1KRWA

Solution structure and backbone dynamics of beryllofluoride-activated ntrc receiver domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
124
structure length
124
Chain Sequence
MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAISHYQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITROGEN REGULATION PROTEIN NR(I)
publication title High-Resolution Solution Structure of the Beryllofluoride-Activated NtrC Receiver Domain
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Signaling protein
total genus 34
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2002-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1krwA00
1S8NA 1Z17A 2JK1A 2FMHA 4W5OA 1DJMA 3CG0A 1E6MA 2FSPA 3RVKA 3SNKA 2M1ZA 3EAFA 3I5AA 5KC9A 2P4UA 4G0MA 1TVMA 1C0EA 1QPZA 3GV0A 3CKMA 3MIZA 4MS1B 3DBIA 1U2PA 3Q7RA 1NATA 1FSPA 4TLMB 3OLYA 2FLKA 2JBAA 2N9UA 2R47A 3M9XA 3NNDA 1ZAYA 3OM1A 2Q5CA 4KVFA 2PUDA 3GWGA 3QLVC 2E4VA 6CHYA 3G85A 3BRQA 3QK7A 2JVJA 3LUJA 5DTEA 5TQ2B 1PEAA 3LUDA 1RXIA 4RS3A 1DG9A 1YS7A 3N8IA 4WWHA 5CNJA 3DLHA 3LUKA 1KRXA 1B00A 3LUCA 2GKGA 1ZGGA 2HPHA 4P98A 2FVYA 3QLUC 3CZCA 4IGAA 5EWJB 2F8SA 2IOYA 1L5YA 3HUTA 3Q41A 1VPWA 3IPCA 4QICA 3RVOA 3OO1A 4W5QA 3RVPA 1ABFA 1D1PA 4LE2A 4F06A 4Z4CA 1JX6A 3TD9A 3L49A 1JBEA 1BDIA 3Q9SA 4IMJB 1DC8A 3HDVA 2PUBA 2ZWMA 3LUGA 4G97A 3H5OA 4H60A 4MR8A 4DN6A 3RVNA 5EWMB 4N76A 1UDRA 3LTEA 1M5UA 2LPMA 3O1JC 3JPWA 1DCMA 1P2FA 3HS3A 2E4ZA 5TQ0B 1GCAA 1QNLA 1AB5A 4JOQA 4PICA 5DLEA 5IX8A 4YGXB 1LBHA 3JVIA 1YMVA 2X7XA 4RXUA 1PHRA 1ZITA 2FLWA 4RY9A 4EYKA 1VLZA 3GT7A 3R0JA 2VUHB 4KMRA 1YTUA 3EJWA 2HSGA 3QLVA 1AB6A 4PEVA 4RK4A 4TLLB 3N0XA 2RDMA 4W5NA 3GBPA 1D4ZA 1OXBB 4YS6A 1MAVA 2QSJA 3JS5A 3KJXA 4IMIB 4N47A 2VUIB 4XFKA 3H5TA 1GCGA 4XXHA 1VKRA 3IPAA 4Z4FA 2IPNA 3TMYA 4MQFB 4WXEA 3QLUA 3KYIB 4F12A 3I09A 5GQSA 4YR7A 4JB0A 5B3JC 5ED4A 1QO0A 3RVMA 4MR9B 5DKFA 4RK6A 4GPAA 5IEBA 1CEYA 3LMKA 3M6MD 4PYRA 3UUGA 3L6UA 4RK0A 4HYEA 2WB4A 2JCGA 1ZGZA 3T8YA 4MQEB 2NT4A 5JNTA 2KYRA 4YP9A 5CNKA 1USKA 2LBPA 1MB3A 3NNSA 4G86A 2I6FA 4MRMA 4N41A 1ZH4A 5EWLA 3EQZA 4Q6WA 1U0SY 3HK2A 1ZHHA 4P1ZA 2ZAYA 4KV7A 5IUNC 6ABPA 3VNBA 1A0OA 3NNNA 4MYRA 4YWHA 1E2BA 2E4WA 2V0NA 4PZ0A 1P6QA 3RVLA 4S05A 3LUFA 4E7OA 4KPYA 1NXTA 1XHFA 1NXWA 1TLFA 2HQBA 4TMYA 3HZHA 2MSWA 3QEMB 5T3YA 4E7PA 2E4XA 3O1HB 1K66A 3CG4A 1MB0A 3QELB 3RVJA 5JS2A 3MYYA 1EWVA 1J56A 1FFSA 2PUAA 4W5RA 3LUHA 1E6KA 4LDZA 1SXIA 4MS3B 4TN5A 2PJUA 1D5WA 3MMNA 1QQAA 1QKKA 2JB9A 5B3JA 1ZY2A 4LDAA 4JASB 1APBA 1USIA 2RJNA 5IC5A 3RVSA 3K9CA 1Z18A 4Q6BA 1QP7A 3H75A 3VNAA 5JNWA 3H6HA 4N0PA 4LX8A 1GUDA 3O2JA 4RU1A 1JH9A 3M9WA 4WXMA 1RXEA 3OQNA 3FGZA 3F6CA 4O1IA 1ZDMA 3QX8A 2YHBA 4WUTA 1H9CA 3C3MA 3RVRA 3OMXA 3SAJA 1A2OA 4ETNA 2O20A 3HEBA 3I45A 4MR8B 4QYMA 3RH0A 4OLBA 1HEYA 2IPMA 5TPZA 1M2EA 3QLTA 3FFTA 3LKBA 3O74A 2MYTA 4JA2A 4O1HA 3LUAA 2MSLA 1DP4A 3O75A 5KQGA 4L85A 2BGGA 4EUKA 4S04A 5BRJA 5FWXB 5E3JA 1M2FA 3TX6A 1P6UA 3F73A 4MR7A 2FMIA 2IDMA 3W9SA 3OMWA 2YHAA 1Z25A 2JRLA 4RK7A 4RV5A 1EWTA 1SXHA 3MM4A 3SY8A 5PNTA 2HJ9A 3MF4A 1ZH2A 3D8UA 1T34A 3BRSA 2PUGA 2H3HA 5CNMA 1XHEA 3C3KA 2IPAB 3LOPA 1NXPA 1SXGA 2ID7A 3H1FA 4RK5A 4XAQA 1EFAA 4F11A 4KRFA 1C4WA 4MS1A 2QXYA 2PUEA 1LK0A 1RZRD 2FEKA 4RZSA 4MGEA 3OQMA 2LUOA 1YS6A 1Z13A 3F7NA 5GOTA 2QV0A 3Q7SA 3A0UA 1DCFA 4G0OA 3E61A 4XLTA 5TPWB 3KYJB 3JTEA 1Z2EA 3N0WA 4YRZA 5BRAA 4OBBA 1MVOA 2FQXA 4Z4IA 5FWYB 2W42A 2FN9A 4H3KB 2MYUA 3MA0A 5DGCA 4Z0NA 2L2QA 4D74A 1Z16A 2JVIA 3OM0A 4WZZA 5FBKA 3EULA 4KFCA 1FFWA 1PNRA 3NHZA 4GNRA 4NV3A 3HXMA 4JP1A 2FEWB 3ILHA 1DBWA 2NZVG 1DRJA 2IPLA 5JNRA 2RGYA 2NZUG 1JDNA 3O2SB 1JF8A 4CBVA 3BBLA 2R25B 1FFGA 1BAPA 2QU7A 3CS3A 1LBIA 4KK4A 4MAAA 2FQWA 3CRNA 4MRMB 8ABPA 1ZVVA 3IP6A 4KREA 1BA2A 4H3HB 1PUXA 4RKRA 4EVSA 2E4UA 2WJWA 2FKAA 3LKVA 2CD7A 3CZ5A 3KSMA 3O21A 4KQCA 5KI6A 3HUUA 3HM9A 5TQJA 4Z4EA 1USGA 1NTRA 2RJOA 4EGSA 1BDJA 2P9HA 3UKJA 3T38A 4MLDA 5EWMA 4DQDA 2ID9A 1W25A 5T7BA 1FQWA 3URMA 5KC8A 3OLWA 4NICA 1PNTA 1PEYA 4Z99A 2PE5A 1BVHA 3H5VA 3KKEA 3KTOA 3HV2A 3FFXA 3SM9A 3EGCA 1DCKA 2GX6A 5JS1A 1SRRA 5HKOA 3FMVA 2CHFA 4MPTA 2AYZA 2WMYA 4IF4A 1CYEA 1YIOA 4ZPJA 3KLNA 3QEKA 1JYEA 1U8TA 1JFSA 3N6VA 1JYFA 2HQOA 2B4AA 2PL1A 3KS9A 3N0RA 5HSGA 2FEPA 2XDYA 3GYBA 4LE1A 2JBAB 4RKQA 5JNSA 1JWLA 1F4VA 3HO1A 2IKSA 4MLCA 4KZKA 5F64A 3T6KA 4MQFA 4QYWA 3OLXA 5KWSA 3C3WA 1R8JA 4B09A 4DADA 2IYNA 5I4CA 2A9PA 3IDOA 3C97A 3OLVA 1JDPA 3CU5A 3SG0A 1NXXA 3KG2A 3K4HA 4Y9TA 1NXSA 2L17A 2QVCA 3CLKA 4MR9A 1L5ZA 3N53A 3RQIA 1KRWA 4MS4A 3CTPA 3Q15C 4O5AA 2R48A 1JL3A 3KHTA 3HSYA 4OATA 5IUJC 2NT3A 2QZJA 1URPA 3JVDA 1I3CA 1NXOA 4KQ9A 1XWWA 2H0AA 1NY5A 1Z12A 1Z15A 3DGEC 4FE4A 4IRXA 1BDHA 4RDCA 1YMUA 3N75A 5TE9A 3F6PA 3IP5A 3DZDA 5C5CA 2GI4A 3FDFA 3H6GA 3IP9A 4EVRA 4XARA 4W5TA 4Z4HA 4LZLA 4YLEA 2DRIA 4F3TA 4HNRA 1E6LA 4PE5B 2L18A 4KK3A 4JB2A 3HVRA 2WWVD 5JNUA 3LFTA 3QEMA 1M5TA 9ABPA 1IIBA 5BQ3A 1ABEA 3A3KA 1DRKA 3OLZA 1ISRA 2TMYA 3CFYA 3QELA 1CHNA 2LIVA 4RY0A 4UHKA 1EHCA 1NXVA 2WRZA 3EODA 4YV7A 1RZRA 2PUCA 4IILA 3JPYA 3TB6A 3GRCA 5IULC 2GWRA 4MS3A 4ETIA 3QX9A 1DBPA 5ABPA 1ISSA 2MYPA 4G0QA 4RY8A 5DCLA 4WT7A 1VRVA 2QR3A 5BR1A 1U04A 4RWEA 2F8TA 3O1IC 3H5IA 3NBMA 1KMIY 2OQRA 4HNSA 4NQRA 2J48A 3BILA 3HDGA 1DC7A 4ZJPA 2CWDA 2QW1A 3DGFC 1JLKA 3CHYA 4XASA 4QPJC 2MYNA 2NUBA 2PL9A 4Z9BA 3H1GA 4G0ZA 3IP7A 4YO7A 1DBQA 1LJLA 5TPZD 4ETMA 5IEJA 5TQ2A 4OLAA 3Q7TA 1A04A 1TMYA 4G0PA 5FBHA 4F8JA 4Z9AA 3D02A 4RK1A 4D6YA 2WJAA 2GBPA 5C5EA 2A9OA 4ZMRA 3A0RB 3FFWA 2QVGA 3GL9A 3S99A 4EYOA 1GUBA 1W9HA 4LE0A 5D2CA 5FWXA 2HQRA 4YCSA 3H5WA 1MIHA 5EWJA 1SD5A 1F51E 1KGSA 3A10A 3KLOA 4M88A 2VK2A 2FW0A 4OTZA 1JFTA 2PUFA 2FQYA 1D1QA 5EWLB 3MQ4A 3GBVA 4OG2A 3G1WA 3ROTA 3GA5A 1QP4A 4G0XA 3I42A 5HQJA 5CHYA 3HJFA 1JFVA 3BREA 2FN8A 3OO0A 3SQNA 2A9QA 3C6QA 1Z26A 4UHJA 4LRQA 2OENG 4JAVC 5IUKC 5HM6A 4NCAA 2R4QA 3TO5A 5TQ0A 2M98A 1JHZA 1RPJA 3CNBA 7ABPA 4Z4GA 1YK0A 2JVKA 3ILYA 2B1JA 4G0YA 4ZMSA 3UK0A 5KQMA 4RXMA 5TPWA 2MSKA 1QQBA 2FXIA 3JY6A 4EYQA 5FWYA 5KQLA 4EY3A 3DLBA 2CHEA 3B2NA 4RXTA 2PLNA 3ROFA 1D2AA 4NCBA 1TM2A 4N03A 2L19A 2VYCA 4MS4B 1ZN2A 3HCWA 1WETA 2AYXA 4RSMA 4KNYA 4EYGA 5KQPA 2PAFA 1GLGA 3NHMA 3OQOA 4L4UA 4N0QA 2WY2D 2PMCA 3EDCA 4FB4A 1Z2DA 5IBQA 1YK1A 1QO0D 1U2QA 2PKXA 1K68A 1QMPA 2FTKE 3E3MA 3T95A 1ZESA 4ZYLA 2FMKA 1RNLA 1DZ3A 1TJYA 1P8AA 1OXKB 5JNVA 4EVQA 4ML3A 4Q7EA 3EQ2A 3RVQA 2LP4Y 1YVUA 3H1EA 3O2QB 1Y1LA 2FMFA 1LJUA 4MQEA 2E4YA 5CNIA 4MR7B 4HNQA 3KCNA 4FE7A 3P9YA 2A9RA 1EWKA 4D6XA 1EAYA 3H5LA 1QP0A
chains in the Genus database with same CATH superfamily
1Z7EA 1PJAA 1QPBA 1RM5A 3ITDA 2DUWA 3KL2A 3M9LA 1D7OA 3CPJB 3KELA 2OCLA 3RVKA 3BWCA 5A4FS 1GT6A 4RJIA 5LWQA 5C1DA 5TIIA 1KMCA 4DR4B 2ZYTX 1ULAA 5KNCD 3OJWA 4JBIA 3AYXB 3AM1A 3ENWA 2QXUA 1V1RB 3KAKA 4FX2A 2WA2A 3R3WA 1N2ZA 3EWSA 1E5VA 2BY4A 4N82A 4DDVA 3W5SA 1P74A 1XDUA 3A9SA 4C0JA 2JI9A 5K0CA 3IBGA 4KVFA 5DRTA 3H7IA 3FUWA 3W9BA 1ZHOA 4OHMA 4FZ3A 3CR8A 3LGXA 2J6CA 2V55B 3LUDA 4BFYA 1Z0FA 4L50A 4QOSA 4MYCA 1P7VA 4J43A 1HLDA 4CQMB 2Z2KA 2CC2A 2VJAA 1E3WB 1W1IA 3L93A 3TZKA 4BRZA 2RBGA 1EFUA 2G80A 4FI3F 5IG2A 3NAMA 1KEEA 2G04A 1SXQA 1OBCA 1QYWA 4I4CA 5BNWA 4M89A 4HF7A 4RTPA 2DFDA 5HVNA 2REQB 3L77A 4QQNA 4DHWA 4PNEA 1QE0A 2W6OA 3Q41A 4IMPA 2CLOB 3OIGA 1XG5A 4MUBA 4BNMA 4YJ2A 1IJKA 1DBVO 5G3YA 5CT4A 5J63A 4KWTA 1USWA 3H1AA 3LWZA 4HTFB 4QEDA 5DBGA 1D1PA 3THOA 4LE2A 3W6OA 1F5NA 3QVSA 4OLHA 1G3RA 2GZAA 4TTAA 4TVBA 3R7AA 3UXYA 2R97A 1LFDB 4YONB 2A0UA 3SQLA 3AFGA 1VSBA 4AY4A 4CFZA 4I6JA 4F3YA 1PKXA 3GRYA 3ESXA 4JJAA 4QRIA 4QELA 1K9SA 2XCOA 4GBJA 3RFUA 3R09A 2DY1A 4NBNA 2O23A 1WQ3A 2JNWA 1F3LA 2RGNC 3L7AA 4GXQA 1C7QA 1CQWA 1G55A 3CZMA 4KU4A 4AZ0B 4Z7NB 2ID8A 4DR7B 2MWMA 1W44A 1VE1A 3VR3D 3HCDA 2P8SA 3GEBA 3VV3A 1W36D 2RHGB 3ZV6A 1VLZA 3EXIB 3N39C 4GAEA 4MTCA 4GPD1 3WL4A 2WHRA 5HDBB 2OCBA 3DOHA 4KGDA 4DMHA 3G8AA 1M83A 3EJWA 4LA4A 5C52B 2RDMA 2FOLA 5AW4A 1A27A 2H9YA 4OK5A 3I9KA 2C5EA 3LFHA 4TTIA 3ENQA 5P21A 4BCDA 2F8MA 4RLFA 1ZK3A 2G63A 1K8ZB 3EMKA 1KY2A 1T1RA 4IIFA 5HK8A 3TIGA 5KWVA 1U8FO 4I50F 1MZVA 4GO1A 5FEUA 1GCGA 1KRHA 2H16A 2QYSA 4QO8A 4RC9A 3ZCPA 2GSDA 4D96A 2VYVA 1V35A 2H3EA 5FLKA 1JIKA 1E3MA 1U7XA 3ZDFA 3RS7A 1KARA 2IBMA 4BVHA 5ALPA 3PX2A 1WDLA 3GJ6A 2AI3A 1VSUA 3FWPA 1MO6A 5CP8A 1SWWA 1FYWA 2YZNA 2XYRA 3DYVA 2QUBA 1CUDA 1ORVA 3OIFA 1KKMA 4RFSB 4TRRA 2HI0A 4D5EA 5KU1A 3GFOA 2BFNA 4N3GA 1FDTA 2OBXA 4IRUB 4HLQB 4DLPA 1C4XA 1LB1B 3WXMA 2YFKA 1W2GA 2WAOA 4BAZA 5IXYA 2W0MA 2XGSA 3L46A 2ZRAA 2JCGA 1Z6AA 1ITZA 2QMYA 4ZIRB 2R7NA 3C14C 2AC4A 3M5PA 3FNRA 3EXEA 5ALDA 3RSGA 1GO2A 4H6WA 2D1FA 1UOEA 4EAAA 1SKBA 1CZLA 2GHIA 1E7QA 1RKVA 1WU7A 2GBIA 3AR6A 4HXFB 3ETCA 2DTXA 4L02A 4QU8A 2GO1A 5AJTA 2IYXA 2EBWA 1OBHA 2X15A 5G4KA 1VA5A 5JARA 3TVYA 4GX0A 1VBKA 2BN4A 2H9IA 2Z8ZA 3O3MB 5FTWA 1OFHA 2OAEA 4KV7A 5H68A 5T6MA 4EA8A 2YXPX 2YY6A 4JH0A 4F6LA 2XUIA 1QG2A 1XZCA 1RXVA 2V0NA 3TI9A 4C76A 3DW1X 1F1BA 4DW8A 2XWBF 3JATA 4GZ3A 1Q0TA 4C0AC 4R1UA 1QB7A 2FP3A 2PK3A 4GVPA 3HZHA 2ZYIA 4J49A 4E7PA 4PCVA 3AUAA 3ADOA 3OJXA 4D7AA 3DLAA 1NOIA 1ZA2A 2CHQA 3LYUA 5JMPA 2XZOA 5KYKA 4AKHA 1NVEA 2B9VA 2IZ0A 4PX3A 1DUIA 5AO9A 4B83A 2VQFB 4DIMA 1JR3E 1P80A 2P6NA 2WF6A 4IBOA 1ZUHA 4NS1A 4TLCA 5IVPA 1HDCA 4UBMA 2GARA 3FDZA 3U0BA 2D8AA 3HI6A 4I4TA 1I30A 4EPWA 4D3DA 3ROPA 4RIHA 4WY5A 4M38A 4XD2A 2JJ8A 4A4DA 3QWBA 1KEEB 5A7FA 3NG1A 1CP2A 4I36A 1MJGM 4MGKR 1USIA 3V48A 2WSBA 2XODA 5LIRA 1IOWA 2G6TA 1JH9A 1KDYA 3PRKE 3G1UA 3HB0A 4M7OA 4YJ2B 4HUTA 1QK5A 4LRTB 4PRZA 3KSAC 3JQAB 3FGZA 1QRTA 1J07A 1NRXA 1UMCB 5LYYA 3RYIA 2ZB2A 3UHPA 4YXFA 1HYGA 3OMXA 2FZEA 3EFOB 4BN0A 2AXEA 3DWFA 4DR6B 3JWGA 2FMUA 4OLBA 4J7XA 3ONDA 4PGFA 1YNOA 2QSUA 4J0CA 3HWX1 4B44A 4Q93A 2MSLA 4KN5A 1LY1A 1M2OA 3AEKB 2R1TB 3ZOZA 1PL7A 6NULA 1QONA 1BGWA 3OD5A 2OBYA 2H1SA 2RHWA 1E2HA 3JR3A 1DLIA 1MPTA 4PAWA 3JCZA 5BQXA 5K7SA 1AQ6A 1X1RA 4V0ME 1Z29A 1KE1A 4BP9A 5FBLB 1UFKA 2N1MA 3UK1A 3WGIA 1ADGA 3DVQX 1ZH2A 4JK3A 3MJFA 1HO3A 2GEKA 1B16A 2H3HA 4OKSA 3TXAA 4DRYA 4IJ5A 4GPZA 4Y18A 4ER0A 2C7RA 1YZ3A 4K2HA 3BHMA 3BPSA 3HKCA 3PE3A 2NO0A 3DBLA 3Q98A 3QBTA 1VJ1A 3TLAA 4LSMA 2Z5FA 3DOUA 5A6VA 2FEKA 3ZK8A 1UBFA 4RH3A 1QH1A 2HMUA 4WPGA 2I2FA 3NHKA 4RH0A 3AF4A 2E2WA 4H7FA 4JHXA 5EZQA 3QVMA 4ABYA 3VAAA 2PX8A 4YRZA 2BPOA 3NDRA 3R6WA 3THSA 4ZRNA 1EXDA 2IP2A 5FL3A 4GOMD 2WF8A 1XCMA 3X1ZA 3AP3A 4CE6A 2XIJA 4OL9A 3T7RA 1LKZA 3ICVA 2FPIA 3EZ6A 1GCUA 4DM3A 3EIOA 3MOIA 3VPXA 4LYGA 1KO1A 2IPLA 3CLSD 1OX5A 1SOVA 3HI4A 5ERXA 3U6KA 3ETDA 4PSKA 5CT6A 1ZUNB 4DSNA 5T41A 3WI7A 4DCCA 4TYYA 1BAPA 2H7YA 3CS3A 4QL3A 1NRIA 3IP6A 2J0QA 4H3HB 3MAGA 3QFRA 2C7PA 4XUDA 2VDPB 3SMQA 5KI6A 1F6DA 4CM3A 3UPDA 5HRAA 2GXUA 4PYJA 1VMAA 3AL2A 4JYZA 2BEVA 3VYUB 1JSLA 1DWOA 2WSLA 2I62A 3UKJA 3KAQA 1NR7A 3WSWA 2OGTA 5GMOA 1YACA 1RP1A 5DGXA 1CUGA 3IB3A 4OQZA 4XQ9A 3AUUA 2B4YA 4D4GA 1CUIA 5CW2A 3KZ1E 1KZGB 3D0KA 2IRWA 3N0TA 4H1TA 1HQCA 2E48A 3FI0A 5CVDA 3A4LA 3CH6A 5JRDS 5FH9A 1AHNA 1UEJA 1T3TA 4K9PA 1TZKA 2OD2A 2D8MA 4ZO7A 1XZKA 2CXRA 3GEEA 1QB8A 3BCUA 4JKYA 5JC1A 2ARKA 1NVUQ 1QAOA 3NWEA 1WEHA 4B40A 2J87A 3CW9A 1SVUA 1KTIA 1CF4A 4GR4A 5AVYA 3V34A 1B4DA 3RRNA 1AXGA 2GJAA 4OHKA 3RC9A 3KSZO 1G4HA 4FLMA 5DHAA 4NWIA 4LKRA 5KSWB 2I2DA 1YS9A 5DE3A 1V47A 4IDNA 2FPSA 1GPLA 3FUUA 3GGPA 2PL3A 3LD9A 5I4CA 3T1NA 1LH0A 3CKKA 1HOTA 3IDOA 4P33A 4WE3A 1KWKA 4XR4A 4L3OA 1DBRA 3M3DA 1NVAA 2YWXA 1RWKA 3P0IA 4QTYA 5B6PA 2AEMA 2WIKA 1W8IA 5I7OA 2C88A 3IXQA 5JVDA 3LUPA 1YONA 3R3JA 3RQIA 3AWDA 5JCPA 5EJAA 4QECA 3Q15C 4JFAA 1WUKS 1XNGA 1VLMA 4KXFB 4DAEA 5IUJC 1SBTA 1M2OB 4OHPA 5PGMA 5ALGA 1HI9A 4UHHA 3VO9A 1DBSA 1U0HC 3QHPA 3TD2A 3WFZA 3DD5A 3AHIA 3PGMA 3O4GA 1ZD2P 2ADOA 3DEHA 1V6CA 1Q74A 3AY6A 1SHKA 1H3EA 3KQYA 5LBTA 4ZVNA 3SHWA 1R88A 2R8BA 3V4ZA 1ESMA 2A2ZA 3DL7A 3IP9A 1RYMA 2E5WA 2G17A 3NFRA 4C7JA 1K3UB 1ZCJA 4X71A 1U81A 1U6JA 4LBVA 4PE5B 1GN9A 3TQCA 2VYFA 2JFNA 3VDRA 4AU1A 2ODQA 3PLRA 5ESWA 1CR1A 3H2ZA 2I6UA 3AKEA 1NNSA 3VNQA 2J0VA 1QH1B 3FGPA 1U0JA 4RLHA 4KO2S 3M7IA 5EIBC 3VGPA 2BH2A 2BKEA 2DFKB 1EUQA 1X8KA 1IDOA 5A4AA 5AICA 4AC9A 1ZD8A 5CDSA 3UB3A 2VTKA 1XLWA 2HWYA 4QXQA 1EFTA 5J58A 4PC1A 1WF6A 1AZLA 3PC8A 4ZDWA 2HA5A 3HYRA 4EI2A 2DPHA 1RLTA 3UH0A 4C3UA 1S3SA 5KCZA 2O8EA 1F20A 5K8UA 4BTLA 4PG4A 1SCKA 5AKGA 1GZVA 2C1EA 1Y33E 1A8PA 3PF9A 2G9VA 3HDGA 2H1IA 2WNSA 2O7RA 3E7XA 3EUEA 3CRQA 3MRVA 1JLKA 1WXGA 3CHYA 3E0QA 5HFAA 3UUFA 2I66A 4KYVA 3WQQA 4S1PA 3ND5A 4OLFA 2ZAGA 1ENOA 2A78A 3UWOA 4XVCA 2V9ZA 2EJTA 4G4SO 4ZPXA 3ZEIA 3ZGNA 4JJ8A 1YZHA 2W37A 2JHFA 3P9ZA 4K9RA 1PWEA 3ZQJA 1RBZA 3S5JA 3BRCA 4XFJA 1OGIA 1BXZA 5FPYA 1CIJA 2F43B 3C5VA 3HZOA 5JSYA 3PQ3A 1DV2A 3AILA 4YMHA 3A4VA 5HZMA 2FG6C 4YCSA 4ZOLF 5D2CA 4YUAA 4ZHQA 1MIHA 1CERA 4RTJA 1KGSA 3I9OA 4M8KA 3OZGA 2P79A 1FRVA 2QPTA 1KORA 4TL7A 3U1TA 2FW0A 1PJLA 1Z07A 3B6KA 5LXTF 3DJYA 5M34A 5LZ2A 2NUTB 1GD1O 3GK3A 3FYDA 4HVTA 4J1SA 5HQJA 2ZATA 5GY7A 1J22A 1JFVA 4L0DA 4LYFA 4US1R 1IVYA 1US8A 3A1WA 2QRHA 5IM4A 2NXWA 1C14A 3UJBA 1TC1A 3I3SR 1C3LA 3V1TC 3O03A 4HDKB 4F4DA 2Q2QA 2PMFA 5IKPA 3T99A 4EFNA 1K4YA 2G07A 1MA3A 2VBIA 5LA6F 4NCAA 3IAM1 2OCXA 3BZWA 2AK2A 2CXXA 3AH8A 3LXMA 7ABPA 4QTTB 4V39A 3ZWWA 1R0ZA 2XUFA 4ZZ1A 1Y6JA 4G37A 2VHTA 1VPLA 3EIWA 1I8TA 4XM1A 3T7DA 5JW6A 2H1OA 4MVJA 2RAFA 3OJOA 4EYQA 3A6PC 3DM5A 4Y6SA 2CE7A 2ZS8A 3Q1KA 4LJ9A 5JROA 2CBXA 1RWMA 1RQPA 1T3LA 1UPCA 2DTEA 4FCWA 3ROFA 4N5NA 5CG1A 2P3OA 2HF8A 4YRMA 2XZLA 3ZNQA 1OLOA 1HT1E 1DAIA 1RZUA 2A3NA 2IPXA 1RPTA 1GGNA 2JZCA 2P90A 3TRIA 2Q3CA 3SE7A 1PT9A 4RSMA 4CMEA 1E1LA 2VKQA 3MOGA 4UEKA 4L4XA 1GLGA 2HBYA 3WQHA 3Q3JB 3KKNA 2PMCA 3EC2A 1A97A 1IK4A 2HJRA 4MWDA 3SP1A 2BEKA 2JFYA 2A1TS 3HRKA 2EBUA 2AN9A 2AQKA 2EDAA 1QS0A 1QMPA 2QN2A 1L1EA 2C7BA 4FJ0A 4GZMA 3TUJC 4ZYLA 4H9GA 3E3NA 1KO4A 2FMKA 3HLKA 4XJXA 5EPEA 3RJ5A 2RBEA 2BKAA 4PS0A 4GEGA 1QG0A 1G2PA 4PTLA 5H9WA 2AT1A 3AY0A 2EP5A 3LG2A 2Q4DA 3QKIA 2IQIA 3H97A 4N3CA 5DB4A 4QREA 3CX8A 4DLZA 1GYQA 1X2BA 1KFKB 4NBRA 4UTZA 3R7NA 3SYMA 4AWAA 1NWHA 1A96A 4PFSA 1LJUA 1BC5A 4MQEA 1V26A 4MV0A 1XMOB 1TMOA 4Y9RA 2VRNA 1YRLA 1ZIXA 3L1IA 3OT4A 1CEXA 4LMAA 4B2LA 3COJA 4O02B 1EAYA 1X1SA 2W2TA 3H5LA 3MCUA 4BVGA 5JZMA 5K3EA 1WO8A 3FUTA 2IK8A 2Q3BA 2QYOA 4YCBA 1GGFA 1ADFA 4G5FA 3GRPA 4UE6A 5AIAA 4XB6B 2P4UA 4KAJA 3PITA 2BUAA 2GESA 4LC0A 4M99A 1K06A 2JFOA 2Q9UA 3FOBA 3FWZA 4MROA 2ZETA 4LF5B 5E95A 1Z37A 3GEDA 1TO1E 4IHJA 1VRWA 2AR0A 3EGWA 1U2PA 1B14A 3AR5A 3LA6A 1IZ0A 4IQGA 5LDDC 4DV6B 1W87A 4X6UA 2PGOA 2Q4OA 3OLYA 3B53X 4MPJA 1G0OA 3DNPA 4B35A 4K6KA 3SDSA 4ZYTA 4AJEA 4HV4A 5KTYA 3UAWA 4YRTA 4XQEA 6CHYA 2C94A 3ZGOA 4J91A 5F7OA 5I7FA 1GZHB 1GPYA 4MMXB 5IVDA 1YI8A 4KHPB 4RS3A 1P1KA 1SQFA 3REFA 5BT9A 1KVSA 1H2AS 1XA3A 1E1CA 4AN4A 3TQQA 4X20B 1CVLA 1L4BA 3CRVA 4E3WA 4B3FX 1G2IA 1XT6A 4Y2VA 5CM2Z 4ZHQB 4RH1A 4C1NA 4RV4A 4BGDA 1BA3A 4TL6A 4DNOA 3R3UA 1AOXA 4JIGA 4LV6A 2XA1A 3A25A 5KUTA 2Z83A 3S68A 1H6AA 3G8CA 3ESQA 3L49A 4HDMB 2A14A 1N5IA 2Q3MA 4MR8A 1NWCA 1US8B 1E9RA 3FA2A 3F98A 3LXXA 4DN6A 2DULA 5JHGB 2IDJA 1K08A 1JZSA 1QP8A 2YMPA 3DDSA 3FRIA 4GR9A 1MP0A 3QG1A 3PHLA 4B4UA 3P9NA 4GH5A 2CEKA 4JOQA 4V1CA 5KVSA 4R2HA 5BNTA 3ZU6A 5AW6A 4BXOA 1HYHA 2GTPA 4WW0A 3HBAA 4RY9A 4TROA 3ANSA 5CPFA 1DIOB 2IEDA 1TCCA 4TRMA 4ZAYA 4ATNA 4XJTA 1TF2A 4ZVTA 1I4LD 1DAPA 1GKYA 3U09A 1CETA 5JYEA 2YWFA 3H9JA 4WCFA 3DHYA 3B85A 2HSDA 3WJ7A 5IK2D 1AXRA 1T1IA 4KGZA 4FFPA 4P80A 1P4HA 3ZWBA 2GA8A 2HMVA 2I2CA 5CB4A 3Q9NA 1JA1A 4DY4A 2QUHA 2VP3A 4LZWA 1SU4A 1P3JA 1TVKA 2C5AA 3O8QB 3I9MA 3HR4A 3T0FA 3M6FA 3A3PA 2OVBA 4DUGD 1BCRA 5F35A 1VKRA 3NKFA 4H6PA 2WTNA 1PQWA 4YWJA 2CNWD 3I37X 1H0HA 1W5AA 4OPMA 4EI8A 1QS0B 2CKMA 3DV0A 4F04A 3LPLA 1GA4A 5ER6A 3OPYI 3Q88A 4NOJA 3GJSA 1O2DA 4LHSA 5D85A 5CFLA 4WSOA 4TMXA 2ZB3A 3F0TA 1DNPA 3C85A 3P9PA 4MIYA 2IIBA 4RJLA 1UJ5A 3NHAA 4XWTA 2QY6A 1L7PA 1YE8A 1BX0A 1Z75A 4R7GA 4NDZA 3SWWA 4R54A 1B6SA 3DZHA 4GD3Q 4IXNA 4MQEB 2ZBUA 2YVUA 2J1LA 2A5JA 3G17A 1YBFA 3TRDA 1XXLA 4G86A 2PUVA 1QX3A 1M8FA 4BP1A 1M72A 1WPRA 2ILTA 4IJQA 3E1GA 4EITA 2FFAA 1P4GA 3KTDA 1NBEA 1T5DX 1FNBA 1HOXA 4IJWA 3TQIA 5D86A 1SC4A 2PGIA 2V5AA 4JI5B 3T3OA 1WB5A 2PMDA 3D6VA 4OXRA 2UVQA 2F62A 3HNRA 3NRCA 3CUYA 3VPGA 3VVBA 6GPBA 3PTAA 2VBFA 3ZVRA 3DBVO 1KC3A 5AUNB 4IHJB 3FZQA 2OR3A 2GZ2A 1TDJA 2Y8EA 3KUDA 1N8TA 3C6ZA 2X4GA 5TNXA 1VL1A 4Q16A 3QX3A 1L8AA 2X1HA 3MRXA 1VL5A 3DF9A 2RMKA 3WMRA 2ERXA 1EWVA 4EQ6A 1GWNA 3A1SA 1TJPB 2UXCB 3TBKA 1TAQA 1JSRA 2JAUA 2VTDA 2Y0EA 4CKZA 3PDIA 5COQA 1GQOA 2QQ0A 1CTQA 2I4LA 2IW3A 3BOSA 3OCUA 3T7EA 3Q9LA 2NVUA 3THYA 2DB3A 4A91A 1VCIA 3IMEA 1BXGB 2HX1A 3EMDA 4MW5A 4M87A 2ZROA 4PR3A 3K0FA 3D0QA 4KPUB 1FDUA 4QFMA 5CDHA 1S4MA 4CDGA 1MHPA 4MWSA 4KX5A 1APBA 4UNRA 1UOPA 1Q11A 2HU8A 5U1PA 3CUUA 3UJ9A 1N3IA 1E89A 4A16A 4EHKA 1NKSA 4Q3AA 2P9ZA 4BLQA 3UGKA 3UT0A 4K2AA 1P1JA 1JIXA 5ADWA 4H31A 2XTJA 2ZTUA 5IJZA 5SV2A 1G64A 3SVZA 3TK1A 2XHEA 4CCSA 1AK1A 3R6DA 3A27A 4AMVA 3OKCA 5C2JB 3DL2A 2QRGA 3KJHA 1YA4A 1HNZB 2B0CA 2GFIA 2Z2ZA 3LDUA 3Q3HA 4IIVA 3USZA 4TWIA 1DDGA 3QU7A 3DEYX 1M1ZA 1MJ5A 4YRNA 2N3ZA 4MR8B 1PBTA 5B64A 2HF7A 1CJMA 1M2EA 1P2DA 2B34A 2FZLA 2WJGA 3IUSA 3KD2A 2Q4BA 3L9XA 2A9FA 4R16A 2QIPA 4A26A 2IITA 2VLIA 5ICSA 3PCXA 4UNNA 4NU0A 4E88A 4M1YA 1TJ4A 3EG5A 3LBFA 3QJ5A 4FOLA 4LVNA 4MR7A 2IDMA 3BWDD 3HUFA 4O2LA 5DEIA 2CNLA 3X2EA 3Q10A 4PPYA 5HPYB 1XTVA 4ACAA 1ZIPA 3P0JA 1IN4A 4TXLA 1EGQA 2AXQA 4P8RA 4RK7A 2N46A 2VZLA 5JH7A 3AQ4A 4HDNB 4IFEA 4N18A 2PPVA 1W85A 4DNXA 5HP4A 1MLDA 4WCFB 1WOMA 3ZY2A 4GC9A 2X76A 5GJCA 2QMQA 4LBZA 4DEVA 4BWVA 4XGQA 2EC5A 3CWZA 2OXCA 4KXWA 5DGTA 5J5AA 4ANFA 2UXBB 3WXBA 2IPAB 3LOPA 4XAQA 3IEUA 3RSQA 2ORYA 2WVAA 2VIIA 1PFKA 3G2MA 3FN4A 2YBEA 3I30X 4G6ZA 5AT1A 3CVYA 3G2JA 4C7MA 4BNDA 1E8NA 3AKDA 4IP0A 3UJHA 4PYQA 1KH3A 3KZMA 4UTNA 2AG8A 1L2TA 3F7NA 3L8ZA 3NT5A 5BQPA 4A8TA 3DOOA 1PLJA 1DCFA 3D6MA 2VK4A 4WD3A 5EPOA 1X70A 4GMFA 4A6PA 4AXBA 1X7WB 4B75A 5DP1A 4AICA 5ALVA 4IS2A 3PXBA 3SEZA 2O2EA 4JOCA 1AKTA 2ZR0A 2XUHA 4PLVA 4DTCA 2HO4A 4YAGA 4JP1A 2AVDA 5FRDA 4X90A 5LD2B 1T91A 1XL0A 3H2IA 2B6HA 4HHEA 1Z5WA 3FTPA 2HBQA 4NENA 2PNJA 2AUNA 2QRQA 3BBLA 1T2UA 1FFGA 3OE1A 1JKJB 4DMKA 3NBKA 3U7GA 4DSTA 4RFLA 2HN9A 5DNWA 1PUXA 4G8BA 4EI7A 1UUFA 1TQ8A 2O4CA 1G5TA 4OJMX 5BSTA 1USGA 2ONJA 2GF0A 3BC1A 3RNOA 1J0XO 1TZCA 3QP9A 3NVDA 4MP3A 4N3AA 2JLVA 1MMFB 1I4OA 1HGXA 3NUGA 4UPDA 4ZJYA 5JRZA 1M33A 1RBYA 3ZH2A 4KO8A 3VNSA 1FSGA 2V7EA 2BFDA 1GZDA 4TSKA 3VV2A 2ZU6A 4ENVA 1YQEA 4I3GA 4R05A 2AJDA 2GF2A 4FT4A 3LY5A 3WMXA 1GAWA 3QPUA 2C5BA 4CLEA 2R79A 3L7CA 4Q4HB 1N6OA 2XCTB 3PDIB 3B3JA 1T5LA 5HKLA 2AMFA 5JSZB 3MMXA 2VHXA 5ERYA 3KZXA 3UWKA 3RW9A 2X5KO 4IDPA 5E6RA 2M32A 3AF0A 4KQEA 4ARSA 1VKZA 4ZT6A 3GUZA 2P5SA 4ENTA 2QTHA 4RMHA 3WIEA 2GAAA 3N86A 4P7KA 2ZJ3A 3KS9A 2D2IA 3W2IA 3OWXA 1Y5LA 1FLNA 4UVGA 2JLAA 4MLCA 3T6KA 3P9XA 2PTHA 2R66A 2WWGA 5E7MA 1ODJA 1ZD4A 3PC8C 3QLEA 4LYEA 2C99A 1UAAA 1SHZA 1P5ZB 2DHRA 2AMVA 1I4DD 2NU7B 2QX7A 1D2EA 4Q7LA 5U9CA 3KG2A 4RWZA 4OK6A 4WLVA 4QNNA 3GJQA 7MHTA 1K88A 1E6EA 2QRZA 1U9YA 2IA5A 2SICE 2ZI6A 3N53A 3ONEA 4LRXA 1P9LA 1QWSA 2KSQA 4QAJA 1DAOA 2A9JA 3HJRA 1ST3A 3P2YA 5JT1A 3S2FA 2KJQA 2P9GA 1KP9A 3VZCA 3ZHUA 4JVOA 4R1TA 4UUAA 3JVDA 1XN4A 2V9PA 3KTAA 1QH9A 1XWWA 4JLAA 1W2HA 4UM5A 1KR5A 2JH8A 5H0IA 4HB3A 1VL0A 1EP2B 1W6RA 2QTVA 2ZBRA 5GONA 3HXKA 3VU8A 4RKWA 2NADA 4IXTA 1ZJ6A 1W85B 3NHUA 1ZH0A 4PINA 1SVSA 1ISPA 4M9CA 3PQ8A 3R0ZA 4W63A 3L7NA 1MAWA 2B4RO 3LCJA 3HN6A 4LZLA 4NPCA 1A88A 4BFCA 5G0WA 4Q21A 1JJVA 2OKCA 3HB1A 4FU0A 2TMKA 1F12A 4ZGWA 4B81A 5C8YF 4CTKA 4CQLA 3L04A 3ER8A 2DSNA 3PDCA 2PJDA 2PZBA 3U13A 1G8SA 1MH9A 4BNDB 2J9GA 2WP8J 9ABPA 3EPLA 3C7TA 3CF4A 3UAZA 3OE4A 1H8HA 4BGVA 4N6GA 1R8SA 2C8JA 3M8KA 4QPPA 3NALA 5JXIA 4DT1A 1NVBA 3O3CA 4YV7A 5JEEA 3J81A 3HR7A 4FYVA 4MS3A 2QPOA 2D0DA 1HDZA 3EBOA 1JSCA 1U8UA 1OYWA 1AZSC 1RRFA 3BIXA 3E9YA 4A03A 2RGXA 2EJCA 1NBMD 3ROEA 2TECE 2RAUA 4V38A 1PI3A 1QU2A 2QNBA 5EJMA 4PQGA 4Y0VA 2GKOA 3GJZA 4JUBA 4NYJR 3ICWA 4TRNA 4AUNA 2Q3HA 3GVIA 3PEVA 1KMIY 4MV7A 2UZ4A 2NUAA 1M0TA 1Z88A 1T4MA 2P2YA 3HB7A 1M1YA 4MWEA 5FO0A 4B80A 4D4JA 3IQXA 1KO7A 4UZFA 4D81A 1QRDA 4P0TA 1NUHA 1LGYA 4CV0A 4NKRA 1QU3A 2ZIWB 3REGA 2YYSA 1YBHA 1S96A 4PZCA 1GFIA 2O7QA 2QTLA 3ZE2B 3WWPA 3A9CA 2QTZA 2WIFA 3WA6A 4Z9AA 1J99A 4CMEC 1ZR2A 3DFKA 3OUZA 3OZVA 1FSZA 5FBZA 1Z0DA 4HYQA 1HQKA 2NTEA 2RCNA 4KH1A 1JMYA 1I3NA 3WG9A 2BFDB 3EDMA 2EF0A 3TD6A 2P3LA 2ANCA 4KVZA 1OKKD 3K8ZA 1CJTC 3WL6A 2V03A 4R51A 4HNAA 3EG9B 3NPAA 3KLOA 4M88A 2IYZA 1E9VA 3SQDA 4DJDC 1JFTA 1KAGA 1IYZA 3IOBA 2XXBA 1L4EA 5EWLB 1E1YA 3NHJA 1IXSB 4BS9A 5I9BA 4X1YB 4BC1A 4UPVA 1ES9A 2EJUA 2HDNB 1SIOA 2P91A 1TADA 3DHWC 3FZEA 1XAJA 3GEIA 5THQA 2OV1A 1R3UA 2Z1DA 1B8PA 5E6RB 1Y82A 1UM9B 2AG0A 3RFFA 5LOVA 2ODAA 5KNDA 3C6QA 3K72B 4L8FA 3H13A 5K5EA 3EZXA 4O4HB 4CI9A 1VI6A 3OUTA 1IZ8A 2ZCJA 3MN1A 2LCQA 5KYXB 4ETWA 1FB5A 4I1IA 5GAJA 3GLIA 1A8IA 1R50A 2DCUA 2O59A 3OEHA 2W2KB 4HVCA 2GGSA 5JXJA 1JIJA 4FWIB 4GXTA 5CLJA 3ILYA 3RFVA 5E4TA 3L1KA 1EQUA 1P72A 1YUMA 4LC9A 4LGVA 4S35A 4MKXA 2X8WA 4RXMA 3TLJA 5T4HA 1DEKA 4UREA 4ZP1A 3IR6A 1Y7PA 1YB7A 5DX1A 4H1WA 4UBLA 4FKMA 1VYVA 5CG2A 2DKOA 1COWA 1E79A 1ZMRA 3H18A 1N0IA 4Q9AA 5EHNA 5KJEA 2P67A 4ZAWA 4MYUA 4N03A 4PO9A 4HRXA 4JT8A 1TQ4A 4LV8B 4AQYB 3C5CA 4B3SB 2CVFA 2J3IA 2ROQA 5B4UA 1OH5A 5F9FA 1GNPA 4P9NA 2QP9X 3EE6A 2WHQA 4EJSA 2CUKA 3AMVA 2ZE7A 1M6NA 2WY2D 4MUKA 4DYHA 4EM6A 3KZCA 3BQMB 3IVCA 5KYYB 3FKSA 2Q8QA 2BFEB 4OGWA 1RXWA 2W4MA 1JHQA 1P4SA 1G9TA 1YK1A 2WFZA 4YT5A 1EH5A 2PKXA 2QTVB 3PQ6A 3RLFA 3T95A 4B43A 2P9TA 3TPZA 2G5PA 4LOHA 3RRJA 4G89A 1KGDA 2XF2A 2GAFA 5HFNA 3AVOA 4DMUB 1N2OA 1TM3E 2HO5A 4KLAA 1AVTA 4DLUA 3TQSA 3WP0A 3BM5A 3EQ2A 3RVQA 3O1LA 1Z35A 1SC3A 1AGPA 2Y93A 4MVJE 2GD6A 3LXRA 3JRNA 4FEAA 4LYYA 5B7PA 1L4FA 2Z3VA 2IYQA 3QOXA 2GD2A 2XDQB 4MYHA 3TZHA 1S2OA 5HR5A 2BEUA 3NVKI 3PR2B 1T2VA 2W8BA 3AGPA 3WL5A 4DPLA 1J2RA 1IMJA 4UULA 1KYXA 1WTAA 1N9GB 2YC2C 4I55F 4L1KA 4NFYA 5DYIA 4ND5A 4GKVA 4EKIA 6PFKA 3FTFA 1JYSA 4EPTA 1E1QA 1XALA 1WZEA 1DJMA 5KC9A 1V11A 1M66A 2XEXA 4YB8A 2IHUA 4IDCA 3ETLA 2JW5A 4XIYA 1DPFA 4U63A 3U0VA 2ZUVA 3Q7PA 1XC7A 5JAZA 3GJ7A 5IABA 4D9IA 1QCDA 5SZHB 4B46A 1GQYA 2NIPA 2VVTA 3BIJA 3OEED 3W7BA 1YBMA 3OTIA 2O7NA 3EGXA 2V7QA 3B82A 2BF4A 3IC5A 4YDRA 5CDTA 2FG5A 4XOIA 2GA9A 2C54A 2WC1A 4ASUD 5ITWA 5B7NA 4A0QA 2O8CB 2JVJA 4FXPA 4IPTA 2H17A 5LR6A 4MUGA 4QATA 2R84A 2R4UA 4IUDS 1GPKA 4QQRA 1FMCA 4QU5A 1EX7A 1DG9A 1YQDA 2VDKB 3QUTA 5A6SB 3CT6A 4Q7MB 2ENUA 1A9QA 3JZFA 3Q85A 2YRWA 4MWZA 3BWBA 5CM8B 2RONA 4M37A 3ZLBA 3QU5A 1WUJS 3DMDA 4JL8A 4RQBA 4UARA 4P98A 1VM6A 4OHBA 3JD0A 4Z8XA 4NMHA 5AK3A 1XNRB 2VHCA 5DJ5A 4HQFA 2ATEA 1FNSA 2COKA 5JQWA 1DXOA 1KE2A 2JK0A 3EXG1 4UVHA 3SXJA 4M53A 1PSDA 1C80A 3BG5A 4R83A 4EARA 1X39A 4Z4CA 2G9ZA 3KL4A 2A6PA 1E6UA 1JE0A 1BWSA 1F5SA 4TUYA 1BMFD 2I76A 1JBEA 4RPJA 3U48A 5AVTA 2BVNA 1A4IA 3EHDA 4M6WA 3J7AC 3HUEA 3ENVA 3PJRA 1NRJB 2Y6VA 4R9VA 3LTEA 4HQ6A 5C34B 3RG2A 4UM9D 3A06A 1F2VA 1PFUA 3QVXA 1H22A 1LBHA 4HH1A 1C9EA 5DPMA 5DHRA 2IS4A 1FRNA 2I65A 4JXKA 3QPBA 3L7DA 3BFPA 1WP4A 2QXTA 4EGJA 4J1TC 4R8LA 4AM8A 3X1KA 3DO6A 3G68A 3LVFO 1I1HA 3D6HA 4ZI7A 3UEOA 3QLVA 4EP1A 1QIJA 2XGGA 1OT5A 1X1QA 2CE2X 3DG9A 2VRBA 2E49A 1P39A 2AFVA 3GAFA 4TTQA 2V5UA 1NPYA 4QPCA 1T2NA 4LYJA 5FA8A 1FNMA 3K8OE 4R81A 2D7CA 2HSWA 2RB5A 3R7BA 1TJ5A 2HLDA 4WNAA 3NONA 1Z22A 4KE7A 4EJSB 4HS4A 3LV8A 3QXJA 4E1BA 3IEMA 3AR3A 1DEXA 4JUAA 3V46A 2W2OA 3QUQA 4EHDA 4FYMA 1IEVA 5FFNA 2JH3A 1YH3A 3IA2A 4MQFB 1TU4A 2ORVA 1CDOA 2WTAA 1IEWA 5SY9A 3CCBA 3ADBA 1WMBA 2O19A 2FV8A 2H1RA 1LFAA 3M4JA 1P60A 5IKXA 2VF4X 1VBFA 3C5WP 4CUJA 4H0FA 1DELA 4KPEC 2BZ0A 1SGWA 2LRHA 5ED4A 2PKRA 2Q3EA 1BRMA 2DWPA 4KH0A 2WKWA 2Y1KA 4PLZA 4ECAA 3W5CA 2O5VA 3DZ8A 1X1TA 5BSEA 4LOIA 4Z8YA 3NO4A 5F51A 3CN7A 1ENPA 3SKYA 3FYUB 3LKZA 5CTJA 2DBVO 3ODGA 1GQ2A 1Z0SA 4L22A 5IDXA 3KHUA 2BI7A 2HYIC 2BEUB 4DCMA 1MB3A 2WUGA 2E18A 2ZBEA 2D62A 4NABA 4ENWA 5GV8A 1KDVA 1XD2A 2COUA 1IN6A 3LHFA 1W0KD 1T9AA 1GU1A 3COPA 3O4VA 4K9DA 3DQZA 1QFMA 1R0YA 4Q6WA 5AOAA 3Q7QA 4N39A 4EPXA 1KQGA 2JCYA 2W2PA 4TS4A 4N5IX 3GF4A 3LLSA 4MYRA 1RM4A 1CF9A 2DX7A 4K1XA 4L7VA 4XDYA 4XM2A 3RVLA 1BROA 3OT5A 4KFTA 1NXTA 4LBWA 1KH2A 4EJ2A 2G9NA 1F48A 1BFDA 3WGOA 3I9FA 1YL6A 2VJQA 2O14A 3MUNA 3O1HB 1YDHA 4NDNE 1Q3HA 3K1TA 3U3OA 4OB8A 5DSTA 4ZYZA 2VDMB 5AFSA 3CSDA 2DFVA 3FY4A 1QFYA 2A86A 2C61A 2W58A 1YFZA 1QH8A 2XD9A 4FDTA 4G25A 2PV0A 1P2UA 4Q1CA 1K63A 3PXDA 3MT9A 4R3NA 3FZGA 1JKIA 3K0AA 1COZA 3L8EA 4YV2A 2EAUA 1XVLA 1NI4B 5FOTA 3U61B 5I3ZA 1J7KA 2GFHA 4NCJA 4C29A 4E11A 4XX0A 1ZIDA 1E4VA 2JIQA 3DZJA 5DN6A 1EZ1A 3T7CA 5KREA 3VPAA 3ZVMA 1NJ2A 1MAAA 1V71A 1WE2A 4Q4AA 4ZODA 4BWYA 5IFLA 1Z0KA 3HEMA 1J5PA 1GUDA 4Z53A 1MX5A 3QX7A 3PICA 4B32A 2C96A 3MJTA 1QGAA 3P52A 2AJBA 1ZDMA 4RIEA 4C7KA 3ABOB 4IDGA 4TUYB 2WYVA 5EJ5A 3HEBA 4M6WB 1XZMA 1FUYB 3BF7A 5AW1A 1E9AA 1YRWA 3WYAA 4ZYVA 3KB6A 4ZTZB 1MT3A 4UVDA 1G8GA 5FBRB 4EVIA 5KQGA 8OHMA 4FQ5A 2ZRQA 1OXXK 3KALA 2EJVA 4Y0NA 4EUKA 1VGRA 4JNCA 4EHNA 1LSOA 2PQ2A 4PG6A 3SJCA 2ZJ4A 5A71A 3PEYA 3HBJA 3W9SA 3SC2B 4ED9A 5KOHB 2QUZA 2B2NA 3A6KA 1TQHA 1KPIA 4U6NA 1Q1AA 1M9NA 2R6AA 4BFUA 5B36A 5PNTA 2EHDA 5CIQA 1YC2A 3TNLA 5J5VA 4YT2A 4Z3DA 3TWOA 4I8IA 1TF7A 2FPPB 2FVXA 1NU8A 5I5EA 2NO9A 3H2KA 1MB9A 4U9IS 1NXPA 2RH9B 2X1LA 3VMFA 4NFSA 1KZHA 4K86A 1KAQA 3ZHSA 1G7CA 4WNAB 4DNQA 5ILGA 2PSHA 5H81A 5KHLB 1JG6A 1VOTA 1Z4LA 3JQEA 1DIAA 3OZDA 5D00A 3O4HA 1C4OA 4L8GA 4DSUA 1CLUA 1RRMA 2ATVA 2OCAA 4BYMA 2D1RA 4P93A 1VJRA 4L07A 1VMDA 3LY7A 4LJ8A 4CM6A 2LTAA 3MBOA 5HMLA 4REMA 2HDOA 5L3SB 5BRAA 1EFVA 5G1PA 2QN7A 5J1SB 1CUFA 4B33A 4JNKA 4L5IA 1C30A 4F2GA 1PV4A 1FFYA 4D6XA 5HM8A 1N9KA 4D9CA 1DQNA 4QXAA 1LTQA 2VNHA 4ZZIA 2HRCA 3V00A 1R16A 721PA 2I2WA 4BNGA 4MRRA 3ILHA 2OLKA 2AZXA 2PH3A 3B8EA 1DARA 1GGVA 4C07A 2C3UA 1V1JA 3NLLA 4EW6A 3CXUA 4L3VA 4QGSA 3RFCA 3OTQA 4CMCA 1H5NA 2IW1A 4MCJA 5HF5A 1HH4A 2P1DA 4LXYA 3TR6A 1R27A 4BZPA 1OREA 3W5BA 4K0KB 4I19A 1NQOA 1C5KA 1P4JA 2IUEA 4PO1A 4RADA 3CRNA 3VR6H 3CCFA 4HXYA 2W6MA 2PZJA 3S8EA 1ZJ4A 2NNLD 3OCCA 4FILA 4Q4JB 2AR9A 1PEKE 4B48A 1ZJYA 5EP2A 1HDOA 1MU0A 4UFPA 4M0EA 5EMMA 3NKLA 3KU4A 5LZ5A 3WLQA 4CF6A 3NANA 2YV1A 1D2RA 3EVDA 2AQHA 2H9AA 1Q0RA 1B76A 2P9BA 2GHTA 2YX1A 3L0BA 2WB2A 2IEBA 3EC1A 1RRVA 4CEIA 4C05A 3LGSA 2CVZA 5K6AA 2CVPA 2H18A 4DR3B 5BV1A 2XNDA 4FYXA 4ZCLA 3ZV5A 2V9CA 2VF8A 5KQRA 2CL6X 1N0WA 2BGUA 4WKNA 1JFFA 3MK31 3K9NA 4D4LA 5EJGA 4HATA 4M1MA 1XEAA 4PANA 4PG7A 1XJWA 4F5DA 3V7YA 1OBOA 1L7RA 1O9GA 3GJ5A 1ICEA 3RJ9A 3VZBA 2C3OA 2R7AA 3V4PB 5CYGA 1R12A 4TTRA 1Y4DE 1SQGA 2WBLC 4XX0B 4E0BA 1L5RA 4M0PA 4TXNA 5CDGA 4ER3A 3G79A 1OLSB 3ON5A 3R5XA 2QT9A 3BD7A 4GP7A 4CLRA 4RHYA 1DAFA 3FGNA 3VGJA 2O2XA 2HJWA 1HL3A 4KQXA 2H5LA 4YV0A 1R8JA 1E4YA 1O7JA 2CUTA 1D0VA 2A9PA 4M55A 2CYCA 3SYTA 1LDGA 4B79A 3L07A 1Q6YA 3QJGA 4FHDA 3SG0A 1QIHA 2YW2A 2I8AA 4G5SA 2ZCUA 2NTVA 2O05A 2PS1A 4QLAA 1JHYA 621PA 1QV7A 3PYXA 4U3JA 4COKA 2IWHA 1R10A 2O3SA 2ZFUA 1XVIA 3F78A 4O5AA 1XRRA 4Y1RA 4XI9A 3SXUA 4BNTA 1OE0A 1UMDA 3NASA 4I50A 2C4HA 4R40A 4WZBB 5DI3A 3PNLA 5G0VA 2ZIZA 2ZYRA 4LECA 2JF0A 4QKQA 4ARAA 1NXOA 4UCXA 3B7PA 2H0AA 1RYZA 4PAGA 2QE7D 3DGEC 2BLLA 1W5EA 5ESDA 4B8YA 5FTMA 4ZAXA 3FDIA 4D8TA 1PYDA 1FIUA 3TSZA 1V8OA 1GCOA 3SN6A 3TIXB 3K53A 4Z7OB 3ZWCA 3PL5A 1XK7A 2C29D 2C5LA 5J2UB 1F7VA 4B6RA 2Z4TA 5FTKA 1BWPA 1G20A 1QX4A 3HJBA 1A5AB 1A9ZA 1P9RA 1SA0A 2GQ0A 3TL3A 1R0RE 2WFLA 3ND7A 2W6IA 3BS4A 1M5TA 3IELA 4UUQA 3BMNA 5AM0A 2BGGA 2P2DA 1GQFA 2TMYA 3LL7A 4JLUA 1CUBA 2FZVA 1A71A 5KVVA 1ZNQO 1M1XB 5H7XA 4D25A 2FUCA 3LP6A 1MGOA 1QMGA 5F78A 5KX5A 3GRCA 3IO3A 1QF6A 2BTQA 2JLSA 4MW4A 4S2UA 1R8XA 3ENKA 3VU3A 3KVRA 4F5EA 5ABPA 2Z2JA 4RY8A 4AIIA 1YV9A 3QUSA 5CYFA 3WBBA 4GSYA 3BXPA 4KN8A 1J97A 5BR1A 2XZPA 4JQSA 2CEAA 3ZWMA 2IUYA 1YZVA 1Y34E 2XBUA 5DHTA 2WI8A 5AOVA 4BO8A 5FPHA 4JC5A 4PW0A 3JARB 4X5OA 4RHEA 1U7HA 1AQLA 1U80A 2D0IA 4PHFA 4ZVKA 4IMRA 4KMSA 3GD5A 2EP8A 3CLRC 4IJVA 2CZQA 3FHLA 3FKQA 3NEPX 1CU1A 4MITA 3PJGA 2GCPA 2HNAA 4R69A 2BFFB 2C2MA 4D43A 2B4QA 3W3ZB 4G0WA 2QLMA 1BQEA 1EIWA 5TQ2A 2F64A 1MGPA 2QWXA 1FUEA 3UHAA 3GA0A 3CNLA 1YIAA 3QTLA 3FMIA 4DQXA 4Q7KA 5IT5A 2C9MA 2KE5A 1JKFA 4UAGA 2OP1A 1Q92A 4C5AA 4KSCA 2H2AA 2YR0A 3QG5A 4AMZA 4EFLA 4JU8A 2P0AA 2ILVA 2HAEA 1F51E 1U2EA 1U3VA 3PPWA 4UBNA 4CEIB 1DKOA 3CO5A 4MO9A 4N1AA 5DULA 4G23A 4OHWA 5GADl 3DMYA 3HFJA 3KEGA 4AT1A 2NUPB 1MVLA 2FJ0A 4XVRA 1JFFB 4U7TB 3V3TA 4BUJA 4MDYA 3QPVA 1LCIA 1CQPA 1G6OA 1H2WA 3AUJB 1E5QA 1M1YE 2VRCA 3QQ5A 5CHYA 1YHZA 3EFEA 4WAUA 1E63A 2FE1A 3BH7A 3R5FA 4K6MA 3SQNA 1AMNA 2FMTA 4AJ2A 3ZWAA 1EFRD 1XZQA 3VR4A 4DRZA 1PKEA 2GD1O 4P83A 2PZEA 2M98A 3BL5A 3LDAA 3T7TA 4M0CA 3RS8A 1EUDA 4CEJB 1L5LA 1FEZA 3FFAA 1LQUA 1JSZA 5EJ8A 1N6HA 5ALWA 2PS0A 1FJ2A 3PD1A 5BWBA 1N2HA 1FP1D 3RBZA 1RHKA 5CAEA 4BY9E 1KEVA 2IZ7A 2XECA 3CZRA 4FYJA 1PR6A 3BB4A 3OU2A 5CCDA 1BMQA 2EXXA 2HGZA 3NHPA 5KQLA 2QRPA 3FNBA 5AK6A 3AFNA 1QGUB 5D8DA 2JGRA 4IFTA 1ZD3A 2EKPA 3A6ZA 3C1AA 4YUZA 4EPYA 2CJWA 3WGNA 3FYTA 3TLYA 2ZBPA 3AZOA 3WYCA 3GFTA 2ERYA 4I50B 5DI3B 2ZWIA 1UPAA 4P4SB 1P1RA 1IUOA 4UBOA 1G5IA 2GBCA 3I1IA 2QMEA 2WF7A 2IDKA 3DMPA 1XEWY 1XWFA 3AFHA 2YN2A 3UWDA 4O29A 1JNXX 2B7CA 3GCGA 4FKBA 1XZEA 4I4IA 3ND9A 3VKVA 1AK2A 2QSZA 5EE9A 1T43A 1AHIA 5J4KA 1N1MA 1HTTA 5JQGF 4TZ6A 5BN3B 4DRXA 3GOHA 4RS4A 3H11A 3BIOA 1C9KA 4RHXA 4BVBA 1C7EA 3U16A 1EP9A 4I0WB 3II6X 1G20B 4IUYA 5FQNA 1BGXT 4JBXA 4F9FA 3H1EA 4MVCA 1SA0B 2ZKIA 1T9KA 3L18A 1C9DB 4HXGA 3I6ZA 1KEWA 1QQ7A 4MB0A 2VT6A 2ZVQX 1E2GA 4BECA 2V45A 4NNPA 1ZNYA 5TS2A 3T9FA 3RR2A 1ICIA 4QUJA 1SXJD 3INRA 3QBVA 4Y3UA 1YFJA 2PFSA 4YIKA 1GPMA 2QB5A 3H86A 5AQEA 4YP5A 1W36C 1CY8A 1QTIA 5A9RA 1T5SA 3P2OA 1J8VA 3WBFA 2BTQB 3I6YA 2FFQA 5ERGB 4YRCA 2PRSA 2YJ4A 3K9WA 4RD0A 3SNKA 4AUMA 4L75A 4MRNA 3AETA 2ZI4A 2BMWA 5HIMA 4I99A 5CH8A 1QPZA 3AHFA 5FAXA 4XLLA 2AMJA 2ISCA 1SELA 3AEUA 3ELYA 3K0CA 2I33A 2ONZA 1XAIA 2VPZA 5ENDA 1AH2A 4M36A 1E5LA 2BFCB 2FLKA 1CY1A 4BNNA 4PF1A 4UBKA 4RABA 3V1LA 1I4TD 4EW2A 2V7XA 3NYQA 3I28A 3KFLA 3QLVC 1J2JA 2HFJA 4MQBA 4D1YA 1L6IA 4IV5A 2YZ7A 3VZPA 3KOXA 5AUOB 5K8CA 1WNFA 1U8XX 5C53B 5TQ2B 3ZDBA 3U4MA 3CRZA 5ALNA 5L9AA 1G66A 3ZNPA 3LZDA 1TK9A 2HK7A 4BN5A 1J8MF 4M0DA 4I9GA 4OEHA 1DVRA 2I87A 1HT2E 4A6XA 1N7IA 2OBMA 4U1RA 5ILQA 5DHSA 1P33A 3AJ8A 3A7EA 1IM8A 2GUGA 4RSGA 3OHSX 4MQMA 5DM4A 3TZCA 3KPYA 4FEEA 4CM7A 2B69A 3SQOA 1QHEA 2JIOA 4BO4A 1U0EA 3MTBA 1PFVA 3E70C 1BS9A 4QYXA 1NV8A 5LYJB 2CHVA 3OO1A 3O95A 2C83A 4M9RA 3OIVA 3S81A 1O6ZA 1UKBA 1JX6A 3IKTA 2MINB 2FRDA 1M34A 1R6BX 2I80A 1OHHD 2ZRLA 2QAIA 2H00A 2K2WA 3A4MA 1EFDN 3G0OA 2RCYA 1XKTA 3HDVA 2Q6LA 2AOUB 1CQXA 2AN5A 2F3TA 1B0AA 2AF4C 4NBLA 5FEMA 3RS2A 4B6GA 3A11A 1VCOA 5MFPA 1WB6A 3C3BA 1ABBA 1W4BA 1M5UA 2LPMA 1WOYA 2QM8A 1DCMA 1RADA 4NJMA 1NW8A 5FBQB 3W34A 3TW8A 3WGJA 5JLJA 1UJ6A 1QGYA 3LT4A 1AB5A 4OA8A 4XDHA 5IX8A 2DWUA 4CMHA 1AKRA 1JHDA 2QD4A 4A10A 3UMCA 3GHHA 1YMVA 5DU2A 4A1OA 3QXHA 2FLWA 2R0QC 3PJFA 1F8XA 1LPOA 1UT5A 5ECDA 3PYLA 2WABA 4BNYA 3GVXA 3K0BA 4PEVA 2GFQA 1RI2A 4TS1A 3LCUA 3UZUA 2O50A 5DGIA 2KLBA 4DVGA 1HZJA 2DBRA 3QBJA 4C6TA 3KETA 4FDLA 2DECA 4RA6A 3CT4A 4CG1A 1QG4A 3SOZA 2CFSA 1C2TA 1KYYA 1P1CA 2V7PA 4FBGA 3EXHA 4OSPA 3SF8A 5G0SA 4XFKA 4GQAA 5JBQA 1DKUA 2VJDA 4U7PB 2PWBA 2Q6TA 2YN4A 5CU7A 1QE5A 5CA1B 3ZJVA 2VNJA 2VO1A 3PB3A 3WJ1A 3OZRA 3T5DA 4A7PA 2HU5A 2Z5LA 4Q3KA 1MEEA 3DDUA 1T6NA 2I7DA 1C0IA 3KQWA 4M46A 4UCFA 2BISA 3IVRA 4JB0A 5AH0A 3NT4A 4YR7A 2GF9A 4XWOA 3D5EA 1Z6TA 1SOUA 4ZRDA 3HXOA 5KPJA 4CMGA 1QO0A 2DZDA 3H11B 4MR9B 1T9GS 2ODBA 3PNQA 1SIWA 2QJFA 4UDXX 2WMDA 2QPLA 2VG8A 4NZMA 4X7BA 4CL3A 4DCVA 1XP8A 5H16A 3ZV4A 4HYEA 3C70A 2EKLA 1C9YA 3U4QA 4QM7A 2JLRA 3TAHA 2CCKA 4NZNA 1N57A 1K97A 3HFSA 3RT9A 4M0KA 1NURA 2F59A 4U0JA 2ATXA 2XNHA 2VDQB 7REQA 3ACBA 3ELDA 4FS8A 5LP6B 1KJIA 4J7CA 2XAUA 4J8PA 3EZ7A 4W82A 1N5JA 4O2AA 2JGLA 3WLMA 4BO1A 2CK3A 2XAAA 1SVOA 1MOQA 4IIHA 2ASVA 4LVOA 4EW3A 1NNUA 5AM2A 4A0HA 3CGGA 4J90A 2O7VA 1M2KA 3V97A 2J3JA 4P92A 4GZ5A 3SLGA 4YK7A 3C3XA 2IGTA 3M5DA 1T5BA 1VMIA 2EFYA 2FF5A 2Q6OA 1ZBDA 2AW5A 1RJDA 3A1FA 3VKWA 1GAEO 3W05A 3OSZA 3ESYA 4FJ2A 4G0NA 4ZOLA 5FUBA 4CGZA 5FTLA 4Q3DA 2YCBA 5JS2A 1IZYA 4FGSA 4DMMA 1FFSA 3T34A 2VOEA 3HZZA 4TGLA 1O8CA 1M6VA 1ACLA 2W2QA 5LXTA 2JCBA 1JG7A 1XZAA 3N8HA 3SS9X 1VGVA 2FB9A 5E9JA 3THXB 1QYVA 2PJUA 3DCYA 1IOVA 4JJ7A 5DNCA 3AHDA 1O1YA 1Z2AA 3D59A 1X94A 3G5UA 1ZW1A 4GLLA 2REBA 2W6JD 3LYHA 5AXCA 4ARBA 2BFMA 3L5OA 5LQJA 3QEBZ 1J21A 1E1MA 1YIDA 2IH4A 1XCBA 5LA6A 1ETHA 1YAHA 3KXLA 3CLSC 3HU5A 3L05A 2ZDGA 4CUZA 1YKGA 4EG3A 5DMXA 4ZEWA 3HR8A 2PU7A 1R5JA 5ALFA 4JITA 1LK7A 2YHBA 3GEGA 2AZTA 3ZIDA 4I4NA 5KTTA 1VZ2A 3H5AA 3K0KA 3W3AH 5IW8A 1GU7A 1T2FA 3FZNA 3AUFA 3E2PA 3MFQA 3FFTA 4ND6A 3HO8A 1S1CA 3PZBA 5F7JA 2C5SA 3QRWA 4HGZA 4ZC8A 3MT0A 3I64A 3TW8B 5KEIA 5FWXB 1U4NA 1K6MA 4B2IA 4PLHA 1G8PA 1MRNA 3MAAC 2P2CA 4GYKA 4JXJA 2FN3A 1GTG1 1FU8A 1N2BA 1S3GA 2BZ1A 6YASA 3MM4A 4XGIA 1NUUA 3DPIA 4XW2A 2UYCA 1TUBA 2AFIA 3DYBA 2WMNB 3B9RA 4RCZA 2SCUB 4FI3C 2ZJ1A 3ROMA 4DABA 1J5EB 2R6FA 3ORRA 3NBQA 2IUSA 3QVLA 5GIPE 3VR6D 1CR6A 4RA6B 5BMVB 1SXGA 4PSAA 1DRVA 1F2UA 1OWPA 1NZFA 3WY9A 2QXYA 2R96A 5EUBA 4JJGA 4ZDKA 2XSZD 3FPKA 3IVMA 2L42A 2XVAA 3L7LA 4RZSA 4Y8VA 2OXTA 1SKAA 4WFIA 4Y2SA 1QHYA 1D4AA 1ZRNA 3BXFA 4L9WA 4UU1A 3K70C 4BTEA 3RSOA 4EG4A 2IS1A 2QRUA 1SC6A 2BGRA 1HE4A 1NTOA 2FEXA 3LWDA 4OQYA 4WBNF 3NIDB 2W42A 1ONOA 2Z8YM 1U9ZA 5B1EA 1AUOA 2Z8XA 1B42A 2YHSA 4RF4A 1X7ZA 5A0FA 3EF0A 5FR1A 4D74A 2FJUA 3JWHA 3INNA 2LIPA 5K0ZA 3UGTA 2QAGB 2P4EA 4U2GA 1IM5A 1B41A 3EULA 4Q02A 5FBKA 5CXSA 1HK7A 1HQDA 5F52A 4EZBA 5E0KB 3H0CA 4ZCRA 4X62B 3HXMA 3QE2A 1DBWA 1IHUA 3CUSA 4NZOA 3OZWA 3FE2A 4EMTA 4WOPA 3T7KA 4CBVA 1NT4A 2XCSB 2FWPA 3UQYS 3NYRA 1ZVVA 4MAAA 4A6EA 5C7OO 1ZNZA 1WW2A 4O4LB 4O4IB 4CQNA 3IBTA 5FL7D 3ZZ1A 1E3LA 4CW7A 1VCHA 1I94B 4R2MA 2C20A 3OZUA 4RTLA 4O2AB 5FPQA 1QYIA 4ZT2A 3V55A 1Y9AA 4P6VF 1N3LA 2VP6A 1RZ3A 4O6VA 1UXJA 2RFLA 3D6TB 5EPUA 5HFJA 3C3AA 2WPNA 1OI3A 3UVEA 2WVHA 2FW8A 1XLVA 1RRKA 1PHPA 5ANRB 4Y6OA 4WNCA 3ZEAA 4DUZB 1QF7A 121PA 3DB2A 1BVHA 4DJ5X 4PONA 4M9QA 1IC6A 2I7TA 3M0EA 5LXTB 3TF5A 3OT1A 1DOZA 5FXMA 3MRTA 4BHTA 3SM9A 3LY8A 2QU8A 3RJTA 2HZ7A 2MOKA 1EJ0A 2G71A 2QZ4A 3AQIA 4WLFA 3OCVA 2PS9A 2AYZA 3IURA 3Q87B 4Q05A 5HS6A 4DIDA 1CYEA 3ENZA 2WJ4A 2DWCA 2X5JO 3KVYA 3NZEA 3WRYA 5EE1A 4YXWA 2JAXA 3W79A 1RIFA 2PL1A 1YRBA 2EIHA 3E23A 5LA6B 1OY1A 1L9KA 4BLRA 4ZZ3A 1DTWA 1A8UA 1VE9A 2JBAB 2O2JA 3AINA 4KR9A 1F4VA 3TKLA 2GDZA 3T9BA 1ZEMA 2GVZC 4IV8A 1VB3A 5CVCA 3CVJA 4KYIB 5A04A 2VNSA 1AMOA 1FCJA 3IAS6 4UU0A 4CF5A 1MVNA 4B3DA 3B5EA 4C1BA 4CM9A 1PLLA 4FW9A 1LLUA 1NE2A 5CT5A 4QUBA 1CT9A 4U6SA 2ECKA 1A2BA 1KZYC 3TDMA 1R9MA 4BX9A 2C00A 1Q6ZA 1LK5A 2W6QA 4MIKA 3RSLA 4AN1A 5I7EA 2ZBQA 1L1QA 1RTKA 1ECCA 4TOIA 5MFZA 3BAFA 4A8JA 5TR9A 3H9BA 1V7QA 2I3DA 3C1OA 1ODCA 1V1MB 5C8XA 3DO8A 4HWPA 1IUPA 5EMKA 4II3A 2ZBFA 4JJ4A 4BO0A 1KOJA 1TAGA 4X41A 4F97A 3HCPA 4B6FA 2D06A 1G2OA 4PZLA 1Z2CA 1Q2UA 3KJEA 2WWHA 1K5PA 5DBEX 3ZHCA 4IGKA 5L3ZA 5C5CA 1L4KA 1K9VF 4Q7JB 2AFIB 1QCCA 3SPXA 3EA0A 3KRTA 3V42A 1V9SA 2ZYGA 1E6LA 4GUAA 3BSWA 4KIJA 5BYBA 3ZHOA 4LG1A 3LX6A 1N6LA 3K5PA 1JXOA 5KNBD 1J4AA 5AJXA 3VAYA 1N0VC 5AKIA 3RRFA 2VBGA 4R2KA 3OETA 4MVWA 3BDAA 4GOJA 4EY8A 1J0CA 4X8LA 3TLGA 2WE8A 1MQAA 3K30A 3ONNA 4BFZA 1FS4A 1XTTA 4AMUA 1BE6A 4ETIA 5CX1A 5T4FA 3ROXA 3T7SA 3ICEA 1EWYA 4KB5A 4YAEA 2C9CA 4M1QA 1H69A 3GLQA 2FOIA 3LSYA 1ZIYA 2GNAA 4OHRA 4V03A 4B7ZA 4JUDX 2ORWA 1WHTB 2C4KA 1VJDA 3F3SA 3TB4A 2F00A 2J48A 3OQVA 3ZVLA 1ISHA 3VR2D 3ZLUA 2E1RA 5K0BA 4WLEA 1ZZEA 3NRJA 4XX1A 5EHZA 2PL9A 2XTNA 4AYWA 4RF5A 4PXAA 3GB9A 3U81A 1FYEA 1G20E 1EB8A 1AF4A 5IAOA 2EDCA 4DG8A 1OT3A 4TMVA 5DYGA 2AUTA 4NH4A 2HFKA 2PSSA 2Y0DA 5KSOA 4R9UC 4CMBA 3ZKWA 4GOKA 3EQ8A 1I24A 4JUFA 3I62A 4ZO8A 2A1TR 1Q50A 1WJGA 3ZBUA 2LR0A 1UJ2A 2CFOA 1HTWA 3TSOA 5JPDA 1JPJA 3L02A 4UD2A 3H5WA 4MVJI 3X1WA 3OLCX 1SUWA 3CWQA 3LP5A 3NC4A 1IH8A 3IUBA 4X45A 1FDOA 4TYMA 3VSCA 1I3LA 2NZXA 3LXUX 4JC0A 3BX1A 1UC9A 4JB3A 3E84A 4N49A 1ZM7A 1WVIA 4XIGS 3GBVA 1YVDA 3REQA 5JIBA 3RWMB 4YYEA 1JBQA 2EGUA 2FN4A 3DHNA 3TQOA 3HBLA 1ZCFA 3K35A 3P94A 4BNHA 2FK7A 4P35A 4L74A 3ZLJA 4Y9SA 1ZLYA 2X0IA 3JRWA 2VNAA 3AV3A 1F4LA 1F4PA 4U6QA 3PTLA 3LQFA 1OJ7A 2PA3A 2XNCA 2O4UX 1UMBB 4FSHA 5AI0A 2VCHA 4CL8A 5K3FB 2VAWA 3AJEA 4YAUA 1JHPA 1RC1A 3DTTA 2BWJA 3G2KA 2AB0A 2DUMA 1DT3A 1TIBA 3DZCA 5FADA 4C30A 4UDOA 3W2EA 5EJ9A 3B2EA 3GP5A 4RZHA 3WWOA 5KQMA 5IXJA 4A1FA 5JR3A 4TTTS 1QQBA 2CB0A 4G0VA 3G8DA 2ZSBA 1X42A 1GNLA 1X19A 2Q2WA 1WP9A 3B2NA 2WF5A 4WLNA 1Y8QA 3EZGA 3WTBA 5M7EA 1QHIA 1XYVA 5ETJA 3JYNA 1RHJA 3I1JA 4C3VA 2I2XB 1AS0A 4P36A 1NJ1A 1TT5A 2IHVA 2YNMD 4F3NA 4LNUA 4L4UA 4Z49A 3IHKA 1N1GA 5J9FA 4UDYX 3BTSA 3IULA 5E4FA 2ZRNA 3ZCXA 2B8WA 4OJNA 2ZB8A 4RLSA 3UT5A 1L0BA 2W98A 3KC2A 3ZVKA 4P2GA 3SSAA 4EB6A 4B7AA 1WBJB 2PPLA 1ZSYA 5CIWA 3FOWA 3CIFA 1OV4A 1T8TA 3GA7A 2NU6A 2PQMA 1V3VA 2JAHA 2NACA 2XIQA 4KO4S 3RBVA 2H4XA 5AJWA 4IQ4A 2IH2A 1YGPA 4HPXB 4X6YA 1JLHA 2UZAA 4RZQA 3RODA 1JAXA 3UWSA 4D9NA 4DC0A 3G9ZA 4DV0B 1NQVA 5IHXA 4ZJZA 4D45A 4KITB 3G5LA 1UP7A 1X1EA 3WQBA 1ZMBA 1LDEA 5KJCA 2R6JA 3ZHVA 3OC6A 4RTKA 1EWKA 2XA9A 3IAXA 3LU1A 4BEJA 4QBFA 4DTIA 1YVPA 2Q62A 1BXKA 2ZJYA 4JEMA 5CX1B 3SZOA 4EHBA 1LNQA 3HMKA 2B82A 2B5OA 4JODA 3RB8A 4B6PA 7GPBA 2HA3A 2IHYA 4X1IA 3H0KA 1OSNA 4IVNA 1TVMA 2NZ8A 1DJNA 1EK2A 4TVKA 4UEWA 4XCXA 1TEZA 2AWOA 3DAYA 2DQSA 3EVGA 3HHEA 1MEJA 2X6TA 2Z8YA 2ST1A 3AFMA 3L5KA 4UNPA 2FFHA 1JJBA 5TF4A 5EY5B 2EFEB 2WSSD 5A9SB 2F9LA 1UJ4A 2HLHA 4JYMA 2VUSA 4TYPA 5C8VA 4D0LB 1O5OA 1HDEA 5A7HA 1F2TB 1BKDR 2IDZA 2VEDA 1CUCA 4UPEA 5KO2A 3JR7A 3N7AA 2NAFA 1E9BA 1OLUA 2FYTA 3IHWA 3EYAA 1EK1A 3HCFA 4I81A 5EIWA 2RGCA 3DP9A 3WSVA 1AT1A 1HEUA 1UK7A 2WIJA 3DLHA 2OA0A 1PK7A 4OGKA 4V1CI 2JDIA 3RYTC 2P27A 1FS6A 4HCJA 5EZ5A 3IQZA 4JI8B 5KHAA 2GJSA 5A3QA 5KYNA 3CZCA 3TNDA 2Y1GA 1WXWA 4MI9A 3C39A 1DAEA 1QBKC 3PIRA 1VYHA 1EXWA 2IXFA 2H4ZA 1RVV1 1YU6A 3HA7A 2CVQA 2B92A 4KR6A 4EF5A 1VB5A 2XMDA 2QROA 4TXMA 3T7AA 2X13A 3IRUA 3W04A 2WT4A 4H27A 3RYCB 3QE0A 2IF2A 4NARA 4GSKA 4NYJQ 4RPLA 1GA1A 5AJZA 4Y2XA 5DRYA 4BNXA 1UJNA 1XYGA 1CUSA 2I9KA 2FZGA 2QK4A 3LY9A 2ZSUA 1KDTA 2WTMA 3AYZB 3HS3A 3LPMA 2WWIA 3BERA 3PU6A 1ZK4A 4HZIA 5KTRA 1N6RA 3DKKA 3B2QA 4I1VA 3JVIA 3GLGA 1BN6A 4GSLA 3ZJTA 1GTZA 2RHJA 1PU2A 4UVEA 3PA8A 3RC1A 5I7SA 2YV4A 1IBLB 4PNHA 3JYLA 4LYAA 4TZKA 3R0JA 3DLIA 2J0UA 1VFPA 1OB5A 3PPVA 1O57A 4B5LA 4G24A 3M82A 2PVPA 3M1YA 4RK4A 5F5XA 3DOJA 1KNXA 4FHEA 3MT7A 3QE9Y 2PL5A 5KYUB 2YIVX 1CZUA 1O97D 4DF3A 3MWEA 2FR8A 3MZ0A 1RKBA 2J5RA 4PPFA 3U9TA 4UTRA 5BSWA 3E9EA 4MH0R 5C8YA 5CFOA 3LDFA 4DA6A 1YZFA 1TYDE 3BB3A 1T0IA 3AHGA 2EF1A 4POAA 4BNLA 3Q11A 4YR9A 4NMLA 1FX0B 1NW7A 4F6CA 4N54A 2E5FA 1ZU4A 1ZRMA 3MUFA 1XBTA 3RVBA 3ZGVA 3P32A 3U60B 1UADA 2ODWA 3ZHXA 4I3FA 4EB6B 1H2BA 2ABWA 1BTOA 4PXSA 3BL8A 3WJ2A 2CUZA 4TVSA 3GZNA 1ZMTA 3N5KA 2P75A 5K3DA 1T24A 1WZIA 4CM1A 4Q4LA 5J4YA 5JJBA 1R6VA 1C7IA 1ZGZA 1U94A 2O1EA 5AK0A 3SQWA 1SM4A 3FF4A 3FMPB 5H3HA 1W581 3UW3A 3KVVA 3UICA 4COOA 1SG6A 4HVAA 4N3NA 1USKA 4E4YA 3QKRA 3KT0A 3PNMA 1NF9A 3P2EA 2OBNA 3G88A 1LXCA 4D92A 1P0IA 4IYJA 5T4BA 1VE7A 2CV2A 4KQMA 3TBHA 3OZ7A 1U8CB 5E9WA 1F8UA 5DYWA 3AKZA 1AURA 2ZRHA 4KSBA 4I1PA 2EBFX 1NR1A 5DHFA 4X1IB 1U28A 1YMQA 4B45A 1FX1A 1EA7A 4DM4A 3F74A 1N2IA 1LPSA 2PRYA 1VJ0A 3SIRA 1RM0A 4E7OA 5D5HA 3FOAA 4KPYA 1DZIA 4CL2A 1II8A 1SIUA 5TMDA 2D4AA 1JALA 2A58A 2JIRA 4M49A 1FFCA 3HRHA 1GSOA 3AHHA 4MHSA 5DXJA 1RAIA 4YJ2F 3QHAA 3W3AD 3W6ZA 2FFJA 3OOEA 3P9CA 1OZHA 3DMHA 5KX5F 5IANA 3PNYA 1U9IA 3WNBA 5EJ2A 5BUSA 2A7QA 3I04A 2GR9A 4RJTA 1LRKA 2EW1A 4OFZA 1BWQA 1UWKA 1OLUB 2QUKA 1HG0A 1S0UA 2ZK7A 3IQEA 1BG6A 3DV2A 3L7KA 2I4RA 1YI0A 3OCWA 3GJXC 3H2BA 1IY8A 1WKBA 4I2NA 3C7DB 3I3OA 3BE4A 4DR5B 3UJ8A 5CA0F 2WT8A 4PS1A 2BMFA 1KJQA 1Y8RB 2FU5C 3QM1A 3T3PB 1OH7A 1GEEA 1S2DA 2DJ5A 4FIZA 1PS0A 1QUFA 2J3KA 3E05A 4LOLA 5DCWA 2HL6A 3AHCA 5D3KA 4CQJA 1PD1A 4ER6A 3NPMA 1NVDA 3MJCA 3OFSA 3RUIA 5ITZB 3EOAI 2V7GA 3ADPA 2BV3A 3LH5A 1OU4A 2O20A 3GLVA 2B94A 2UYHA 3FZYA 2VDWB 2X3FA 5A2QA 3GARA 4PHCA 1BOFA 3QSGA 4ZI2A 4JL5A 3SICE 1ZD1A 1K8YB 2Y9MB 1B43A 1BMDA 1OI2A 3GPCA 3N3BC 3NRBA 2Q5JA 3KEOA 4LOAA 4ROTA 3O8OA 3VOBA 3V4RA 2Y92A 1NJGA 2H48A 5BRJA 1W4LA 1GUZA 4QNMA 2REOA 1V4BA 1PGOA 2B7BA 1AKUA 2Y4NA 3L0CA 4JR1A 1K7FB 5I45A 4IVQA 1IN7A 2EJWA 2J0UB 3ORFA 2Z6VA 2CBGA 4UXJA 2H4JA 5DNDA 3DTVB 1M0WA 3EF3A 4UMDA 3D8UA 1QZTA 2A0FA 3PE6A 1EX6A 2NW6A 3O90A 3WR5A 2PUGA 4G56A 3A3YA 5EZYF 4DPKA 3DD1A 1YULA 3R9XA 3U62A 1C4KA 1LVGA 4I5EA 4TMKA 3WYBA 1ZUIA 1CJVC 2GEUA 3KUCA 4KWCA 2VDJA 3N2GA 3QV1A 2JG3A 5KKAA 3AKCA 2O3TA 3EDQA 3C7KA 1B73A 1EDBA 3EN0A 4JOSA 3U1VA 5COAA 2NU9A 3WBKA 1BVRA 1EA5A 4XSGA 1EDEA 1ODTC 1SNYA 2G28A 3QBEA 3T0IA 3U17A 3ZE8A 4EDHA 5IZCA 1M6WA 2D00A 2XYPA 4EJ0A 5SZJA 4XQCA 3GPIA 1FRQA 2J30A 4IQ0A 4N9QA 3WOHA 2NP6A 1DO8A 2NYRA 3QUBA 3RWOA 3C98A 4RQAA 4GOND 3IEKA 4A82A 2W6ZA 3IAUA 3D7KA 1F8GA 5BYJA 5K6RA 4BLPA 4HZGA 1VLQA 4HQLA 1XTSA 4HUQB 3UJ6A 3ZV3A 2AFIE 4FB5A 1A7KA 2QX6A 1SBZA 1UKYA 1UFOA 3E58A 3IP8A