1KRWA

Solution structure and backbone dynamics of beryllofluoride-activated ntrc receiver domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
124
structure length
124
Chain Sequence
MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAISHYQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords NITROGEN REGULATION PROTEIN NR(I)
publication title High-Resolution Solution Structure of the Beryllofluoride-Activated NtrC Receiver Domain
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 34
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2002-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1krwA00
1IIBA 3KYJB 2GX6A 1Z16A 3OMXA 4NV3A 3H5IA 1D1QA 1EAYA 3VNBA 4W5QA 5FWYB 1DJMA 2NZVG 3UK0A 3UUGA 2RJNA 4Q6WA 4W5OA 3DZDA 4MR7A 1P6UA 4MS3A 4XASA 4EVQA 4MS4B 1K68A 4EVRA 1YK1A 3IP6A 3VNAA 3NHMA 3BRQA 5BR1A 1VKRA 4G0OA 1KGSA 3OMWA 4MQFB 3EAFA 1U8TA 2RJOA 5TQ2B 3M9WA 5BRAA 2PUBA 3QLVA 3KKEA 1ABEA 3N0XA 2MSKA 3OO0A 1BDHA 4F06A 1SXHA 3Q7SA 3T6KA 5IULC 5DLEA 3FFXA 3BRSA 1M2FA 4Z0NA 3T38A 2FLWA 1JDNA 4G86A 4KMRA 3I45A 4EGSA 3L49A 2WWVD 1NXXA 3GBVA 4JASB 2FEWB 2WJAA 3B2NA 1USKA 1DZ3A 4G0QA 2LP4Y 4WZZA 4KK4A 1P6QA 4Z4FA 1PEAA 2E4XA 2P9HA 2V0NA 1TLFA 3CFYA 2A9OA 1TM2A 2FW0A 4MR9B 4YGXB 2E4WA 2GI4A 2IOYA 2X7XA 4UHKA 4Z4EA 4KZKA 3GWGA 5ED4A 2WB4A 3D02A 5F64A 1TMYA 4NQRA 1UDRA 4Y9TA 3LUFA 3KLNA 6CHYA 3LUKA 3MMNA 3FGZA 3O21A 1ZY2A 2HQOA 1SRRA 2CHEA 3D8UA 2JK1A 5HKOA 3RVJA 2QZJA 3Q7TA 5C5CA 3E61A 3RQIA 2BGGA 3MF4A 4MQEA 1QP4A 1L5YA 5KC8A 4KPYA 1F51E 3A3KA 3IP7A 5EWLA 4F3TA 1BVHA 1SD5A 5CNMA 4RKQA 4TLMB 5KI6A 1GCAA 6ABPA 2IPNA 1JWLA 5TQJA 4D74A 2PAFA 1NATA 4ZPJA 4G0PA 1D4ZA 2AYXA 2Q5CA 3ILYA 3NNSA 4N0QA 4RZSA 4F8JA 3KJXA 4RV5A 4KRFA 4W5NA 4MR8B 1JF8A 1M2EA 4Z99A 3HK2A 4HNRA 5JNWA 4FE4A 1KRXA 3LKVA 5IEJA 3P9YA 2A9RA 3JVIA 4N03A 9ABPA 5EWMA 5IUJC 2RDMA 1S8NA 4YCSA 2IPAB 4RK6A 1VLZA 2WJWA 2L19A 1SXIA 3TB6A 4RY8A 5TPWA 1JYEA 3SQNA 1CYEA 2VYCA 4JA2A 1NTRA 2FXIA 4TLLB 4HNSA 3IP5A 2LBPA 2QVCA 2E4UA 2MYUA 2NT3A 5T7BA 4RK4A 3CNBA 2PUCA 3LUAA 2PUDA 2PUAA 3QLUA 2FQXA 4EVSA 2R25B 3A0UA 2FMIA 3K9CA 2L18A 2CWDA 4OG2A 4ZMSA 4DADA 1DC7A 4O1HA 2IPMA 4EYOA 3OLXA 2PKXA 3OLZA 4RK1A 1CHNA 3O1IC 1AB6A 4RXTA 5CNKA 4PYRA 2FQWA 4MRMA 2PL9A 2MYNA 2MYTA 4EYKA 3KSMA 2P4UA 2E4ZA 2B4AA 4MLDA 1Z26A 3RVKA 4F11A 3GA5A 3IPCA 3JVDA 1EWTA 1FFSA 3L6UA 3CLKA 4ZJPA 3JPYA 3C6QA 4MR7B 1DRJA 4OTZA 1L5ZA 3QLVC 4YRZA 4MS1B 1ABFA 1U2PA 1YTUA 1E6KA 2JB9A 4N0PA 4XXHA 1PHRA 3JTEA 2ID7A 3DBIA 3SY8A 4MLCA 2GKGA 5FWXA 1FFGA 2HQBA 1A04A 4RY9A 1OXBB 4H3HB 2QU7A 1M5TA 3SM9A 3QX9A 4XLTA 5DCLA 5T3YA 3NNDA 1QKKA 3RH0A 1QO0A 1JFTA 3TD9A 1VRVA 1DCKA 3EQ2A 3T95A 3FFWA 3CZCA 1RXEA 3HZHA 2WY2D 3SNKA 2PUFA 1BDIA 3I42A 1YVUA 1ISRA 5I4CA 1QNLA 1TJYA 4F12A 2QW1A 1T34A 2JBAB 1YMUA 2E4VA 3FDFA 5HM6A 1P2FA 1PEYA 2XDYA 1PNRA 4L4UA 1F4VA 4QICA 1EFAA 2R4QA 2GWRA 1LJLA 5FWYA 3QK7A 2R48A 3HS3A 4NICA 4YS6A 2B1JA 4S04A 4HYEA 4Z4IA 1ISSA 3CRNA 4G0YA 4KREA 1D1PA 1K66A 3Q9SA 2OQRA 4LDZA 3NHZA 2HPHA 4IMJB 4Q6BA 4RU1A 2L17A 5FBKA 2CHFA 3LFTA 5TQ0A 4MYRA 3DLHA 1YIOA 3Q7RA 3EQZA 5CHYA 5TQ2A 4D6XA 3G85A 5IUNC 1HEYA 3MIZA 4KNYA 1XHFA 3LUCA 4FE7A 3KTOA 4W5TA 2A9QA 4CBVA 3LUJA 1DP4A 3CU5A 3ROTA 4EUKA 4Z4HA 1YK0A 3G1WA 4G97A 4QYMA 3BBLA 3I09A 3QELA 1Z2DA 3DLBA 3LUDA 3I5AA 3H6GA 4RWEA 2F8SA 1YS6A 4KQ9A 5JNSA 3H75A 2MSWA 4MR9A 3HCWA 5BQ3A 1YMVA 1Z13A 3ROFA 5KQLA 4JB2A 3HSYA 2L2QA 1ZITA 1A2OA 1EWKA 3N8IA 1AB5A 2WMYA 3GL9A 4YWHA 1ZHHA 3EULA 2J48A 3DGEC 4KQCA 1BDJA 1FQWA 3RVNA 5DGCA 4EYGA 1JX6A 1Z12A 5EWMB 1NXOA 4H60A 3HM9A 1QO0D 3H6HA 3OLWA 4N41A 5TPWB 5B3JA 3MQ4A 3A0RB 4YP9A 5KQPA 1SXGA 2JVJA 1NXSA 3TMYA 1NXVA 2PLNA 3DGFC 1ZDMA 4FB4A 3R0JA 1QQAA 1A0OA 1YS7A 3RVPA 1E6LA 4WUTA 3HO1A 2I6FA 4KVFA 5JS2A 3JPWA 1XHEA 2R47A 5IBQA 1BAPA 2IPLA 4E7PA 1DBPA 1DRKA 4RK0A 1NXPA 1JLKA 3QEMA 4Q7EA 3H5OA 5TPZA 4WXMA 1E6MA 1NY5A 3RVMA 2JVIA 1GUBA 3H5VA 1W25A 4LE2A 4Z9BA 4ZYLA 5CNIA 5KQMA 2QSJA 3W9SA 2RGYA 1JL3A 1B00A 2GBPA 1DG9A 3N6VA 3RVQA 5JNUA 4MR8A 4RK7A 3IPAA 4G0MA 2ZWMA 1RPJA 3H5TA 3IP9A 2PE5A 4PE5B 4KV7A 1MB3A 2PMCA 1KRWA 1LBIA 2QVGA 1DCFA 3CG0A 5DKFA 1ZH4A 4MAAA 3RVOA 3HJFA 1GCGA 1QMPA 2VUIB 2QXYA 4PICA 1RNLA 1QQBA 3LMKA 4TMYA 4YV7A 7ABPA 1Z15A 1PNTA 2VUHB 3JS5A 3HXMA 3GRCA 5E3JA 5FBHA 5JNRA 3SAJA 4MS3B 1Z2EA 5FWXB 4XAQA 5HQJA 1MVOA 5IC5A 3RVSA 3O1HB 2LUOA 3NNNA 3C3KA 3H5LA 2FEKA 4OATA 3O2SB 2E4YA 1GUDA 3H5WA 2NZUG 5IX8A 5EWJA 3URMA 3CG4A 2VK2A 4JP1A 2FMKA 2FLKA 4RY0A 3LTEA 4PEVA 5D2CA 4RKRA 2FN8A 5KQGA 3Q15C 4LZLA 3OO1A 3TX6A 1VPWA 1EHCA 3EODA 4O5AA 2YHBA 4LDAA 3O74A 4LRQA 4WXEA 3LOPA 3A10A 3O1JC 1Z18A 1ZN2A 3RVLA 2M98A 4JB0A 1JFVA 1JBEA 1URPA 1NXTA 3M6MD 3QEKA 4P1ZA 4YLEA 3CZ5A 3HDVA 1ZVVA 4MS1A 2LPMA 4JOQA 3BILA 3EGCA 3EJWA 3ILHA 3OQMA 3JY6A 1C0EA 3LUHA 5TQ0B 2NT4A 1LBHA 1BA2A 4RXMA 5TPZD 4MS4A 3OQOA 3GBPA 1E2BA 4LE1A 4IF4A 1MAVA 1USGA 3E3MA 5KWSA 3N75A 4MQFA 2OENG 4OLAA 3CHYA 2W42A 4H3KB 1U2QA 4LE0A 2MSLA 4G0XA 2NUBA 3FMVA 3T8YA 3EDCA 1D5WA 4UHJA 1EWVA 2FMHA 2KYRA 4TN5A 3F73A 3QELB 3RVRA 3HVRA 2QR3A 1W9HA 4MQEB 1FSPA 3O75A 5EWLB 2JBAA 4HNQA 4EYQA 1CEYA 1GLGA 2ZAYA 1NXWA 3MM4A 4WT7A 2N9UA 3KCNA 4IMIB 3OLYA 3NBMA 1JH9A 4NCBA 3HUTA 3LUGA 2O20A 2FN9A 1H9CA 2H3HA 4N76A 2HSGA 1P8AA 2IDMA 1ZH2A 3IDOA 4KK3A 3Q41A 4QPJC 3N53A 5B3JC 4MPTA 5PNTA 3OM0A 5JS1A 2FSPA 2MYPA 3KYIB 3O2QB 1J56A 2JVKA 2QV0A 4IILA 4WWHA 3CKMA 4RSMA 4DQDA 1U0SY 4OLBA 3KHTA 1RZRA 5DTEA 4W5RA 2IYNA 4RXUA 3KLOA 1MB0A 3H1FA 4GPAA 1Z17A 1DBWA 4RK5A 1LK0A 2PUEA 3F6CA 3HUUA 2WRZA 2AYZA 2YHAA 3GYBA 3H1EA 3QLUC 4IRXA 4QYWA 1MIHA 1Z25A 2HJ9A 4O1IA 3HEBA 4N47A 3FFTA 2FQYA 4ETMA 2PJUA 3OM1A 3QEMB 1D2AA 2H0AA 4P98A 2FKAA 4LX8A 1TVMA 2PL1A 8ABPA 1DC8A 5JNTA 5HSGA 3CTPA 3S99A 1USIA 5ABPA 4D6YA 2PUGA 4MGEA 4OBBA 1Y1LA 4ETIA 1U04A 2FEPA 3OLVA 4Z4CA 5BRJA 3BREA 1QP0A 4ML3A 1PUXA 1FFWA 3O2JA 4ETNA 3C97A 3HV2A 1DBQA 1QP7A 1WETA 3CS3A 1C4WA 4MRMB 3N0RA 4S05A 4PZ0A 3KG2A 4L85A 4Z9AA 2FVYA 1JHZA 2DRIA 3UKJA 4ZMRA 5CNJA 1ZAYA 2F8TA 4Z4GA 4M88A 5GQSA 1ZESA 4GNRA 1JDPA 1XWWA 1DCMA 3GT7A 3QLTA 4XARA 3KS9A 3QX8A 1JFSA 5IUKC 1R8JA 1APBA 5KC9A 2FMFA 1JYFA 4JAVC 4RDCA 5IEBA 2TMYA 4RS3A 3GV0A 5JNVA 4E7OA 1RXIA 3M9XA 3OQNA 4YO7A 2HQRA 4XFKA 1OXKB 5EWJB 2JCGA 3F7NA 3MA0A 2JRLA 4EY3A 3C3WA 3F6PA 1ZGGA 1LJUA 3C3MA 5TE9A 3LKBA 3N0WA 3K4HA 4B09A 2CD7A 3H1GA 3MYYA 5GOTA 4DN6A 1RZRD 2A9PA 1M5UA 3SG0A 2ID9A 2LIVA 2M1ZA 2FTKE 2IKSA 3HDGA 4YR7A 5C5EA 1QPZA 4KFCA 4G0ZA 4IGAA 1KMIY 4NCAA 1I3CA 3TO5A 1ZGZA
chains in the Genus database with same CATH superfamily
3I53A 1M6HA 2FMTA 4FD3A 3TMKA 3N39C 3LPDA 3VVLA 2PD3A 3T7CA 1RHKA 2AG5A 1NVKA 4YP1A 4MPJA 1PJSA 1X77A 1AUQA 4FOTA 5IASA 3DCNA 1TZCA 3LBAA 5BR1A 2JLSA 1IG0A 3H1BA 3HH8A 1TGVA 1UWVA 2PO7A 1BNCA 3A36A 3QY0A 3SKVA 4A0SA 4E07A 5BV7A 1ICEA 2CFIA 1YR1A 2ABWA 2GPYA 5TRTA 2Q5HA 1IJFA 1D6SA 1E2GA 1ZD3A 2D62A 4K03A 3TF5A 1F2TB 1MGOA 1WB4A 3TUZC 3N0XA 2HDWA 2WLTA 2V03A 1IYZA 4UQOA 3OO0A 4BNKA 1N3BA 4L07A 1E1CA 2PHZA 3IE0A 2D0OB 1NONA 2UYOA 4ZCPA 4BGDA 4UUNA 3ZHZA 2J5BA 2PT9A 1AZTA 1Y8RA 5FV7A 2WW8A 4KCGA 2W43A 1VXRA 2DJIA 2IZ7A 4WADA 1R4MA 5CPBA 4G86A 4C2TA 4GQBA 4Z8XA 5CBPA 5D5PA 4WH0A 4KIJA 1UJNA 1JIUA 2W70A 3LT0A 4B6SA 3AEXA 2GYVA 3QPAA 1FUEA 1DX4A 1NWCA 1X9GA 2R66A 3NOXA 4PTZA 3U09A 3DDNA 2VHQA 3AFOA 1WVGA 2GILA 3PEVA 3RYFA 3GLGB 2Q8NA 3PEYA 1G8GA 1K5GA 4NJMA 3N2KB 3GVXA 3GAZA 1QIMA 2AFHB 1ZJJA 3VPSA 1JPNA 2A14A 2CHVA 1YJQA 1MQSA 1RQ7A 2BT4A 3Q85A 3Q7IA 1AS2A 3HCNA 1P2GA 3QLEA 4MAMA 4NATA 1Y1QA 3UHFA 2RGXA 2YRWA 4J3FA 4OBXA 4DJJA 6PFKA 4CKEB 5ILGA 1XMXA 4B4KA 2P1RA 4GM0A 4II3A 2NVWA 4TV8F 1SRRA 2BP7B 2CHEA 4RF2A 4Y2UA 3RRXA 1H6DA 3CPSA 5I9LA 1IVSA 5HXAA 2JIBA 2GCOA 3TECE 3HPRA 4GQAA 4TL6A 3QIAA 4TT8A 4KPGA 4ICIA 3CNLA 2JZOA 4Q7KA 3TQFA 4HNTA 4Z6KA 2CNDA 3V8EA 1HGXA 2VRWA 4K1XA 2A5GA 3UXMA 5KI6A 1PQ4A 1GCAA 1Q1BA 2XAUA 2OMEA 3EFHA 3KVOA 4WI1A 4AZVA 1DC6A 2JGFA 5HNKA 5FI1B 2XMSA 2R85A 3PEUA 1X9HA 1KOJA 1P6XA 4N5DA 5J2TF 4GVXA 1PR5A 4B40A 1JJAA 4F8JA 2EZ9A 4IHJB 5JJCA 2EWVA 3AR9A 5B53A 2HIHA 5L53A 4LZNA 3NZEA 3CLUC 3X3HA 4PLZA 3HK2A 1MVNA 4FE4A 5J9FA 5JZSA 5KSZA 3B3JA 4X3CA 1P44A 1JVNA 3EASA 4LTNA 4PSDA 4GR9A 2QV7A 2P9GA 1HEIA 4QARA 2ORYA 1QRAA 4RVGA 1I9GA 2AOXA 2JJ8A 1Q77A 2P1DA 3HABA 2ZJZA 5ILOA 3U19A 3PC2A 1ECCA 1EP9A 2WJWA 4KACA 4V0NA 3G2NA 4YAJA 4RY8A 5TPWA 3ZOZA 4XRGA 1T9AA 1CDEA 2JAWA 3IJRA 3M33A 3A4TA 4KGZA 4ZHQA 5BT9A 4ANFA 1E2UA 2KS6A 1N3IA 4WD3A 4FOOA 4TZKA 1A4UA 1XFAA 3D6UA 4G5RA 3S44A 4HLQB 3UMRA 2CCGA 1TQ6A 1PJBA 2HDOA 2V3VA 1D2HA 4F6RB 4ZYZA 3I3SR 4A5OA 1C3OB 5CLIA 2BMAA 3L40A 2PUCA 4RTJA 2DYKA 4O4IB 1EFRD 4DMLA 1IY2A 1LFDB 1VYVA 2F1HA 5KTRA 4EARA 1B6GA 3HKEB 4MRPA 4WJKB 3V8NA 1VJRA 3ASZA 4HYQA 4LWZA 3LKZA 1JQ5A 4QAQA 1PSDA 2PSHA 5AESA 5HP4A 1C1HA 1DJOA 2F8MA 3A6GA 4JLUA 2IGBA 2E21A 1BVRA 5E1MA 1G4AE 1V11A 2TECE 2ENWA 4NNJA 2QWXA 1A9QA 1RHQA 2C9DA 2MYTA 2C5SA 3GLSA 1RC1A 2P4UA 4ZDJA 3JD1A 2OFPA 1T8WA 3MWFA 3QQPA 3QUSA 4LSGA 1VZ2A 5SZHB 2ZRFA 1OJ7A 3ACCA 2K7ZA 3DT9A 4QXOA 2ACKA 4OJMX 5DNAA 1GITA 1KGDA 2O1XA 3CJTA 3CLKA 1QV9A 1NRXA 3C3PA 2FZWA 5I48A 4HZUA 2ORWA 3R40A 1DRJA 2H48A 2ZAOA 4F5WA 1N2CE 5I4BA 2HA0A 2XXJA 3PNVA 4Y6SA 3V48A 1KY5A 2J6HA 4W7HA 1J7JA 4RVDA 1PHRA 2RGDA 4H16A 4JZKA 2YVAA 3SFVA 4UOEA 2I1LA 4KODA 4TQAA 5AW6A 3HO8A 4JXJA 5IPFA 1ZIDA 3V55A 3I62A 4Z9YA 3ZWDA 3FDZA 2EKLA 2ZUTA 2H9AA 2FG6C 2PNJA 4IXMA 3Q40A 4RHYA 1MLDA 4WN9B 4XLTA 5K3FA 1OLXA 2FWJA 2JFYA 3MGCA 4LYHA 5B3KA 1WMDA 1YRBA 1FQOA 3CNEA 3OZSA 5EKDA 1KEEA 4BN4A 3R3ZA 4A92A 2E1RA 1NP3A 1AV7A 1HDZA 1X15A 4HXFB 3UWOA 1CTQA 2OY0A 3WV4A 1TADA 3QG1A 3L6BA 3BKXA 4A03A 2J9RA 1ISRA 4HO1X 4PG5A 2Q99A 1I4OA 3FUCA 3JR7A 1NIJA 2I33A 1CS4C 4F4IA 4BWFB 1CFJA 1K92A 3PITA 4KZPA 5P8WA 2XOXA 1SQGA 3WWZA 4CM9D 4JLDA 2P2SA 3H19A 2WPDA 3B1ZA 2R4QA 2GWRA 3JQBC 1OYYA 3DKRA 4PWZA 3HS3A 3TBKA 2G07A 1FP7A 1JFFB 2FX3A 5JAOA 2HA5A 2PN1A 1O0BA 3BXHA 1DSSG 2W6NA 1Q91A 3WQSB 3E84A 3WBBA 3B6MA 4M1ZA 1Z0AA 2D7CA 3IJEB 1CC1S 1M7BA 1HEYA 2JFOA 2ZQ5A 2QZ4A 3KEOA 5SYMA 1AUOA 1Q0PA 2WT9A 2OKGA 4EW3A 5JIBA 4JYZA 2ZT8A 5DW0A 5LNK6 4JVNA 3V1TC 3TNDA 2W4IA 3ICQB 4H77A 4PGHA 1R74A 3L8DA 3QNMA 4TQ9A 5A6SA 2R97A 1E18A 1RRFA 2QLMA 4X1KB 1NM5C 2ERXA 2FZGA 3BF7A 1M6WA 4O29A 3UQZA 2R84A 4FZ3A 2PAAA 1NJ2A 5IU6A 5KEIA 3W7AA 1RBYA 2YFHA 3NXSA 3BPSA 3JD3A 4V0OA 2IWHA 4D4GA 1JQJC 1VM6A 3BGSA 3VR6H 1NT2A 3LZCA 2VUUA 4BBJA 3OJXA 1UP7A 5AFSA 1EG2A 2Q5FA 3CXUA 5F52A 5A4JA 1N5OX 2C82A 2L2QA 2VTEA 3LCVB 1RYNA 4KDRA 2B37A 2JH3A 4FOLA 1N9GB 5TXGA 5AKYA 3HEAA 3EULA 3KBOA 4LKOA 5ALSA 2BKEA 5DISB 3RK1A 4BE7B 1C41A 4RPHA 4IIVA 1Y4ZA 5M29A 2V7WA 1MJHA 5EOVA 4ALLA 2IW3A 3KHSA 4G5FA 4HDKA 5IG2A 5B3JA 3EZFA 1JYSA 4C0BA 3EIQA 5KNBA 1N77A 2G0TA 3NTRA 3PEFA 3PGKA 3SJZA 1Y63A 3R5JA 4X1OA 1H05A 3AXSA 4E1AA 2ZM5A 2CDAA 3CLSC 4DYVA 1YJCA 3BCUA 2A0KA 1OAAA 2PM8A 2W2XA 4IGEA 1L7QA 1RXVA 1FYXA 2B82A 1OH7A 5C1DA 1QE3A 4HWOA 4M83A 4GC9A 3ESZA 2O3QA 4WACA 3TOVA 2P1ZA 3VH3A 2R8PA 1DRKA 2P5TB 4JX9A 1JLKA 2VHXA 2Q4RA 3FYCA 3ITEA 2EHJA 3OOYA 4GC5A 4WXMA 1HYHA 2CV1A 2WF6A 3F2IA 5ULLA 5B3LA 2QYOA 1Q19A 1PAUA 1TW2A 1X1BA 2FN3A 3PI6A 2GBPA 5AI4A 5F2NA 1LU9A 4WJLA 1IBCA 4MJXA 2Z5VA 4LOAA 4LC1A 3DOCA 2B8TA 3TSWA 1H6BA 1RPJA 2GRUA 2VF7A 2PPLA 1GAQA 1DUSA 4FWBA 4JP8A 4F3RA 3O4IA 4KQKA 1TI7A 2Q7XA 2OE2A 3A3NA 1XPRA 3I8SA 1GCGA 5M34A 2VUIB 1FTQA 1NZDA 2QXYA 3D6FA 2Q4BA 3NT2A 4ZWNA 1X92A 5ALUA 5JWOA 4L0DA 5LOVA 4QNMA 1ZGBA 5B58T 1V8DA 3FG9A 2YVKA 4B6EA 3DHVA 1F8FA 2IOHA 3E9ZA 1O4VA 1EX7A 4LZJA 4YREA 4Q9IA 3ORQA 1KVQA 4D43A 3EF0A 3ZS8A 3GRPA 3D2CA 1O8CA 1EX1A 4G6ZA 1N2SA 3PFGA 4BP8A 3WYCA 2E4YA 1VL0A 3H5WA 4PYLA 1U3FA 5IHPA 3K9HA 1P19A 4EUHA 1OIXA 1X38A 4LMPA 2JCVA 2YYYA 4EKGA 1E1CB 4R5MA 1FFBA 3OI7A 2J41A 4XTRA 1H2WA 1R4NA 3R7WB 1L4KA 2X2FA 3EVZA 1Y8RB 2BKVA 2AJBA 5D87A 3TG2A 1WSBA 2GEJA 3LOPA 1KMCA 3HZZA 1JJIA 2RIPA 3O1JC 5CBPB 3BWEA 5K0JA 2R8XA 5CEEA 1DCTA 3EHDA 1BSVA 3OM9A 4GPD1 4U8HA 3WLOA 2RHCA 4AIRA 5JV5A 1CUFA 1Y3IA 3D3JA 2YJGA 1ZQ9A 4GUDA 1O5TA 3UPTA 4NJMB 1T2EA 3LKDA 3KAQA 3SWWA 1V4BA 2VYNA 2PCLA 3G9QA 4B3GA 1BA2A 1TPZA 3VR2A 2GHTA 4M9SA 3LL4A 3U81A 1INLA 1NE2A 5FBLB 2NU6A 4ZARA 3L04A 3OIYA 5B55A 3EBOA 4KPEC 1AUPA 1DOZA 1OF1A 5D01A 3DULA 2OQ2A 1NOKA 3IJ5A 4GX1A 1M34E 2KM1A 3IIMA 3Q0TA 2OILA 4HB4A 2Y1WA 3OFSA 3OPNA 2BEWA 3AIIA 4UAJA 3WLAA 1Z6PA 4E32A 3P2EA 4OSEA 4YAGA 5CFRA 5ALQA 1IMJA 1SPXA 4R51A 5DN9A 4C0AC 4TN5A 4LWOA 3QELB 4UUBA 3F73A 2VUSA 5AOBA 3AVQA 4CYMA 1JR2A 2ZAYA 4RQUA 4WOCA 1OFUX 1TRKA 1XRNA 1EFRA 2C7BA 4IMIB 5E38A 1JH9A 5JDIC 2I2WA 4NK4A 4C04A 5JSUA 4H31A 4HQ0A 3CT6A 4AX4A 1P8AA 4DANA 4P4SB 4FFSA 1JHPA 3O8OA 4G67A 3BCRA 1SU8A 4RLFA 1GZ6A 3RT9A 4E3ZA 1FP1D 5H3HA 5ENDA 3D4IA 3JQ8B 3PXDA 2GXSA 2KPOA 3KQOA 1ZOIA 1DFHA 4ZCTA 4D81A 4DMUB 4DQDA 3H1AA 3MNFA 4LVUA 2GCPA 2AD1A 1XSEA 4F9GA 4FYWA 2QBYA 5D8DA 4JGGA 1QYCA 3E9DA 3RHSA 1R0LA 4H0NA 1YXMA 4PSKA 1ZGHA 1L4HA 2BRUC 2JKVA 3AI1A 3AHJA 4QA9A 3ZCQA 4EPTA 2YX1A 4UJ3A 1FXUA 5L4LA 3P8ZA 4M0UA 3K15A 5HHTA 3FWYA 3P9CA 5C4MA 1NX9A 3DWEX 3DHWC 3G0CA 2UXDB 1C7IA 3E81A 2PL1A 1XRRA 1LSSA 2ZYUX 3DS8A 4PFKA 5DIFA 4DY4A 2DTXA 3QXXA 5ABPA 4I1PA 2BFWA 4D6YA 1N5DA 3JWJA 3ONEA 3OZFA 4UFOA 3WO0A 1MAHA 4Z4CA 1ORVA 5MN5A 5CT9A 5E0KB 3KE9A 4Z1OA 1KJYA 2W98A 2UYQA 3SYMA 1DKLA 2P90A 1V11B 5HF8A 5TY0A 5LIRA 1OWOA 4Y6GB 2Q0SA 1XCBA 1UBRS 4OUDA 3N0RA 4IKPA 3UW1A 4E70A 4D25A 1P4SA 3A04A 1MRNA 1GL9B 3KOXA 4F60A 4GECA 3G5TA 4K26A 1IQPA 3NALA 2NM0A 1XJQA 3ET5A 3HBLA 3VNRA 4F4HA 3QVVA 1UBJS 3TLAA 1XWWA 4MYSA 1ENPA 1ODJA 1QK4A 2QTFA 3ETGA 4NX2A 4CE6A 4CTOA 3NRBA 3F2VA 4PN3A 5IC4A 3I6ZA 3QX8A 1HR0B 3WO1A 1JBQA 2QM0A 2AS0A 2FMFA 3HUDA 5IEBA 4D8XA 1R3UA 3RIEA 3NH6A 3QVWA 1OZHA 2GCIA 2HCBA 3RREA 4D9KA 1A4RA 3L8YA 1SXJC 1B2LA 1XYVA 3QNUA 1IDOA 2HQSA 2Y0EA 1UC4B 4MWEA 5EWJB 3ZW8A 1THTA 1V1MA 2NV0A 1K7SN 5K01A 5JYEA 2O3JA 2IYFA 3F7NA 1MXHA 2COKA 3I04M 1LZLA 4R9VA 2JFGA 1OLXB 3R6DA 1OVGA 2NV2B 3A11A 3K0HA 3PCXA 4QYSA 2WU3A 1VCIA 2FE4A 1QIDA 1H42A 4KXVA 2PSSA 3ASUA 4BJ6A 4RL6A 5ECYA 1EP1B 5F2OA 5CFNA 2YVUA 5AK6A 2Q5EA 1KEZA 5EJEA 4IJKA 3FHOA 3BHIA 4TTQA 3WWPA 2G9RA 3UFXA 2VT6A 3QVOA 1CEYA 1IIBA 3SCZA 1CY7A 4N40A 1XN4A 5NLLA 4JDPA 1UFOA 2L82A 2B6HA 4QYTA 2XUIA 2CD9A 2VP6A 2OD7A 1GNVA 3S40A 1N3YA 1K68A 2ZWOA 3VNAA 5E6RA 1EUDA 1VKRA 2IY9A 4LYAA 5FPPA 1GA4A 3ZDYB 1J20A 3NBYC 4MROA 3V46A 2Q4TA 4JQCA 4EW2A 1TQ8A 2VTVA 5A0FA 4S1VA 2IWRA 1CJMA 5J23A 2X4DA 1GR1A 1VHJA 3EBPA 3RAGA 3WJAA 4CNQA 1UJCA 3BWCA 2DEUA 1SXHA 4Q9HA 3REFA 3ZY3A 5KBYA 1F7VA 2HW8A 3NTUA 4DIKA 1Q11A 4MKRA 1T8PA 2IYQA 3T38A 3VKUA 4PX9A 5MGBA 2NO1A 3URKA 3K8YA 1ZP6A 3NVMB 3EWNA 2YXDA 3I45A 2BGJA 1KYVA 1DKNA 1ZOPA 2WUVA 4U9IS 1W0JA 3TBFA 2WWVD 2BM0A 3AX6A 2A5FA 3OJOA 4HN2A 4YACA 4J6FA 5AM5A 3B2NA 3KJIA 4WZZA 1U5BB 1GA1A 1AK1A 4IIYA 5EGSA 3NTOA 3ZHBA 4Z4FA 3IMEA 1J22A 2ZBFA 4FMBB 3WRWA 1S2IA 4ODIA 2I3AA 4B0OA 3FETA 3EG9B 2RH4A 1JP7A 2RKOA 4GM4A 5HX7A 2M2IA 3PFNA 2IP1A 4RLQA 1TK9A 3U3OA 2WM3A 4CLRA 3QUBA 3GIWA 3W4IA 2RFLA 4BKOA 4U2BA 2EJVA 4MZXA 2QN6A 2YC4C 3PNPA 1UM8A 2JH9A 4UPVA 4PZLA 2J07A 2WU0A 4EECA 3CRVA 3H87A 3H99A 4XJSA 5E4TA 1XIVA 1WX1A 2AFVA 1O77A 2JCYA 1TYBE 2R8YA 1ZGAA 5AW5A 3R3HA 2LZ0A 4FYPA 4KR6A 1ML4A 1SVSA 2FRXA 2ZBGA 5EFZA 5CBKA 4P92A 4BX3A 1NMQA 2F9LA 4YV1A 4GAEA 5EPEA 1H9AA 3ZD7A 4F3TA 1KS2A 4PRLA 3B5IA 3L0ZA 4KWEA 4LRXA 1LLUA 1ZONA 4C9BA 4Z2AA 4HUTA 1FUIA 3LL7A 2MR5A 2PAFA 1W29A 4GGMX 4RA9B 2B0JA 3MPOA 1U1FA 1FPMA 1TYDE 2CGEA 3I1FA 2RSLA 4GM1A 4K6OA 4TKUB 3H9EO 1PR2A 4YHBA 4ZOLA 1X87A 3V2GA 1XLWA 4RZSA 3WIEA 4C7JA 4Q3LA 2AFIE 1KMQA 4PQGA 3REGA 2FWPA 4FC7A 4JLVA 4Z99A 4J1TA 3U31A 5HPYB 2O0JA 5CIQA 3H2SA 1I51A 3C1TA 5I9BA 3DBHB 4U00A 3AR3A 3D4LA 4H7PA 4EF4A 2R1VB 1PFVA 2YW2A 1YBHA 4OHZA 1CYEA 2DECA 2OXRA 2XDQB 1JIVA 2H85A 2AEJA 4E08A 1STOA 3ZXIA 1TO1E 1XXHE 3H7AA 1B0UA 2YNMA 3IUYA 3HA5A 2E4UA 1TOAA 2DSNA 4V0ME 4TMXA 2PUDA 1XNJA 3O4RA 1BZYA 2C0QA 3QBTA 1P7YA 2RHMA 1M8JA 1SVKA 1NP7A 4ARBA 3A0UA 1Q0SA 3OQPA 2VVTA 1XCOA 5EHNA 4HGZA 2H0QA 1DC7A 3A1TA 3FMFA 2WTUA 1KKUA 3L7JA 4ILKA 5IBCA 3ELBA 5K3DA 1SU7A 3V9PA 3EG5A 1I2BA 2VNKA 5C18A 2VEDA 2Z8YM 1XZEA 1RLIA 2VXCA 3PNYA 3PWZA 2M6LA 5JATA 3LYLA 4YP6A 4CKCA 1R4NB 3BWVA 2NG1A 2B4AA 4H1UA 1MN6A 1S6YA 2KQUA 4HDOB 3KXKA 3RF7A 2JH8A 4GI1A 4PLYA 4KQGA 1KY4A 5CXUA 3RC9A 4BV2A 1OGJA 2HCJB 1QDLB 3CUWA 4AFNA 3UGTA 5KYTA 1ESDA 3OEED 4I7EA 3PDCA 3QLVC 5JWHA 4IDNA 1KMNA 1GG8A 2QK4A 4BP3A 3QX7A 2QQGA 1O6FA 3D1LA 1EHYA 3E4CA 4MLCA 3FUXA 3WLKX 1A8PA 5HRAA 5CEFA 5I51A 3ABIA 2VLBA 3DMDA 1QGYA 4Q24A 2NU6B 4NYMQ 2NUTB 4DB4A 3OZIA 4BAUA 5DWDA 5JCJD 2XB8A 4MDEA 1PD0A 2XWJI 4LMAA 8GPBA 3R09A 3TVYA 1E2PA 1LI7A 1XEAA 3DCJA 3QM1A 2FWMX 4R0MA 1I5OA 1CB7A 1RRVA 2HX1A 3GD7A 5CVTA 2BEWB 2XR1A 3RUEA 1O97D 4ASUA 1E2IA 1RXEA 3LDUA 5FHRA 4X64B 2FPIB 3F98A 1ANKA 1RTTA 3OOEA 4RL4A 5LP6C 4YJHA 5I3ZA 4RF3A 3C3XA 5DLDA 1TJYA 4LSMA 1JDZA 3RU2A 2QW1A 3WGZA 1KVUA 4PVDA 2ODEA 1KYWA 1MJNA 4ALJA 5KJ6A 3U3RA 3FN4A 1S4MA 4XOUA 3IRUA 2DFVA 2Z2IA 1F4VA 3A4MA 3AUKA 4GOND 4D57A 2DPYA 1E60A 1TC2A 4KGDA 1JZTA 2NZXA 3IBCA 4E30A 2B1JA 1ZK3A 3EVCA 3ONVA 4A2PA 3CRNA 4KREA 1VJ5A 3L8ZA 2P3QA 1YAJA 5DHQA 1H93A 4QUAA 3SC2A 2FWAA 1BN6A 1KR2A 3G7NA 2MSDB 5DZSA 1IJKA 5TQ0A 4A6XA 3AEUA 3EVDA 3I0ZA 3UV3A 4D6XA 1V7CA 1CQWA 1QNFA 2DUNA 1M33A 1P4HA 3HSSA 2C5LA 2VCHA 3UN1A 4UVDA 4JFRA 3LUCA 2BL4A 3KTOA 4FHCA 2EKZA 2HMTA 4UUPA 2Z8XA 3RU7A 4A9AA 1KVSA 4J03A 3OC6A 4I4IA 3OVMA 2UYHA 2NXEA 5KNDA 1MX3A 3HXTA 4B33A 1R4ZA 3ABOB 3L0SA 2C7PA 2QYTA 1Z4QA 1ZVKA 1DC4A 3CLTD 4Q9LA 2EERA 5KKAA 2GKOA 1UBUS 3K96A 4TMKA 5DTRA 2YJ4A 5AI6A 2Y0DA 4UUMA 1HETA 4CXMA 2AN5A 3A14A 5EHIA 1YJXA 2MSNA 1NW6A 1A2BA 2JPDA 3T12A 4EGAA 5JH7A 2G9QA 5KPJA 3QH4A 4WZBB 1DAGA 1V7PC 1ZI6A 2PWZA 1Z75A 2X6RA 3HJRA 3ILXA 3IR6A 1W46A 4I3FA 4PYQA 4MGZR 3KELA 5C53B 4IDHA 3WFJA 4YMWA 3H2ZA 4M9QA 4PRYA 3RVNA 1T4CA 1GV0A 4DTCA 2HCFA 4J2HA 2P5SA 4DSZA 5K0BA 1H65A 2X7JA 3SD7A 1QO0D 4XQGA 2WJ3A 1ACJA 1E7RA 5FYDA 2IIVA 1IPEA 1E2KA 2VHUA 3IUSA 4FCWA 5LDGA 3B52X 1N33B 4OCZA 4BFVA 2B25A 1OMOA 2VQSA 1RZUA 4ACBA 4UASA 4ES6A 3F9IA 1PLJA 4FCCA 1HDCA 3SYLA 3BIOA 1KXJA 2Z2XA 1P75A 3PXBA 5FL3A 3FX2A 4NMXB 4C87A 4CEHA 4CHGA 1DBPA 2Z1NA 1KZ1A 1RAGA 1TQ2A 1Y48E 4KAAA 4NH4A 4RQTA 4XW2A 1VLHA 1ZINA 2V4ZA 3HNRA 3N28A 2PWAA 2YFKA 3GLKA 3AUTA 1ZVQA 3RASA 4QGHA 3C2QA 4D0SA 2IW1A 4TTJA 5EEHA 2C7GA 3UJ9A 1PJCA 3W9SA 4HGRA 4AULA 4J94A 4BNUA 4LCBA 3FPCA 2R751 4PR3A 4LI0A 4H1HA 3RS3A 2NMVA 3GGCA 1JPJA 3IQWA 1Q50A 3T3IA 2C4UA 5H3CA 1YUMA 2A1UA 2WDZA 1LD3A 1MIOA 2QPTA 2RH8A 4XJXA 1GEEA 2IX3A 2CDNA 1CY8A 1QDEA 3AJRA 3AOEA 5FYQA 2JJ1A 4M87A 2YMMA 1FU7A 3UFXB 1XYGA 1NUPA 5THQA 3RKRA 4BO1A 4L9SA 2OFXA 3GDHA 4C3VA 2B5OA 3M1AA 2FETA 3PUJA 3SZMA 5FBHA 3DEAA 4KTVE 1IPFA 3KOYA 4LHYA 3SHTA 4UTRA 5IH7A 2QUJA 2Y2UA 4HVLA 2O5VA 4QFMA 4HZGA 3WQRA 1GPUA 2C5FA 1GZ7A 3C7AA 2GBGA 5CVCA 5E6RB 2Q5QA 5K1ZA 2P6OA 2R5FA 1NNI1 3LVQE 4N54A 4WCFA 4PG7A 1JPVA 3I1JA 5CM8B 3COSA 5EUBA 4DUGA 4OJKA 1MOQA 2NZUG 1UWKA 2PWBA 3ZY5A 1MENA 3IURA 1GQQA 2EW2A 3FZQA 4RY0A 4LXXA 1DBSA 4BP9A 1BQ3A 3EC1A 5I9MA 4LY3A 4HAIA 3HR7A 3QE2A 4LZLA 4DJTA 1U3DA 1Z8HA 1ZD5A 4TYQA 1EHCA 3E1GA 1KJ9A 4KW7A 1SQ6A 1RI3A 1SEVA 5D86A 3UHOA 1EZZA 1DX6A 5DLYA 5AVQA 2H4WA 2CFCA 3AFGA 5G41A 2Y27A 5KVCA 1FLNA 3P32A 2JJ2D 5I7EA 1DGQA 1NXTA 4BNDA 3RFFA 4P7BA 1R4AA 2CYCA 1ODFA 1CY0A 2DFTA 3A9CA 3DFZA 3IPRA 3NP7A 3CWZA 1GVNB 2W2OA 2B94A 3ZV4A 1AE1A 2G0NA 5H9VA 3MPUA 4DS3A 1ZCZA 2PYDA 3AYZB 4HXGA 4MI9A 3EGCA 1ECLA 2C3UA 4OQYA 4L51A 3GY0A 5ES3A 5TJ9A 2CHQA 5FL7A 1C0EA 4EHJA 2HF8A 2FRDC 4EI8A 2GAAA 4CLRB 2BJHA 2D2VA 2Y1XA 5C8YA 3B1WA 3BAFA 1TMOA 4D8YA 4JJFA 5F3WB 2J0UB 3CEJA 2QQEA 1USGA 2C8KA 4RIEA 5D5HA 2BHRA 1A9XB 2C77A 3BXOA 1NVTA 2IV3A 2WQ7A 1KKLA 4YASA 2XCRB 1GVHA 2ZRDA 1E3QA 4OHMA 2XKKA 1OAOA 4G0WA 3L05A 3KZXA 4MV8A 3KJGA 1K0FA 2PD4A 5JE8A 2YWCA 4YGYA 4AF7A 3PHJA 4WLFA 1D5WA 5K4GA 1P1FA 3HG7A 4HLUA 2KYRA 2ZB4A 1W9HA 1Y1PA 1FSPA 5JPIA 4UOQA 3WMRA 3MWKA 3HVKA 4CN8A 1TJ4A 3KCNA 1HMPA 3LRXA 5AI9A 2WD8A 5K8VA 5CD1A 1AZLA 4EG8A 1WV1A 2FZKA 3B38A 2JGLA 2IHYA 1M2HA 1W30A 3MT9A 2PH3A 4JUBA 1IEXA 4KK3A 2ORED 2FR8A 4ZOLB 1Z4KA 1KDZA 2HIAA 2XQVA 3IOEA 2EARA 4UHDA 1HFWA 2ZK7A 3PC7A 1K86A 3DONA 2F9MA 2RG1A 3JQEA 4HEJA 4TVBA 4LJAA 1U02A 1VIVA 4FQ7A 2G3YA 1TZMA 1NY6A 4AYWA 1PVOA 5DIZA 2CJPA 4MWSA 5KCMA 3I83A 4KMOA 4NSNA 3KZ1E 3DKPA 1DO8A 4RVNA 1A77A 1P61B 3IVMA 2F1OA 3F6EX 3QMWA 4JHLA 1Z47A 1LB1B 1D4OA 2QAGC 4PS0A 3WXMA 1Z17A 1J70A 2QVYX 2C98A 2VQ3A 1KDTA 3QFSA 4BLTA 3FR7A 1UBOS 2O2CA 4RK5A 1RM0A 2FF7A 4TZ0A 4G5HA 4ZOEA 1EI9A 4JMLA 3MJFA 4DLWA 2W11A 2CNWA 1L7OA 1PR4A 4BV8A 1E63A 4C2BA 4B2YA 1FFEA 5A62A 3DP9A 3FNQA 4JYCA 5B6PA 3JVUA 3L7KA 4JBNA 4QUEA 2PUGA 5FFMA 1UBNA 1YV9A 1AXRA 4CQJA 3M1IA 2G83A 4IEIA 4G9BA 3LWZA 1QP0A 1L8QA 1P0MA 2QPAA 4KYTA 1ESMA 2D59A 1PQYA 1ZGJA 2F00A 3NASA 4R8VA 4Y30A 1RYFA 4C7XA 4OX9B 3E03A 1N6NA 3DDWA 3AVYA 3JRXA 4QO7A 4MO9A 4IUCS 5HCNA 4S05A 2WHXA 1P3DA 3KG2A 5E9AA 4CKCB 3A9WA 4MW4A 2DUMA 5AYVA 2H59A 3LCJA 5CNJA 3ZZTA 1F2DA 1QQ7A 1BXRA 2XUJA 4TKUA 4DCMA 1ZAYA 4RYLA 2PBZA 4TL7A 1AURA 1NU8A 1GSAA 3F3MA 4FMDB 5DDIP 5FLKA 5M2QA 5FTLA 1ND5A 1JHQA 4OP3A 5DXJA 1XNHA 3COWA 5EIEA 1C14A 5E7QA 5BVHA 4TZ6A 2CSUA 2RGNA 3DDHA 4RKFA 4F97A 1OLUA 2JAPA 3A4LA 3OCVA 5IUKC 4QTYA 5CB4A 4XPIA 1QU2A 1QC5A 1UKYA 2QRJA 4JBLA 1SB9A 2QPOA 4EMUA 5JD4A 3QXHA 5JAMA 2H1HA 4GO1A 2C3OA 5DK6A 5K4AA 1QYVA 4HXYA 2PQ2A 1XBTA 4S3MA 2HQRA 5LJLA 4XFKA 4KH0A 1VCHA 4CTJA 4DQ0A 5ALVA 1QJCA 3VO2A 4J1SA 4YCCA 3T9CA 3WRXA 5J2UA 3SJUA 4Z2YA 1Z0JA 4LBVA 1M2GA 3JWPA 1LRJA 1QHGA 5LZ2A 1P5HA 2AJDA 2GLXA 4P7JA 3PQ4A 4TVKA 1CF4A 1T25A 1W0KD 1QG4A 2ZAMA 4MQBA 5GOTA 4G8DA 3KETA 1Y7HA 2PUTA 3C6XA 2B34A 3CWCA 1KR5A 2VYVD 4FMCB 2IXGA 4K9MA 5EY5B 4DKJA 1I0LA 3HWRA 4QVGA 1IN5A 2ADMA 2CNBA 4YJHB 8ATCA 1NR7A 1GILA 3NHAA 4G0ZA 5JRZA 2UZ1A 1SZCA 1I3CA 4WHMA 4C30A 5KNBH 3NPMA 2BFFA 3KQYA 4LY0A 1VGQA 4V0LA 4CQLA 4GP7A 5FOQA 2PSFA 3ZQJA 1T1RA 2HCRA 3LH5A 3ZVLA 4JEHA 1RPTA 3W2GA 4U63A 4C2UA 1AUVA 5BWOA 1YDEA 3LUPA 1KAOA 4DA6A 4ZDWA 4W9NA 1TM5E 3SI7A 1S4QA 3VOTA 4B3SB 4RSRA 3HA3A 3ADBA 3NHMA 1BMFD 4XUGB 2BEUB 1FXWA 3SC2B 3EAFA 3UJAA 2QD1A 2HO4A 3LX4A 3B2EA 3VPBA 3AEUB 4NDNE 1AT1A 3HEMA 1TVCA 3I5MA 3OOJA 4FXOA 4HDNA 4MIYA 4JP2A 2YHUA 5COBA 3MQFA 2MSKA 2JARA 1YZTA 1C8LA 1LVGA 1S9HA 1Y8QB 2VRCA 3ZCRA 1XZ8A 2BTOA 2ERCA 2JFNA 4XWAA 5CH3A 3BRWA 5CFLA 1A7AA 4IIXA 3ZUPA 2NPOA 4TOIA 2Z56A 1A9ZA 2R2GA 4X61A 3KM0A 2GEDA 1OLSA 4OKNA 1QF9A 5DRYA 5FUBA 3SBDA 4BFUA 1IUPA 4P3PA 4CM5A 4CV2A 1RRPA 4R41A 1L7BA 3FNFA 4PR0A 1KQGA 4QOEA 1XMVA 5FUXA 4KK4A 3ZTTA 1XOIA 5B37A 3G59A 4UNQA 1TLFA 4UTPA 2A9OA 3KTAB 3QF4A 3UH1A 3SXJA 3R41A 1MG0A 5CLGA 3SE7A 5BNIA 5DYTA 4KZKA 1B1AA 1CY4A 5J58A 3GK3A 1X7ZB 3HBFA 5ESXA 1FVFA 1GTG1 3NORA 9LDTA 1C4KA 3MMNA 4G85A 2I3DA 4RKWA 4IHQA 3DBVO 1ISHA 1P17A 1VJCA 4YPFA 1E5LA 4O4JB 2Q2QA 4CEJA 2IXEA 1FNMA 2VK8A 4DV5B 3ZU6A 3UB2A 3MB8A 3IH5A 3ZH2A 1C0KA 1NVDA 1PYOA 3ZWBA 4S1NA 4JENA 1VA4A 4ZOCA 1JKJA 5D00A 3W2FA 3D6VA 5KOHB 4J0DA 3KWLA 5G0UA 4EK9A 5EZYB 1V6CA 3BE5A 5EJ4A 1XYYA 2QUKA 4MLZA 4KXMA 1AQUA 4CEHB 4JYBA 4BX8A 2O07A 1ZL2A 1ESEA 1J0DA 1H8ED 3AEYA 3BK2A 3BXZA 4GP6A 5TQJA 3W9UA 2R7LA 3ZQKA 2QRHA 3MJRA 3WI7A 3QNWA 1PN3A 3BMOB 3Q8LA 2XBMA 2OHFA 3BOSA 3NNSA 5CM2Z 1J8QA 1U2SA 1E9VA 4NOMA 3VU9A 3FAZA 4R2XA 1AKVA 1I0IA 1WUTA 3CZMA 3PPYA 5CH5A 5AP9A 2QL6A 3ULKA 3D7SA 1T5LA 4MV5A 1M2EA 3PICA 4I46A 1GDHA 2J4FA 3AW9A 4BZPA 5I5EA 1NHGA 4P3YA 2VDPB 4RZQA 3STUA 3WZ2A 5DI9A 1PEKE 2VT3A 2OZLB 3H9JA 1AXGA 2A1UB 1GPBA 1K6JA 1MIOB 2VS1A 2Q5JA 4JUCA 2IA5A 3JQGA 2GMWA 4JXKA 2WTAA 4WIAA 4JL8A 2GA9A 1D8AA 1BRMA 2JJ2A 2RDMA 1NLFA 3LQRA 1FNSA 3WGIA 3INRA 3AI3A 1O03A 1U8XX 4M0FA 3P5BA 4TLEA 2JAHA 1T5BA 2VO1A 4M3NA 4MWCA 5D84A 4WZAB 2JFWA 3FWNA 4WINA 1KZHA 1K98A 3V8MA 4BMSA 5JD6A 4PM4A 4RD3A 1V2HE 1VJ1A 3LVFO 4CTNA 1YBVA 3CT4A 1FTWA 3F8SA 4DCSA 2DQZA 4QHTA 4XCQA 3ICEA 3ET4A 1CS0A 1NVVQ 3QVMA 4WCFB 1V4NA 3UQYS 1QTRA 2GGSA 3AVXA 1H8HD 2P27A 3BHJA 2WZQA 4HAOA 4CV3A 1ZOSA 2WKPA 4HEA1 5C46F 5CIWA 2QX7A 2D5BA 2YUIA 1A27A 5BSKA 2JFVA 3T3PB 5GV7A 1JTFA 5AUOB 1RYZA 2AFHE 4MWTA 4NBNA 1BD3A 3IOBA 1ZWKA 4AY3A 1KAEA 3I0MA 1W5TA 3U1VA 4EI9A 2HJGA 5IM4F 4O4HA 4RVFA 3EF3A 1GTRA 3QFCA 2FPMA 3RTEA 1VL5A 1U0LA 1JBKA 3I4CA 1BMTA 1ENOA 1KH3A 4BNDB 1WOMA 2ODPA 1USWA 2QXUA 3OUUA 4R2LA 4K87A 1Z45A 4BKMA 5AKLA 5HRCA 3DW1X 2ZRPA 3Q98A 3M8KA 1YKFA 4GP9A 4PAQA 1UBGA 3EMKA 4XGKA 4EHKA 2NPIA 1E6KA 1PVVA 3X1YA 1JQKA 1X1CA 4B5LA 2AG8A 3CR7A 5CD9A 3K4PA 1E0KA 4OHOA 4N0DA 4L02A 2CHGA 2HBZA 3AMVA 2BMVA 4ZANA 5LR6A 3HRKA 5U4XA 1VL1A 2A0WA 4WK2B 1PQWA 4XI9A 3KV1A 1RWWA 2C2WA 2GD0A 1CZHA 2PZMA 2RHRA 3D0OA 1HDRA 5BR7A 4LJKA 3KQHA 1WPGA 1PE0A 2Q27A 1KMHA 2P77A 3ZHTA 3I42A 3U7EB 2G6TA 2CJYA 2QG6A 2ZRJA 3K9GA 1I9CA 1M1NA 4KC0A 4CIDA 5HM6A 2WAYA 3KB1A 3E35A 3CLVA 4G5QA 5F23A 1Y4SA 3GJYA 3E2PA 5JT1A 4ENUA 1RFLA 2JD1A 2GPWA 2BH9A 2P9JA 3BTSA 4F5EA 5C9ZA 3G0HA 1G8FA 4DARA 1YFKA 1BTOA 1G2PA 1US8A 2G09A 1YR3A 4D3YA 2R8ZA 1H9BA 2WAAA 2M1XA 2H57A 4PLGA 3EVGA 5C37A 3EQZA 1PFUA 4MUJA 4AVYA 2VR1A 1ZFNA 4OGKA 4QOFA 4UUOA 3DV2A 1RC0A 1WDTA 2NQ8A 3OOSA 1XA3A 4FQ5A 4OXNA 2WDPA 1QH8A 4W5TA 3ZK9A 3CCCA 3TXXA 3UWDA 1D4AA 4X6XA 2OGTA 1YI0A 2W6JD 5EP2A 2YBEA 3H9GA 2YWRA 3G79A 3GO4A 4OHVA 1ZLYA 3I72A 1NBEA 1GZUA 1GDDA 1BH2A 4PZDA 2OG1A 1FVHA 3BBLA 5EJAA 2HU7A 1I2MA 4FEAA 3DAFA 2DR2A 2IYEA 5A9RA 5HS6A 5BXYA 3I12A 1E2BA 4EUFA 2AC7A 1BXGB 1ZRHA 3AF2A 4JB8A 1R5OA 3ZHQA 5HFJA 1PR6A 1G41A 2G1UA 2IEIA 3GVCA 3ME5A 2O06A 1QAOA 2I4OA 1KAGA 1PGNA 1UINA 2BY4A 1CV2A 4G1BA 2PCJA 4GR4A 1XQYA 4AF8A 1RJDA 2VYVA 4UTXA 1C9YA 2R4UA 3TNLA 1RAHA 4BJ1A 5CDGA 4WXRA 2QE7D 4EYGA 1WULS 3K6JA 4HBGA 3IVCA 3THYB 1R5NA 1U5AA 1E32A 1QZTA 1SIBE 1BXRB 1GFSA 1QGOA 2WD7A 1H22A 3KYCA 3KX2A 1CERA 3IR7A 4PRZA 5CU7A 3R7LA 1SXGA 2JVJA 1CJKC 3KSUA 1I7NA 4QEDA 3R7FA 3TMYA 2IODA 2PLNA 5J5AA 1D2MA 2C8JA 3NYWA 1QCZA 5BN3A 1MTZA 1RPZA 4KNWA 4WL0A 1QGDA 4PX2A 3K30A 4OGLA 2I87A 3CBQA 3JPWA 5TJHA 2RHWA 1BMFA 5IW8A 2C07A 4HQRA 4AQDA 1QB8A 1SD2A 1POXA 4JWKA 3CVWA 4DCNA 2WUDA 3AWIA 4H4DA 2EZUA 3IP3A 4NOKA 1O95D 3PLRA 1IBLB 1ZM7A 1QYIA 3E5MA 3JQPA 3K72B 5CNIA 5J2UB 1B00A 1SKMA 4CUJA 2ZBEA 4GLJA 2H0RA 3THWA 4P31A 3A37A 2NN3C 2YC2C 3AB7A 1YFZA 4MHSA 1LBIA 1RWXA 1SM4A 1JHAA 3AGPA 3Q9NA 1XX6A 2YJTD 4WNIA 3RVOA 5ALHA 3H4VA 3ILSA 2UZ1B 3WL7A 2BFPA 1VPTA 4TRRA 1RNLA 2BFFB 2XVAA 3MMSA 1R8QA 1C8KA 4R8MA 4RPKA 5F5LA 4BB9A 2CLKB 3C70A 1DT5A 1JB9A 3M5DA 4I50F 1LW7A 2HM7A 4NG5A 2QT9A 1Y3DE 2NUPA 4PVCA 1F4PA 4RJJA 5LA6F 1K88A 3AHEA 1Y1SA 4AG5A 5ES4B 5ICCA 4GHWA 4X91A 2D5AA 2ZPUA 3PIRA 4UTOA 1KK1A 4NLLA 4PYOA 1IHDA 4XD7D 2JLYA 2LUOA 4Q02A 3H5LA 4TTVA 3D59A 3DEIA 5LYJB 4LXIA 2W6QA 1K7XB 1Z5VA 4PFSA 4DG5A 2D8MA 3JV7A 4WDRA 4EPRA 4JP1A 4HDNB 1ESZA 4G4SO 5JI2E 5KOIA 1DFGA 5AHRA 2C97A 1XZCA 2XYGA 4ZVTA 3TQHA 3WTBA 1G3UA 3G82C 3LSTA 3WDLA 4AX8A 4ZO9A 3I2JA 2GJSA 3DM9B 2PRZA 4HDSA 3Q6IA 1N5IA 3C48A 3DVRX 2FPGB 1HE1C 2YZGA 3BSWA 4ABYA 2W2MA 4B3TB 4LDAA 3JSAA 5K0CA 4IV0A 4GZ6A 5F98A 4QJBA 3ROMA 4FYYA 1XEWY 3U1TA 1OLSB 4AS1A 5ALZA 4KKVA 1EVQA 1M67A 2CMDA 5DB4A 1ZAKA 4IFEA 4TUYA 4DCCA 3HDVA 1WD7A 2XQJA 2ECQA 3ENZA 4JOQA 2Z4TA 3JAWB 1VTKA 2D4AA 3QF4B 2GJKA 2QDKA 3FNBA 3OQVA 2AG0A 1HV8A 2ZRQA 3GFFA 3GJ4A 4JEIA 4L50A 1IC6A 4RXMA 4S0ZA 1I7QB 4EI7A 3EMVA 1NN0A 1Q44A 1WZ2A 1J2UA 1T36B 1A8SA 1Z5GA 2ZQZA 1RJGA 1M6NA 2FP4B 1JHOA 2HUPA 2YY6A 3Q12A 4NOLA 2F1RA 4PYMA 5FHQA 4BVFA 5ENVA 3CIOA 5K3EA 3ZVRA 3MWEA 1JEQB 4N18A 3GUYA 4CEJB 1SRQA 1YU9A 4KQ2A 1G2OA 4FFMA 3JZIA 1GL3A 1DHRA 1XP5A 3FMVA 3FSEA 1J09A 3Q7QA 4IKOA 2JFQA 4X63A 2E18A 3IBYA 5H83A 3UJDA 3G2OA 3WBJA 5C2JB 4I2NA 4JKIA 3W5HA 3OTWA 4K8OA 2AOVA 3GRAA 2ZS8A 2R8BA 1V96A 2TMDA 3RC3A 2BHSA 2COEA 2BI8A 4GZLA 4GYKA 2W83A 4BO3A 3SICE 5MN6A 2OZPA 3O8DA 2H3HA 4B3MB 2XXAB 2XPCA 2B5WA 3E70C 4IXNA 1V3TA 2QUZA 5G02A 1SHLA 1Z0DA 3VJLA 1L7EA 2XZOA 3SR0A 2XHEA 3QYAA 3VHRA 5A05A 3N53A 5B3JC 4RH0A 1C3XA 3N8GA 1V9LA 2IH2A 5CW2A 2BE7A 1LNZA 1NE7A 1SC1A 5IYZB 2Z5LA 5A5DA 5JROA 4OLBA 3AUUA 2V5UA 4KFTA 4H59A 3N6RA 3QUQA 3WYAA 2G08A 5H68A 2ONJA 3KQUA 5AOCA 1GAEO 1NYRA 2ZB2A 4MVJG 5LYYA 4PGGA 3T1HB 3GLIA 2JI6A 4J7AA 1HOTA 5AJXA 4Q5IA 1LK0A 3N5CA 1YVDA 4LF9B 4YJFB 3T9EA 2YR0A 4NENB 3WKBA 4DPLA 2E55A 2EGGA 2EFYA 1CQJB 2DFNA 2DFLA 3DDUA 2MMCA 3Q1KA 4JVSB 4MW1A 4KO1S 4M1TA 1D2AA 1IOZA 2OK8A 5AHWA 1H66A 4EL5A 3SVTA 2AJTA 4DLLA 1QZZA 1NN3A 4ITRC 4F45A 4K6HA 3IAM1 3ZNNA 1TZKA 3CKKA 3LT5A 2D00A 2DPGA 2QN7A 4B6PA 1R0SA 2H07A 3O3MB 3QJ5A 3TTSA 2PJRA 4MI6A 1O94A 2JF0A 3GPDG 4HH1A 1YNOA 3O7WA 3JX9A 3OAAD 2ZJ1A 2XZTA 1OR8A 3NANA 3LBHA 1NJFA 1R66A 3UHAA 4L72A 3WNDA 1JHZA 4J0CA 2EZTA 2EBWA 5JZ9A 2X5OA 2VDJA 4RPCA 5CDTA 4O4HB 1L7PA 2B35A 2QSYA 4XARA 4BMCA 1C5KA 2O0HA 5EFOA 3D7MA 1O2DA 3VJMA 4FGKA 2O7SA 2Y66A 3B9PA 4RQBA 2CJWB 2BONA 5LVAA 3TGPA 2V5AA 3FOEC 2HN9A 1RJFA 4ZXFA 1U1DA 2OGZA 5L3ZA 4E4TA 1MAAA 5AVRA 7ADHA 1QG6A 1WB5A 2EVWX 4JQSA 4XZ3A 3VI3B 3EFBA 2VJYA 1U2EA 4B3HA 1MD9A 2RHJA 4OVKA 1OZ0A 2JCGA 5CYGA 5FUQA 5K2OA 3VZPA 2IZ5A 3R5FA 4LJ6A 1WQ3A 3EOZA 1AMUA 2I6TA 3L7AA 4UBLA 1YASA 1PJRA 2DM6A 4WNYA 4GFDA 5DEOA 2W6JA 4ZIRB 3DMRA 5DLPA 3T0FA 2CD7A 1Q0QA 2LTAA 4XQ9A 3PF8A 4YAOA 4EBBA 1KMHB 5F5NA 2Q3JA 4KFCA 1V26A 3K35A 4EHLA 1JGTA 2O7RA 1FFDA 5JJ5A 4EJSB 3MXOA 1PI3A 1F06A 4DFDA 4YRAA 4RM3A 3RBAA 4JEMA 1MC4A 4Q3AA 4R0VA 1LQTA 1W2GA 2WHEA 3E7FA 3F97A 3EIFA 3JZAA 2W71A 3RYHA 3ROQA 3VSCA 4CI0B 4GPTA 2J3LA 3N2ZB 2A78A 2BGUA 4RBNA 1V25A 5GIPE 1HQCA 4GU5A 2I91A 1WSAA 2E0IA 3V4RA 3RJZA 1US8B 4KO4S 1TQHA 3KJEA 2JGEA 2Z2YA 3O8QA 2O8DA 1E3JA 1LTHR 4R68A 1O1YA 1E5VA 5EXPA 1TM1E 2IS1A 4FHGA 2FDRA 2XQIA 1CYDA 2W90A 3TUIC 5FA5A 3RRMA 5BRAA 4RW0A 3RS8A 4PLVA 1EA7A 2CK3D 2HDNB 5B30A 1T1EA 1ZJWA 2W6OA 2W5UA 3D7NA 4Z51A 3H0KA 2Q07A 4CIXA 5LQUA 4W5WA 2FOXA 2GFIA 1DTSA 1YMQA 4GPBA 2R60A 4IM7A 1PJ3A 1EPUA 2WNIA 4G9GA 4KYIB 2WE8A 5IDQA 3KEQA 4EP1A 1FQKA 2B36A 4A27A 1DKPA 2BMFA 2CF6A 2HFJA 4KITB 3ELUA 1WDLA 5HILA 1ZVJA 4R81A 4RADA 5E7IA 1O95A 1EIZA 4MIKA 3D1VA 5EINA 1TKCA 1CIPA 1PEAA 1PO7A 2I78A 2UVDA 3ZWAA 1TCBA 4DMHA 1ZM9A 1QCCA 2JG3A 3R3YA 4C76A 2VBCA 4ZQHA 1VDMA 2OBNA 3CVYA 2V6IA 2I80A 1BROA 3ZDRA 4BL5A 4IYRA 5JQWA 3OZGA 1LZKA 3RIHA 5K4HA 1YFJA 1OXUA 3QBJA 4MPPA 2XY4A 3OWHA 4B6RA 2O54A 2Z9CA 3B9RA 2JKZA 2GCNA 3L7CA 4KPUA 4RSGA 3E5RA 1V16A 3KYCB 4E6EA 4MDHA 3R9XB 4KRYA 3DM5A 3JAMA 4MKXA 2C92A 4U7WA 3E82A 3JQFA 2VQEB 2QTRA 1IUOA 3OF3A 3PQ3A 3EISA 1TFUA 3HRIA 1XDBA 4H6PA 4IOLA 3SR4A 5BWMA 1PNVA 5BN3B 4NAVA 2VTKA 1RHMA 3DD1A 2PWPA 1E2EA 4KXYA 3E18A 2YIDA 4OP2A 1GKKA 1D1SA 1QE0A 2V7UA 1PT6A 4XD7A 1EXVA 1W34A 2ZE7A 1NQAO 5C8DA 3PD1A 4AJ9A 2LKCA 1W9MA 1FS4A 2EQ5A 2XKJE 4M9XA 3ILYA 4CCAA 5BUSA 4P0PB 5AW2A 4X8HA 5HBRA 3VH4A 1WW3A 3SDSA 3EZ7A 1XEXA 4LHZA 3V33A 4PO9A 4W5NA 1GU1A 2DCMA 2RHGB 1KRXA 2DPXA 4BVAA 1COZA 2JLRA 4GBED 1P72A 3GNQA 1KE2A 5JBIA 2CE7A 1R6UA 2XLBA 3TQTA 4EMBA 4EPXA 3S8MA 4MICA 4YLYA 1RKQA 4GMDA 4N03A 3I9V6 3Q3JB 4H18A 4NNPA 1DBRA 2OYCA 2CCKA 3QHPA 4D4IA 4M54A 4AT1A 1NBME 1W48A 4QHYA 1PT8A 1TJ5A 1ZBQA 1DIGA 2ZIXA 3ESBA 3OHPA 4UDNA 2PEYA 4BNIA 4R71A 1DQPA 5LDDC 5F9FA 1SEPA 1Y5MA 3TNFA 2NUPB 3IVRA 2LBPA 1YCGA 2QPLA 3TYXA 1DHTA 5AVUA 4N3CA 4P5EA 3U56A 3SBXA 4J91A 1DXQA 2NT3A 5T4HA 2P41A 3NWEA 5GJBA 3KAJA 1OFHA 2XWPA 2WINI 3EPRA 4EVSA 3RCBA 5KNCH 2OECA 1NNUA 1QV7A 3IESA 1XKXA 3HJAA 2IF2A 4KVGA 1DJLA 2H06A 5HJEA 5LD2B 4X44A 2PKXA 4QBGB 1PR1A 2QJTA 2WIKA 4IP0A 4JJAA 4HFNA 1LLDA 2CEKA 5CDFA 3OFND 4UD6A 1ABBA 3FNIA 5A4FS 2ZYVX 3AVPA 2H1CA 4NBLA 1FDOA 2PL9A 4NZOA 4TWBA 3QIVA 4HDSB 1QKJA 2CVHA 3DWGA 4UAVA 2WF7A 4A2CA 3MCVA 3GMDA 2OC9A 3AUFA 3MJCA 4KPFC 1CJSA 1XZKA 4O2BA 3F9RA 2NZJA 5JASA 4L5CA 3KSAC 2PGLA 3F3YA 4IH1A 2AMFA 1R8YA 2VH2A 3ZHSA 4CFZA 1P0PA 4TUYB 2X6QA 1KF0A 2YTZA 1U2PA 5EKSA 3FYHA 3ANMA 1M1YB 5E4FA 1PR0A 3CLHA 1V3VA 4WRRA 1GGFA 4L4SA 2R6JA 4ROTA 2NAPA 2HF2A 4EY7A 2XHZA 4ZN6A 5EPOA 4HC4A 4I4TF 1E7WA 5EE5B 5FNVF 4A10A 2BZ0A 3RNLA 2OR3A 4IS3A 3SU8A 3NP9A 1OZAA 4F8EA 1WCWA 1A7JA 2B9VA 1UMDA 1XMJA 4MP3A 2QM8A 5EHGA 1L0BA 1Q15A 3MWEB 3KXIA 4YCMA 1XUOA 3A6HA 3MWYW 4N9WA 3GJQA 3T0IA 2DGDA 3VPHA 5ELXA 1PV2A 1YVRA 4BTEA 3EE6A 2BZSA 3IIKA 5ALIA 2J6BA 1ZC3A 2VUTA 5DASA 3OY7A 4DG8A 5MHTA 1XDSA 1YMUA 4D9IA 1PNRA 3EZ2A 3N2GA 3TJMA 4R9NA 4OM7A 2IDZA 5HTKA 3P0RA 4FVTA 3BWMA 4R2JA 4U6QA 5CCEA 3EF1A 4BEBA 3QK7A 4NPHA 2WG1A 4B4DA 1E7SA 1O57A 1WDMA 1G5QA 1IBKB 3OAAA 4HYEA 5B1SA 4ENQA 2QQ0A 2B7BA 1H2EA 1U9JA 2XCTB 2CXXA 2QTVA 3DR5A 2HK9A 1W4CA 3I73A 1G3RA 2UDPA 3GAAA 3DLHA 3H11A 4XWKA 4GOOD 5HYVA 3G85A 4P3XA 2ADOA 4QLAA 3CSDA 4J8PA 1YA6A 4O59O 3OU6A 1ZK2A 1OI4A 3B6EA 5GM1A 4BCBA 2JJQA 1N8NA 2D0DA 1GL7A 3NWJA 3EIEA 5TLSA 2Q49A 1IU9A 3GLIB 3K8OE 4B7CA 1FRFS 5D3MB 4Q4AB 1JHUA 4GOMD 5LU8A 4TXMA 2Q6IA 3WK7A 3OPYI 4KSCA 4G97A 4QYMA 2C2KA 5JAQA 1BYUA 3CZPA 3H8JA 4I5FA 4RPGA 1W4BA 4I1YA 4IQ4A 4WEQA 2E7ZA 1COWD 4J1TC 3ZGYA 1N6LA 1L7VC 1T0HB 3L6DA 3B3AA 2BKUA 2X1HA 3Q11A 3WL4A 4DLPA 3PSHA 1F17A 2CLCX 2IYXA 4OJYA 3T41A 5BQ3A 2XW6A 1DV2A 4OMCA 3PE6A 5KQLA 4X62B 3INNA 4PIMA 1ONBA 1OVMA 3FTCA 1Y9ZA 3UATA 2W8BB 2IY7A 3GWZA 4R83A 5DNCA 3RO7A 3RIGA 10MHA 1NW3A 5G1OA 4JSRA 3NVKI 1VYHA 1EXMA 1W5AA 5DGCA 3TIXB 4EHFA 4N6NA 5JISA 1W6UA 3M82A 2EFCB 2YNMC 1RVV1 3FRJA 1RLUA 1YZKA 1LK5A 4YTEA 2JFFA 3AJEA 1G6KA 4G09A 3H2YA 5JVDF 1GG5A 1PBNA 4BMDA 4C5BA 1NXSA 1OSNA 1YBAA 4ENSA 3TZCA 1SY7A 5K05A 2OMKA 3FOAA 1J0CA 1SUAA 4KVZA 3R0JA 2PJDA 2RK6A 3U4AA 1TGYA 1IB6A 3DTYA 2DC1A 4NJEA 2X3YA 4ON9A 4RULA 4DBZA 2EATA 4ZVOA 3Q5GA 2VJMB 2ZI3A 4O63O 4X24A 5DWQA 4YJGB 3D4BA 3ZHUA 1OB5A 1E2MA 1TM4E 2X42A 2FPLA 2ZJ6A 1NXPA 4YUAA 5EQFA 4RTPA 2YMQA 5HS4A 1SH7A 1YC2A 2MINA 2CK3A 2Y4OA 3PIIA 4AO8A 3OCCA 3BAZA 4G1EB 1ZUNA 3CZ4A 3ZI0A 4BO6A 2V8BA 3FPGA 4C5AA 3HADA 1K6XA 2DQKA 4U2CA 4HAZA 4Q34A 4FD2A 4KN6A 4E11A 3O95A 3JRNA 3QQ5A 1Q17A 5G1PA 2D54A 5DBEX 3U13A 1ZH4A 1L5RA 4EZEA 2DB3A 2HYDA 1KP9A 3CCFA 4XD2A 3WG9A 4DA0A 2WFZA 3LLMA 1RADA 3Q3HA 3KXPA 1KZ6A 3OCJA 4E2FA 2ZVPX 4IRUB 1ECJA 4RF4A 4XQCA 4YRDA 3JS5A 4EM6A 5K45A 3RYHB 2ORIA 2QVXX 4WTOA 4DDWA 1NNEA 1Z8FA 1WS6A 3C15C 4TZTA 3FD8A 5CFZA 2WYOA 1ZD4A 2XNDA 2FJPA 4KXWA 1VSTA 4O0MA 4XUCA 4XAQA 1Z38A 1IXZA 1V5IA 4O8ZA 5JO9A 3O8QB 1LLCA 2O8DB 1AKNA 1Z4OA 2EX4A 3PD7A 5BN5B 4OATA 1SBIA 4BVJA 3ADKA 2GWHA 2EOAA 2L42A 2QX4A 2VL7A 3ODGA 5JMOA 4UDYX 4JI2B 1E2DA 1Z08A 2J30A 4LHVA 2FLKA 3FW1A 4HFMA 9MHTA 5A9TA 3KP1A 3LP6A 2FFQA 1Z56C 5BPFA 1WG8A 3LX5A 3UW3A 5EEGA 4DDTA 2VSNA 1JQDA 2VF2A 4KR3A 2WYUA 4EY4A 1P3JA 3H2IA 2QW0X 3GT3A 1ZHFA 1U98A 2OV4A 1Y6FA 3DVLA 3F49S 3OECA 4OJNA 1Z18A 1QWSA 2JAUA 3D6NB 1VB3A 4PZEA 1CUIA 4TSFD 3ZY4A 4RUKA 5BVGA 3GPLA 4NZMA 2VDLB 4FYVA 1WXIA 4WY8A 3T4PA 1N6KA 2VHYA 3T7RA 2ZP1A 1LDYA 1SPBS 1VHDA 1ZQ1A 2LPMA 3DMTA 1SCBA 3OJCA 2QNRA 3EJWA 3P9IA 2KHZA 5CIYA 1L4GA 2QD2A 4Z4QA 2ZBUA 1S2OA 1O3YA 2MJLA 4N3NA 1GPH1 2H8KA 3OY2A 4LMRA 1T0BA 3R5SA 4ID3A 3ESRA 3KYBA 1SKYE 1RXWA 3B6JA 1MAVA 4L7VA 3K6KA 3N75A 1E1DA 4MUBA 4DV3B 2GZ2A 3H3JA 7MHTA 3I64A 1FDTA 4KPUB 5KTNA 2YOHA 4ND1A 1V16B 4NMHA 5AM3A 1E1RD 1TCCA 4G0XA 5EJ6A 2NUBA 1V39A 3BXXA 4H9GA 2OYRA 2BFOA 2PH1A 2BKLA 3C24A 5CK5A 4H4CA 4LV6A 1J2RA 2BV3A 2QR3A 4HGQA 3BWXA 1ESNA 3IVGA 4DDVA 5KTPA 3IKLA 5AHKA 4D0LB 2DAPA 1XTTA 1XTBA 3PNKA 3FNEA 3BH0A 5FEUA 3CEAA 2ZJOA 3FKQA 3OLYA 4NCBA 4IY1A 5KINB 3F96A 1JI0A 1Z68A 4RD1A 2QQ5A 4KU4A 5FF9A 2WJJA 1QZUA 1KI7A 1FP6A 2PXAA 3IAS6 2CHUA 2L0XA 1X7YA 4N5NA 1GUAA 1WAMA 4ZOQI 3OFNA 4R8RA 2QTNA 3KOUA 4GWLA 4LJ9A 4M7WA 5LMNB 3LUBA 4HAVA 3K8QA 5I6DA 4LG1A 3E3AA 3O03A 4HLNA 4HDAA 3IBSA 1GWNA 2ZOSA 3P52A 4G8BA 2VYQA 4K8RB 1QIGA 3SOPA 4O4IF 2VPZA 1JJ7A 3RI3A 1H1TA 3TOZA 2I4LA 4B46A 5C1OA 1V0JA 4BFWA 3C43A 1PS0A 1ECBA 1MVLA 1OYWA 1ZM3A 2HLHA 2IYZA 1T29A 2NU9A 4YCBA 1I5EA 1MH1A 3PK0A 1TD1A 2X6TA 5BWBA 1T3TA 1KZ4A 4KQWA 4DR5B 1GKUB 4BX0A 2F1IA 4TVOA 4DBVO 4BVEA 2P4QA 1SN7A 3Q3EA 1JEYA 4E5DA 1U2DA 2QJWA 4W9MC 1SK9A 2H2WA 8ABPA 4DR7B 3NV9A 1QGED 3D8BA 2DHCA 3HUEA 3P4YA 3S99A 4BLPA 4JLBA 1HEUA 1WXGA 4IMRA 4C4XA 3L0BA 3DJYA 1Z4MA 3DT8A 3LXUX 1S1CA 2F2TA 3HL4A 4G4IA 4BEVA 3VHQA 4PINA 4QECA 5BRJA 1JLLB 1OW3B 2IZOA 3AOEC 3ANNA 3GOHA 2R6AA 4NZ9A 1NLMA 1O96A 2X1LA 5I4KA 3DXXA 1TEVA 1X0XA 2HRCA 3CS3A 3LZ6A 2NAFA 2GZDA 3LBYA 3UKJA 4P6VF 1NSYA 1JG3A 5I9SA 1JKIA 2OQVA 2ZT7A 5LLSA 4POOA 5IN4A 1GQFA 1NW4A 4ND6A 5FOUA 3PFBA 4QT0A 4OQXA 4U3JA 4K9DA 4HRYA 3UMJA 4HTAA 1Y3FE 1D3AA 4O4LA 4WCFC 4UXHA 1P0CA 4PNHA 1G60A 1W4ZA 1A9YA 4PLTA 4ZQFA 4PC2A 3DVQX 4HRVA 5HOQA 4TYPA 5G4KB 2QTCA 1EAMA 3QMPA 5D51S 4HQOA 2P2CA 3PPXA 5DP2A 4KXUA 2H08A 3M9XA 4Q18A 5ARCA 2P4HX 3ZE0B 1I1OA 4KTTE 4D0RA 1EHIA 4NWIA 4JI7B 3EGXB 1IZ9A 3RQSA 1JAHA 4L4XA 4EENA 1LWNA 3NBAA 6REQA 1ZYUA 4BQOA 1GO2A 2I4TA 5TVKA 1QO9A 3QHAA 1SVIA 3NBFA 4YXWD 4E21A 2A86A 4AJPA 3DOUA 3GH3A 3KAKA 1UMDB 2NU7A 3QE4A 4AG6A 3U6KA 2V65A 4W1QA 1L1EA 3JWHA 4CTKA 3W3AD 5ESWA 3OC0A 1BOFA 2R62A 2YY5A 2PFSA 4M1WA 3S1SA 2QHXA 3IV6A 2YHIA 3N2YA 3AP3A 2DHDA 4ZT5A 3TSYA 3HXLA 3W5AA 1ZN7A 3VM6A 2YKGA 4IG4A 2YASA 3A1FA 1COWA 4G89A 1DRUA 3CIFA 4QXMA 1T6BY 4R31A 1Z2CA 5LQNA 3G9UA 1RBQA 4CKXA 4BZQA 2VLIA 3QBEA 3A6DA 4F91B 1E96A 2AUTA 2DUWA 1GU7A 3UK0A 4MARA 1NVBA 3NM6B 2YL2A 4XASA 2WKRA 1GTMA 2PMFA 1LV7A 3KPUA 3AY3A 3IALA 3M6VA 4FU0A 4MDYA 1GSOA 4QTXA 2QTVB 3MS7A 2EDAA 4BIMA 3EQ6A 4B45A 3DO6A 3FTPA 3H11B 1RKXA 2I29A 4B73A 2N75A 1GXSA 1YJBA 2R11A 1Q84A 4X60A 2UUBB 3GZ4A 3FR8A 3NBKA 2Y4NA 3AERB 3I2IA 3LPLA 1BE0A 3V00A 3WWEA 4ENWA 1OZGA 3WL3A 3B1FA 5C0OE 5JEEA 3HYCA 1ACLA 3DDZX 5DP1A 1FJ2A 4ALMA 2FR8C 4L9WA 5AICA 3ZJ4A 1DE0A 2I54A 3KTFA 1RJ9B 4NZNA 4XE5A 3TZBA 3ACBA 4JH0A 1PL6A 4FUQA 2J3EA 4CDMA 1TZ2A 4N6GA 2Q28A 2J09A 3KOZA 4GS5A 4AP6A 3KHUA 1JR3E 2WJAA 3TLGA 1DZ3A 1V6AA 3REQA 1CRQA 2LD4A 4RHUA 4D9EA 3J80A 2JGAA 3OUZA 1MV8A 1OWPA 1SQFA 5TF4A 2R1TA 1JKFA 3FA2A 1B6RA 1T5TA 5G0TA 3FPAA 3MWDA 4NYIQ 3RAPR 2GAFA 1K5DA 4LZZA 2LV8A 1G291 1VIAA 2Q8QA 3TW8A 4GVLA 4IIJF 1ZM4A 3GQBA 4Y9TA 3V2IA 3P9SA 3ZGLA 6CHYA 9ATCA 3J81k 2GEUA 2ZQYA 1Y9EA 3DV0A 3LUKA 3ZK7A 3AG5A 1AQLA 3J7AC 1EVLA 1YULA 2EFJA 2VK4A 2FGJA 3ANLA 3PZBA 3NBZC 3D8UA 3PHHA 1GY8A 2JHFA 4CTMA 3U16A 2ZXEA 4KWTA 1QR6A 1N92A 2OUKA 3AJAA 4LQDA 3M9LA 3N3AC 1UMCA 2QN8A 2WWTA 3O73A 4DUZB 3T9AA 3OX4A 4NJEB 1BVHA 3GDWA 4OXIA 2G5TA 1O97C 2FPXA 1DXYA 1X86B 4I1OA 1Z6XA 1KTVA 3CONA 3QVKA 2XD9A 3EXHB 4G0PA 1FXSA 1WHTA 2DULA 3FGPA 4R1QA 2OXIA 4F3YA 4V24A 2GYWA 1KWKA 2PMBA 1SIWA 4WX2B 3DO8A 4RV5A 5B7GA 1I14A 2EEPA 4CL3A 4LQCA 5T4FA 1NNLA 4TLBA 2IU0A 1XL1A 1NMYA 5ILQA 2X76A 1BEEA 1JLMA 2O2IA 3B6KA 2NACA 3K5PA 3N8DA 5CFPA 1E77A 4XPZA 1VRCA 2VNHA 4JU8A 4TSFA 1QZ3A 1SJ9A 2FSHA 4OAPA 4HAUA 1IN4A 3WKDA 5IUJC 2ACEA 3QKIA 4RENA 4RA6A 2FFBA 4BKQA 5C5DA 2FDXA 4JSYA 1QV6A 2PX8A 5K6AA 1FMCA 1YHNA 4JA2A 3CCBA 2OD9A 1SQ5A 3WRXC 1V4VA 4OQLA 2IYAA 3KOMA 3VR4D 5L6MB 3LC0A 1RWKA 2ARKA 3HN7A 4W1SA 2PVPA 4R2WA 1XP8A 3CNBA 1IM8A 4QUGA 1FU8A 1QOPB 3EVFA 3FCAA 1CUVA 1YQQA 1ZSYA 1GGMA 4Q3NA 4QYXA 5G0WA 2QY9A 3F3SA 4YNBA 3IPLA 5EJ8A 1J25A 1EGHA 3WTCA 1J2JA 3DMYA 4O1HA 1XTSA 1HL3A 4EY6A 3OLZA 3G2LA 1Q74A 1SC4A 4MZDA 4A0RA 2ZI6A 2PR2A 1VECA 3IOMA 2FQWA 1GLNA 1LS1A 2O7NA 2PQMA 2NVUA 2VP5A 4MVJA 4UBOA 3UK7A 4EYKA 1Q95A 3UG7A 4LF6B 5DSZA 1KOFA 2EV9A 1R0CA 1E9BA 2G06A 3KT6A 4UAGA 4F11A 5K09A 1MX1A 3DBOB 3G89A 1NRIA 1NI4A 2J9FA 3DZIA 1C9MA 5EZ6B 2EYQA 4BAZA 4PSVA 1H2HA 5EUQB 2UZAA 2X8WA 3JPYA 3C6QA 1FP4B 2W9XA 4EG4A 2RAFA 1HH4A 2P9FA 1L4MA 1F9EA 1XTVA 3QA9A 1ZW1A 1CRZA 2OO7A 4WZ6A 3UJ6A 2GJAA 2ONZA 3MEQA 3W2TA 4BU0A 1I7LA 4N0PA 4BWGA 2P3LA 3P26A 3EDQA 4HDCA 5EMJA 2D8AA 4IQ8A 4FBGA 2GKGA 4UEKA 4R84A 3R6GA 3ADDA 3FLEA 2QRVA 3LVBA 1OXBB 2XRYA 3PNOA 4F5DA 4KN8A 5H4HA 2OUIA 4UXJA 1U3VA 2Z83A 1MEJA 2LCFA 2QIOA 3OPXA 5TSDA 4HD8A 2YHSA 4R3NA 1Z3IX 1GTSA 3T7JA 3GRFA 5FJJA 4S12A 1POWA 4EGJA 3PKZA 3OE1A 2QXTA 3ADCA 2ES4A 2ZE8A 3P94A 1VRVA 4AS2A 1DCKA 4CMIB 1EFHA 2EGHA 2GN1A 5HQ3A 2PVCA 3I58A 3WL6A 2Q4OA 4YJ2A 2O7QA 2VYFA 3IA7A 5CLHA 2V0GA 3PFIA 2OYSA 2A4MA 4KBFA 5H82A 4GPZA 1ZRNA 2A88A 5I4CA 1SUWA 2Z0MA 1AF4A 3IQZA 1QBKC 2Z95A 3ILVA 3KEFA 1EFLA 3MB5A 1G20E 3PCRB 5ALJA 5ERXA 2JGIA 4EKYA 1EH5A 2XNJA 4BNXA 4DIUA 3DC7A 2WVAA 3NOQA 4YUZA 4JI0B 2XUHA 4ER0A 2C59A 4YS6A 1M72A 1X7YB 1TIPA 2PGOA 1SG6A 2W93A 4G0YA 4DLBA 2GZAA 4HRAA 3ABZA 1KH2A 2WIFA 2YQ5A 3EARA 1YHZA 2ZB3A 1DX9A 5J3JA 1NF2A 2BKXA 2EWMA 4GMGA 3Q7RA 2IVZA 3CLSD 5CHYA 5TQ2A 3P20A 3SYTA 3X43A 3PHGA 1K8ZB 4BLWA 4DXDA 2H6EA 3AQ4A 3VR5D 1RWPA 2VPQA 3DZJA 3HYLA 5AMXA 4QFDA 4D9HA 1QUFA 2IPXA 5THXA 3VAAA 4A6EA 3ZBQA 2HJHA 4CHTA 3DZGA 4CL0A 2NU9B 2D3TA 4R7GA 4WMLA 4M37A 1XLUA 2FN7A 3TSOA 4JA0A 4YMIA 1A76A 1USUA 2AQIA 2HPAA 2FWIA 3HE3A 3M2PA 5E4YA 3CO0S 3HFSA 2DT8A 1C81A 4LBYA 1G7CA 1Z7GA 2XYHA 2PBLA 3QWAA 2J6CA 4ZAFA 1JEYB 2AX4A 1NOJA 2E85A 2XMPA 2PXXA 3IHKA 3EVTA 3CA8A 4QXAA 3U7IA 3JYLA 3BIXA 3H6GA 1CW2B 1U3GA 1YS6A 2QYHA 1BHO1 4KGXA 1TMKA 4WA7A 1CUGA 3WYGA 4Q19A 4DYHA 3H75A 2XNSA 3FWKA 4JSTA 5IT9A 4PQFA 4KOEC 4UC0A 4QDZA 4H1WA 5AJTA 2ZYAA 3HSYA 5FAXA 3B3GA 4PPFA 1NKVA 3MAJA 1V7QA 2FFAA 5HGXA 5JCOA 1SQSA 2C0CA 5ESDA 3TTXA 5K0SA 1ZSVA