1KRWA

Solution structure and backbone dynamics of beryllofluoride-activated ntrc receiver domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
124
structure length
124
Chain Sequence
b'MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAISHYQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITROGEN REGULATION PROTEIN NR(I)
publication title High-Resolution Solution Structure of the Beryllofluoride-Activated NtrC Receiver Domain
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Signaling protein
total genus 34
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2002-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1krwA00
1JDNA 4W5OA 1E6MA 3OO0A 1LBHA 4WXMA 3LUKA 2WB4A 2A9PA 4ZPJA 3BRSA 3LUGA 1A04A 4Q6WA 3N8IA 3QX9A 2TMYA 5TPWB 1ABEA 3DZDA 3QLUC 2PL9A 1DCFA 2LIVA 2QVGA 5EWJA 1CHNA 3IPAA 4HYEA 4ML3A 5BRAA 5JNUA 4OLBA 4WZZA 1PEYA 3FMVA 3O75A 4MRMB 5TE9A 3K9CA 3LUAA 3T8YA 2R47A 1M2EA 3GWGA 2FMIA 3QLVC 4OG2A 2B1JA 2QR3A 5TQ0B 2Q5CA 1L5ZA 4F3TA 1TMYA 1OXKB 4JP1A 4EVRA 3KJXA 5DGCA 3QLTA 3NBMA 3O1IC 5JS1A 3LUDA 4DQDA 5HM6A 2L19A 2NUBA 4RS3A 2WY2D 1MVOA 1YTUA 1MB0A 4G86A 4M88A 4EY3A 6ABPA 4PICA 2IPNA 3HM9A 3H5VA 3O74A 2PE5A 5BRJA 1PHRA 3GBVA 5GOTA 2AYZA 2RJOA 3Q7RA 2L17A 5IUKC 5C5EA 3JVIA 4G0PA 4JA2A 4G0MA 3QELA 4QYMA 4PYRA 1JFVA 1F4VA 2FN8A 1GUBA 2CHEA 3QEKA 4G0XA 1ZAYA 3OM1A 3JPWA 5KQLA 5PNTA 3RVMA 4MLDA 3Q9SA 3I5AA 1APBA 3UUGA 3JS5A 1YK0A 5FWYA 1EHCA 1SD5A 2FEKA 1RPJA 1JDPA 4Z4EA 1FQWA 4YGXB 5CHYA 2AYXA 2FKAA 1FSPA 1E2BA 3CLKA 2IKSA 1KGSA 3O21A 3OMXA 2PJUA 9ABPA 1D1QA 3HV2A 5FBKA 5ABPA 3RVJA 4MS1B 1JFSA 4UHJA 2GX6A 3Q41A 4JB2A 4NCBA 3HUTA 4MR7B 4ZYLA 3QLUA 1A2OA 2FMHA 1IIBA 2MSWA 4MGEA 1DG9A 5IUJC 1JLKA 1FFWA 4KQ9A 4LDZA 3BBLA 3QLVA 2QZJA 4F06A 2LPMA 2W42A 1ZH2A 3DLHA 2O20A 2CD7A 1USIA 4EYQA 1QP7A 3JPYA 5ED4A 1H9CA 2LUOA 1EFAA 1PNRA 4UHKA 1ZVVA 1LJLA 3MF4A 1EWKA 4H3KB 4S05A 1XHFA 1R8JA 3LUFA 1ZY2A 3LUHA 4MLCA 3LOPA 4MS4B 5TPZA 3HSYA 2PUCA 3HJFA 2IPLA 3MMNA 3N53A 4IMJB 2FVYA 3N0WA 5IBQA 4L4UA 4LRQA 3R0JA 3HUUA 4NICA 3H5LA 3ILHA 3FFTA 3O1JC 2DRIA 4MS3B 2A9RA 4RZSA 4Z4HA 1DRKA 4W5QA 3EODA 4XLTA 2HQRA 3M6MD 4KPYA 5BQ3A 3RVPA 5IULC 4MR9B 1TJYA 3RVOA 3W9SA 2ZAYA 5HQJA 1Z2EA 3EULA 3BRQA 5HKOA 5TQ2A 5T7BA 1QQBA 3I45A 5EWLB 3JTEA 3SNKA 3MA0A 2BGGA 1KRWA 4G0YA 2OENG 2FEPA 1U04A 1BDIA 1DBWA 1SXIA 3IP6A 4JAVC 3N75A 4N76A 3H6HA 4D6XA 3LMKA 1PNTA 1AB6A 5EWJB 1Z18A 1QMPA 3KYIB 4H60A 4ZMRA 4EVQA 4RK0A 5CNMA 4IMIB 2PKXA 4OLAA 1EWVA 2VK2A 3GYBA 3ILYA 1QNLA 3LFTA 4IF4A 4EYOA 2JRLA 2PUFA 1DZ3A 5TPZD 1B00A 3LKVA 4RK4A 3VNAA 4Z9AA 4EYGA 2L2QA 1C0EA 2HSGA 1P2FA 1ZGZA 3KYJB 2IDMA 3NHZA 2N9UA 3DLBA 3SAJA 1HEYA 2WJAA 2A9OA 5DTEA 4Z4CA 1DBPA 3NHMA 3ROTA 4DADA 3KSMA 1F51E 4IGAA 4YO7A 4PZ0A 3CG0A 1QP4A 1XHEA 2PUBA 3IDOA 3O2SB 4ETNA 3KHTA 3DGEC 3IP5A 3UKJA 3H1EA 4TLLB 1QO0A 3IP7A 4ZMSA 4N41A 3OQOA 3TD9A 5DCLA 3QELB 4RWEA 3HEBA 4RKQA 1USGA 1YS7A 2MYTA 1RNLA 2FLWA 3OLXA 1NXPA 2B4AA 4XXHA 5KQMA 4WWHA 3H5OA 1BDJA 3KLOA 3BILA 4W5RA 2H3HA 2LP4Y 4LX8A 2YHAA 3MIZA 3JVDA 1ABFA 4KV7A 4TN5A 5FWYB 2WRZA 5T3YA 2FXIA 1VRVA 3MYYA 4FE7A 3NNSA 4QICA 1D4ZA 4MQFA 4Z0NA 1MB3A 1TLFA 2FEWB 4RK7A 2J48A 3K4HA 3H5TA 2QU7A 4GPAA 2FMKA 2ID9A 3F6CA 3GT7A 2E4UA 2P9HA 4LZLA 2VUIB 1SRRA 3OMWA 4ETIA 3D8UA 4XFKA 5JNVA 2PUGA 2YHBA 2WWVD 1T34A 2FMFA 4G0ZA 3SQNA 1NXXA 1BAPA 4RKRA 5JNSA 4KRFA 4CBVA 3CU5A 1EWTA 3M9WA 5KQPA 4TMYA 1DC8A 1M5UA 1JX6A 8ABPA 1QO0D 2RDMA 3JY6A 3TO5A 3N0RA 4MQEA 3LKBA 3IP9A 4D74A 1D2AA 5KC8A 1RXEA 1M5TA 2PAFA 4KNYA 1FFGA 1Z15A 3CHYA 4O1IA 4O5AA 4IILA 5GQSA 4E7OA 1Z17A 4W5NA 2NZVG 4RU1A 4RY8A 1CEYA 2GI4A 3OM0A 1QQAA 3F6PA 2FQWA 5CNIA 1NTRA 3S99A 4MR8A 4Z4IA 4G0OA 1JL3A 1ISRA 2RGYA 3RVRA 4P1ZA 3N6VA 3RQIA 1S8NA 4KFCA 3E3MA 3TMYA 2P4UA 1Y1LA 1W25A 3FFXA 2E4YA 3FFWA 5F64A 5TQJA 5BR1A 4RXMA 2JCGA 3T95A 1DP4A 2GKGA 1KMIY 4Y9TA 3D02A 5TQ2B 4ETMA 2R48A 3H5IA 5FBHA 3VNBA 3HS3A 4QYWA 1Z2DA 5C5CA 4RSMA 4IRXA 1YVUA 5E3JA 3MM4A 1QP0A 2JBAA 1JH9A 3I42A 1JYEA 2R4QA 3F7NA 5EWMA 2CHFA 3P9YA 5KC9A 3HVRA 4KK4A 4MPTA 4YCSA 2R25B 1AB5A 4N03A 3M9XA 2HQOA 3C3MA 4HNRA 1SXGA 3KS9A 4EVSA 1JWLA 3LTEA 4KK3A 3CS3A 1NXSA 4JASB 2I6FA 2PLNA 5IUNC 1QPZA 1ZDMA 5HSGA 2V0NA 1RXIA 2QVCA 2XDYA 1EAYA 4FE4A 1L5YA 3OLVA 4RDCA 3H1GA 1M2FA 2MYPA 3HDGA 2GBPA 4Q7EA 3G85A 1MIHA 5DKFA 2OQRA 2ZWMA 2A9QA 2IYNA 1Z13A 3A3KA 2FSPA 5CNJA 4XASA 2FQXA 4KZKA 3SG0A 4W5TA 1URPA 1RZRA 4YLEA 4GNRA 3NNDA 3EQZA 4KMRA 1DCMA 1Z25A 2KYRA 2QSJA 3CRNA 3QK7A 1D1PA 1JFTA 1CYEA 3E61A 1YMVA 3ROFA 7ABPA 5B3JC 5JNWA 3Q7SA 2VYCA 3EDCA 1I3CA 1TM2A 3KKEA 3KG2A 5FWXA 3RVSA 3RVQA 3DGFC 5KQGA 2GWRA 3Q7TA 3SY8A 3N0XA 3QEMA 4RXTA 3CZ5A 2ID7A 2JVKA 2PMCA 1MAVA 4HNSA 4EGSA 2E4XA 1P6UA 3HDVA 1ZN2A 2PUEA 3TB6A 1BVHA 1JBEA 4MQFB 5I4CA 2E4ZA 2MSKA 1ZGGA 3HCWA 3TX6A 1JYFA 1VPWA 1YS6A 3GV0A 2WMYA 1K66A 2NT3A 5D2CA 4Z99A 5TPWA 1E6KA 4EUKA 3HK2A 3GBPA 2JB9A 2E4WA 1UDRA 2L18A 2M98A 3EGCA 2FTKE 1P8AA 2H0AA 2IOYA 4D6YA 2IPMA 4YRZA 3RVNA 3CZCA 5DLEA 2X7XA 1JHZA 2CWDA 4JOQA 4F8JA 2JVJA 3KLNA 3FDFA 4H3HB 4YWHA 5JNTA 3O1HB 4G0QA 2F8TA 4NCAA 3EAFA 1RZRD 2FN9A 3CTPA 4MRMA 4OATA 4WT7A 5IEJA 1E6LA 4RY0A 2VUHB 4YS6A 1DJMA 5TQ0A 3GL9A 4RK1A 5KWSA 4RV5A 1YMUA 5IC5A 2E4VA 3FGZA 3EJWA 2PUAA 4PEVA 4YP9A 4KQCA 4MQEB 3RVKA 3OQNA 2IPAB 4F11A 3B2NA 3SM9A 1K68A 4XARA 4QPJC 3IPCA 3C3WA 1YIOA 1GLGA 1Z12A 4OTZA 1ZITA 1USKA 4LE1A 4LE2A 4Z4GA 1NXVA 1PEAA 3RVLA 1A0OA 3BREA 5IEBA 5JS2A 4Q6BA 4MR8B 1VKRA 3H75A 1Z16A 3O2JA 5B3JA 4HNQA 2HQBA 3C3KA 4KREA 3HO1A 3I09A 3A0UA 2FW0A 1U2QA 3OLWA 4FB4A 3O2QB 1NXWA 4N0QA 1PUXA 2QV0A 1NXOA 4KVFA 4P98A 4LE0A 4NV3A 2M1ZA 4PE5B 4F12A 1BDHA 3RH0A 1Z26A 2WJWA 4N47A 6CHYA 4B09A 1U0SY 1U8TA 3NNNA 3URMA 1DC7A 1ZESA 3EQ2A 4MS1A 4E7PA 1LBIA 1XWWA 1W9HA 3H5WA 3KTOA 3HXMA 2JBAB 2MYNA 4Z4FA 2PL1A 5EWMB 5JNRA 1ISSA 3A0RB 4MR7A 1GCAA 1LK0A 4YV7A 5IX8A 4G97A 3GA5A 3CG4A 1FFSA 3A10A 3KCNA 3Q15C 4WXEA 3T38A 3GRCA 3G1WA 1WETA 1NY5A 1OXBB 4DN6A 2HPHA 3F73A 1GUDA 4YR7A 4Z9BA 3MQ4A 2PUDA 4NQRA 3C6QA 4ZJPA 4XAQA 3T6KA 2RJNA 5CNKA 4JB0A 3HZHA 4RK5A 4S04A 2QXYA 4WUTA 1ZH4A 1P6QA 4LDAA 2MSLA 1DBQA 3CNBA 3OO1A 4N0PA 2JVIA 1C4WA 3QX8A 4RK6A 4MAAA 2FQYA 1LJUA 4RXUA 2HJ9A 1TVMA 3OQMA 1ZHHA 2NT4A 3CKMA 3H6GA 4MS4A 1NXTA 4MYRA 2JK1A 2LBPA 2FLKA 3DBIA 4RY9A 3OLZA 3CFYA 1SXHA 3LUJA 1NATA 1KRXA 4TLMB 1DRJA 3UK0A 4EYKA 2MYUA 3C97A 4MS3A 5FWXB 3H1FA 3OLYA 1J56A 1JF8A 3L6UA 3QEMB 1YK1A 1D5WA 4MR9A 4L85A 4O1HA 1U2PA 2NZUG 2F8SA 1VLZA 5KI6A 3L49A 5EWLA 1BA2A 4OBBA 1DCKA 1GCGA 3LUCA 1QKKA 2QW1A
chains in the Genus database with same CATH superfamily
2VZ0A 3G49A 3I34X 4Q3DA 2RCNA 5ALJA 4DG5A 3RREA 5CXXA 1U4SA 3AHFA 4JIMA 3SFZA 4PYMA 4E70A 4F56A 3QKSA 5C1PA 3LSTA 4FNOA 4ZPJA 5L4LA 1XCPA 2F1IA 4HUQA 4PTZA 3EW7A 5G02A 2VUUA 4CG0A 1RM5A 3GU3A 1BWPA 1A71A 1UF9A 5LQUA 2YFQA 1PEYA 1K8RA 1UIMA 1ZU4A 3AR3A 1F2VA 3KQNA 1N36B 1J0XO 3WJ1A 4N3AA 2J5QA 3H18A 3QPDA 3T7SA 3OCJA 3V2IA 4FWTA 1OB2A 2Q5CA 1L5ZA 3IPLA 2W2NA 3VX4A 1D6NA 4U3JA 1EUDB 1T4MA 4X84A 5AHKA 1TT5A 2GUWA 2R7NA 3KQMA 4X97A 3TSOA 4GLOA 5LDHA 3B1JA 1AF7A 1JVSA 5HM6A 1C9JA 3G0GA 1KWKA 3WLAA 2UYGA 3LVBA 4R9UC 2GF2A 4E1VA 1N7HA 2BHNA 4LSZA 4PICA 2JFYA 4R2MA 4CVNA 2R8RA 3LDUA 3GI1A 2G4CA 2EDCA 1N25A 1FP6A 1W52X 3O74A 3WBJA 5BT8A 4PS1A 4YJDA 3RKRA 4BQSA 5JAUA 3RKSA 3CLHA 4HRVA 1JQKA 4KVZA 3BSFA 3PXEA 1GQSA 5E6UB 1CLEA 3FPGA 2KM1A 4YONB 3TJMA 4ZVOA 3CVOA 2OFWA 4N0EA 4PYRA 1OMOA 2WIFA 1VQ1A 4OD0A 1YGYA 2CHEA 2PX0A 2OUIA 2V54A 3E8MA 5KYXA 4R1NA 2ZW9A 1L4KA 2CFSA 3L4BA 3QYAA 1II0A 1LZLA 3PZRA 4GXTA 4IBOA 4IUBS 2PKCA 4W4TA 5AJXA 1DX4A 1Z56C 1BOOA 3EEBA 4OY3A 4BN0A 3GWZA 1RHRA 1KEVA 1RPJA 5FAKA 1FP4B 1H5UA 1NW7A 3QE2A 4YBRA 4MUFA 2CVPA 1TDJA 2AZTA 1NMSA 1TZJA 3LAWA 3LRPA 4XGIA 5CHYA 4BRWA 1UT8A 3CLKA 3C7CB 1UBTS 3LF2A 1VMAA 3R7LA 5JYBA 1W36B 3LPMA 2OM6A 5ECGC 3OZWA 1NBMA 1XOIA 4KXUA 3L7IA 2C5HA 3AK4A 1P18A 4JB2A 4QUDA 4CLEA 4D56A 3SICE 3LGAA 1V4BA 3UCFA 1FXWF 3BJMA 5LNK6 4KR7A 4GZ3A 2ZS8A 3B9QA 3LCCA 3MBKA 1ZU5A 5IBRA 1P0MA 2E5FA 4V24A 1DCTA 1T35A 2EX1A 1KEPA 2HRCA 4MV1A 1XEWY 4TLAA 2QLNA 1SCBA 4TXNA 2NO4A 3L7JA 1Y1SA 2PTHA 3NHLA 2NSHA 4G5OA 5CH5A 3SVZA 1FMFA 3OG9A 2Q6TA 3KWFA 2HH9A 3R41A 5IAKA 3U9SA 4DCJA 1L1RA 5HR5A 1MTOA 1U7ZA 1XVAA 5A5GA 1ML3A 3SBXA 4X24A 4RMIA 2R7KA 4JJKA 5JBQA 4G4GA 4HWTA 1H8HA 5KYYA 3CXRA 5HP4A 4PRLA 1HYGA 2AC7A 4WZAB 1HH4A 1LWNA 3P2EA 3WOVA 1XHFA 1NJ8A 1LW7A 2GNPA 2C3YA 3GMDA 2A14A 2KQUA 1T9ZA 2LCFA 2HIHA 4GLLA 3VZSA 3LJKA 2G28A 1KDPA 4PC2A 5DCWA 3LHFA 3OZSA 5F73A 4I3HA 1IWPB 3DEIA 4HX9A 4FHCA 1KA9H 3WAJA 2XQFA 2AL7A 4H17A 4LECA 3DO8A 4HV4A 5AKXA 3LBAA 3F46A 4PC1A 1H2BA 1AUQA 2C5GA 4K9RA 4NICA 4MWBA 3BORA 5D7BA 1JU3A 2OMEA 1SURA 4GSKA 2QD1A 3LT4A 2R86A 2XRMA 1SKQA 3Q12A 5A3VA 4IS3A 2AMVA 1GNLA 3QFTA 3AOGA 5BP7A 4GBED 3SC4A 1PLJA 2YRXA 2ASEA 5HKOA 1YZTA 4M1MA 4TTAA 1P0IA 5LB2A 4Z3OA 1XQ6A 1N2ZA 1KEWA 4P35A 1RXSA 5BUQA 1RQXA 2IUFA 2XOEA 5JUWA 3ZDDA 1YAHA 3PKJA 1EK6A 3N28A 3VPGA 3AUJB 4ZC8A 2XCLA 3MCZA 1Q22A 5KOJA 4Z4GA 3ESYA 3PXXA 4M55A 4YV0A 3JARA 2ONZA 3K92A 1GA1A 1E7MA 3OF5A 4K9QA 4HLDA 3PC8C 3C8HA 5CLIA 1H8HD 4XX0B 3LECA 1PQPA 5ECWA 3MRSA 4HGRA 4IYJA 5HTKA 4B7ZA 1E58A 1N5KA 5KWSA 2F3UA 2Z5LA 1ZM2A 4EGAA 1GKLA 4G37A 3AF3A 1SVOA 2JCBA 2PH5A 1J8MF 2RHGB 5EC8A 4P83A 1NVDA 4ZAVA 4ALNA 5JRDS 1QTRA 2PUFA 3M8KA 3QOYA 3BWXA 1Y80A 1UZAA 1US8B 2V7PA 1NDQA 4JI0B 1P9LA 4FT4A 1Y3FE 4FZVA 1E2QA 1XZDA 5IDVA 1DBPA 2CBGA 1A76A 1QP4A 2V65A 3ZHYA 2QRNA 1RAEA 2YXPX 3HUFA 5IXSA 3AW9A 4EGJA 3ZHCA 1U6IA 1SBNE 3QVGA 4OM8A 4RMJA 1YB7A 3PUKA 3SZOA 3H4IA 2CEAA 2Y9PB 1Y8RA 2YVUA 3HEBA 1GZ3A 4RH1A 3SYTA 4P0QB 3DZ8A 1Y6FA 3DC2A 1TTQB 1RM0A 1Z6XA 1EFHA 3N07A 1AHNA 1M10A 1WUTA 2NXNA 4UUNA 4BWFB 3FCYA 2CWWA 3N0VA 1E99A 1RBQA 2AIRA 2EKBA 5AK3A 4WD3A 4DANA 2VP6A 3G2IA 1NOKA 3BMCB 4N18A 4JLAA 4GW3A 3G68A 3CLUC 4Z0NA 1O6BA 1X38A 4J3NA 1LRKA 3HCPA 1DAPA 1Z38A 3H5TA 3SF0A 2H18A 4HEA1 4JJIA 3WZMA 2XQKA 4OXXA 4AJKA 1KFKB 1GU7A 2G70A 1GCOA 2PXHA 2H1LA 1IXZA 1EVKA 4L73A 4NENA 1PZFA 2OBXA 3MTGA 1JKJB 4HMQA 1Z7WA 4AQ7A 1QIEA 3V3KA 1A7AA 3M3HA 4PVDA 2JLWA 4ZYWA 3T3MB 4QJIA 1L6RA 1K86A 2LDBA 4Q3CA 1ONNA 3H1TA 4DA0A 1RAHA 3D4PA 2V98A 2AR7A 4TL9A 4O4HF 4MUKA 4RWZA 1TU3A 5IVHA 4EFNA 3SC3A 1GQOA 1ORRA 1OTXA 4IVNA 1LQTA 4JT8A 4K26A 4AMGA 1VIAA 2AJTA 2VOEA 1LS1A 4AROA 1W75A 2FOXA 3FKSA 3GNLA 3L0OA 3LLUA 5CK4A 1H2WA 3G9XA 3K70B 1C1DA 1EZ4A 2IQIA 3NOOA 4XVQA 3P9SA 4JQYA 4M7OA 4BE4A 2GDJA 3CX6A 3F4KA 5I7OA 1VJTA 2LWIA 4MO2A 4TWAA 4B43A 5FNZA 3NI2A 1U3FA 2C96A 4UUBA 1OYWA 4INZA 2H57A 4W82A 1B0AA 4O2AB 2AKYA 1QMGA 3QIAA 4XB1A 4Y67A 3TEFA 3BMXA 1BHO1 1DARA 4CUZA 5CDSA 2ZLBA 3URKA 2PZEA 4A0RA 1NTRA 2CY0A 4UMEA 3UT5B 1TJ5A 3GD7A 3W06A 3UICA 4EKEA 1ISJA 4US2R 1FJGB 3D6AA 1ZQ1A 3CVYA 3GLFA 3LYUA 2QMZA 4LJKA 2FU5C 3JASA 5KTTA 3GP8A 2OCBA 3OE1A 2Z6QA 2QORA 2ZBQA 5KTKA 1SQFA 1P4JA 2FK8A 2NSLA 3EGOA 4L28A 1KSGA 3ORQA 2P4UA 3WRYC 5EIFA 1RZ3A 3L0ZA 4FBMA 4D8YA 3L82B 5CDHA 1YR9A 3L8DA 2ZI6A 4MEBA 1MOQA 2JCGA 3I6IA 4WJKB 1KDVA 5ALOA 1Q16A 3P71T 4DXAA 3I61A 1D1TA 3MERA 5I9IA 3QE9Y 4M4SA 4WZBE 3GLHE 4ZK2A 2IYEA 3TCNA 1N9GB 2OLEA 3MJSA 1TU0A 3LK7A 1IQUA 1UQRA 4U0KA 1LS6A 1FTNA 3E9QA 3JYHA 5CLJA 2NWQA 2VZEA 5EWMA 3RU9A 8ADHA 1G5HA 3I01A 4G0VA 2PSFA 3B12A 4EENA 2YYYA 4ZD6A 2X2EA 5EIHA 3IRVA 4QTTB 4I5FA 3HSKA 4KK3A 4CV3A 4M1KA 3W77A 5LQKA 2P4SA 4JASB 2PLNA 5BVGB 4O29A 4A36A 1VFNA 2VJPA 1R18A 3IBFA 4J2OA 4MKHA 1DWOA 3Q2OA 1HNNA 5TEVA 2QRQA 3D1LA 1Z6PA 1EQ2A 2PXCA 1HX7A 1CZUA 3VO8A 2Q7XA 5HRUA 5JAIA 1P1RA 1Y9EA 3G23A 4W5HA 2R79A 3JQRA 3OE5A 4R2IA 4FDVA 3RF6A 5BQFA 3R6DA 4V02A 1QLHA 3GUVA 3N2NA 2GZRA 3A58B 3OQIA 4BZQA 4S2EA 1IBSA 1YCHA 3IAS6 1HZZA 3FPHA 3K53A 3MAAC 2JI4A 4I46A 2NUAB 1YZQA 3VNSA 1NKVA 3KWJA 1Y48E 4IICA 1RHJA 5THXA 1Z25A 2PS3A 1FYEA 4PGFA 4M0EA 3AF6A 1JFTA 1GG8A 4A92A 1CYEA 4MVJF 4BB9A 2DTXA 2CC2A 5JVDB 2VHZA 1BCSB 1I80A 1BFKA 1BNCA 2IH4A 3RC8A 1Z83A 4X90A 2BJHA 1XEXA 1E2JA 1VSVA 4WJLA 3Q7TA 4LX0A 5ADUS 2EOAA 4K2HA 4TTVA 1PYGA 3HXTA 4BMXA 3TQSA 1UOQA 4REMA 3V46A 4EG3A 3QLEA 3S2ZA 2BVNA 2OZKA 4OM7A 3AT1A 5DJ5A 3E9DA 1RXCA 4TKMA 3WFIA 1UKYA 1R3UA 2GK6A 4H15A 4IGKA 3KAKA 5DPMA 1XRRA 3F6BX 3BM5A 3NV7A 3U1TA 4TTPA 3ZEAA 4EBBA 5K8IA 2CV0A 1OXUA 3C0KA 4EQ6A 3PQ5A 4K3UA 5CW1A 1Y7IA 2FTKE 3E2PA 2H0AA 1ORWA 3OJ0A 4XYEA 2QX6A 4N5DA 1H3NA 2X5KO 4YAJA 1PFGA 5BXQC 3VYSB 2W48A 2AFIA 4K1LA 2NXWA 4B73A 4C4OA 3DO6A 3TOCA 2OV8A 1WTCA 3BMNB 2ECKA 4NCAA 1Z34A 1ODCA 2XUHA 4OHOA 2FSFA 3NU1A 5DO9A 1LU9A 1CPYA 2W2KA 3PGVA 5KTNA 2TMDA 5JR3A 4DB4A 4FLEA 4OHKA 3ZHRA 5IDQA 1QAOA 4E2YA 1E6EA 1PG2A 4EKDA 1ZVKA 2QROA 1BX3A 2Z0MA 1UC5B 2HNKA 2R7AA 1SIUA 1U8CB 5DT2A 4ARBA 5TC4A 4BQQA 3OQNA 5TDHA 2JFFA 4ZO7A 5DXJA 2DWPA 1TIPA 4DDVA 1L4LA 4C4YA 2QUAA 2WYWA 4YCAA 3VYWA 4GMFA 1AKRA 4OHRA 4YR9A 3DE1X 3TCKA 2I4MA 1FUUA 4TXJA 4KHZA 5IEBA 5JS2A 4MR8B 3K94A 5BSKA 3H1PA 1I5EA 5G3ZA 4AJOA 4C01A 3QE0A 4KREA 3E1KA 4O4JA 1YULA 3QXCA 1PK9A 1M3SA 5BSMA 1DGQA 4IQ0A 3U09A 2C59A 3MWDB 1XHLA 4WBSA 3AW8A 2CLFB 3AI1A 5ALEA 3MHPA 1NPDA 3ZUGA 1QRSA 3KQKA 5LLSA 1A96A 2PYZA 1HT2E 2H1HA 4PLGA 1SBQA 3S2EA 2ZI3A 3E8SA 2ZRHA 1QX3A 1PX0A 1E1DA 3GCXA 1UKVY 4F9EA 3UNXA 1QRUA 1U0SY 3UANA 3RWMB 4A2WA 2G1KA 3AVOA 3Q4GA 2GHIA 3EFHA 721PA 4XI9A 1GPUA 2PSHA 2UV8A 1P2VA 3HKBB 3KTOA 3S5JA 1DFGA 1X0XA 2DTDA 2F1KA 2JGFA 3PEEA 1A8QA 3OOHA 4P3YA 3IODA 5FIUA 3UF0A 1TA9A 5IVIA 4R54A 3NEAA 4KQWA 4LF7B 1EFTA 1YZGA 4LRYA 4B9AA 1H42A 2DLNA 2XE6A 1QO7A 2OFXA 5HRCA 3QPWA 1TAUA 1F4PA 3EA0A 3I9KA 3GRCA 4IQ4A 2EERA 2FGKA 3G1WA 4PTLA 2O0HA 2WI8A 2Q2OA 1NY5A 3QP9A 4ZYTA 1J0CA 3TE7A 4UDXX 4ZCMA 2P9FA 3COPA 4PAWA 3AVWA 3TOZA 4CIWA 4JL5A 2AMJA 2PGOA 5LL6P 4IH4A 1H8ED 2I2AA 4H4DA 3RT7A 4E12A 5BVHB 4ZJPA 3HEMA 3ZU2A 5BUCA 5CXUA 1U0GA 3L8HA 1MC5A 3CEPB 4TYNA 4PYOA 4IEEA 2COUA 2G0AA 4K2AA 2DWUA 1VBFA 1ENZA 1U9JA 3OEHA 4L50A 5BSEA 3VKUA 2ODEA 5ANRB 3UPUA 1JLMA 5MN6A 4BNLA 3QJYA 1W8DA 4KWHA 1BGWA 1JLRA 4ZIRA 3FHLA 1EP9A 3AZOA 2AFHA 5BWOA 1GPYA 1S4MA 5FNVF 2OC4A 1UKCA 5A4KA 3GARA 1M1YA 3VU0A 4MJ3A 5ALUA 4ZRMA 1OLSA 2Y8EA 2G1PA 2VYFA 3AXTA 2AI1A 2ZVQX 4JLKA 3L4BC 3UJPA 2Y68A 3B1WA 1T9AA 1WQ1R 5JZSA 3RC3A 5CDTA 3BGVA 3QI2A 4HPXB 4OYLA 4P08A 1U3TA 3OPMA 4J2TA 2WTXA 3ICCA 5DP1A 5JG7A 2HW8A 3A31A 4FKBA 4Y2RA 3GMTA 4MV7A 4D9GA 1RQRA 5GJCA 2V8BA 5K8LA 1DC3A 4HDSB 3CW8X 3GRAA 3UY4A 3CY6A 1ZGCA 2XRFA 4M87A 5TPWB 2C2HA 1RLMA 1DEHA 3GLGA 5BW4A 1L2TA 2QP3A 1S8OA 2WF6A 1U3VA 3GFVA 4QWWA 2ZDGA 4A16A 1LX7A 3QX9A 3R6GA 2Y77A 1B3BA 4URFA 1TTTA 2PL9A 1J0DA 3PC4A 3BC1A 4HYEA 3OEHD 4KDEA 1RIFA 2VP5A 2CHUA 3G0OA 2Z30A 5TY0A 3NEYA 5FPHA 2PSJA 3GXBA 1G20E 5GIOE 2EVWX 2CLCX 1FTSA 2PBZA 1DEKA 1W2HA 2Q3EA 1E63A 2I6TA 3TM4A 3ZUPA 3QVUA 5CT6A 2NZJA 1JGTA 2POCA 2ZIEA 1Z8HA 2OZLB 1C0KA 4FFBA 3ZZTA 5SY6A 3PJDA 4FU0A 2ODTX 3PQFA 4DIOA 2W4IA 5BV1A 4GLFA 4WA7A 5LQAA 3PPWA 3AJ9A 4JLUA 1PKEA 5AVTA 4BBPA 1ZCAA 3COSA 5EE5B 4AY4A 1XXHB 4BFSA 5A4IS 1KY4A 2RHWA 2P78A 3HCRA 4YXFA 1EXMA 2O8DA 3R3ZA 3MXTA 2VDQB 2VH5R 3JWHA 3MLEA 3Q3CA 1XA3A 4GP9A 3M7IA 3RS4A 4YRNA 1ZAYA 4YJGA 1XUOA 4P0PB 1HRDA 1UMBB 2VDOB 4N8DA 5TF4A 4G0WA 1VOTA 5B1YA 1T0JB 2FI1A 1PJSA 3T41A 1JR3A 1O3YA 3DLAA 4BO3A 5H8WA 3MJ4A 3D6FA 4RGBA 1ORTA 3W9YA 1HORA 4C5AA 5E2AA 4NYIR 2AYXA 4U0JA 3RLFA 3MS7A 4HCJA 4E6EA 3OZTA 3QVMA 4O2LA 2WM3A 5A9RA 3EMVA 3E3NA 1F5NA 1EBUA 1ZINA 2QRGA 2X8JB 2ZR9A 1FNDA 4IXTA 1KDZA 3GRRA 2FR1A 3RVJA 1T6XA 4JXZA 1ZHFA 1YI0A 1Z5UA 2RARA 3IL2A 1JRLA 2R85A 4ITUA 3WDLA 3LF1A 4ASUD 3WL3A 5JH7F 5GP1A 3ZVNA 1PNQA 3U3KA 4F46A 3HUTA 4O4IF 3E3AA 1CJCA 1HGXA 2AFRA 3EF0A 3ORYA 3VC3A 1FU4A 3QI7A 5A5FA 3H8VA 1SUFA 4ZRDA 5DISB 1U11A 4Q3AA 4UQLA 4KN5A 1YR3A 4ZT4A 4IUCS 2FP3A 1K3TA 1XTPA 2WFAA 1SEPA 1GFWA 1NSTA 1Y42X 4Y6OA 4PWYA 2B0JA 5EQTA 5GOZA 1R5NA 4CTOA 4B3IA 2WHEA 1EUCA 1VPDA 3QNUA 2WFZA 4X65B 2RC6A 3TMAA 3VVLA 5DOZA 4AI6A 4FHFA 4MX8A 1EGQA 1RPAA 4B6RA 3RV3A 2JGKA 4L1KA 1GSIA 2RH4A 4MUAA 4MKXA 3R3JA 4TKZA 4ZV4A 4I4TA 3LW8A 5K0ZA 4KNWA 4TWZA 1NZJA 4FEEA 4W1RA 5IU6A 4Q18A 4RY2A 2YIMA 1JR3D 1SELA 3KKNA 3KOXA 5TPZA 1XKQA 2F3SA 3NIDB 3MWEA 5DCYA 5E6RA 1KBOA 1NE7A 2AKAB 3ED5A 4IOLA 5JMWA 3R9XA 4KO1S 3Q9NA 3PQ2A 4LBWA 4F92B 4RORA 4XM1A 4OLJA 3TOXA 1KJWA 3K0FB 5C3MA 1J1ZA 1U9CA 1MZPA 3DLTA 4D98A 3UV7A 2GCIA 3OQBA 4XLTA 3W3AH 3DB1A 5GJVC 5IWCA 5AVOA 2C78A 5B7NA 2PRSA 1I2ZA 1ZD2P 3KYDA 1XYGA 2BFAA 2NZ2A 2CFRA 4PQRA 2ORYA 4XWYA 4D8WA 5T7BA 5B4UA 3ZLTA 4S1TA 4U6QA 5FO0A 2WQ6A 5AWFC 4U2FA 1V16A 4RH0A 4FNMA 1E5DA 4CQJA 2QMEA 1QH9A 1LTQA 1TCVA 4GH5A 4INOA 3R7FA 3MQ2A 2OENG 4K6FA 3V4ZA 1HFJA 1JG3A 5F33A 4RTJA 4F5WA 2YRWA 1WDMA 1ZM4A 1Q57A 4PO9A 4WESB 1PNTA 2H65A 4UHDA 4DJEC 1KXJA 3PD7A 2IBTA 1TF5A 3BCUA 5BN1A 1OYOA 4QREA 5F4BA 3AEQA 4IF4A 1A9SA 5DVZA 1KFBB 1N6HA 5EE9A 3W8EA 4EKGA 5TPZD 2X2PA 3LKVA 4DLLA 4EYSA 4DQ0A 1NNSA 1P2FA 1W44A 1ZGZA 4DLXA 3QTBA 4EPVA 5HS4A 2WTMA 3ABIA 1SCIA 4GRIA 3AY6A 4K6MA 1WP9A 5ITSA 3ZG6A 4QTZA 4C0LA 1JJBA 2F1JA 1GPH1 3Q5EA 3SOZA 4E22A 1XHEA 1J9ZA 1ZMRA 3UXEA 4B6JA 1GQ2A 1IG0A 3RFVA 1KJJA 2BR3A 4QSMA 2BL4A 3TIFA 2REXB 2R00A 3ZD8A 3MQFA 4P4UA 1L3IA 2M1XA 3DFZA 2ATCA 3AIOA 1FW8A 2XUQA 1H4QA 2OD2A 2P9CA 2Y67A 3JAKB 4TTSA 1GGEA 3JR3A 5AICA 3BERA 3WMWA 1BDJA 1KOFA 3NAQA 4YYEA 5CA1B 1G5TA 2OFFA 5FP0A 2WUFA 3EDYA 4KJZA 4X6LA 1U2ZA 4WVLA 4D0SA 2HLHA 1WMDA 4U8HA 5FWYB 3BB1A 1ZA1A 4DTCA 5EINA 3A05A 1CW2B 1ZLXA 1W34A 3ELYA 4M7RA 2WVHA 2NU7A 2BEVA 1LK5A 1QHYA 3BQNB 3FBWA 2ZR7A 2XTZA 1E59A 3BOSA 4F7DA 2V7QA 1OJLA 2WW8A 4I1YA 3T1VA 2OV1A 4F0JA 4IH9A 4Q9KA 1N2HA 4FOLA 1C8LA 2J8ZA 1QYWA 3B9RA 5HGJA 2NG1A 1Q0ZA 2NOAA 4LI3X 4AF6A 4QYIB 3WYCA 3ABZA 4OSOA 4XFKA 1YQ9A 1ZOSA 4P5PA 5HTOA 2PUGA 2R2AA 5IT4A 5CYOA 1XEFA 1L4YA 1NBHA 5JQGF 4XUDA 3G2LA 3CU5A 5K0TA 1AMUA 1HQYE 2XT0A 2O19A 3VKHA 4BWYA 5KNLA 1GTJ1 2FWMX 5BQPA 5IVPA 3EVFA 4YCJA 2I62A 3SCZA 2EFCB 1N5IA 4YC7A 3NORA 5J5VA 5ALIA 1I51A 1A9QA 1T1JA 1ZCZA 2EZUA 2C84A 3JRNA 3O2NA 3R0QA 1EE1A 4AXXA 4H6VA 1P4HA 1U65A 3TGLA 3EC1A 4P3OA 1PE0A 1I4LD 5EIWA 3NTQA 3X1KA 3MJTA 3UMSA 1N9ZA 4XUGB 1OFUA 3OF3A 4BVGA 1PR1A 3VHRA 2Q5OA 4Q1DA 4DLAA 1HZZC 3DM9B 1Y6ZA 4R8SA 3ZDFA 4CM5A 2NZVG 1MNQA 2WSMA 3KNZA 2NNWB 2Z2XA 5EMLA 3F6YA 2X6QA 2PZLA 5BYBA 5LZ5A 1F0YA 2A3RA 2XNSA 3FD8A 2PKQO 2XLCA 4RA9A 4ECAA 5EMNA 5HW0A 4RM3A 5JZVA 3I6QA 1FUKA 2V7QD 1ISRA 1XU9A 3EFOB 3R3SA 5C80A 4HQ6A 3AB3A 4HXEB 5IKXA 1C9EA 5F1KA 3F47A 2YL2A 4WBNF 5JZBA 1U2RA 1E5LA 2NO0A 3D7NA 2E4YA 4OBXA 5F4ZA 4DJFC 2PGLA 3PUXA 5BYKA 1RHMA 1ESDA 2H9IA 2Y05A 1ZM9A 1VBKA 3TLBA 2WTUA 4B6QA 1I24A 2PRYA 3L5OA 1U28A 1P3DA 3MXOA 4IRXA 2PH1A 1QYCA 3WMRA 2SKEA 4KQ6A 3DQZA 1MC8A 3C7DB 1X74A 3C41J 1IN5A 5AW3A 3VGPA 4M9ZA 3IELA 3DOHA 4KITB 4AKHA 2C58A 2Q62A 4KGDA 2VCYA 4PCUA 2DM6A 1SXGA 3MCAA 4BLOA 1N3BA 1OX5A 1TX4B 3DMNA 2DOKA 3L7KA 5BSGA 1NXSA 4UHFA 2H1IA 1WDKA 3B7PA 3QVVA 4UBNA 4X20B 1JKIA 3FZEA 3KQWA 4D3ZA 1PJQA 3H1GA 4MCAA 3AETB 2HMWA 3B8EA 3HVUA 4W7SA 4Y6RA 4ARZA 2RGXA 4FI3F 3H42B 3ITEA 4I9FA 5H16A 2ZUVA 2EJBA 1A82A 3L7BA 3KZNA 1BCRA 1M83A 1U2SA 4MEAA 1J23A 2W58A 3OD1A 3RIGA 4CKWB 1V5GA 2C8LA 1CRLA 2DHEA 4JNKA 5AVXA 2PXXA 2B8EA 5FJIA 4B5LA 4A2QA 2WFLB 3T7AA 1B16A 4BKRA 5TARA 2O07A 2WMNB 4GVXA 5A4DA 4KQIA 3TI7A 1C81A 1UBSB 1PNOA 1CJVC 2X0KA 1XP8A 4HNUA 3JAWA 2V4ZA 4ROTA 4TMTA 4FC7A 1GIAA 4CM8B 1AA6A 4F3CA 2PGJA 3W5IA 2AG5A 1RJ9B 2JASA 3H0EA 1QHEA 3UJ7A 3E7XA 4L72A 4ITVA 1NA5A 3FYDA 4RNCA 4PYJA 3AONB 4BNDA 4EGSA 4YCBA 2I4RA 2UZAA 1A1SA 1H5NA 3QF7A 2WTEA 3DZBA 3RF7A 4CTNA 1ZGGA 4F84A 1QZZA 2H5EA 4A6DA 1K66A 3TFWA 4EPTA 4TRNA 4GOJA 3GBPA 4X1YA 4ZYUA 4MW2A 4L6IA 2M98A 4QPNA 1DHTA 2W6IA 1E3JA 1X2EA 2TSYB 3PPYA 3I28A 3UAWA 5AI0A 4YRZA 2WABA 2R96A 1PT6A 2J3HA 3ESXA 2W37A 2WSBA 1U80A 4UNQA 5K0BA 5KVQA 4XWWA 2R0QC 1T4DA 3I4FA 4NJMA 3ROGA 2FN9A 2H59A 4E51A 1XMQB 5FUXA 3K2IA 1AOXA 2OC9A 2QUHA 1X80A 4O6VA 4QPCA 4WCVA 4L9RA 4W9NA 3UMYA 2W2VA 5TB5A 3C39A 2HPVA 3ANSA 4RK1A 4OOEA 1XXLA 4W8OA 4KR2A 3FYUB 3PVZA 3BUSA 3DBRA 4BLPA 1QIGA 3DULA 1BH6A 1ZEJA 4B6OA 3OUUA 4DBZA 4TTTS 1TIBA 3RS7A 4E4RA 3DG9A 2C1ZA 3M5DA 1X86B 2BI7A 3AVPA 2G82A 5BR4A 4RDIA 1OBOA 1U2TA 2FZ4A 5ARCA 1DXHA 2H4YA 4RD0A 4LE1A 1E61A 1GZ7A 4IZIA 5KVSA 1PEAA 3TR6A 4DZRA 3BREA 3VPFA 4BX2A 2N3ZA 3H75A 1CR6A 1PJRA 1JDBB 3PGLA 1GVHA 4HDNA 5AH0A 3VU9A 4ABYA 1EWYA 2YBDA 2PUWA 4MWEA 4TYQA 1MO5A 3B6IA 3SYMA 3VA7A 1LI7A 3GZ4A 1PL7A 1ODLA 1LZKA 1UPTA 1PUXA 2IELA 3OCYA 4BX8A 1F60A 3PRYA 1NXOA 3BRWA 1MAWA 4ZXFA 5C52B 4OQDA 4WINA 4ZYVA 5AW2A 3S1LA 3KYCB 1P2BA 4P4NA 2RGBA 1YZLA 4MMYB 3L1VA 1Z26A 1COWA 1J2EA 3A6PC 1HDRA 1CQXA 4B09A 5AW8A 3GVCA 1KI6B 3L3BA 4URVR 2VT2A 3CCBA 1JFRA 5HA5A 3T12A 1NW4A 2C1XA 2INGX 2B4KA 5F3RA 3CX4A 2JGDA 5HIIA 4FFDA 3CONA 3QLJA 4QEDA 5AOAA 2SECE 2HA7A 3ZR4B 5A2QA 4IV5A 4F2HA 1LK0A 1KC1A 2FUKA 4GBJA 4G97A 1AUPA 1GYQA 2HIMA 4UEWA 1Z7GA 2XVXA 4LY3A 2NLOA 4X1KB 4AYXA 5B2FA 3A10A 1IY2A 2UVPA 1Z74A 1SOUA 3JRXA 2FNAA 2AEMA 3QKUA 3MWKA 1NP3A 3QVKA 1KY2A 3EZLA 4PIVA 4B76A 3ZE7A 4ABTA 3D7KA 1VGQA 2QRPA 2EWMA 3U4HA 4FYYA 3O4IA 3ICOA 4HSGA 4MA5A 4NQRA 4PBSA 4OAQA 1FYDA 3C1OA 1P3Y1 2JL1A 4Y9UA 5CNKA 5JT1A 3BEDA 4YDHB 4RK5A 3TR0A 1EX1A 2YVKA 3ROMA 1SVIA 3LTNC 3PQ6A 3PJRA 5LKAA 5HNKA 4KYTA 1NT4A 4PGMA 5F3DA 2QJFA 1KMMA 3QVSA 4C6SA 4ZI3A 3CVUA 1O95A 3BRWD 3OQMA 5AVKA 1QGDA 3CKMA 4PSKA 3IMEA 1UBUS 1L5QA 1HE3A 5JIBA 3WK6A 4BO9A 2EL9A 3KPYA 5F77A 3L2OB 4ZAFA 4BCCA 1D4FA 4BNKA 1COWD 3EQ7A 2C3OA 2HSWA 4KQMA 4UVDA 4BDTA 1YUBA 4B5KA 1ECGA 4BN5A 4HFMA 5HUJA 2MYUA 1CUYA 3HXLA 3T15A 3PC2A 1I9CA 1LVHA 4WK2B 5DX8A 5FKJA 2X0RA 3RM3A 3ZYCA 4G24A 2QE6A 3HVIA 1YJBA 4FR0A 1WHSB 4EUHA 3EVNA 4KAFA 5ALMA 1EZZA 2FW6A 3DVRX 2KPOA 3PDCA 2QTTA 4M1YA 3Q9UA 1FU8A 2CLMB 2DFLA 1Q0HA 2HRQA 3SLKA 2FSVA 2OAGA 3QPUA 4NU5A 4TZ0A 1T8SA 3K2BA 4KXFB 3NXKA 1E1MA 2NP7A 1E9BA 3HO6A 2A0YA 3CR8A 5JYEA 1YBHA 2JLAA 5BORA 3U60B 1FJXA 3O83A 4PZPA 1E2UA 3UB4A 5EP3A 4GVPA 2AS0A 3N74A 4AS1A 3PUVA 2O06A 2E5LB 1AZWA 5BYJA 1CHNA 4AYWA 4AIRA 2QTBA 2XW6A 4WFIA 1I7SB 2ZGVA 1OWOA 1LH0A 2JGEA 3SX0A 1O95D 3FYCA 4NAUA 2OCLA 4R01A 3QGMA 3LI2A 4OHMA 4WCFA 5LQNA 1UFRA 3E9EA 3HWX1 3D4NA 3F78A 4NVRA 4MRSA 4UHEA 1JSZA 5AT1A 1LC0A 2BZSA 2JJYA 5CA0F 3U26A 4EAQA 3D3WB 2DHRA 2VYNA 3G88A 2P0EA 1U5AA 3KEGA 5DGCA 3FOZA 4J94A 1LLUA 1U2DA 2QN3A 2XMPA 5LLTA 2NUBA 1IBCA 2X1MA 3INGA 3R09A 1MB0A 3R76A 1YTUA 3UQYS 3A8TA 5ADHA 2HU7A 1O6ZA 1PO7A 4BXOA 4OKIA 4NABA 3TZ6A 2RJOA 1IB0A 1OVMA 3KXKA 3PNLA 2CKDA 1WQ4A 3DEKA 3FWNA 5U9CA 3KR0A 3ILVA 2G9RA 3PYMA 4BUZA 1JFVA 5AK0A 1P31A 3SX2A 1DEXA 3FGNA 1JHMA 3IT2A 4GYJA 2R8PA 2ZQ5A 4RF2A 4DZZA 5J1SB 3EEOA 5NULA 1VFPA 2OV3A 2O3SA 4F1KA 4Z4EA 1T0UA 1XLVA 3CLSD 3VR0A 5FL7A 3PXGA 3DUFB 1V3UA 1WCIA 2NZWA 3K09A 4UU8A 4YUVA 2QRUA 3NHYA 2II6A 1N2IA 5JH7B 3GLIB 3P32A 3ZHTA 4DA9A 2PZAA 4RV4A 2C4KA 3ETNA 1OT5A 3EVGA 3Q40A 4OGLA 3IUPA 2P2GA 3SEAA 2VYND 2C29D 1MX1A 1E0DA 1R0LA 1JEJA 1SD2A 2IOFA 4ALLA 1RXVA 4MIEA 3TLJA 5KYNA 2ODNA 3M6XA 3DDUA 1G5FA 1BEEA 3Q3VA 4D4LA 5LD2C 1R16A 5IK2A 2OGUA 4EG4A 3HVKA 3I04M 3R6LA 4YJFA 3I1FA 1TIKA 3PNSA 2GMWA 1YA4A 2FFAA 2IE8A 2HI0A 4G89A 3D1VA 3LBIA 1R6TA 4EYQA 2D3TA 1T3HA 4D9KA 3B70A 1GY8A 4WNAB 2GF9A 1W5SA 3MRTA 8ATCA 4OXNA 1JEQB 4NJEB 3N8GA 3WIVA 2FR0A 3VH2A 4YMSA 2R6DA 1FFYA 3U4DA 3WV4A 4UTPA 4UUMA 2VPYA 3PQ3A 4ID3A 4NDNE 3TJZA 3CV3A 1TAQA 3OOWA 1CLUA 4H3VA 1Q21A 1R5JA 3DV0A 3HSYA 1SZDA 2R00C 4RFSA 5FL7D 3AVVA 2D0PB 1NRIA 2FQQA 4FQ8A 1A8SA 2W0SA 4INPA 4RFVA 3DYBA 5GZ1A 1LY1A 4IZHA 4QUIA 1T24A 2JF0A 3GFPA 2GARA 4NATA 5DHSA 1L7BA 5HDBB 3HUUA 3PQEA 5DYNA 1KY5A 4C0JA 2PWZA 5AM2A 5ADWA 2YFYA 3EZ7A 1XMIA 4AM8A 2PT7A 2VDUE 1L9KA 3WHPA 5KTSA 1ITZA 5A71A 2Y0DA 1WL8A 1H2HA 3OU6A 1ESZA 2BHRA 1H85A 2QKYA 4Q1BA 5JNUA 4XYLA 4MYHA 1QQBA 3RRJA 1NJFA 4Y2UA 4U6SA 4YH1A 5IK2D 3Q11A 3Q1LA 3ND8A 3SNKA 4WOJA 1FX0B 1HE5A 3I2JA 5T4FA 4UOEA 4C7KA 5T5QA 1ZD4A 4J76A 1KETA 4LJ4A 5C7OO 3AI2A 4HC4A 2HU2A 3M4NA 1DBWA 4J16A 4XB6B 5JD4A 2GPJA 4HAVA 1EGVB 2WUEA 2GAOA 3KQYA 3PFCA 4I1RA 4WLOA 1UL1X 4HLCA 3MFQA 4WZ6A 5EYPA 3NT5A 1BE1A 1XEAA 2A59A 2YJZA 3WICA 2I4IA 3G6WA 1AG9A 2VT6A 3ZCQA 5IDWA 1YZ3A 3M5PA 1D0SA 3HE3A 1EWRA 2YWDA 3FNRA 3G79A 3ORFA 3AB8A 3QBDA 4HJRA 4KLZA 4CR7A 1U5BA 1M34E 4L75A 2W4QA 5K6AA 1Y9DA 2YOGA 3ASZA 4UXHA 1JKXA 3QYFA 1B00A 2ZSIA 4M8IA 5B1SA 2VRNA 3CH5A 4FOPA 4IR7A 4QGGA 1SG9A 3FWZA 3UJDA 4X61A 2AQHA 1V2HE 3O84A 4HY3A 2DSTA 3ROPA 4LF8B 4I6GA 2IIPA 2MCFA 4CR6A 5C81A 4KCGA 1WV0A 3N2YA 1DAGA 4KB5A 2WKWA 2Z2ZA 4MI3A 5B1DA 4HATA 4QQKA 3TZQA 3CA8A 3QA9A 1TCUA 3DGEC 4IXDA 2BGWA 2R68A 3EF1A 3M4XA 5I9LA 5EMKA 1JXOA 3HU1A 3ZWMA 3UWMA 4UFOA 3TD9A 1J6UA 1ETHA 2AMFA 3VVCA 4RKQA 2NPOA 3T3HA 3OLXA 3ZK9A 3K8OE 1A9XB 4E94A 2LP4Y 1C9NA 2FJUA 4RZUA 1QVAA 2H1SA 2BMVA 3OA0A 3PRJA 4J7AA 1R5BA 4KXYA 2AMLA 4BU0A 4DRXB 4GL2A 3IAFA 2ZYRA 1FTQA 1NG9A 2A0KA 3NNSA 3OLQA 4QICA 5G41A 1QRTA 4WZBB 3GLHB 2VP9A 3KETA 1TYEB 4TUYA 3LWBA 3GPLA 1Y8ZA 1NKTA 1ZO8A 3QYJA 3UWPA 4OHYA 3M49A 2CHVA 1LK7A 1YAJA 1U28C 1ECJA 3ESZA 4MVJE 1WKCA 2B92A 3FUCA 4N6GA 4S1PA 4TV8A 3I2IA 3VOBA 1NJ2A 3LPAA 3QVWA 4YDQA 3IMGA 3LUBA 3WB2A 1MOSA 2MJLA 2VFAA 5BO5A 1GL3A 1AN9A 3EXEA 4F38A 2XZOA 1ZUNA 3PIIA 2O0JA 5CPBA 4YRFA 2Y1XA 5JNSA 2J32A 2OCAA 1SHLA 1OHHA 3U0VA 4PHFA 3UMFA 2GXAA 3E5MA 2P91A 1HFKA 2NZXA 2Q9UA 2FSHA 3BKXA 1G41A 2AI3A 2BEWB 4IDAA 5KMGB 8ABPA 3TTTA 1B0PA 2C07A 1SKAA 2CNLA 3E9MA 2ZSAA 5EUMA 2OM2A 2WV7A 1KAHA 2O2EA 1U4OA 4H6PA 4J9UE 4YYZA 1Q2XA 3AM1A 5LA6A 1IMJA 1SHTX 4DDUA 2XUOA 1RRGA 6GPBA 4ZHQB 4JGGA 1FFGA 2NO7A 1I94B 4M8KA 2D06A 2A7XA 1PWEA 4E7OA 2PZMA 4N12A 1Z17A 4EEZA 4KFSA 4DUZB 4NRDA 4RU1A 3INTA 3QPAA 5TMBA 1ECFA 4GXRA 1XU7A 2ASVA 3KJGA 3TNFA 3V8NA 5AVRA 5JRJA 2WUDA 4QPPA 1FNNA 2YH2A 4IWNA 4AO6A 1A4RA 3VHXA 1SKUA 4BVHA 1E8DA 3FDIA 4DA6A 2ONCA 3NHWA 2ZRDA 3E3MA 3LU1A 4OK3A 4JELA 3TW0A 1Y1LA 2G36A 3O26A 3RVBA 3MGKA 1OFHA 2HJRA 4JWKA 5BR1A 4PLYA 4K0KB 5JW6A 2J3QA 3IUMA 4KIFA 3WO0A 4R3UC 5CB0A 1GA6A 2GUGA 3L1UA 1PFVA 4BECA 2QQFA 2NO6A 5C5CA 3JD1A 2ZB4A 1OWNA 4RH3A 2IZ1A 4NJOA 1GNVA 5EP2A 1M2NA 1IZ7A 1R6BX 1J1UA 4Y7DA 5G4KA 3DC7A 1FK8A 3IDZA 2ORED 2BKLA 3O82A 4ZALA 4B48A 1MU0A 1PVVA 4N03A 3R3YA 5FX2A 2N47A 3FCCA 1GVNB 2FWRA 4X6YA 2J45A 1KP9A 2BAGA 2GEKA 2QUZA 2UZ1A 1K4YA 1B0ZA 5DW0A 4B79A 3KKQA 3DMTA 5FPTA 4ZCIA 5JY1A 3NBUA 4YCNA 3PA8A 4HFJA 4W9NC 5KDOA 2I91A 3PS9A 4KW7A 1KP3A 4NZOA 4OJNA 3HDGA 1JIVA 1VZ3A 3SIPA 4ZT7A 4JYAB 1MOPA 4II7A 1T6YA 2JZCA 2N1MA 3A6LA 3VISA 4QTXA 3HJNA 3IC5A 2Q4EA 1D8TA 2QP9X 4BUCA 1I4DD 4TN1A 4QYSA 3W6OA 5KU7A 1AUOA 2G17A 3NWOA 2FPOA 2H2HA 4GI1A 4GNRA 4JI8B 2DQYA 3IBGA 2VPZA 5KQSA 1UPBA 3EVBA 4LYGA 4O8CA 2XQJA 4OSEA 4PQFA 1UJCA 2H0QA 1DADA 1NONA 4ZQFA 1JUDA 1KI9A 3FVRA 4FTWA 4NZMA 4B2IA 5LYJF 4JYCA 1NUUA 2WHPA 3K0BA 4OK5A 3PHIA 3VZRA 5CFMA 1NNEA 2WG0A 3MFYA 3SY8A 1OF1A 5H81A 1ZX1A 3QEMA 2CUTA 1R0YA 3Q3JB 5D3MA 3OZIA 4ND8A 4F71A 3QPCA 4V03A 3PNMA 4ZMBA 3IA2A 1SA0A 2PUEA 1IN4A 2NM0A 2ANCA 3GP5A 3TEJA 2JFOA 3F4LA 1JQAA 1MW9X 2ZJZA 3BQMB 4EEKA 1BMQA 2F59A 4I4LA 2JJQA 2VPXA 5D2CA 1E5VA 3PHBE 3VH3A 1PR9A 5JTTA 3O8RA 3KAPA 2EWVA 1NL3A 2V7WA 4PG7A 2F43A 1ZJ6A 2AR9A 2QD3A 2IOYA 2IDZA 2KJQA 3SSMA 3THYB 4U00A 4HR7A 4HH3C 3EGXA 5HCNA 1JA0A 2P2CA 2VDKB 1GGNA 3HBMA 3PC3A 4IDQA 4JOQA 5F51A 2FDXA 3L01A 1HKHA 1H2EA 3G2KA 3FLEA 2O8CA 4YWHA 1TA0A 1AV7A 2XZDA 2QWXA 1SKMA 4J0EA 2A0XA 1U6KA 1H4TA 1E9RA 3SYKA 1G5PA 4YO8A 2WWFA 3DZKA 2WU3A 2OHGA 4LHEA 3MUEA 4K87A 1LDBA 1T2UA 5T6MA 3HPRA 4KN6A 4F4JA 5AOBA 5CEEA 1OD6A 1OZFA 5IYZB 1GARA 3FMPB 4HDCA 4ZA2A 2D54A 2H4XA 4K9KA 1JEYB 2QV7A 1E8NA 3WYAA 2G9QA 4KODA 4K9LA 4ZAYA 3QZUA 5EE3A 2YOFA 4MQ6A 4QPJC 5F7ZA 3IPCA 3RTCA 3WTBA 5B3LA 1U8UA 3UH1A 3UM9A 1O95C 3E58A 1RI2A 3FPAA 1KOJA 2E1RA 4BTLA 3FM9A 5DYGA 1AGNA 4HKTA 2PS1A 1SKYE 4RSRA 1FJHA 1N2BA 4Q82A 1HPLA 4E5YA 3EWAA 3EXHA 4ASUA 4HAIA 5B3JA 5J2UF 1QTQA 4KMSA 2B7BA 3K0HA 2P41A 3I09A 1NU8A 1XCMA 2BTQB 1XVUA 1WEKA 3WNDA 3A1NA 5C9ZA 1KIFA 2AG6A 2GPWA 1NXWA 3ANMA 1T5OA 4CKYA 2ADOA 1CU1A 2B8WA 3KEOA 3R5XA 3H3XA 5IAAA 1P0PA 4LE0A 3H17A 4KXVA 4CDMA 3OZRA 3WE7A 4F12A 3Q7PA 3PF8A 1AQNA 1MPXA 1VCHA 5TS3A 3QUSA 4IDHA 3OPYI 2FP4B 2XD4A 4MW0A 4QQRA 2DT5A 1RPZA 2ID8A 3IIMA 1JLLB 1J0BA 2FSVC 4UE6A 4YHBA 3A3YA 3DB2A 3MJHA 3KTFA 2R6CA 3D8BA 3TCXB 3RHSA 4BLWA 3W34A 3K1ZA 2ZR8A 5HQTA 1PJCA 2TS1A 9ATCA 2ZUDA 4C76A 3CE6A 3VYRB 5JBIA 4FBGA 4IO1A 2IGBA 3CG4A 4HQNA 3SE0A 5CVTA 3ONWA 3SVLA 3L4JA 3THWB 4LF5B 3CLSC 2DSNA 1MH1A 3RAGA 3TINA 3U80A 2GJ4A 2NAPA 3CBGA 3W6ZA 4PSUA 3EFEA 3F9IA 4WCFC 1ACJA 4BFWA 5IJ0A 1TC2A 1CVIA 2E49A 2H63A 5LXTB 2VWHA 1HFEL 5KYTA 2BEJA 1DUIA 1VHJA 2Q0HA 3M6IA 3PZBA 3RROA 4RDHA 3T6KA 3DV2A 4QODA 4YRLA 1JG4A 3HPQA 5EKDA 1U2DC 1FNSA 2PEYA 2HXGA 3CUYA 3UWSA 5G0UA 4Z86A 2PJRA 4MW1A 3SYRA 1YS1X 4N0PA 1M6VA 5CFQA 4CEJB 1SOVA 2RBEA 1ILWA 4G5YA 1QH1B 2OESA 3CWZA 4JJ8A 3JYLA 3OFJA 4JC5A 2W2TA 2EW8A 3AR8A 3G2OA 3H9EO 4MS4A 3SZGA 4D9EA 4DSZA 4F4IA 3ES9A 4CFZA 5KNBH 1E64A 4WTOA 5JCOA 3OQPA 4GP7A 1QE5A 5ALWA 3LNTA 5DZSA 1NATA 4DNPA 3ADOA 5KSYA 3HN2A 2QR2A 2OE2A 2H11A 2NVOA 4ADSG 2EU8A 2JD0A 3D2CA 4LVCA 4PGAA 4URWR 1RT9A 4FR5A 4PLFA 4CV2A 4CTMA 1OU4A 3SR4A 3GT0A 1IK4A 4O1HA 3B1KA 3H9UA 2IYAA 3LL7A 4K3VA 1VLZA 1CZOA 1G9XA 1RHQA 3K09C 2FOIA 3M3PA 3D1JA 4KFRA 1KY3A 5L3QA 1JDNA 3B5EA 3GJYA 4OO3A 3MJVA 2IUEA 3OE7A 3LUKA 4DEYA 2C57A 2VKQA 3PX2A 4NFSA 1U0BB 2ZZNA 1XPOA 1P0CA 3AVTA 4KU4A 4QDUA 3LQYA 3W2FA 5JEEA 4NS4A 2QI9C 1CJKC 1NC3A 5A02A 3HFGA 1EH5A 4CMHA 1UOPA 1VE3A 2FPPA 3GROA 3MJEA 5LIRA 3BAZA 4I55F 1D4OA 3ZLVA 3V4SA 1VCNA 2DH5A 2WJIA 2LGJA 4TWIA 3VO1A 3K9CA 5KSOA 1HQKA 1OZAA 2XIJA 2Q8QA 2W93A 3EBPA 2B1JA 3K9GA 2ODWA 1K4KA 2AF4C 5E9QA 2PVSA 1P4GA 4MRRA 2AV6A 4B3GA 4Z7JA 4O4LB 3UC5A 3QOWA 2L19A 3BL6A 4HN9A 1KKUA 1WB5A 2YVQA 4G86A 1ATZA 4OQ4A 4CEHB 1DV2A 4HRAA 4O2BA 4JBGA 1GQYA 4AJHA 4NE2A 3S2YA 3EX7C 1SUIA 1ULBA 2NNLD 4I1PA 2WUVA 1QORA 2D1QA 2FQ1A 3ON5A 3RYIA 5DNUA 3S81A 5TEWA 1ATIA 2TMKA 2Z8ZA 2JAOA 1VDZA 2PR7A 3DHVA 2O57A 4HFRA 1ADFA 3I0ZA 3K30A 1WXQA 5IWAB 3PYXA 2YMMA 2Z8YM 5EJ6A 3KDAA 1N5LA 4N49A 2Y1DA 4GZ5A 3OE7D 2YR0A 1UANA 4H0FA 4WK0B 5K3SA 1KMCA 1JSXA 2Z9DA 1N2EA 2I76A 3MWFA 2RB4A 1W5TA 4RJ2A 3K8QA 5ADVA 4I9HA 1R8SA 2HCTA 3JYQA 3K16A 3EZFA 3WC4A 1W5BA 4C43A 4MVJM 1RHKA 4NBTA 4WNCA 2N46A 3LX8A 1VXRA 5CJPA 1F7UA 3Q9LA 3Q8LA 3W9BA 5ALFA 4BV8A 2NUTA 5EGSA 3HADA 2JAHA 4YMWA 1J9GA 1SZPA 2XF8A 1T4BA 2ZWOA 2ZDQA 3KVYA 4O3FA 3Q41A 2ZEJA 1NAHA 5B1HA 521PA 4J16C 2B1GA 1G66A 1I4WA 5JS8A 4XYBA 1P0QA 4ZYLA 3GH3A 3DVAA 1T1RA 3FPEA 1UKBA 2ZKIA 3I5YA 1P3JA 1XPRA 2ZUTA 1T6ZA 3ZD7A 1K5DA 4K5QA 3QKRB 5SICE 3JD0A 2HFJA 3TGPA 2QBYA 2IYYA 5K6AC 1ZL0A 1YJ8A 2VNJA 1JB1A 5ER9A 5FOXA 3RB8A 4G5SA 2QJOA 4EA7A 5K45A 2QEQA 3DCJA 4HAYA 1EWQA 5L6LB 3PD0A 4YAEA 3KUXA 3O8OB 4QUGA 1ODJA 4XEHA 3TZCA 5FTWA 3TOSA 1U7OA 2B8NA 1E7WA 1VSQA 3SE7A 3VYVA 4UKDA 5REQB 4EB6A 1P5HA 2O9JA 3P19A 1CBUA 3AUTA 3U7GA 4RE5A 2Q4TA 1VI2A 1E7YA 3IV9A 3N6XA 1UUFA 4I9GA 1JPNA 4POAA 5TX7A 1WCV1 3C1TA 4P4SB 4Z3DA 1IHDA 1I6LA 3EJ6A 5SY4A 4DCGA 2Q9AA 1XSEA 1I13A 2CHQA 2JLCA 3F3KA 1QGAA 4MDFA 3CIOA 4UDYX 5LP6B 4FYVA 1KAGA 1RJEA 1XCBA 1JT9A 2YICA 4JSRA 3DAPA 4LRQA 3ENVA 3N2ZB 4EUSA 1F12A 3QU7A 2QZ9A 2FFRA 1R50A 4IIXA 3FTFA 5LBIA 3FVQA 1NBOA 4WY2A 1U0FA 2DCUA 2JLRA 2ZVJA 5DTRA 4DYHA 2O2YA 2O2ZA 2VSXA 1A2KC 1Z2EA 4M37A 3SMQA 5IANA 3KVRA 1W36D 2DXIA 1JG2A 3RBXA 3ESQA 5JYDA 4FUQA 1D7AA 2V96A 3G8CA 4DWJA 3FCEA 3I9MA 5EI5A 1TF2A 2OCDA 2ODPA 3YASA 1QGZA 1BXZA 2ZIUB 2PT9A 3T3PB 1ZOOA 3OCZA 1VL2A 2AK3A 1QYVA 2BMEA 3FRJA 5E3IA 3NC0C 3U7HB 2J5BA 2DP4E 1GU1A 1SGWA 2HBYA 4FD2A 2VF4X 4LZWA 4RX1A 5EWJB 4C78A 2ABWA 1KWGA 4DV6B 1GPNA 4GYKA 4U7DA 3EPRA 1X1RA 2D62A 1MHPA 1WXIA 4DLPA 3VNAA 1KC3A 3AINA 1JDSA 5K8JB 2FVXA 4XGNA 4YP0A 1YF3A 2ZOSA 5KVCA 2N9UA 3OKFA 4JI6B 1PDOA 4ZVTA 1YKGA 4G81A 4NV1A 2XMBA 3OFVA 2XNHA 3WGMA 4TKVA 2I22A 4C0QC 4DADA 2OZEA 4RTKA 2JGMA 5ICFA 1I0IA 2MR6A 3PHHA 4RPJA 3IO5A 4KTTE 4LHVA 1ZMBA 4AZ0B 4COOA 7AT1A 1DJNA 3FIJA 1DKOA 5DM2A 4MQLA 2MSCB 2DEUA 3IP7A 5DSZA 4JP8A 4KPEC 1X1SA 4GIBA 3WQHA 3KM0A 3VVMA 2FW8A 4D41A 3G2HA 4E31A 4F1JA 3KC2A 3MMXA 5LZ8A 4EVIA 4CLRB 4D4JA 3ONNA 2F8LA 1DWUA 3WS7A 2QPOA 3LIIA 3QQPA 2ZIWB 5DP2A 5BSWA 3V8MA 4E21A 1LDYA 1CF2O 3BWVA 4NK4A 4H0CA 4EKYA 4QUKA 3AYZB 1DQYA 2CKMA 2YINC 4K6GA 4MV5A 5JWHA 4D9CA 1P75A 1BD4A 1GL7A 4ER7A 4QVKA 4IJQA 3LHDA 3FCOA 1M2GA 2JLZA 4J6EA 1F2UB 2V3VA 2GNAA 1HLDA 4YRTA 3LE8A 5JD5A 3TN7A 3W2IA 3A6JA 1Z0KA 1KE1A 5E4YA 1YZHA 2P9HA 2V7UA 5K3CA 4KDCA 4RZIA 4GKJB 2FFJA 2CMKA 4H7EA 4Q01A 1EX9A 1EM8A 2LNDA 3NTRA 4TROA 4U7TB 3MJFA 1KZ9A 4IO0A 3Q8XB 4E08A 2AX3A 4ZI2A 4WQMA 1H6CA 3UKDA 1L4NA 1RWXA 3K9HA 5KQPA 5ALXA 4AP6A 1SQ6A 4PNHA 4AFNA 4MV0A 5BNWA 1I1OA 1KI2A 3ME5A 3DMTC 4OI0A 3JQEA 3TUJC 4NMWA 4D3DA 3UPTA 4IVQA 1SWWA 5AJYA 4F9GA 1NQ5A 1E1KA 2ETXA 1KI8A 3OQHA 4IKOA 3RG8A 4CDNA 5CB4F 3G5UA 5DNCA 5ELXA 2W9XA 1XCJA 3IP1A 2PLAA 4P7BA 1KPIA 4MQEA 3ZBQA 1DKQA 1ORVA 3FA2A 1AMNA 4HWSA 2PT5A 2N42A 5CG1A 5J4HA 1ZAKA 4QJ3A 4LF4B 1YZFA 3NDIA 4MRPA 3DZIA 4O1IA 5AXDA 3GLQA 4P84A 5AKHA 3MS2A 5K3BA 3VYUB 5IRCD 4HLUA 1NYQA 1FOEB 2RHJA 3V8QA 3OPYA 2B9VA 2HK7A 4JI2B 5A4JA 1UKEA 1UK6A 2IHUA 4YP1A 4B3XA 1H2YA 4JOSA 5CXSA 1EQUA 2JKVA 1CNMA 2J6CA 1ZICA 1A8HA 1WSBA 2AXQA 1U7TA 2F9FA 5EIOA 2V4MA 3EZ6A 4O2AA 4YRIA 3FB1A 4P2BA 4XDHA 3NPAA 1MTZA 3GJQA 3FZYA 5TT1A 4FN4A 3B5IA 3KHSA 2BF4A 2V7TA 1O5IA 2DQZA 4YCCA 2XQGA 2GKGA 3GRUA 5L8VA 4H1HA 3NM5A 2ZWIA 4O0MA 3LZDA 1Z2AA 1MGOA 4JJFA 2PEZA 5ESWA 2EKZA 4XYMA 1RJWA 2G6BA 3BE8A 1ODTC 3D54D 3DF9A 3R1IA 4UE2A 3T1HB 2GA8A 2QZ4A 3PV0A 5E3JA 2ZBEA 5AJHA 4A27A 2DR3A 4MXDA 4IIFA 5BWNA 2R3SA 3I73A 2J6HA 3JALB 1Z4OA 3P9YA 3R9WA 1FXUA 4MPTA 2JHCA 3AR6A 5E2BA 1OA1A 2GAFA 1QVVA 2R25B 3BE5A 3Q0EA 1B74A 1SVMA 2RGCA 2HQOA 3RS0A 5JJCA 3BQ9A 2VBGA 1YIAA 3QVXA 4M6WA 4Y1RB 1SPBS 5DYIA 5GWXA 1CEXA 2VHTA 5FOSA 1IM8A 3WL6A 1O6GA 4L27A 3WL4A 3UAOA 3MTDA 2QUKA 1UT6A 4YXWA 3OLVA 1M6WA 4RDCA 4JODA 4E46A 1PJBA 2ZSHA 1DAKA 3A4LA 4Y2QA 2IXEA 1QNFA 2F4NA 3RRMA 4ANFA 1BTOA 3MG9A 2MINB 2J3IA 2OBMA 2XIQA 3H2YA 2PSEA 3HV0A 4MYSA 5GZ6A 5BVGA 4KZKA 5T8KA 3CKKA 4R7TA 4PC7A 5DYTA 5I8ZA 1R8QA 2H7CA 2K5UA 3OECA 2BMFA 1FMJA 3AESA 4FKZA 121PA 1G8PA 2PK3A 3NNDA 3VDMA 5LYJB 5DIZA 4EJSA 1GOTA 2QSJA 5ELLA 3H99A 5DWQA 4ZI7B 1XFAA 3OM9A 2EJUA 2YWRA 1GZ4A 3EXHC 3AUAA 1II9A 5B3JC 3E4DA 1S3GA 4H7HA 5JNWA 1T4CA 2CZQA 4PR3A 3MAJA 4YQFA 1VJ1A 1YVRA 4W1QA 5AJVB 3H2BA 4D25A 4HWRA 5K2MA 5FI3A 1EFDN 2QNIA 3SZUA 2Q2QA 4MSUA 2TECE 3OX4A 3G89A 1E9CA 1E60A 2BV3A 3TLXA 2E4XA 3DNPA 3IV6A 3HJUA 5JVDA 1BCSA 4ZZ1A 1KGDA 4TLEA 5K3DA 2H16A 3SQOA 4EHDA 5I4CA 1RC1A 2OY0A 4O1MA 2NT3A 2PIDA 4WRRA 1E6KA 4FVTA 3T5DA 4YXWD 2G3YA 2WWYA 1GN8A 3ADDA 5FBWB 2XMDA 1GN9A 1OBFO 1I0ZA 1UAGA 4Z7NB 3NDJA 3KSRA 2WLTA 4UDOA 1Z6QA 2FPIB 3PX7A 1WIWA 5IJXA 3I04A 3EY9A 3BZUA 3NBAA 3CZCA 4FDAA 4DNQA 3RQSA 3DTVA 1XZCA 4J3FA 5HILA 5KTPA 1QF6A 3AUKA 1W0KA 3H97A 1CUEA 1RR6A 2Q6IA 5KNBA 4EZEA 4H7JA 4Q4AA 4BC0A 3DCNA 2BH2A 4QUHA 1L5RA 2OQIA 3JXEA 1BJTA 2X19A 1CE8A 3EG5A 1EGAA 5TQ0A 5BSHA 4GPD1 4I6JA 4GOMD 2VXCA 4GM1A 3BTSA 1CUCA 4ZCSA 4UNIA 3BMNA 1XGKA 1T6BY 1IOLA 1A2BA 2FCRA 4AMZA 4BO4A 5TGZA 4G0UA 4JGIA 5BMVA 3W8DA 2WPDA 3HR4A 4YJ3F 3S70A 4MWTA 3IVMA 4B3MB 2NYAA 3C6MA 4PYQA 4EMTA 3BJRA 1TLLA 2A9FA 1JPVA 4ZP1A 3ZU4A 3DKKA 1OIXA 1DIOB 2YFHA 4Q6BA 5JCOC 2CYBA 1V9SA 4AJJA 5ILQA 2UZ0A 4R1PA 1U2QA 2GGSA 2VAWA 1XLTA 4RPHA 4JA0A 4W7IA 3L40A 4B6EA 5BV7A 8GPBA 3ETEA 2FEAA 4YQYA 1X87A 4IEIA 1XVLA 4PPQA 4ZVKA 4QA9A 3P4UA 1IM5A 2EGUA 4DT1A 5FYDA 1YKSA 3BF7A 3PTLA 3EIUA 3DTVD 2QK4A 1BDHA 1M7BA 3DL7A 4GI3A 2HX1A 4C30A 5BPHA 1W0KD 3C3XA 2JGLA 4IFTA 2H7XA 2XDQB 1GZ5A 2I9KA 1N8KA 2J0EA 4LGYA 5HF6A 3UXYA 3B82A 1BDMA 1ZD8A 4XCXA 5JXHA 2PGAA 1WB9A 1I2MA 4O08A 4HEJA 3F5DA 3WNQA 4C3ZA 2OBYA 2JBAB 2JA2A 2QUJA 3GLKA 4ENVA 3C7AA 1MEOA 4MR7A 5M29A 3ANNA 2JIRA 2Q4OA 2HKIA 4MVJH 2GZMA 1BXRB 2XE4A 3GJ4A 1YBMA 3HP4A 4KUHA 4L3OA 3WA7A 3LLSA 4A73A 1ZZGA 2CL5A 4WXEA 4CKBA 3CVWA 1N1EA 1QGOA 3DPUA 5D86A 2BN4A 2O05A 1FVFA 4R2WA 1QK3A 4PLTA 4C5CA 3G17A 3BB4A 4JGBA 2IPOA 2ZR0A 1OTYA 4RF3A 1FLNA 1RKBA 3NJ4A 2Q49A 2XWSA 4Y2VA 2HYIC 4YTEA 3EH2A 2EFDB 1B6GA 2JDIA 3NBKA 3UB3A 1JAYA 4S04A 4ZOLB 3PQCA 4WUTA 2HZBA 2NPIA 5JWOA 3S55A 1W49A 2GPNA 4RK6A 1D0IA 2JFXA 3E9ZA 3T5TA 1WQ3A 3N2KA 3LVQE 5FUVA 4DC1A 2Z2KA 4G4JA 4IMPA 1QU2A 1DG3A 4AXBA 1DAFA 3ZDRA 3ZPXA 1B8OA 1GGVA 5HQ3A 4DKXA 4EJ0A 1MZVA 4F96A 1FF9A 2XUAA 5DHFA 4TQ9A 3JATA 4KPUB 1UJ2A 2SICE 4PZZA 4EYKA 3EZGA 4PNZA 4MS3A 1TJNA 2PGIA 3H8JA 4L7QA 1J56A 3PUYA 1TCCA 4EB8A 3AEUB 2CZGA 1LSJA 4J1QA 4PLZA 4Y1EA 1FSSA 2BCJQ 1FDTA 3SJZA 5HZMA 4L6CA 3VR6H 3OIVA 4UEJA 5D7NA 3DPSA 3LCUA 3DJYA 2VIIA 3B48A 3JWPA 4OMUA 5P21A 5EWLA 4EECA 5BR8B 3P9NA 2HIAA 2P1RA 2XYGA 2Y1GA 1OUMA 2JH8A 1DTEA 2NTYC 4H0NA 1T5BA 2IYXA 1H2ZA 1E4OA 2HF9A 3BXFA 3IH5A 3UUWA 3VBEA 3EXFA 1HOXA 1ZRSA 3GEIA 1HQDA 3HUDA 2IT1A 2ZIVB 4HSEA 1WHTA 2PS0A 2KW5A 4QYXA 1UXGA 1N3YA 4XDZA 1P5JA 2XGJA 2JDID 4MVJI 3OURA 4NYMQ 3DOFA 3L1HA 3OX2A 5FB3A 4GUDA 4HB0A 4GAEA 5DLPA 1F20A 3LQ2A 5G1OA 3VPSA 2A7QA 3G7SA 4DDHA 5BRAA 1R4AA 2Y2VA 1KEUA 5L45A 3ITDA 1KP2A 5TF0A 3KOWA 2PH3A 1Z8NA 3JQGA 4OG2A 2YW2A 3A4NA 2P2NA 4B40A 3TK1A 6REQA 5HFAA 4JP1A 1FQKA 5F7OA 2VZ9A 1QC5A 1ADJA 5GONF 4AZ3B 1UK7A 3EDMA 5L53A 2WF8A 3O1IC 1OLUB 3ZGZA 4OGFA 2AEEA 4MO9A 1G2QA 1Q0UA 2NTEA 2OORA 2Q3MA 2R751 3L6DA 4OYRA 2GLXA 1VB3A 4RS3A 4XR9A 3RGGA 3I5XA 1THGA 2X5JO 5KOIA 5JLJA 4DCUA 4WOCA 2VYVA 1PLLA 2DG2A 5J2TF 2PE5A 1R74A 4G9BA 1NMEA 2NACA 3GAMA 3ZHOA 5KHAA 2V03A 3W4KA 2BHTA 4IV8A 5CVCA 1TC1A 3HHEA 1JR2A 2UZ3A 4HX5A 4WCDA 2OZLA 1XQWA 2B69A 3O92A 3S29A 3U49A 4ZKDA 3QEKA 1FFXA 1GUBA 4Z2YA 2CXOA 4JT2A 1M7GA 1HV8A 1QJ4A 3G02A 4QXQA 5J4YA 1V47A 3I5AA 2YJ6A 4DIFA 5A7HA 1PUIA 2BDEA 1XQ1A 3DQQA 3AI7A 1M6HA 5DBOA 4L08A 4MV9A 4YB8A 4D3XA 4M76B 3USES 5AVQA 2IOQA 1JDPA 4OXYA 3T9EA 1Y3AA 3V7FA 3P9PA 1WS6A 3VQTA 3LRTA 1Q50A 3RHZA 4ENUA 3VC2A 3QEOA 4TV9F 1NUTA 4MCHA 3JD2A 1H22A 3SSOA 4CKXA 4EUNA 2I0FA 4BEVA 5FBKA 5HEKA 2EFEB 2BJWA 3A1TA 1XE3A 4D9MA 1PGNA 4I7EA 1TJ3A 3CNLA 2PKQP 4M1QA 1Z4MA 5BWCA 4UBOA 3T34A 1OT3A 5AIBA 2B99A 4GSYA 1JLKA 4KLAA 1FXWA 3OIUA 5T57A 2IXGA 5C2JB 3TQQA 2VI5A 2VYVD 2F1OA 3ZIAA 3QLVA 2QZJA 1DTWB 4MW4A 2ROQA 3QE4A 3UA4A 3W5HA 2Q1TA 2R4TA 3F2IA 2XCOA 2FFHA 5HKLA 2VDRB 3VTZA 3AP3A 1SQSA 4L5AA 4MUGA 1D1SA 1HK7A 4ND7A 5ALTA 3OZ7A 4YJHB 4M1OA 4BZZA 5BOSB 3K32A 4ZV9A 3IUQA 1M1NB 4H3KB 4HS4A 1P91A 1X8KA 4U7PB 4BKMA 4BMOB 2G04A 4BQPA 3PWTA 2OGTA 2IRWA 4ESVA 3U48A 2QMOA 1NASA 3F8TA 3FW1A 1AXEA 2FPKA 5FWAA 2PUHA 2ATXA 4TRRA 3HJFA 1R9JA 3MMNA 1TVKB 5LDDC 3ZZUA 3NPMA 3O4RA 4IMJB 1MV8A 4PX5A 5KJ1A 5K3FB 1V9CA 3J7TA 2ZBRA 4L4UA 1JECA 4J0CA 5BN3A 3AHCA 2LD4A 1U1IA 2VO1A 5FADA 3ZGOA 1E6WA 5HKAA 1TAGA 5BWBA 1U02A 2HSEA 1ZXLA 4PSDA 3U44B 3OOYA 1XMSA 1E3TA 2BP7B 4FILA 5AHOA 4A6EA 5I47A 3NBFA 4EPXA 5JOQA 4KAJA 1T2AA 2HMSA 3EPJA 2Y0CA 3V2HA 4WADA 3UAZA 4F8EA 4PIPA 1V43A 2NYUA 4Z8XA 3VR1A 3ZIAD 1W4AA 5CW2A 5A03A 4GPBA 1Z2OX 4YI3A 2IZZA 5AMXA 4BCBA 4F4UA 1ZS9A 2G1UA 3DDNA 4N6OA 4BLVA 2YZKA 9LDTA 1UPCA 2XHEA 1BDIA 4XWTA 5EOVA 4HVCA 2R8OA 4OQMA 2O7RA 1JR6A 4QRHA 4OJYA 3RRNA 3H2HA 2ADMA 4EF6A 1GV0A 4KBYA 5LU9A 1N7IA 3I4LA 4CN8A 2VTKA 4PPGA 5BNIA 3ECCA 4HGPA 5JJKA 3S1AB 4GXQA 4DQKA 4QU9A 4IMIB 2EYQA 3FG9A 3KZ1E 2HREA 4EMBA 2VBFA 4BDSA 5KCZA 2EBUA 5A9SA 1RKXA 1E0JA 2WUGA 3DEFA 4RK4A 4LJRA 1O58A 4Z9AA 2L2QA 4M0MA 3IAAA 2C7QA 2CLOB 3KVVA 4WESA 3UHOA 4B32A 3FTPA 1IHYA 1XP5A 2VJQA 1JEYA 421PA 2QTFA 3EQ9A 3PXDA 3QBJA 5L3VA 4P2GA 5C5DA 2GXSA 5M7EA 1WF3A 5DGXA 4MKRA 2LW7A 1EI9A 3MMSA 5EIEA 1WMAA 1KZ4A 2WEKA 4PRKA 1N8TA 3QFSA 2CDCA 4G8BA 4HXYA 4P3XA 3O8CA 1S2OA 4HLUC 4OI1A 3S1SA 3H1EA 3OZEA 2PD4A 4RTMA 3NGMA 1OLXB 2JARA 1UDWA 3JYOA 1RTTA 3JZMA 4JBYA 3ZV6A 3MILA 1JG6A 2WLSA 2CN1A 3HCFA 2XT6A 3FX2A 1RABA 4N82A 4GECA 1IXRC 3UJCA 3KYBA 1J09A 2B4AA 3MGAA 4JXJA 4QFBA 5L4SA 1VTKA 3MCUA 3I9LA 3MWLA 5DTJA 4TT8A 3EEYA 5IBCA 3WNBA 1P19A 1ABFA 3VJMA 2P75A 1J5PA 5AJUA 3MMPA 4YJKA 3EC2A 3RFUA 2PIAA 5B7GA 4IY1A 1MRNA 3EISA 4MQBA 2P1ZA 2WSIA 3AGQA 4FSHA 3IOYA 1X7XA 1XT6A 1OWLA 2BFNA 2PX3A 4GF5A 5I7EA 1WMBA 1PL6A 1CUUA 5BT9A 3IVXA 4MQ4A 4U7FA 3RAEC 1ST3A 4FNAA 2NVWA 3FTNA 3ZTYA 3FYSA 3HJCA 3C45A 3F0TA 4DIDA 1QK5A 2YN4A 1U0NA 2I7TA 3OQ1A 1N6LA 2BSQA 1CDZA 3ER6A 2GQ0A 3ZHQA 3U4QB 5CB4B 1NI4B 7GPBA 1H0HA 3ZHSA 2A5LA 4PLWA 1WW3A 4QX6A 2FPSA 4MQ5A 4O4HA 3H7AA 2RDMA 3BH0A 4GGPA 2Q27A 1IBKB 1NULA 3RS8A 4GZ6A 1UP6A 1YS9A 3ODGA 4B3HA 5FUYA 1YQWA 3F96A 1TO1E 1JDUA 4L95C 4QRIA 4ONEA 2F64A 1RJFA 2EZ9A 3RR2A 2P8SA 4PLHA 2QX8A 3BYZA 4JBLA 2O52A 1T4GA 4Q02A 1AVTA 4ZVVA 2OLKA 2VSNA 1G6HA 3JVEA 5TV2A 1JFFB 2YMLA 3OOEA 1Z0ZA 3ZY3A 4AUNA 5B55A 2PTGA 3COYA 4PZDA 5F78A 4IHAA 4EJSC 2I2WA 2FQWA 1N1MA 1V96A 2BKAA 3DVQX 1K8YB 1UBKS 2Y6VA 3LBHA 4JUAA 5CBPB 4Z4IA 5HJEA 5K0SA 3O8DA 5EHZA 3BGSA 3FOBA 1OROA 2Q1YA 4ZCRA 3PNKA 4BQOA 3ED1A 3ZY2A 3L7MA 1BWRA 1T15A 2GB4A 3PITA 4ER0A 4RS4A 4JYZA 16PKA 1NVKA 4KRXA 3TAXA 1T1EA 4J8PA 4Q05A 1R4MB 5LJLA 3QW2A 3GFGA 1SXJA 2X4IA 4M49A 5CR9A 4D2IA 1G21B 1JDVA 1OVGA 2NQTA 4ND4A 3PSHA 2O8BB 1QCCA 1MGPA 3CVJA 5AM4A 3SQDA 7REQA 4EFDA 4L15A 2QSZA 5C1OA 4GPEA 3DDOA 3QM1A 4YDRA 5TXGA 2VQ6A 3IQWA 3RODA 5MFZA 1ZGJA 4JC8A 4GI7A