA 3NURA 5ENLA 1QR7A 4ROPA 4EF8A 4HNTA 3LENA 4RUBA 3VZYA 3FX4A 2EAWA 3AIBA 4REQA 1VEOA 1LRNA 4LX4A 3WLMA 3V18A 4XZBA 2GWNA 9XIAA 1Q3NA 3FAXA 4F8XA 5JIWA 3BMVA 2L5HA 4AHOA 2FH6A 2PDYA 2FKPA 4LW7A 4AYSA 1Z44A 4C7DA 3DG6A 4JYDA 4PTXA 5C2GA 3A64A 4IP5A 1GTEA 1AL8A 1EJXC 4U31A 2WZTA 2AL2B 2XTKA 1OX4B 3ERPA 4DZ5A 1OZMA 3VNMA 3TQVA 4MNJA 4M7TA 2BGQA 3TKFA 3GWQA 1E6QM 3CL8A 5H6HA 3G24A 1EL3A 4UTFA 3EDKA 4AG0A 4A3QA 4FNQA 1F5ZA 3N6QA 1BVWA 3EA2A 1P0DA 1X98A 6REQA 4L7ZA 1TVPA 4A3HA 2OELA 1LBMA 1YBQA 3LRKA 4UMCA 1SGJA 3M46A 4U5IA 3RGTA 3SUWA 3VVGA 3I65A 3VNJA 1MUMA 1W1B1 4DIAA 2Q8LA 4AY8A 4Y6GA 1OD8A 1IZCA 3PBGA 4HOWA 2EHHA 4IGHA 3TYAA 2WVVB 3QM3A 1MXDA 1QK2A 1W1IE 2F61A 2PS2A 3LTPA 3M0ZA 5I07A 5PTDA 2DZBA 1UC4A 2JGYA 3H70A 4S38A 1KM0A 1V7YA 2PU0A 3KWXA 1QNSA 3QZAA 2O9TA 2YLLA 4W86A 3Q67A 1J79A 3C8FA 2IPFA 2VR5A 4M5PA 1SZNA 3CT2A 4I9JA 3SR7A 1ZP3A 4QQ3A 3BG5A 5BWAA 2QKFA 1IQ8A 2OSWA 1I0BA 1FKWA 5FJJA 1SFJA 4PFHA 1W5MA 2AL2A 5A95A 3UD6A 3PWIA 3UZZA 1JI1A 4UTMA 3VKJA 1QPQA 3AYRA 3WJSA 3L2LA 1Q2SA 1R2TA 3THAA 5EPDA 3CTTA 3G3DA 2QPXA 3EMQA 3A22A 4U2ZA 5TNVA 1O94A 3L4XA 1W1VA 4CCCA 4NKCA 4CU7A 1VBUA 4UCGA 1O1HA 3P81A 1FDJA 2PODA 2QV5A 2XN2A 4H9MA 2ZWZA 3EWDA 1RQBA 2FTPA 3LHVA 3MV01 3FEQA 4J2MA 3HO8A 1M7PA 1FWDC 2F2HA 2E7FA 3BQ5A 3H24A 1RR2A 2QLYA 3W7MA 4C6NA 2DQWA 3DIPA 4JTRA 5DQPA 4UR7A 1S3TC 5HXMA 4LEQA 5EBUA 4C6KA 2NQ5A 5DY3A 3SFKA 2QUMA 2ISDA 2ZBTA 4JICA 4OBRA 2GYIA 3RX3A 3GG0A 4MB4A 4C6BA 2O7QA 3QPZA 2NT0A 4ML4A 3WF4A 5T91A 3P67A 2WKGA 3A12A 2H9AB 2EG6A 1A4MA 3KDOA 2A3HA 2PTYA 3W4RA 1FHLA 3G22A 4OVXA 1PKMA 2VX6A 3ZT5A 1DXEA 2F9RA 4PMYA 3LQLA 1XH2A 3ZSSA 4IGSA 2YL6A 4UOZA 2JALA 2QS8A 4XBKA 1BXCA 3T9PA 4CGTA 1XYBA 5HDRA 1BFNA 4NHVA 3EBVA 2AAAA 2POTA 3KOWA 1E6SM 3E1F1 4US6A 2WW5A 4UTJA 2J4GA 5C0QA 3OA3A 1JUKA 3OG3A 3HB9A 1HVXA 4MADA 5C7HA 2ACSA 1WZMA 1DJQA 1EJWC 2RHGA 4O18A 3CASA 4S3FA 3TIMA 5D37A 1UB3A 3SY8A 4HMDA 3ABSA 2CKSA 3NQDA 4KBXA 2R1LA 4JTLA 5FF4A 4AQLA 3CJPA 3BGGA 3W23A 3BZGA 3ABOA 3LD5A 3TQPA 2CEQA 1I2RA 2YR1A 1QI0A 4ECLA 3HJZA 4HU4A 3P6LA 1KM5A 3UZJA 4FA3A 4POCA 3H6OA 4HP5A 4Q8TA 4KT2A 4S3AA 5LNSA 3AO0A 3KDNA 4O13A 4HJWA 4FPSA 2P88A 3LCLA 4F48A 4JX4A 3AICA 5EGRA 3WQ6A 1TMLA 1SFSA 1UR3M 1V08A 3BW4A 4ZFMA 1ZALA 3PG9A 1UH3A 1RHCA 3UY8A 2GJLA 1XLAA 4LFYA 4BEQA 3IVSA 3POHA 5E70A 4YTUA 3PP7A 1ZLPA 1A3HA 4XO7A 1SYTA 2FB2A 4RE0A 3TYEA 1HT6A 1L6GA 3QFEA 2W0UA 4QS6A 3T1GA 4R9OA 3G5EA 4H83A 2QHAA 3FA5A 1IZJA 3V16A 2VGBA 3T4CA 5DXXA 3W83A 1Z48A 2HZGA 2QZRA 3E38A 4LVGA 2E5DA 5A8GA 3R79A 1VFOA 4I7VA 4QJ5B 4NRRA 1LLWA 3INPA 4U2YA 2XIMA 3N3MA 3SUUA 2ZRWA 2OQYA 2HVMA 4HSNA 3SY5A 4MWAE 3O0KA 1CGXA 5HR6A 2EPKX 4MJMA 4U3CA 3P3BA 3RRAA 4RK8A 5XIAA 3TNBA 1OT1A 3DKJA 3KTCA 4PL1A 4FIRA 3EMZA 1G94A 5GVJA 2HXTA 5FI8A 2IS7A 4GUGA 3LHZA 4IIEA 5IOBA 1BKHA 1W37A 3PAJA 3VABA 3D3AA 3L67A 3MQTA 3ATZA 3VTRA 2R1MA 1E5NA 3LI0A 3KS5A 4YWIA 1V0NA 4DJDA 3WNNA 4IGNA 1V0KA 2NV1A 3LM7A 3VCNA 4NJIA 3FEMA 1MVYA 1OG0A 4JGDA 4DPPA 1E6XM 1IXQA 3AUJA 2VEGA 3M0XA 4G8TA 3RCMA 2VFFA 3ZR4A 4DBSA 5D2YA 3N2XA 4RPQA 2OR2A 1VFLA 2NQHA 4W85A 3DU0A 3W3OA 1BF2A 2V63A 4RJEA 5CPMA 3WQEA 2VGGA 4E8DA 2ZRZA 4KRUA 2J79A 4QITA 3IK2A 1JPMA 3WLPA 4O8RA 1G69A 1W17A 1CB7B 4D6JA 3OVGA 5I09A 3B8VA 3CO8A 4ZQPA 1TPH1 3PBWA 4CNUA 4BQ5A 5FAGA 2JEPA 4Q4SA 1I8JA 2E4TA 1XBZA 2YLAA 1LF1A 4UIOA 1RBAA 4RE2A 1ICSA 4QP0A 2VZSA 2VUYA 1AG1O 4DBEA 2C1HA 3MCNA 1TR9A 4KH2A 1KR0A 4BKNA 4LRSA 1V6YA 1KM3A 1G4TA 3USZA 5I3KA 4CNPA 4W8AA 1TTQA 3H23A 1QI3A 1OFBA 2GVYA 2J7CA 3EPNA 1I6NA 2QJNA 2PBGA 1H7RA 5G1TA 2ONEA 3CM4A 2DP3A 1QHZA 2OX4A 2YBUA 4O1BA 3DN5A 1K8CA 3WX7A 1XDJA 2OKTA 1EC7A 2FMNA 1BWLA 5AYBA 4U33A 4WRHA 4ZSTA 5CG0A 2I5GA 4HA3A 4LNCA 1W9PA 2ZRUA 1A5MC 3CMFA 2WBGA 4HYRA 3WQGA 5BRPA 1NWUA 2P3ZA 3NEHA 1NU5A 3TN5A 2VC6A 3CB8A 3BJTA 3RHGA 3A9IA 3TFXA 3MANA 4KEVA 4ZENA 2BS9A 1NQ6A 1WZKA 4GO9A 4QLLA 2ZXBA 4MFEA 4N0RA 3UFYA 4H9XA 5KSWA 3T0TA 1NP2A 2ADAA 3TQKA 3BICA 1BAGA 4LY4A 5M1TA 3WD1A 3G18A 4D6EA 1SSGA 4RE3A 3S2CA 1J5TA 3UF9A 1W56A 1BQGA 1MUWA 1VCVA 1H3GA 1CGVA 3ATYA 3B0PA 4AD1A 1MI3A 4OFCA 3FJLA 2HE5A 3A13A 4NAEB 2YIHA 3CO4A 7REQA 5EMJA 1UD6A 2NLYA 4R88A 5C71A 3N14A 2XIBA 3TJLA 3NZPA 4LUSA 3QSTA 4HD5A 2EPNA 1YTDA 4ZE5A 4YMZA 2RDXA 1T8XA 4C6MA 4DY1A 4NJKA 3UXKA 4BWLA 5DBTA 1KRBC 3ES8A 4E4PA 4RDWA 4H9YA 2YYUA 3ABXA 4I6KA 4YTRA 5IHRA 1H7OA 7ODCA 2GWGA 1S39A 4I8YA 3SIMA 1E4MM 1R0MA 1K70A 3UZWA 3NSXA 1GZGA 3ARSA 2BP1A 3MW7A 2EQDA 4MY9A 4A8RA 3LPOA 2FVKA 5E93A 3BVJA 4BCEA 3SN4A 1JCLA 4QBXA 1KW1A 5HMSA 4MOZA 5CPSA 3U5YA 3CZKA 3THQA 2V38A 3VD7A 3ITOA 2OGJA 4DWSD 3Q45A 4HB7A 1TV2A 3AIEA 5CZSA 4C6CA 2WPBA 3MSDA 2NV2A 4K8HA 4AUBA 1REQB 4C6JA 3HF3A 2WPGA 5H2ZA 4C91A 3QGKC 3W82A 1RJPA 1UASA 1IEVA 1EQPA 1G67A 3EWCA 4TTUA 1SO5A 1FDYA 4NQ1A 4TO8A 5FEWA 4O53A 3KLKA 3LX9A 3KL5A 4V15A 1WXYA 2VXNA 5CJNA 1MW0A 3ZIZA 3R10A 1AH4A 1VHCA 3U9IA 2Y7GA 4P8VA 4R7WA 4EX4A 2WKLA 4NILA 5AHEA 4UTWA 3RITA 1UKPA 4QXIA 5A6MA 2YCEA 4W4QA 3A5FA 1EP2A 3SRDA 4GQQA 3B4UA 4JQ1A 4ATLA 2BMBA 3SUVA 1GHSA 4E3TA 1NY1A 4IUGA 3R5EA 3V36A 3OODA 5HK4A 3W0KA 1T41A 3ZVHA 3W24A 2QCNA 3RLVA 2ODOA 1FOBA 1YDVA 1CLVA 4DUVA 4FLQA 4HJFA 3TJIA 1Q66A 3QQ0A 4C7GA 3WUEA 5K4XA 4FMVA 1BYCA 5CPNA 3QSRA 2PDWA 1E40A 1T99A 1LT8A 1WP6A 1D8WA 3UWQA 1CLXA 1POJA 3L7RA 3QR3A 1AJ0A 1KV5A 4Q4RA 3G6MA 4JNYA 1C29A 3HQOA 2F6UA 1PS9A 4CNNA 3NWRA 5A2BA 4N9CA 5MKGA 4ES4A 3F7JA 5XINA 2VZOA 3AIRA 3W76A 1GVQA 2ZUVA 1RY0A 4AY7A 3DGBA 2OODA 5BRQA 2J9XA 2XM2A 3BCFA 3AHTA 1LM1A 5LNWA 2V5BA 3OZYA 3GAKA 1XLLA 1JCJA 5AC7A 3KEHA 3WJWA 3CZEA 3I3BA 1NEYA 2Y7FA 4R33A 1EIXA 3KBNA 1M5WA 1DJYA 2YW4A 5GJPA 1W8GA 4O0QA 2NUYA 3LLFA 4DWDA 1GYMA 2YL8A 2Z00A 2DSZA 1OCQA 4LVAA 4Z0SA 2WC4A 1K1DA 3N1AA 4GXWA 3O8AA 1YRRA 2FHBA 1BTMA 5B80A 1XP3A 4DBDA 3W1RA 2A6NA 2QMJA 3GIQA 1F76A 2FZ8A 3CUIA 4JTDA 1QTWA 1XDLA 4OBTA 1VJZA 2HNEA 3MBDA 3VINA 4W8BA 3TR2A 1XLDA 3RO6A 2XVLA 1TIMA 3WK0A 3C4UA 3EPMA 1W0MA 4NZFA 2G8ZA 1L0PA 4HCHA 1HX0A 3M9YA 3H2OA 3LGEA 3FVMA 2P10A 4P7NA 2ON3A 2ABBA 1R3YA 3OA5A 3MKCA 1BVZA 4QJ3B 3FYOA 4UFJA 4A8IA 3C0JA 1BGAA 1F7BA 2Q09A 1XJBA 1SPQA 2PSNA 3MMTA 3HMJG 4AMCA 1OF6A 1YNPA 2CYGA 2E9MA 3U3HA 2DW7A 5JIPA 2PE4A 3F5JA 4O14A 4XSLA 4C6PA 3K8KA 1IEXA 3JZUA 4GI8A 1EB3A 1GONA 2IKGA 4ZQCA 3VM5A 1CYGA 4WY0B 4I3GA 3E0VA 2Y5EA 2R14A 3DHFA 3LMZA 4URIA 2QULA 4QNEA 3VIGA 1SW0A 3DENA 2A0NA 1ML1A 3WBAA 2QF8A 1XLKA 2FTWA 2HXUA 1GWJA 4CCDA 2BWGA 4FIQA 3ZZ1A 1R3TA 4GVHA 5A69A 5EFDA 2G3JA 2C1GA 2CBJA 4OJYA 3MC5A 2XU2A 4WVXA 2V30A 5HWNA 4DWSB 4ZXOA 2BLEA 1S1RA 4DAIA 1WOAA 4U28A 5TAOA 4MUZA 2PB1A 8TIMA 3CGTA 1UZ4A 3UXDA 3WEMA 3WQWA 1GOOA 1LLOA 3U8GA 3H55A 2Z2BA 3DYPA 3UYCA 2O9RA 3NGJA 3G1SA 4PMOA 8XIMA 2X05A 2J74A 3GQYA 4M29A 4NX0A 4TX6A 3UGRA 4GZIA 2BY3A 4LV9A 2KX9A 1QO2A 2ZUMA 3HV9A 1X38A 2CHNA 1EDGA 1G4SA 1KCKA 3USBA 2DVXA 4GJJA 2OXNA 2TODA 3ABZA 5BXPA 4NAFB 4PB5A 4ZBCA 1DL3A 1HN1A 5A6AA 3M43A 1QW8A 3CHDA 4TMBA 1L6WA 1LT7A 1G4EA 1I4NA 1OGSA 5FJTA 1C93A 1KBJA 2PD5A 1EEXA 1AW5A 4S3EA 1E71M 1FQ0A 4ACZA 2XVKA 4OHQA 3QBUA 3NO3A 4JS3A 5DN1A 1Q6FA 1OK4A 2CLPA 3H7RA 4X0VA 1RD5A 1MWOA 2XIIA 3SCPA 1TJ2A 4L65A 1WV2A 3EWYA 5BOOA 4K36A 4LVDA 1GKRA 3NDOA 3LPPA 3W37A 2ZXQA 1EP1A 3W00A 3CAKA 3LXAA 5EMMA 1ONRA 4ERGA 2CHRA 1SR9A 4AF0B 4M81A 4RZ6A 2VFIA 2DUZA 4O1EA 1JDEA 2BVTA 3O7UA 4GQRA 4GD0A 4DRSA 3XINA 2JF6A 1P0KA 5EMLA 1JQXA 1J0JA 3WQDA 4DJED 3NL3A 3UYIA 5G2HA 1V3IA 5A8QA 8RUCA 3G1HA 4GX9A 1E9YB 3VIFA 4KEMA 3QTGA 1X8CA 2YB1A 2WMIA 2X1UA 1WBHA 2PDBA 5CZKA 4I9AA 3V75A 4Q7BA 1XD1A 1QCWA 3W07A 1DQWA 4Q8OA 3FOKA 3BSHA 3ZR6A 2VZUA 4Q4PA 3QQ1A 3I3EA 1F2JA 4D6HA 2BHUA 3N3TA 2JBMA 4MB1A 5HMFA 3AC0A 2XWEA 4XO6A 1W6TA 5EB8A 2XH0A 4Z2JA 1JZ3A 4QE1A 3BWWA 1TWIA 5F7UA 3GUWA 3U5UA 4A05A 1H11A 4W7VA 4AWUA 5CPLA 4YVVA 5LHEA 2W6RA 3W2MA 1DE6A 1CXLA 1PO9A 3V0TA 1N8WA 3K5XA 3H8AA 2YDQA 1ZCCA 1YDYA 2X40A 2V2CA 4I7UA 4QE4A 3WNPA 1TREA 2XVGA 3B05A 3VIHA 4MNLA 1UWQA 2VURA 1T96A 1CT5A 4ICCX 4JNMA 2C0AA 1FWRA 2ZTJA 3PJUA 2R8WA 3SIZA 2A3LA 3DHUA 1HJUA 5IBXA 4WDUA 2BXVA 2PTDA 4GOAA 3TN3A 1B1YA 3S2MA 2X41A 3SGUA 4ACYA 4KFOA 2EG7A 2MUCA 1W8SA 2OWCA 1KCZA 2Y5JA 4CVUA 1Y5VA 3BAJA 5CZJA 2IXVA 3VE7A 4O0KA 4ZB0A 1OYCA 1WKYA 4D71A 5BXRA 3OVQA 3CUXA 1BLIA 3A4JA 1T6MA 3GHUA 4HN8A 3NJ3A 3WH5A 4AZ6A 2ZKMX 1W2VA 4LT9A 5EL1A 1K03A 1UMYA 3NDYA 3CMJA 1GVYA 3DUGA 4H2HA 4F0SA 2JIEA 4LUTB 1XYMA 4O19A 2D2HA 1MRAA 1GPFA 2BGSA 2CXEA 3UG5A 4H8HA 1CI1A 1XQLA 4N6EA 2J27A 3KWSA 2V9DA 4CQDA 3LCIA 3QQWA 1W9DM 3GHRA 2XSXA 3GUGA 3ZFHA 3ONCA 2GDUA 1G6CA 1ISYA 2B81A 4QDWA 3OOQA 4RPPA 3RM4A 1ME7A 2PDFA 1LUCB 4IXHA 4PZVA 1UR4A 4NXKA 1EPXA 3URAA 3VNKA 3I7RA 2AGTA 4KRZA 3PSWA 1UD8A 4OV4A 1X1ZA 3R0KA 4QLKA 3S46A 4KWWA 4H41A 3WD0A 2J9ZA 1FTXA 4CQCA 4UTHA 3N2MA 1BRLB 2PA6A 3UETA 3ARZA 2PUZA 2F7FA 4G6CA 1UQZA 3O9NA 3PNZA 4CD4A 1IR2A 3TTEA 1NARA 3RR4A 2DSWA 2PWUA 4GXMA 3C61A 4O16A 2YBVA 3TAKA 4L80A 5HMDA 4E2VA 1IEQA 1RJQA 2X1TA 2GGJA 3BAYA 5D30A 1TIWA 2PRHA 4ONVA 1Z42A 4ZQMA 4O4WA 3R94A 4GUJA 1B4KA 1YPIA 5DT7A 3H22A 4UTKA 2F2KA 1XGDA 3MUY1 2VWSA 3VAVA 1AK5A 3O6DA 2OWWA 3M16A 3GZAA 4B91A 3MP3A 1OCBA 1DJIA 3REQB 3LS9A 2GGEA 1HKIA 1ZU8A 3LYEA 4I7WA 2FMOA 4C1KA 2OYLA 4CN6A 3G1YA 3CV6A 1TE1A 3BGAA 4J28A 4YIWA 3GKFA 3F03K 1QNQA 1NFPA 4NNBA 4M24A 3GFXA 3EWZA 3OGRA 1PPIA 1NELA 1V6UA 2V2HA 4GZ7A 3GO2A 3DG7A 4O1FA 2DH3A 4D6DA 3CUHA 2QIIA 1K9DA 3N2OA 4PUEA 3W1AA 2INEA 2VGFA 5F2GA 3L4TA 2VTFA 2X1RA 3VKKA 3CZLA 2GQ9A 1Z41A 3EA3A 3GKAA 4EXQA 3WENA 1TCDA 3AZTA 3V4BA 3B0XA 3NG3A 4E6MA 1E73M 2EBNA 3S42A 2J13A 1S2TA 4B15A 1VENA 3BGJA 1EJUC 1T5AA 2AQVA 2P3EA 1XYFA 4RZ4A 2PWHA 5KZDA 4LH8A 2R6OA 3GC5A 3E0WA 1EF3A 1KRCC 2ZRXA 1UKOA 2IUZA 2RAGA 4PCSA 1KWKA 1VCGA 3CL6A 3TDFA 1AQMA 1K3UA 4WSHA 5HJYA 3C56A 1VZWA 3C86A 3MUCA 2PWGA 1B30A 3QPYA 3TFCA 2C13A 1SJCA 4IMAA 1HJVA 3CK5A 3SEPA 3NL5A 3PHAA 3V5OA 1MW2A 3NOEA 2CZEA 2QW5A 1O95A 3TV8A 4Z2GA 4LEFA 5LA2A 3D46A 1ZBKA 4KMQA 1UH4A 2J75A 3LQGA 1W3KA 1R5YA 1MQQA 3CPGA 2OLAA 4JY9A 2TPSA 3XISA 2Q8ZA 3AMCA 3BAIA 2Y70A 3O16A 7CGTA 3H4WA 1Q6CA 3UZ5A 3NPVA 1TZZA 4GUIA 2PDNA 1GW1A 4DELA 2D0FA 3UJRA 1GHRA 3U6WA 4NP7A 1E15A 2NUWA 5GQBA 4PMQA 3IARA 1UR1A 4FR1A 5L6UA 1UBPC 4IFKB 3WNMA 5CSRA 3R4IA 2HVOA 3W01A 4AIEA 1KFWA 2VWTA 4WKFA 2R24A 3UU0A 2BXZA 4E3VA 1H1YA 1B9ZA 1ZENA 2V3GA 2E8ZA 3DZ1A 4BA0A 4E4UA 1ME9A 1PIIA 3RUBL 1W3NA 5H8MA 3ZWSA 3RR1A 1NVMA 4L4PA 5T9CE 1CZ1A 3SCUA 1CPUA 4DM1A 4J3UA 1E4IA 4R7JA 1HXJA 1B31A 3S6OA 2J66A 4CCEA 3RDKA 2CBVA 2QVHA 1YTKA 2RJGA 4JTAA 4C6DA 2ZOXA 3WUFA 1K7EA 4LBRA 4IISA 1Y0EA 2BXYA 2OLSA 4JD4A 1ADDA 2QJIA 1P4CA 2GUBA 1DIKA 3I6TA 1MFVA 4GXPA 2NX9A 1TR1A 1JPDX 3VGGA 1EJSC 3RLUA 5KZMA 3B9OA 3BLKA 3CC1A 3F5KA 4Y9NA 3WLQA 4GZEA 2V68A 4AVOA 3NZGA 4DUOA 5JBDA 4EPEC 4LYPA 5JMUA 1IIHA 3R12A 3O06A 4C5YA 1KM6A 3B97A 4GUFA 3FLUA 2WLZA 1OWQA 4QEEA 3N9RA 3W7EA 1X1OA 5BMWA 1DIDA 2O7SA 3SB0A 1E56A 1S5MA 1TCMA 1OF8A 1KQZA 3NQMA 3NNTA 3KCLA 4FX7A 2YA0A 1J4EA 5TBOA 3TMLA 1G01A 1KKRA 3M0YA 4S3GA 4I6VA 3E0IA 4FF5A 3KLLA 1FUYA 1OJXA 3V35A 3W7HA 4PUNA 4W9TA 5K4ZA 1MDLA 5CGMA 4OU1A 3S1WA 3ITTA 3PULA 3QOMA 1WZAA 3MHUA 1FCVA 3MCOA 3R89A 4LRTA 5C9RA 1ITUA 3H2FA 5I79A 1GQKA 4CLMA 4EPBC 3MV11 3QF0A 3ANVA 1R6WA 1R7AA 4ALDA 1RVKA 5DLCA 3LI1A 1OY0A 4AY1A 3MHFA 4CD5A 4IIDA 2XVNA 2D22A 1GG0A 2DZUA 4I9MA 4G1NA 4H19A 1Q6RA 3QV8A 3W84A 2ZCGA 3DFHA 1US0A 1AJ2A 1TO3A 1YXYA 4AWEA 3EXTA 3L66A 2X7VA 4CN1A 1JDFA 1OSEA 1WA3A 4Q8VA 4PTNA 1MNSA 1X96A 2FHFA 3BPWA 4YCPA 2WO5A 3ICJA 1DXFA 3APYA 3PUEA 2A3EA 4QAIA 1XINA 2Z24A 2BG5A 4K8GA 1AZ1A 4BI6A 1UQYA 3AALA 4GK8A 2E6YA 3GTIA 2TAAA 1EJVC 3DC0A 5AYZA 1HO4A 3MO7A 3AMLA 1XBVA 4K39A 4AF0A 1V5XA 3GY1A 3CYJA 3BLDA 4WOZA 1J01A 2AQOA 3MSRA 4MM1A 4LYRA 3CLWA 4AZCA 2XSBA 2VOTA 1KA9F 2V6AA 2EJ1A 2VQUA 5LZLA 1A47A 1J12A 4GCXA 4ZFCA 2FJKA 3ZT6A 1D7FA 3Q37A 3ZR5A 4KCWA 1JVNA 1EA9C 4L61A 5FEXA 3U2CA 1TTPA 3O15A 4LF1A 2W67A 4MSSA 3UJFA 2YXOA 3TWAA 4H9UA 4LCQA 2J6VA 4N02A 3HJEA 1TWWA 5DMMA 3ENLA 4X9YA 3MI6A 1UROA 3VIPA 3CL7A 1UIPA 2ZA2A 2WSKA 1JYXA 3VIKA 4DHGA 1THFD 3I10A 4YTQA 4KPLA 4GNJA 1VPQA 3NXLA 1OIMA 1Q45A 3TMQA 2DW6A 2GVJA 3TZNA 3GIPA 2Z6JA 2W79A 1I60A 4H8VA 2PC4A 3L5AA 1X6NA 4S3BA 5K9XA 3QV6A 4HBKA 4IMDA 1AA1B 1P5BA 3C2EA 3W2JA 1B90A 1ECQA 4O11A 2E0PA 3I6EA 4JN6A 4PEKA 5LA0A 2VDHA 2GL5A 1NH6A 4MKNA 3L4VA 4UQEA 2O0TA 2RGLA 3ZWTA 3MMUA 3GBEA 3DESA 1MEHA 1SW7A 3UWVA 3S5NA 1DHKA 4OWGA 3BLOA 3VIOA 4E8CA 4RW5A 1B3YA 2ACQA 4H01A 2OYKA 2F38A 2DEPA 3JRKA 3QR0A 3L5MA 4AH7A 4WXYA 2OZ8A 4C60A 4BFAA 3QN3A 3WEOA 2XFWA 3LXBA 1XGEA 3H4XA 3WL1A 3MCMA 2ZADA 3BANA 1F3XA 4ZB2A 2ICSA 1M53A 2YPIA 2JIWA 1KGUA 1TJ1A 3SRHA 3STCA 3SSJA 1UUMA 2W62A 2X09A 4S3DA 1F8IA 5AYYA 4S3CA 5FJRA 5LXXA 3UA4A 1DJZA 1WKFA 1OYAA 1E1EA 4M0XA 2ISFA 4M7SA 3IUDA 3STFA 2BASA 4PRTA 3KBWA 7ENLA 4M3PA 3IAPA 4MG4A 4Q4OA 3GXTA 2E68A 2QPSA 5AZ1A 1W1A1 4LJ3A 4QDMA 4IF2A 3QGVA 4D6IA 3F5LA 2ZZ5A 4QGCA 5G4EA 4WJ8A 3H4GA 3WNLA 4OQVA 3QY8A 3S6DA 2PU1A 4JN8A 1NP0A 2PWEA 1ZJHA 4XBSA 1VPXA 1P48A 1ADSA 2EPOA 3W73A 1QO5A 2DZXA 3DFPA 2VM8A 3CS2A 5CSSA 2C16A 2GSHA 2QDGA 4YTTA 3MZNA 1M7OA 4RX0A 1XIMA 4O10A 1RALA 3TCEA 4B5XA 3TYDA 1SMAA 1FHVA 3PZQA 4J7RA 1XFBA 1I0DA 2E77A 3WMCA 2H9AA 1UP0A 2EJAA 3ITCA 4O57A 3UZYA 1E6RA 4IPJA 1TA3B 2RGMA 4IJRA 1OX4A 2HK1A 3UW6A 4EKJA 1E9LA 3AIWA 1UYQA 4RKAA 3ZYZA 5A3HA 5JBFA 3W1NA 3G2GA 3VOIA 2PEVA 1XLHA 2PGRA 3S4TA 3ZJ6A 2PURA 3E2QA 2QF7A 3VOFA 3G1DA 1XLEA 3GVGA 5HUPA 4J4KA 1F74A 4AMAA 4UQBA 4JIPA 2Z1BA 2PGFA 3OP2A 2Z25A 4MTVA 1SO6A 3LZ3A 3VKDA 4FK9A 3A5VA 3GTXA 4WUIA 4IHCA 4DO7A 2BVYA 3P14A 1KBBA 2JKEA 4F40A 3E12A 5G2WA 2TMDA 4GKLA 4AHQA 2X2YA 3NDZA 5C2XA 2C15A 4PL2A 3RF9A 3T0BA 2QJJA 3AHZA 3BUVA 3IV3A 3DDMA 2VMFA 2ASHA 4ZO7A 3S6TA 1QWGA 1C7TA 5BU9A 3A4AA 3ITLA 1LTDA 3VIMA 2OX1A 3HG3A 1XIHA 5I3DA 3PPGA 2HISA 4ZTXA 4XQ6A 4NI8A 3ZXWA 3AHYA 5JXQA 5D32A 4ZQNA 1SW3A 1YDNA 3NZRA 4W5UA 1H63A 1O66A 4P8XA 5K7JA 3PUDA 1UH2A 1W2PA 4XD5A 2ZX5A 1BHGA 2NSXA 2ZQ0A 2PDLA 3FJ6A 3I7SA 1RLDA 5CSUA 2W66A 1V3JA 3EOLA 3CQJA 4TVDA 4IMGA 2VEFA 4UMBA 4LALA 3OIHA 4CEUC 4TOQA 4FHAA 4LAUA 4P7RA 5BXSA 3TYCA 1O5XA 1FWFC 1V6WA 3W7NA 1QBAA 3EKZA 3ARTA 4K37A 3RXZA 2C71A 5LGZA 3WYZA 1TUXA 1OFEA 3TYUA 4JY8A 4NVTA 2UY4A 2CLLA 4GC3A 4GI4A 3IJIA 5D4YA 3UT0A 1EBHA 5E6ZA 1F05A 2RFGA 4Q4QA 3EOUA 1HJQA 2YJQA 2FIQA 2OSYA 1B3ZA 1VB9A 3BDKA 2BV9A 1OC5A 3CUFA 1AJZA 4Y8FA 4AEFA 3HG5A 4NL1A 3HPZA 1DTUA 3WLKX 1PIFA 1GEQA 1Y8BA 1EYWA 4F0RA 3R8RA 1RPKA 4IOTA 3TW6A 3WJZA 1BYAA 1R85A 2GSJA 3NUKA 4AD0A 2PZNA 1K8ZA 4L4LA 5A6BA 3SJNA 1KRMA 2DZWA 2PCQA 5HQMA 3WBEA 4CQ9A 5M2FX 4NYUA 4DO6A 3K8LA 4DB7A 4DZIA 1TTIA 5CZTA 3FW6A 3KX6A 2PF8A 1JZ2A 3KS6A 2ZX8A 4HZ8A 5G5IA 1WQ5A 2CLOA 4DLFA 6A3HA 3FA4A 3VGEA 4LQ1A 4ROQA 2A7NA 4H9TA 3U7BA 5C9ZA 4FX8A 2CLFA 3WSUA 1GVEA 2PDMA 3W6MA 5CPQA 1OK6A 2GQ8A 3NEVA 1XCXA 1AQFA 5MKGB 2QCDB 1KR1A 1VYPX 4N9DA 4RDVA 4GO8A 4RLIA 2XVPA 3DGRA 4ZCWA 3N4AA 4GX8A 1QNPA 1FXPA 4W93A 3WLOA 5MHBA 2HROA 3MHGA 1UMLA 4Q8QA 3R2GA 1U22A 1FA2A 3R0UA 5LNUA 2IQ0A 2Q6ZA 3GG7A 2VX7A 3GHTA 1H1NA 3GVQA 3CAWA 5HNTA 1MYRA 3UP8A 5KITA 4Q22A 3PSVA 1ZQ5A 3BLPX 3B9EA 1PZ0A 1UW9A 1XHGA 1DWAM 2I9UA 2G3IA 4CQAA 3PPFA 3HBLA 4X61A 2HE8A 4JYEA 2WAGA 1FP8A 4HSOA 4AWSA 2XGIA 4HA4A 2ISVA 4FI4A 4IFKA 5I6SA 3G77A 1BSIA 3P5ZA 1TRDA 3WLNA 1TV8A 4PFMA 4C7FA 4PUJA 3DBPA 2WXDM 1BF6A 4LCSA 1C8QA 4RW3A 1OCJA 2JKPA 4PUDA 1J6PA 4C6OA 1M9HA 2VVNA 4XAYA 2W92A 3GVRA 4TV5A 3WKZA 1UR8A 1E70M 1I1WA 4UB9A 4JCMA 2VCCA 1UD3A 3TA9A 4WSKA 2XZ7A 4S39A 4PE8A 4GI9A 1OFDA 3S0CA 1R9XA 3MMWA 3MWCA 1DJWA 5IFPA 1EXBA 3MYPA 3RLGA 2ZDRA 3DFQA 4CQ8A 1H50A 3PK7A 2UY2A 2WNZA 4LU0A 5CEWA 4PULA 3KOYA 3KZPA 4RV8A 3VFLA 3QPEA 3UVIA 2I57A 3AISA 3PUGA 1H0IA 1RBLA 4Q7NA 3AU2A 1UZHA 2VYOA 3FDKA 2FZ9A 4B5UA 9XIMA 4J35A 2EXOA 2HEJA 4K7YA 5T26A 4AB4A 3MSYA 3MDUA 3T2PA 3EAUA 3TCSA 2DH2A 4GISA 4Z08A 3AIQA 2Q01A 1YPXA 4ZQOA 1EOKA 4KWOA 5A8OA 4X22A 5AFDA 4GYJA 2YW3A 2CBIA 2PDXA 2GDVA 4KEUA 4XAGA 3T2OA 5J8LA 3O05A 4PMVA 3T0CA 5DMNA 3N15A 4LBSA 1RA5A 2UZ9A 1L2UA 2PDHA 1UWAA 5J5RA 1WDSA 1BG9A 4HZMA 3HTWA 4O12A 1S3HA 2OT1A 1V02E 3W1TA 4P7OA 3VKBA 1JZ7A 3CUGA 3T0AA 3BJFA 2W5FA 4DYKA 4CNTA 1LCOA 1QOQA 2DVUA 4HT3A 4L6HA 4MZ1A 4KRTA 1ZAIA 4GC4A 3KVKA 3T05A 2O56A 3W2KA 4PUMA 2QDHA 3G0XA 3OZPA 2ESCA 1A5UA 2C3ZA 5E0KA 4JYFA 3L12A 2XGZA 5DF0A 2D69A 2WJEA 5DANA 2J6XA 2CFFA 4J27A 4FAMA 4HMNA 3K1GA 4KCVA 4LB3A 3W87A 4UTWC 2WJFA 3L4YA 4WKHA 1ADOA 4EVZA 5HPCA 1RCXB 4IFOA 3M0KA 1JNEA 5DO8A 4DF1A 2WSPA 1FCUA 1PHQA 1A5LC 3Q94A 3WLJA 4F4RA 1XR2A 4AEEA 1QUMA 3HN3A 2ZX7A 1XIEA 5HA7A 2ZXDA 5E0CA 3MJYA 1QW9A 1IGSA 4HMEA 3EGJA 4B5SA 3GTNA 4HN4A 2QCFA 4XIAA 2VELA 1OGBA 4ORIA 2CBUA 2P1FA 1DPMA 3MBFA 4G5DA 4EAYA 1J0IA 3EB4A 4H00A 3T6CA 2Z4GA 3O2LA 4BQ2A 5JH2A 4K7VA 3VNIA 2G3MA 2PP1A 1MFUA 3EOEA 4KWSA 3T8QA 4HOXA 1HNYA 1S2WA 2C1IA 3CQ0A 2H8ZA 3P61A 1S2CA 1ODZA 3CUJA 3QEZA 4YVXA 2WB5A 3P0XA 1LDCA 4LC8A 2WC7A 4LS0A 1YE4A 3U7VA 3GBDA 3AMKA 4F9DA 3AS1A 1K02A 3IS4A 3LBOA 3D3FA 5HWJA 2GPTA 4HNLA 2WZHA 1Z8AA 2HS6A 3SI9A 3P74A 1UWSA 1SO3A 3ITXA 3WQCA 1TKKA 1ONXA 3KXQA 3SN1A 3ZVHB 1JDAA 3W7KA 3WQ8A 3LZ5A 3GXFA 4BS0A 3UR8A 1C91A 3SRKA 1ONWA 2JK2A 2BOEX 3IK4A 1Q85A 1V3HA 3GXPA 5FJIA 2GUUA 1KLZA 2VC7A 3UPWA 4DUXA 1O5KA 3N18A 5C9UA 3BG3A 3HGSA 3KFTA 4AZ7A 3EWBX 1S1PA 4AVNA 4M56A 2W4XA 1GCYA 1Y65A 2ZZ7A 2NUXA 3OO2A 1U1JA 1RXOB 1PIGA 4LS1A 1C9DA 1O1ZA 3CT7A 3RU8X 3E3HA 1U5JA 4QCFA 3GW3A 2HV5A 5LIKX 3GH5A 2YSWA 2ZA3A 5C6MA 2PDIA 2QAFA 1AMYA 1F73A 1JZ4A 3R1ZA 1E6PA 2ISWA 1TUFA 3B8IA 5E0FA 4FXJA 4L5ZA 3E9AA 4IMEA 1UZDA 3N25A 1LG1A 4B3KA 4UR8A 1I2QA 3I6RA 4MZYA 2B0MA 2WWCA 2XM1A 3W1LA 4UFHA 2LLEA 4Q8PA 1EOMA 2V5KA 1FKXA 1FWSA 1TV4A 1OC6A 1O7AA 1E4LA 3KM8A 1W1TA 2VZVA 2VD8A 3ARXA 1S5WA 1WCGA 3BSGA 3ZT7A 4JTEA 4NF7A 1VF8A 1MDRA 2X1SA 5ABHA 2JFEX 4M6VA 4WCJA 4S23A 4R5EA 1SJAA 3LU2A 1OADA 3FDGA 1PKLA 3L2IA 3RILA 1UUOA 2W91A 1UPMB 3CTLA 4C90A 1A0DA 2Y88A 5IBXC 4GABA 4XZNX 4HVXA 1H49A 2OTDA 1B54A 2PGWA 1K7XA 1WAUA 2HK0A 2QCCA 2QCEA 3B9DA 4A29A 2I5IA 4B5NA 2IPGA 3PZ9A 2D0HA 4K68A 2WHKA 3BLLA 1HJXA 3WLRA 4ZQRA 3S83A 1PAMA 5LNVA 1NWRA 3FAWA 1MRQA 3A9BA 1O68A 1CGWA 3HOJA 1U1HA 4GWEA 1YTEA 4LVBA 1TVLA 3T42A 4E2DA 1GEHA 1XUUA 2J7BA 2VR4A 3GTFA 2OB3A 2QIWA 4AZIA 2J47A 3VKAA 3II1A 3QOKA 3R25A 1A0CA 4UQCA 3LPGA 4QSHA 3ZLGA 1F61A 2WQPA 3TC6A 1W3JA 3IPWA 3WFZA 3IIXA 3FHQA 1KGXA 4W84A 1R2RA 3R8GA 1WZLA 4P61A 1Q4NX 5AYIA 4XUGA 3LOTA 4XIMA 3PY2A 3GC4A 1A3WA 2AMGA 3IIPA 1VFHA 4QDPA 1EYEA 1XIDA 1S46A 1N82A 3MI3A 4EPDC 4U4MA 2WC3A 4HNOA 3LCFA 2GGHA 2DUAA 4NSBA 5G4HC 1QPRA 1XIFA 4Z2IA 1UCWA 2FPTA 1O12A 4O1AA 1IZKA 1TV5A 1XG3A 4XSMA 1OYBA 1WO2A 1DWFM 3MUXA 4Y8EA 1PTGA 1JPHA 1T8QA 3L0NA 3PZNA 1PEZA 4PC8A 3B06A 1C8XA 1W5OA 4UFLA 3B9NA 1X1NA 2TRSA 4LAKA 4H6RA 4GYPA 2J25A 4J3TA 5HPOA 3L65A 1MNZA 1HP4A 1G7VA 1G9HA 4OBSA 2WV8A 1EWEA 3MKVA 1XS2A 5BROA 4Z2LA 1XW8A 4NY2A 1EHNA 4Q4MA 2YFNA 3IAQA 2G4JA 2FQIA 3UQNA 1D9EA 3HG2A 1X8FA 4JEQA 2P50A 1SFTA 4O17A 3UESA 2DDXA 5LIWX 3HPAA 1E6ZA 1VEMA 3GU9A 1TG7A 2O55A 5I5RA 4G1KA 3VCRA 3GXDA 4H4IA 2ZC8A 3HQ1A 1J2BA 1TWDA 4BWLC 3S5ZA 1FBAA 3VC6A 1W32A 3C0SA 2QUVA 1KM1A 3SAZA 2OCZA 3LEPA 4JDYA 2DU2A 4IPNB 3V5FA 5HQLA 1EZ2A 2CC0A 3DOPA 4H7ZA 1GQLA 5HATA 5JH1A 1ZGDA 1F3WA 4DYJA 3B04A 4UOQA 3B0UX 5BU6A 3M6DA 4PRWA 1LRQA 3IJ7A 3MPGA 1K8YA 4L1WA 4PBGA 1BXBA 1HL8A 3NYZA 1PCKA 3GAYA 3OTRA 1TPWA 3EEGA 3DAQA 2I16A 2OU4A 5FSDC 3S8HA 2YX0A 5CAKA 3AU6A 3CBWA 4QHRA 4C1NB 2RDWA 4BI7A 4HOZA 1AFSA 1HIZA 3B8DA 2HVNA 2CIPA 4QX4A 1SJDA 4XD6A 1VLWA 1ZJBA 3LSCA 5A6LA 1CXEA 1DXIA 1S5NA 2ZE3A 3ZM8A 4EWND 4NYYA 1E9IA 1EIBA 3NXFA 1XPGA 4PA8A 3QH2A 2IKHA 3DG3A 2O92A 1ZJIA 3QLDA 3WDHA 1R3RA 1QHOA 1RJRA 4CVWA 1P0EA 2D73A 3H26A 5FF2A 1ZAHA 1OFAA 4HNNA 4GRSA 4UNKA 2OYMA 3O63A 4G7EA 4FEZA 3ONBA 4PR4A 4FZIA 3OVRA 4CU8A 5A1AA 3U4FA 3KBVA 1W3LA 4FOKA 1B9BA 1KFBA 1XV8A 2AKZA 4ATWA 3F4VA 3UG4A 3KP1A 1WDWA 1FWWA 3REQA 4Y7EA 1OB0A 2B7OA 1RSCA 4MAVA 3CV1A 8A3HA 1UC5A 2NZLA 1DBTA 4I8DA 3IJLA 1Z9AA 2DZAA 5LIUX 1LROA 2Y7EA 1Q8JA 1IYXA 3VKCA 4RCXA 5TQLA 4IZGA 3UERA 1LORA 4GYFA 1FFQA 1FDZA 3COTA 1Z32X 4CNSA 2BVDA 5IDZA 1AMKA 2R82A 1KTCA 1K9FA 1P6CA 3ISIX 1HF6A 3KBMA 1FWJC 5A8PA 3E0LA 5D02A 1KB3A 1IXOA 2ZX6A 1Q7ZA 1JCTA 2P0OA 4IICA 3G1FA 2QGHA 3CQIA 4JPGA 1Q2RA 1JULA 3HMCA 1TZ7A 3N12A 4A35A 4ENLA 3GDLA 2XZ9A 4BK9A 1WDQA 3BZJA 3WDIA 3ZMRA 3GNNA 4HNCA 5BNKA 4NU7A 4S2CA 1O4UA 3ARVA 3W1PA 3F2DA 1CXKA 3LV6A 4DXXA 4WDXA 4MHBA 3GDBA 4ICMA 4B4HA 4AFYA 4F0MA 1UOKA 4XZHA 1XLGA 3GNDA 1ZTVA 3F4NA 2Y2WA 3FV9A 4AWTA 6REQB 1H1ZA 3QC0A 2YDRA 2PZ0A 2BGNE 4ZODA 5REQB 2UWFA 3BV7A 1W1PA 2G3NA 2PLJA 3H2CA 3PUOA 5IHSA 5F4XA 4P7LA 1NF0A 1J6OA 2Y6ZA 2Z0IA 2VDIA 4LBUA 3T44A 1KBKA 5CAHA 5DCDA 2YDSA 3VO0A 2DZPA 5C54A 4IH3A 4ZMGA 1TFVA 1KFCA 2FVLA 1H5VA 2DSVA 1GJUA 4GJIA 1X7IA 4ZR8A 3O1NA 4BQ4A 2H3BA 3CPUA 4F0HA 1MO0A 1PBGA 3BLFA 4W7WA 5DRCA 4HU8A 3IGSA 1EP3A 3S5SA 1XXXA 4GGHA 4NZ3A 3TOPA 4L6DA 3AIUA 1TX2A 2VO5A 4A3YA 4D6FA 4DF0A 1XSKA 1ZSXA 4Z1BA 4WOQA 1FH8A 1HGWA 4L1XA 5F4WA 4Y9MA 3M4HA 1GORA 4RNHA 4WY0F 1WX0A 3N04A 1AH0A 3CHVA 3VX1A 1H4PA 3UR7A 4WJEA 3GC2A 1DYSA 4KWVA 2JF7A 1HL2A 4BF5A 4HA0A 2EF9A 1PZ3A 2Z26A 2FZDA 1R7OA 4GMEA 2BSLA 3SCNA 1VYRA 3VNDA 4KGLA 3EB2A 3UCCA 4LB4A 4JQ2A 1E1CA 1CGTA 4CUCA 1XX1A 4H9ZA 2BOFX 3MP5A 4OE7A 4WDTA 1VFSA 4LVFA 1V02A 2D24A 5D38A 5FJOA 4DQWA 3E5PA 3VNZA 4MKSA 2BB0A 1FVPA 2DZSA 4L9ZA 2NVCA 1PUDA 4UNIA 2H8XA 3TK7A 1TPB1 3DC8A 4K2SA 2CZVA 4JHZA 1EF2A 1NDZA 2HJPA 2QQ6A 2CW6A 2REQB 4XD3A 1BKSA 2YYTA 1KC7A 2WVTA 1OX6A 4Q6JA 2J7GA 3PC0A 5LYRA 1MZRA 3DERA 5HMEA 3TA6A 4FALA 2FH8A 5JBEA 2PWVA 3PTQA 1W91A 4K3ZA 3KRBA 1RCQA 3QKEA 2FGBA 5LKYA 1C8VA 4EK7A 3ITVA 4NG3A 2ZX9A 4YNGA 2Y8UA 4GI6A 2I56A 3V5CA 3IIOA 1MW3A 4PBEA 3BLEA 3QZEA 3RRXA 3W1XA 4O1CA 3RAOA 3VD9A 4YHEA 1TTJA 4NJGA 3K4WA 1XG4A 3EPOA 3BXWA 1E43A 4I9TA 4UQ9A 1TV7A 3V0SA 3LV5A 1VPYA 3BMXA 3KRSA 4Z42C 1QK0A 2DPEA 2YGYA 1OBAA 5CSYA 3HIJA 4C6IA 2Z7GA 3CIVA 2OEKA 3CV2A 3WLHA 3WQ5A 4IPLA 1M7XA 1EZWA 3H7UA 3NAVA 5LNRA 1V77A 3FFSA 3ID7A 4CU6A 1OCNA 1ODUA 4Z17A 4EOUA 1XRFA 4X9SA 2GOKA 3CUZA 1QI2A 1RQEA 4JXCA 2VEPA 4Q7IA 3FKRA 4RNIA 1LWJA 5KTLA 4O28A 1XPYA 2ZYFA 5HNUA 3UCDA 1H62A 3UG3A 4ZOBA 3LCWA 1E0XA 4HPJA 3CAQA 4MMWA 4Y9PA 3TTSA 1GOQA 2Y5SA 2QCDA 1B3OA 1PZ1A 2HS8A 2WHLA 1EQCA 2E5CA 5AC6A 1PYFA 4RXFA 2ALRA 1X7FA 4NXSA 1FWAC 5D9NA 5JU6A 4YL2A 4O52A 4XVEA 3OYXA 1YBQB 2DT1A 1IXPA 3FGCB 6TAAA 4KCTA 4GNKB 2XUCA 4QG8A 4GIYA 1IWBA 4ZO6A 4ZTYA 3NQ6A 4W5ZA 1JXKA 1SR0A 3VGHA 3G0SA 1QHPA 3FS2A 2VRQA 1P6BA 1UWRA 2OVLA 3DI1A 2QCHA 1JEZA 2GFTA 1GPWA 1RD6A 3SO7A 4NZ5A 1RCOB 1TVNA 3VD3A 1JJKA 4PH6A 2VHLA 2VJXA 1OD0A 3QHNA 4GIAA 2H3DA 3WCZA 1DV7A 7XIMA 1DWGM 4QG6A 1W3HA 2PF0A 3PZVA 4A4AA 3KCJA 3C2VA 4H6KA 2WSRA 3L2MA 1EEPA 3R11A 5ABEA 4GLEA 2VC9A 1YEYA 5C2CA 3T7VA 4ZOAA 1KBIA 4X0NA 1BQCA 4H7VA 3AJXA 2XISA 1LL4A 2G0WA 1QNOA 1NOWA 5BOEA 2YCLA 1GQNA 4Y9AA 1OFOA 8XIAA 3MWAA 4NJHA 4TX9A 4DNHA 2F6XA 3TVAA 2NX1A 4ZSUA 3KBSA 3SUTA 3TZFA 1LP6A 2CZ5A 2TYSA 4J40A 2ZA1A 4WQ6A 4YTSA 1JNDA 2WSYA 4L64A 3OZMA 1XC6A 3NR0A 3WH8A 2WVVA 1MEWA 3S1GA 4PRRA 5DX7A 3AFBA 3AS0A 5DMLA 1NDYA 3AMDA 5I23A 3P2VA 5F2MA 2WCSA 2ZRYA 3PVFA 1ZP4A 2OT0A 5I3HA 1JI2A 4PMDA 1ESWA 2F6KA 2QPUA 1UJQA 2R9RA 4H6QA 1FH7A 1FY6A 3C2YA 1HGYA 3GK0A 2G50A 3TSMA 1U33A 1HKKA 3HURA 3OU8A 3IACA 1FWHC 4UZSA 5HR7A 4AX7A 1E6NA 4CD7A 4LAMA 3I68A 3U0HA 1F4HA 1TZ9A 5EYWA 3P93A 4KWUA 4MUPA 3UCQA 3M0MA 4L56A 3OLIA 3EXRA 3TWBA 3W75A 3NZQA 3W2UA 1JXJA 4XWUA 1QVBA 4KFPA 4AYGA 5JUVA 3QYQA 3T8LA 1M01A 1BXNA 2X42A 1BEUA 1KFLA 4BZYA 4NRSA 4JIIX 2WBKA 3BO9A 4RNFA 1B3WA 1XLMA 1PDYA 1VRXA 1KFEA 3AZRA 4UFMA 2OSXA 1KXQA 4PMUA 4CD6A 3WK2A 2A79A 2ZWYA 4JX6A 1AH3A 4HNUA 2PLKA 3E6EA 1U83A 1D2KA 2V3DA 5CKSA 5EY5A 3WD4A 3BC9A 3OGSA 3VE9A 3O0FA 2I17A 1ISXA 4FOUA 3CWNA 3EEZA 4IIBA 1KCLA 1RK6A 4B2DA 4WSJA 3G1RA 3VGDA 3WBYA 4ZE4A 3H53A 3RMJA 2Q71A 2GK1B 2WMGA 4WX2A 3G8RA 2J88A 1UHVA 1QPKA 3D5HA 1U30A 2ZUUA 3TJXA 5C70A 2VNCA 5CBBA 5ABGA 4IFRA 3SGGA 1K9EA 4TX8A 4DAFA 5A6SA 3RG6A 1RAKA 4JR5A 1PSCA 4JAWA 1XLBA 1ZZMA 3K4AA 3TN6A 1WAWA 3PPHA 3GZ3A 4DLMA 4L9YA 2VDGA 1RPXA 5CH9A 5FACA 1UR2A 2PP0A 4V1YA 3V0UA 1YPFA 1VYSX 1GT8A 1GNXA 1JZ8A 3U2EA 4IP7A 2C19A 3W7IA 3H2NA 5U7SA 4CN4A 1P0BA 1W3TA 1ZY9A 2Y63A 2HDJA 4MWAD 4C6LA 5A2CA 5GNYA 2QJGA 4EANA 1HUVA 3KOFA 4HZ7A 1YE6A 4I5UA 5D09A 4A22A 3UWEA 4LV4A 2BHYA 3KUMA 3E0FA 3BJSA 4LAOA 1R3SA 9RUBA 3ZJ7A 1YMYA 2Q02A 2G3FA 1UP3A 2FB3A 4UTUA 1MQPA 1ZUAX 1EWDA 4KERA 1TYGA 2GQ3A 5D05A 3W88A 3N19B 3W1QA 2ZZ2A 1NFBA 1L6FA 3KRZA 2VENA 1BD0A 4N42A 1LJYA 1N2VA 1TMHA 1ZFJA 4INFA 4N4PA 2ZICA 1OG6A 1V93A 3WZ0E 3NM1A 3NQVA 3P60A 4NIRA 2YL9A 4GGBA 4UUIA 4YCOA 5KINA 3L0GA 2P0IA 3F1QA 1J93A 2O9PA 1D3GA 4MB5A 1KFJA 1Q8AA 3GXIA 1CXFA 1RBOB 3LCHA 1J0HA 1K6AA 2V69A 1ICQA 1TJPA 1E51A 3WDQA 4K8EA 4FXRA 1C9WA 4AIBA 5D2VA 1LBLA 1C3FA 4PCTA 3PZIA 4R85A 2D3LA 3ANYA 4K1GA 3K1DA 3N73A 3N2TA 2X0YA 4WLCA 4Q8UA 5FSEC 4GIRA 1QBBA 3F4DA 4HU0A 1GTHA 4WGHA 5I06A 1YLVA 3MS8A 1VFFA 1Q5MA 2AOSA 2XN0A 4GY0A 2CETA 3SCWA 3GVWA 3OLEA 1XRSA 2D1ZA 1GOWA 3TW7A 3WMBA 2D2JA 3I4KA 3M0IA 1JCXA 3VGBA 3BOFA 3HZ3A 4J9JA 1NWTA 4QRNA 4WIWA 5HJLA 5IFTA 5AKQA 4LGXA 3GR7A 3M07A 1UJPA 4HK7A 1TWSA 4M51A 3PZTA 1UPPA 1SZRA 1G0CA 1CB2A 1A80A 3QKZA 2NVDA 3SQMA 3RNDA 3MDWA 3QW3A 1N55A 3RFAA 2PBOA 3PJXA 3P0WA 4AZGA 4HYWA 5C8BB 4W89A 1XYZA 2XIJA 3FVDA 4UMAA 4WY0A 1PE1A 1FWNA 3LG3A 1XLCA 4MB3A 4QEHA 1JGMA 3RPMA 1OFPA 3NFUA 2VFGA 3J7HA 6TIMA 1HZYA 4AZCB 4H2CA 3W7QA 2ZTKA 2HMCA 1GJWA 3LGGA 2PRLA 3IVTA 3TXZA 4MY8A 2E5BA 3GR8A 2VKZG 1P1XA 3BOLA 1PKNA 1ZBVA 3H2AA 4F79A 1KO0A 2DY3A 2YKKA 2VOMA 4QS5A 5AN7A 1EGZA 4IQDA 2I14A 3URBA 1NWSA 2BTMA 4ZOEA 5I3FA 3CU2A 1EA0A 1ZL1A 4D6CA 2VR2A 1WBJA 3UNTA 3GS6A 1P1MA 2QYGA 1V79A 4GINA 4JFTA 2Y85A 3UG8A 1WYIA 3RCYA 3PJWA 2E25A 1L6YA 2Y4SA 4AC1X 1D3CA 3KRUA 2VX4A 4O15A 2QV4A 3IJQA 3AWOA 1SUXA 2Y1HA 1GOKA 4PTVA 2GSEA 3GDKA 3VU2A 1YXCA 5XIMA 3MMDA 5MF5A 3STEA 2NX3A 4A8LA 3Q58A 2FGZA 4ML9A 1X97A 3N34A 2CPUA 3SDOA 4GFIA 2WZMA 2IKIA 4Z0JA 3QV7A 1QXLA 4BQ3A 4GACA 3W7DA 3LM3A 4BI5A 3KAOA 2HSAA 5A5WA 1H60A 3W72A 3K2GA 3FXGA 1EJTC 1OX5A 2PDCA 1GVIA 5DY2A 1AD1A 1Y7VA 3ZJ8A 5CGTA 2OQHA 2YBTA 3QZ6A 3THCA 4LUSB 1SO4A 5H91A 5FL1A 3UGVA 4JTKA 3GTHA 2NXGA 3GDTA 4GH1A 3QTPA 2ATMA 4GJ1A 4BR1A 5HNNA 5DELA 1PXGA 4WJXA 2W63A 3BTNA 3NVDA 5M5DA 5G1MA 3V1HA 2BY2A 1L8PA 5HBFA 3SBFA 4IPIA 4TTGA 4JNZA 3M1ZA 4FLOA 3VMOA 3WH6A 2YCLB 4F2UA 2PPGA 1O5QA 3KE0A 3KHJA 4U3AA 2VRKA 2BVWA 1NSJA 4TMCA 2WYSA 3A3XA 3IJ6A 4RDZA 3WY1A 3P5YA 2WM0A 5CLWA 4R27A 3H7VA 2XH7A 3BH4A 2EPMX 5K9CA 1PTAA 2YDAA 1YIXA 1Q6LA 3CMGA 3Q2DA 1CCWB 1WE5A 4K6AA 2RKXA 3MA8A 1QMLA 2E6DA 3WN6A 4I90A 2FYMA 3TSDA 3CB3A 4Z2HA 4GE8A 3WDRA 4UTTA 4P2VA 2YZRA 5FJUA 5FF0A 1XFCA 3F2BA 3W29A 1A5NC 2OO6A 3EX3A 1GJPA 1EH9A 2E8YA 2I7GA 4MYXA 3PZOA 1YDOA 4RL3A 3W22A 5LIYX 2XIOA 2VL4A 4M1RA 1NJJA 3AIVA 1GZJA 3FJNA 3LXCA 2FPVA 4RNJA 4A21A 4TIMA 3VIJA 3RO8A 3DYMA 2WCGA 1DHPA 2FHCA 4PCNA 1EGVA 4BF7A 1ALDA 3FY1A 2BNJA 3C3NA 2WVUA 3Q4DA 3VC5A 4XZIA 3A21A 1JRBA 3ME3A 4DWSC 3NTYA 2X1IA 2YCJA 2Z29A 1QPNA 4HCLA 4Q4KA 2DVTA 3N2CA 4YWSA 1IEWA 4Q3MA 5AHLA 3EXSA 4C6FA 3PB0A 4PYSA 3LRMA 4YPJA 3GHSA 3W1MA 1IXNA 4ZA0A 3VILA 4ZZ9A 5FKYA 1S2UA 4JOMA 4LUTA 1MUCA 4LXFA 4HPNA 3C3UA 2PRMA 2GJNA 3RLHA 1QNRA 1DWJM 4H04A 2CWNA 2WKJA 1GOXA 1TPDA 3JUGA 3O07A 1YX1A 1AD4A 2YB4A 2WHMA 3KTSA 1VLIA 5C9XA 4QLJA 3VM7A 5D2WA 3VZXA 5CJ5A 4B90A 4D2JA 4QE5A 1CX9A 5I7GA 2IQDA 4ZOCA 1E1FA 3WEZA 3AUOA 2B7NA 5EMUA 1G4PA 2ZVRA 3G0UA 3FSUA 2ZUNA 3CH0A 3ARUA 1E5JA 3SCSA 4C1NA 4DZAA 1I2NA 5AHMA 3OHMB 3TAOA 3DEQA 4N2YA 5FF3A 2BZNA 2PCEA 1DP0A 3TTOA 3L4ZA 3IV8A 2D0GA 4GFSA 3WG6A 5JVLA 3TUUA 4JTTA 1XC4A 1F6YA 4B4FA 4GBDA 3LY0A 2B4GA 3GXMA 2V81A 1PDZA 3HPXA 1EHAA 1YADA 2E6AA 1KGWA 3KVJA 2VZTA 3A4XA 1XRVA 4V33A 1PZ2A 3BL3A 4DM2A 1MZHA 3VDCA 1UD2A 2OOGA 1VQTA 4YS1A 3STGA 4B5TA 1XQKA 3OLDA 2INFA 3B9AA 5H1WA 3S9ZA 3JVAA 2PDGA 3WBWA 4DJFC 1OT2A 3MTWA 1A5AA 2WM1A 4V28A 3WNOA 4UTLA 4FB7A 4DX3A 3BARA 3NA8A 1HKJA 5D9OA 3I3DA 4NI3A 2XWDA 4X2PA 3NQ8A 1H51A 3LPFA 1V4YA 3S3GA 2A1YA 2P8CA 3CEUA 2OEJA 4Y96A 4HZ6A 1I2PA 3UJSA 3LGDA 4HCDA 2V2DA 5D04C 4E4FA 2NQ9A 3W71A 3CQHA 1EX5A 3S1XA 3LRLA 2VQTA 3YPIA 2Z28A 1AW2A 1KTNA 5KZEA 1JR1A 3BCDA 1DQXA 4JFUA 2BY1A 3C5QA 3S1VA 2HBXA 3TP4A 3AMGA 3OIXA 1WXZA 3H2MA 5BRBA 1XBXA 3W02A 4PTDA 2PDUA 4DN1A 2POZA 1PHWA 2P53A 2I1OA 2PTXA 3BAWA 4TVCA 4NUWA 4YYFA 2ZDSA 1LBFA 3KTXA 1LQ0A 5D8WA 1AL7A 2A4AA 1LRTA 4AD4A 3WMSA 2Q3RA 2VVSA 1Z3NA 2V3EA 3BSMA 1WKDA 3PBYA 2PD9A 2ZVIA 3GH7A 1K4HA 5BWFA 2NXIA 3NGFA 5CPTA 3PR2A 2R94A 3P84A 1CBGA 1VFMA 4N4QA 4BHYA 2PC8A 1KFKA 3P8JA 3DX5A 3TH6A 2Z27A 4S2BA 2V67A 4PODA 2GK1A 1ISWA 4UCFA 4LYKA 1PJ9A 3WL0A 1UP2A 3GRIA 3ARPA 5AB3A 1A4LA 4KW2A 1BGGA 3LMYA 3NO5A 5E1QA 3M0HA 5F1VA 4GVIA 3WDJA 3VMPA 1RLCL 3SJ3A 3AXIA 1R87A 4GNVA 3KBJA 4U5KA 3SZ8A 1ECEA 3NQ2A 3TN4A 1N8FA 3VDAA 3C2FA 4F9JA 3F4CA 1VAHA 1XI3A 4WXZA 1CLKA 1GQIA 1GK8A 4WF7A 4XZ9A 5CBIA 2EKGA 3WK1A 1J11A 1ZB5A 4W88A 5ABFA 3GE7A 2FPYA 3DI0A 1JZ6A 1PWLA 2P76A 3DFSA 1ITCA 3NQAA 3CXOA 4LC6A 2YOCA 2O9OA 4F2BA 3MJMA 4ERAA 3FK4A 3IGUA 4NASA 2Z1WA 3TTQA 5SWUA 1XCWA 4KETA 3PTMA 5HINA 3QV9A 4DYEA 4GUHA 2FGLA 1FWGC 3QLLA 1JGIA 2G96A 3WF3A 2W27A 2B31A 3QY6A 5A6BD 1U2YA 2IW0A 1ZS2A 4HPXA 1RP9A 1PKYA 1DJNA 3DFYA 4KS0A 4UQDA 1SVDA 2XN1A 3LSBA 2V0TA 4X60A 2D3NA 4TV6A 3GB6A 1WUEA 1NF7A 1X6UA 5J5DA 1VJIA 1A53A 1XYLA 2HCVA 3E02A 4R53A 5I00A 2H90A 1CNVA 2NVAA 3W38A 3RMEA 3RX4A 3OBAA 2H6RA 1WOBA 3M7SA 2OFJA 3W7LA 4AXNA 5IRPA 3GR4A 1CGUA 4GH3A 3GM8A 2EPHA 3MT1A 3GG8A 4QROA 4W87A 3URQA 2CZDA 3B0VC 2OPJA 1OZQA 3UWZA 5HJXA 4IT1A 5KEZA 2WJZA 3UWUA 3QYSA 2VEMA 3GH4A 3M5YA 1P6WA 4A3UA 3OW1A 4IL0A 4AD2A 3B3DA 5U4NA 2QMKA 1EJ7L 4MY1A 1GUVA 1W1ZA 3GD6A 4QR6A 3PANA 4XX6A 1VEPA 1BWVA 3S2JA 2GGIA 3PB2A 4DBWA 4AVFA 4DBUA 1H5YA 2PFHA 4AXKA 2YZ5A 1TPFA 3UXLA 1HL9A 3NQEA 4FNUA 1IT8A 1IEIA 3W7JA 1JYNA 2C18A 2Y61A 5BOFA 2WNWA 3EZ4A 4M80A 3ES7A 1W5PA 4KFNA 1RVGA 1MSSA 1OINA 4D9PA 3OZOA 4XTIA 4E2OA 1M65A 3KHDA 4AZBA 5AC4A 2BX7A 1JRCA 1R30A 3R8HA 4OUEA 1RUSA 3ECQA 1TX0A 4GZJA 3VDHA 3VDBA 3ORWA 2X0SA 5BXTA 5GNZA 2ZUSA 1B57A 4FNPA 4I5XA 4JTGA 2CLHA 3T2QA 1J5SA 3QMTA 3PJTA 4LOCA 1KM4A 3AROA 4QCEA 1FCBA 2HTMA 1XKJA 3QHOA 1TPUA 1F9CA 3HG4A 3L68A 2A3AA 4EACA 4HKPA 4PUKA 2PDPA 3R13A 4JBRA 2E28A 4FLRA 4FP1A 4XBJA 2EO7A 4AIOA 3W81A 1UA3A 2J78A 2WOQA 3NOYA 1QT1A 5EBAA 3CIWA 2EG8A 1R9ZA 4ZXLA 1VRDA 2V5JA 4HHHA 1G5AA 2QVNA 3HM7A 2OLHA 4TQTA 3E2RA 4F0LA 3S2LA 3PN8A 4GKTA 1B5TA 3KZSA 2CESA 3ZVIA 5ABTA 4IPPA 4XVDA 2E9BA 3C0QA 3L5LA 2SFPA 1LQAA 4JN7A 4QFUA 3FYYA 5I3GA 4XAZA 1CW2A 4XG1A 3M64A 4LWWA 4PBFA 2QCGA 3LNPA 3AOFA 3M5VA 1R2SA 1VR6A 3MSGA 1YNQA 4S1FA 1R3WA 4M6PA 3BK0A 1AODA 3NM3A 1DWIM 3K8MA 4D8AA 5I0DA 2PTZA 4JL2A 3LB0A 1A5CA 3AHVA 3D47A 3LA4A 5FD0A 4DJDC 3AQUA 2CZFA 2Y0FA 2WZEA 4UOJA 2X30A 2VX5A 5H8UA 3VPLA 3GSMA 3GNXA 4YYCA 5C7VA 1EC9A 1DJXA 1E3XA 1LWHA 5LGXA 5TF0A 1ZBCA 5EMKA 3MUIA 1DWHM 3VXGA 5FF7A 4TU1A 4H6EA 3NQCA 3TEVA 3LK6A 1W9VA 3K46A 3PBMA 4EE9A 1QJWA 1CXIA 3CAVA 1O60A 4PMXA 2GJXA 4X2RA 1TB3A 3TXVA 3OVPA 1J18A 3ALFA 3PFRA 2AMXA 3BW2A 2RH9A 2V5LA 2VP8A 3ZS4A 1NOUA 3D0CA 4C65A 3EDDA 1JDDA 1UKSA 4CNOA 3GXNA 3FSTA 7REQB 3CEPA 5TD4A 3ZQ9A 1LL6A 2EGZA 3VX0A 1IE7C 3W7PA 2PGEA 1MQRA 2OJPA 3UEQA 3IEBA 3IRDA 5G1YA 2F84A 1L9WA 5CBJA 3NL2A 3VD5A 4UNLA 3NCOA 3M6YA 4V27A 5FESA 3FYPA 3DXIA 2B7PA 4IGMA 3IANA 3AXXA 4FO4A 3WO8A 1QRQA 1M3UA 1LYXA 4JHOA 4L4MA 4FNTA 5E5CA 3CHCA 1RY8A 4B9ZA 3EWUA 1SMDA 4M8UA 4R9XA 5CXPA 4GA8A 3EB3A 2GLKA 5LA1A 4HQVA 3S47A 4FXFA 3S9YA 3NPXA 2XPKA 4IWWA 4Y90A 3P82A 3PNUA 4D72A 2E67A 1W9BM 4RDYA 2IQTA 3HU7A 4XZMX 2RUSA 3OEXA 3W26A 4M19A 4C5ZA 4OGZA 1M7JA 2O4MA 4B5VA 1SM9A 2PAJA 1M41A 4OV9A 3OQ8A 3ZOAA 3PZUA 4O8AA 3A4WA 5CPOA 1F4AA 3CWOX 5I3JA 1Q7MA 3E2VA 4UFIA 3C2OA 2DIKA 4XKMA 1TE6A 2I5QA 3JW7A 4NNCA 1R47A 4LTSA 2Q8XA 1HO1A 4DPQA 3V7PA 4G2DA 1R3VA 4NAEA 3JU2A 4Z1CA 4PEEA 2KZHA 4OIFA 4IP4A 5A2AA 3KCOA 4IIFA 4YN5A 3NL6A 3C2RA 3LHYA 2Q3OA 3TOYA 4PUWA 2DT2A 1VBJA 3M5XA 3V3WA 1NFGA 1EX1A 4JKMA 2E40A 1XICA 2Z2AA 1C8YA 5AHFA 1FX6A 1XUZA 5HQEA 4GY7A 3SGZA 3CLMA 3TC3A 1QDSA 2WNQA 2D2GA 1ITQA 1G1YA 1GVOA 2BHZA 3P62A 4PMJA 3GNOA 3NO1A 4MPQA 5A94A 4RZ5A 1Q63A 4F0KA 3UPMA 4HPGA 3MY9A 4OT7A 4KKXA 4JTJA 5DEZA 5IXEA 2WMJA 2DSUA 3TONA 1GKQA 1FHDA 1J8VA 1GQJA 2VFEA 3D6NA 2GJXB 2NSOA 3QRHA 3IUHA 2JKAA 2YA1A 3OLGA 3W7GA 4I5RA 1W31A 1L2QA 3W2LA 3O6AA 5ECVA 4MWAB 1VC4A 1FFRA 1BPLB 1HP5A 3PWGA 1AW1A 1K6WA 4PMZA 4WK9A 4Y2WA 2A6LA 4MLRA 3RJXA 1Q6OA 2A85A 4TR9A 3M0VA 4MVAA 3CZGA 3G1VA 2JGQA 3GFYA 1ZPTA 1KD0A 2ATSA 2XYLA 2QJHA 1R46A 2QGYA 1V3LA 1TQJA 3EX6A 3N17A 4AZ5A 3TYBA 1DJHA 5ECUA 1XISA 4AU0A 3THDA 1JAKA 4XD4A 4TUFA 2V8ZA 3ALGA 3C0LA 2C14A 1ZRQA 5CC3A 3F2CA 5ABFB 4E5TA 3UVAA 3DCPA 3DYOA 5E9XA 1QPOA 4QJ4B 4KEZA 1AVAA 2R1PA 3AAMA 1PVNA 1DE5A 2FLIA 1E0UA 1C7SA 3WLLA 1REQA 3SQSA 4HTYA 4O1DA 4ADUA 2QDDA 3QC3A 5DMYA 1T0OA 4LNYA 4MPKA 1YHTA 4RE4A 1Q7QA 5D9PA 1BWKA 4C6QA 2QUTA 4A2RA 3NQBA 1VBHA 2AGKA 3DBNA 2NXHA 2HRWA 3JZEA 4YLWA 2WJDA 1H0GA 3MU7A 2G5WA 3WQVA 4IUOA 5L9FA 3IJDA 1YXDA 3KOXA 3P8IA 4KIEA 1LL7A 1KLYA 4ZL1A 1NDVA 1V6TA 5EU9A 3BLIA 4M6UA 1WDDA 3LUTA 1EKOA 4ILSA 3UJ2A 1Z7AA 5CCZA 1SSDA 3RYSA 3A23A 1E9ZB 2Y24A 4JFSA 4D1IA 2C6QA 2R1KA 3OJGA 2PP3A 2YXXA 1HFBA 1H7NA 2G4FA 1QASA 4DJFD 2C8NA 2VCBA 3UXIA 2VI0A 3VMNA 3WF1A 3N9KA 4IIHA 1V7AA 4IMFA 2BDQA 3M0LA 4Z1DA 3CWHA 3WIJA 3WDPP 1UWTA 1PL9A 5AC5A 5IM51 3BV4A 3EX1A 2DJXA 3R0DA 3T0DA 1Q6DA 5D9MA 1B3XA 1KXHA 1JD7A 3FJ4A 3U2ZA 3GG1A 1S5TA 4LUYA 2Y8VA 3DHDA 2JEQA 2YCKX 3N6HA 3OBEA 1YKWA 4S3KA 4US5D 1FWIC 4PCFA 4GYPC 3H21A 2DIJA 5AYXA 3VOGA 3APTA 3KW3A 4Q8WA 2ZZ6A 3QMRA 3GYEA 2IKJA 5CC6A 2PDJA 3HPSA 2FTYA 3CIXA 3CH9A 4XAFA 3MUAA 1ONEA 3B8UA 4MIMA 3OGVA 1F8MA 1YQ2A 2J7FA 2REQA 3A47A 4QTGA 3PS7A 3VFCA 1JIBA 4ZO9A 3RX2A 1E1CB 5CGQA 1ZAJA 2ISSA 2ZE0A 4UC5A 4JTCA 5CZ0A 4R3UA 2BBFA 3MUZ1 4ZB5A 1NM9A 4MWAC 5EKYA 2A7PA 5H8PA 4AZHA 3O3RA 1A5KC 2WSQA 1GOMA 1YYAA 5A6TC 3QFWA 4XUYA 1CENA 4P8WA 1GOIA 2WCAA 1NOFA 1B3VA 5M3WA 3GYCA 4IG2B 4LF2A 1Q6GA 3JS3A