1KRWA

Solution structure and backbone dynamics of beryllofluoride-activated ntrc receiver domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
124
structure length
124
Chain Sequence
MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAISHYQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-Resolution Solution Structure of the Beryllofluoride-Activated NtrC Receiver Domain
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Signaling protein
molecule keywords NITROGEN REGULATION PROTEIN NR(I)
total genus 34
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2002-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1krwA00
4N0QA 3O2QB 4W5RA 4Z4CA 3SAJA 3TMYA 1E6LA 5TE9A 4LE2A 4PICA 3RVOA 1P8AA 2QV0A 5D2CA 4PZ0A 2E4XA 1DP4A 1QMPA 1Z26A 2HPHA 4G0QA 1L5ZA 3EDCA 2MYTA 4L85A 4RKRA 5BRJA 1Z13A 2W42A 3F6PA 2JVJA 2A9PA 3QELA 1AB6A 1U2QA 1PNTA 4KQ9A 4JA2A 3DLBA 1ZDMA 3QLUA 1YK0A 4UHJA 5EWMA 3RQIA 5DTEA 1DCMA 1MVOA 3HSYA 2FTKE 4H3HB 3QLVC 5F64A 1SXGA 4P98A 4EYGA 3LUKA 4NCBA 4EUKA 2FQWA 4MYRA 1ZHHA 1FFGA 5JNRA 1USGA 3OLWA 3OQNA 1DG9A 4KV7A 4MR9B 5KC8A 1ZH4A 4ETMA 3JY6A 2F8SA 1JFVA 4JP1A 4RU1A 2FMIA 1MIHA 3OO1A 4O5AA 3LUDA 3OO0A 3QEKA 3MA0A 3W9SA 4EYOA 2MYUA 3BRQA 5B3JA 3BRSA 2LBPA 4YGXB 4TN5A 5EWMB 3C97A 2JBAA 1PEYA 3LUAA 3GBVA 1P6UA 2CD7A 4WXMA 4RY9A 3EJWA 2MSLA 1QP7A 1QO0D 1ZN2A 2M1ZA 1KGSA 4MGEA 3O2SB 2BGGA 3QX9A 4EYQA 1NXPA 3I45A 4JASB 1BAPA 4JAVC 1LBIA 1DCKA 2NZVG 2A9QA 1JX6A 4MR9A 5E3JA 8ABPA 1DRKA 1KRXA 3KS9A 4HYEA 2CHEA 3IPAA 3HV2A 4G86A 1RNLA 5I4CA 3Q7RA 3H6GA 3LUFA 4KFCA 1EWTA 2Q5CA 3HZHA 3UK0A 3VNBA 5JS2A 2QXYA 5KQLA 3LKVA 3CG0A 3TO5A 2VK2A 1PNRA 3GBPA 4G0MA 4EVSA 4YRZA 5GOTA 3B2NA 1NY5A 2RJOA 5JNTA 1D2AA 1DBQA 5DGCA 4KNYA 4YWHA 3GA5A 4G0ZA 2JVKA 4Q6BA 3UKJA 1JYFA 4W5OA 2GBPA 4WUTA 3QLVA 2PUCA 3M9XA 3IPCA 3CTPA 4XAQA 4ZMRA 5HM6A 3BBLA 3CNBA 2ID7A 3IP9A 3A0RB 4F8JA 6ABPA 3EQZA 2NT4A 2M98A 1TJYA 5TPWB 4MLCA 4RXMA 3KSMA 4MR7B 3RVSA 4NQRA 4MR8A 2F8TA 4DQDA 3EODA 4RXUA 3C6QA 3T8YA 4MQEB 4F3TA 1P2FA 4IILA 4S04A 3CFYA 3T95A 3DBIA 1Z2DA 4WXEA 4DADA 1KRWA 1JHZA 1C4WA 1I3CA 3G85A 4IF4A 3GWGA 3LUGA 1XHFA 4RK0A 1ZY2A 4XASA 4XLTA 5FWYB 3FFWA 2CHFA 3GV0A 2ZWMA 3P9YA 5CHYA 1QP4A 5HKOA 3O1HB 2VUIB 2PUEA 2AYZA 1BA2A 2JB9A 4UHKA 3RVLA 1USIA 1PEAA 1KMIY 3GL9A 1LJLA 5HSGA 3IP6A 1ISRA 5DKFA 5FBKA 1D4ZA 5T7BA 1NXSA 1QP0A 3JTEA 3O1IC 4KZKA 2FXIA 2J48A 1DJMA 3KHTA 4Z4IA 2HSGA 1NXWA 1LBHA 4O1IA 2JVIA 1IIBA 3H6HA 1UDRA 3DLHA 2MYPA 3H5TA 3NNDA 3D8UA 2IPLA 2MSWA 4E7PA 3OQOA 3OLZA 1QQAA 4IGAA 3BREA 3N0RA 4Q7EA 3H1GA 4YS6A 4QPJC 1E2BA 2QSJA 3EGCA 1ZESA 4G97A 4MR7A 4ZPJA 2YHAA 4KVFA 2P9HA 2B1JA 3JS5A 4MR8B 1BDIA 2IKSA 1RXEA 5TQ2B 4W5QA 3KTOA 5KQMA 4ETIA 1ABEA 1P6QA 4RSMA 3GYBA 2L19A 1K68A 5TPZD 3CLKA 3KCNA 4Z4EA 1Z12A 2YHBA 4HNRA 3HEBA 2R25B 1DC7A 4TMYA 3Q7SA 3HUUA 2FMKA 4N47A 2WJWA 4RWEA 3SG0A 1TLFA 4OLBA 5FWXA 4HNSA 3ILHA 3RVMA 3HDGA 3RVNA 3I09A 1NXTA 5CNJA 1DZ3A 3F6CA 3HK2A 4G0YA 1QKKA 1XWWA 2RGYA 1H9CA 1NATA 3A10A 1E6MA 2JCGA 1CHNA 1JFSA 1Y1LA 3QELB 2O20A 1M5TA 1JFTA 1QPZA 3KLOA 4NCAA 4ETNA 3LUJA 2HJ9A 1CYEA 1MAVA 3OLXA 3DGFC 1JF8A 1R8JA 1ZGGA 3O75A 2JRLA 3EULA 1A0OA 1JH9A 5KI6A 4QICA 5KQPA 3O21A 4KK3A 4L4UA 3JPYA 3MYYA 2IDMA 2L2QA 5IEBA 1XHEA 3N75A 3CU5A 3ROTA 4OBBA 4EVRA 2L17A 3NNNA 3LKBA 3SY8A 1ZVVA 3KYJB 3L6UA 4YP9A 3LOPA 3HVRA 3LMKA 4LX8A 1U2PA 3OLYA 3H1FA 4GNRA 4Z4HA 1VPWA 1YMUA 4MS1A 2TMYA 4KK4A 3H1EA 2NT3A 1J56A 1SD5A 3IP7A 1K66A 3CG4A 4TLMB 2FMFA 2WRZA 1DC8A 3KG2A 3H5IA 4OG2A 1CEYA 1GCAA 5CNMA 4N0PA 5CNIA 5TQ0B 3LUCA 5C5CA 3GT7A 2JBAB 4P1ZA 4PE5B 1NXOA 4EYKA 3HXMA 1YK1A 5ABPA 4QYMA 2FLKA 1MB0A 5BRAA 3TB6A 1M2EA 3E61A 5IUJC 2FW0A 4LZLA 2MSKA 3HCWA 4WT7A 4D74A 4MS4B 5TQ2A 1RXIA 2PUDA 3O2JA 4RDCA 5JS1A 4PEVA 3QLTA 3L49A 2RDMA 2WWVD 5T3YA 1E6KA 3S99A 3G1WA 3DZDA 1VLZA 3MMNA 3VNAA 2E4UA 2PJUA 4YO7A 2XDYA 5IUNC 2A9OA 4LE1A 4Z4FA 3JVDA 4GPAA 4H3KB 2VYCA 4EY3A 9ABPA 4YCSA 2V0NA 2FN9A 2PAFA 4FE7A 3Q15C 3MQ4A 1HEYA 1TM2A 1ZH2A 1FFWA 4MS3A 4D6YA 1JYEA 4B09A 1OXKB 2PMCA 2QR3A 1Z15A 1W9HA 3A3KA 3HUTA 3QEMA 4HNQA 5KWSA 5IUKC 3NNSA 2WY2D 2AYXA 3SQNA 4F12A 4N76A 4RK1A 2E4VA 3N6VA 5FWYA 4N41A 3LFTA 2OENG 3JPWA 3K4HA 2FQYA 3Q7TA 2E4WA 4KPYA 2LIVA 4W5NA 2MYNA 2FEWB 3E3MA 4MQEA 2LUOA 3H5WA 4RY0A 1JWLA 3MIZA 3LTEA 1Z18A 1YVUA 2I6FA 2L18A 3H5VA 5EWLB 5PNTA 3I42A 5BQ3A 6CHYA 1QO0A 3OM0A 3CRNA 4MS4A 4G0PA 2IPNA 2GKGA 1GCGA 3F7NA 3IDOA 2WB4A 3KJXA 1C0EA 1FFSA 2PL9A 3C3MA 2OQRA 4MRMB 2FEKA 2ZAYA 1RPJA 3FFTA 5IEJA 1RZRD 3R0JA 4IRXA 1BDHA 2QZJA 4M88A 1ISSA 2QU7A 2QVGA 4EGSA 3ILYA 1AB5A 1BDJA 4RY8A 1A2OA 3SNKA 1F51E 2PUAA 1NTRA 2DRIA 3QX8A 2FN8A 4F11A 3NHZA 4OATA 2QW1A 5TQ0A 3A0UA 3SM9A 2IOYA 5EWLA 2FLWA 3I5AA 2E4ZA 1FQWA 4MQFA 4RK6A 4RXTA 3N0WA 5HQJA 2PE5A 4NICA 1U8TA 4Z4GA 3HDVA 1JL3A 4NV3A 5ED4A 3ROFA 1Z17A 5IBQA 2PL1A 5EWJA 4EVQA 3N0XA 3KLNA 3RVJA 5JNWA 1B00A 2HQRA 1EWKA 3QEMB 2R47A 3LUHA 1D1QA 3QK7A 4MLDA 4YR7A 5IX8A 2JK1A 2E4YA 1BVHA 4Q6WA 4Z0NA 1Z2EA 4RS3A 2R48A 4KMRA 5BR1A 4Z99A 2H3HA 1D1PA 3EQ2A 4D6XA 1YS7A 4KRFA 2GX6A 1U04A 3HO1A 1TMYA 2FQXA 3OM1A 2A9RA 2FKAA 5JNUA 1SRRA 1DBPA 3RVQA 3EAFA 3D02A 4LRQA 4MQFB 3N53A 4QYWA 4TLLB 4JB0A 2NUBA 1NXVA 1GLGA 2KYRA 1W25A 1YIOA 2GI4A 3H75A 3NBMA 1GUDA 2QVCA 4FE4A 1M5UA 1QQBA 3CS3A 3CHYA 1APBA 1JDNA 2VUHB 2FSPA 1ABFA 2B4AA 5TPWA 3HM9A 1ZAYA 4DN6A 2LPMA 4CBVA 5JNSA 3Q41A 2IPMA 3C3WA 2N9UA 1EHCA 1Z25A 2FMHA 3CZCA 3RVKA 1JDPA 1GUBA 4MRMA 3UUGA 3RVRA 4S05A 4LDZA 4Z9AA 2RJNA 3M6MD 1T34A 3OMWA 4ZJPA 4KQCA 4OLAA 1DCFA 1USKA 5TPZA 2IPAB 3HJFA 3CKMA 1A04A 4MS1B 5IULC 3OMXA 4ZYLA 1DRJA 1EAYA 1SXIA 1ZITA 2ID9A 4FB4A 2PUFA 4MAAA 1QNLA 2HQOA 3NHMA 5DLEA 3TD9A 4RK7A 3K9CA 1F4VA 5C5EA 1SXHA 4O1HA 1LK0A 1VRVA 1ZGZA 3T38A 1M2FA 3GRCA 3FFXA 5B3JC 1PHRA 4JB2A 3URMA 4MS3B 4JOQA 4G0XA 3MF4A 3QLUC 4RV5A 3FDFA 5IC5A 4KREA 3OLVA 5EWJB 1VKRA 4MPTA 4WWHA 3F73A 3T6KA 4ZMSA 3HS3A 1PUXA 4Y9TA 3DGEC 3H5LA 4LDAA 4E7OA 4YV7A 3OQMA 2LP4Y 3FGZA 3M9WA 4LE0A 1NXXA 1U0SY 3MM4A 5JNVA 1FSPA 4F06A 3H5OA 2WJAA 5DCLA 1EWVA 3BILA 4XXHA 3RVPA 2PUGA 1YTUA 2CWDA 1MB3A 2FVYA 1S8NA 2PKXA 2H0AA 3N8IA 2GWRA 4RZSA 5FBHA 4WZZA 2FEPA 2PLNA 3CZ5A 4RK5A 1EFAA 3C3KA 1DBWA 1YMVA 3KYIB 3JVIA 5CNKA 4XFKA 4W5TA 1D5WA 2R4QA 3Q9SA 3FMVA 4RK4A 4G0OA 2HQBA 3KKEA 4IMJB 1L5YA 4H60A 4N03A 4YLEA 1JLKA 4RKQA 2P4UA 2NZUG 1OXBB 3O1JC 5KQGA 2PUBA 2IYNA 4OTZA 4ML3A 3IP5A 4Z9BA 1YS6A 2WMYA 4XARA 5FWXB 5KC9A 5GQSA 3RH0A 1Z16A 1LJUA 7ABPA 1TVMA 1WETA 1JBEA 4IMIB 5TQJA 3O74A 1URPA 3TX6A 1RZRA 2X7XA 4PYRA
chains in the Genus database with same CATH superfamily
5D5HA 3T15A 5JD6A 1P7CA 5FYQA 2FE1A 4PICA 2JDIA 2PD4A 4PWZA 1E6WA 3D8SA 4YRIA 3AM1A 4WI1A 2RHOA 4KWIA 1EVKA 3B3FA 2GN9A 1US8B 3F6PA 3G0DA 4FHZA 4RHFA 3WZ2A 3DXZA 3D3QA 5KDLA 4RTSA 4P33A 4YIKA 4KQ9A 3B1ZA 1ZDMA 3M81A 4KWEA 5DI3B 3T7AA 2GD1O 3OQVA 3U09A 2O8DB 1G6HA 4TTTS 3W8FA 3ROEA 3GLIE 2R8OA 4R9VA 2P9YA 2F59A 1W5TA 4P98A 4JT4A 4BIIA 2EJUA 2GCGA 1QU2A 4H6XA 4YNBA 1XMSA 4EJSC 1SQFA 4M0EA 5LL6P 2OKGA 2WWRA 1W30A 1DJPA 2YDYA 3HWRA 3JY6A 4N3BA 4XE5A 3CLRC 16PKA 4JP1A 3I9JA 4IDGA 4IG4A 1M1NA 3U48A 3VTAA 1XELA 1BGVA 1XZQA 1N57A 1ZI6A 1YB7A 3EEYA 2TMKA 5ELMA 4EYOA 1BVUA 1Q17A 5KTPA 1OD6A 3BRSA 2H4HA 2YZ7A 2EYQA 2AWNA 3HC7A 2AOXA 3QKWA 5DI3A 4ZMBA 5AVXA 2VYVD 3CT6A 1N0VC 1ZQ9A 2B5WA 2QB5A 2JLSA 3ZK7A 2PLAA 3KZXA 4FUQA 4MGEA 1YGYA 1AS2A 1J9ZA 2V8BA 3E22B 3GG9A 3B53X 1PZFA 2Z2KA 4JASB 1ABBA 3K0FB 1U80A 3VO8A 1JIJA 1YI1A 2A9QA 3EG9A 5E3JA 2AWOA 1WW3A 3VYRB 1VL6A 2VRBA 2FPIA 2CHEA 2JGNA 1C9EA 2C9ZA 4KO4S 4LJAA 2VNHA 1RNLA 5JQGA 3H9UA 3C16C 3DQPA 1WUIS 2VBCA 4O8ZA 4L7QA 3Q5EA 1Z0SA 2TMGA 3AHHA 1WD7A 1U9IA 4IUCS 4B46A 4E15A 3RRZA 2O23A 1IJFA 4FWIB 4WOKA 4G0MA 4EK9A 5BSWA 2OCKA 4MLZA 4ZA2A 3T3OA 1ZBQA 4R68A 2I65A 3ZW9A 3KJQA 5TDHA 2JFVA 1JU3A 5KSZA 4CGZA 1GUFA 4G0ZA 3AHGA 4Q6BA 3N7UA 5JXWA 1JIUA 3M9XA 1X1EA 3PENA 1DWUA 3Q10A 4ZMRA 2JAUA 3MS4A 4Y8VA 4JSYA 5BPFA 2P65A 5CVCA 2PN1A 1CY0A 1CEEA 1D6MA 3IP9A 1DGQA 5AJUA 3M49A 5KB3A 5T4BA 3T52A 2VZ9A 4BJ6A 1A8SA 1ZM3A 4BO7A 1M6YA 3IL2A 2VDNB 1OB5A 5AVRA 1R0ZA 3HE3A 4PC6A 5AJYA 4HSEA 4RXUA 4DZZA 1CZOA 2PU7A 4G1BA 4MQEB 3TXAA 1CY4A 1N92A 2Y9MB 4D0SA 2IH2A 4LMRA 1TZCA 4CM6A 5GINE 3DBIA 5JSZA 5DTJA 3TJZA 3EZNA 1AT1A 1J49A 1RBMA 5AJTA 2CBXA 3AY7A 3VZCA 3L41A 4J90A 1DC5A 1GQSA 2GZ1A 1USWA 3F3MA 2CHFA 1A7UA 3R7BA 3K1ZA 4RNCA 2G1AA 1W46A 1ZKMA 4OLHA 4GMGA 5JPCA 2UUAB 2O8FA 4PLCA 3KUDA 4UC0A 1O96A 2BTQA 4DJDC 5B4TA 2XNSA 1RRCA 2GD0A 2P6MA 4GYKA 3GLHE 5ARBA 5KYVA 1NMYA 4AT1A 5K0EA 1H3FA 3JQGA 4K1XA 4K05A 5JE8A 2A84A 1UDRA 4KNWA 1H65A 4QPNA 5DYTA 1N2ZA 5JLAA 4TS3A 4YI5A 5D7NA 3M4JA 2BFCA 1A1SA 4WLVA 4YDRA 3TI9A 4U2BA 4FW8A 4B48A 1JQAA 2F4NA 1S4QA 3V1UA 1AKUA 3BREA 1JEEA 1YRWA 3T1NA 1CUYA 2NTJA 2EL9A 2C2OA 3FPFA 3L8HA 4ZT3A 4JLKA 3PJEA 3DE5X 4KIGA 2AFRA 2B0JA 4XD2A 3RSZA 4ZPJA 1NUPA 4IJKA 1SULA 2OR3A 1RQ7A 3ZYCA 2IKSA 4LDJA 4LOAA 4MYHA 1RXEA 4F4HA 4PSKA 2C5LA 3KTOA 3A4LA 4YASA 1UP4A 2XV1A 5EKUA 5C81A 5KWEA 4MQLA 5B2FA 2VP0A 2NMVA 2G9ZA 3TD6A 3WZMA 4US0R 3SEQA 1YU9A 4JL8A 4ZZ0A 3ICQB 2B35A 4LS3A 3VZPA 4DMRA 1H93A 2NAPA 1NXQA 4CQJA 1C8VB 4P3YA 3A1EA 4MV6A 3IAM1 2FW7A 4YAUA 3F5FA 4PR0A 2EDCA 3IVXA 2BI7A 2P11A 4K0KB 3Q12A 4YRPA 3V1KA 3OJLA 2XR1A 3C3EA 2VP6A 3MB5A 1MVNA 1SJ9A 4PC1A 5FWXA 3U4DA 2NU9B 1KEWA 4LWZA 4B9AA 5ARDA 1UR5A 3TQHA 4OXRA 4P93A 2D2EA 3KT8A 5CLLA 1FBNA 1NMSA 2JI4A 2RI1A 1NVVQ 3AHDA 4QBKA 5CNJA 5EEHA 2E1PA 2VJNA 2HHHB 1WF3A 1W34A 3UTDA 3SEFA 3WOHA 1N6IA 1NOIA 2WF5A 3UBTA 2DR2A 3DOUA 4RLHA 4MGIR 3L2OB 5KWVA 1FJGB 3OP1A 2R751 4CPDA 3LPAA 4HUQB 1HKHA 1JVSA 4RH3A 5JJIA 4J0HA 5FH9A 1EFVB 2C77A 4BC0A 3AESA 4MVJP 1R8JA 3ASZA 2CNBA 4HEA1 4J91A 4XUEA 1A0OA 1EP2B 3G5TA 2JFZA 2ACWA 4RJKA 2HLHA 5G4LA 4GMXA 4I50F 1TCVA 4B1FA 3HKEA 1YJXA 5LWHA 2GPBA 4X1YA 3AUYA 5F1KA 3W06A 1TAUA 3PK0A 3ZYZA 1S4MA 1VHTA 3QENA 5H83A 2EYUA 4C0QC 3WNQA 2VXOA 1C1XB 4IYRA 1J1ZA 1YL7A 4Z4HA 5FTWA 4FIDA 1FX1A 3M1YA 5CXQA 1MX5A 3W3AD 2V6JA 4CIYA 2CV2A 1E2NA 3E7WA 1XU9A 2WRZA 5EJFA 2IW1A 3LU1A 5BV7A 2Y71A 3PP8A 4UTRA 3FCEA 1XLWA 1GCAA 5ADUS 2BEVA 3PR2B 3K6SB 1J21A 2RH5A 4PLZA 2FX2A 3KXIA 4LV8B 4JZYA 1H5QA 1EH5A 1R5NA 2BEUA 3HVUA 3R5TA 4PHHA 4V3CA 5G41A 2C2WA 3RKSA 3DAFA 4M9SA 1TQHA 1U1IA 3JATA 1ZM7A 2X2OA 1MNAA 4PPNA 1C3OA 3PXBA 2ECKA 3A05A 1XCGB 3VO2A 4TQUS 3U3RA 1Z4NA 3A1NA 2XPCA 2FRXA 2WINI 4LJ7A 3GA7A 3O2JA 5CGQB 3SQMA 4PEVA 1OQAA 1E6KA 1GV1A 2OILA 2XMGA 4I5FA 4UQPA 5FBVB 4X97A 3LBFA 4C0JA 1UJBA 4D80A 1SHLA 2GPTA 1I3MA 1VPTA 4R1LA 2JZNA 3DOCA 4TM7A 3S5JA 3ZBPA 4LRWA 4YMGA 4AU1A 2AW3A 1IJKA 1CTQA 1QR6A 1PGJA 1SZPA 2W6CX 4OJMX 4D9JA 1M8FA 1PU2A 2CK3A 4K9LA 3Q3VA 4JYMA 9ABPA 4QYIB 3OT4A 4C6TA 4GOKA 1KZ9A 5CDYA 4KR3A 1KPGA 3OOEA 4WFIA 1DLIA 4PAQA 4DBLE 2RCNA 3G2OA 2EKPA 1YHNA 3EEIA 1D3AA 2FXVA 4I9NA 4CQMA 4F0JA 3C6XA 4FHEA 3FUCA 4GEGA 2NYRA 2O5EA 4LQDA 2YWEA 1DIRA 4TGLA 4U5XA 4RMIA 1BH6A 4AMVA 4F12A 3T5CA 4ZXFA 2CLMB 4GI5A 2C00A 2E4VA 4L0QA 4EECA 4IVPA 1EXWA 4KPYA 3A6JA 4HCJA 5JMTA 3WB1A 4GI1A 2PT5A 3BB4A 4DTIA 2QT1A 3E3MA 1K6XA 1WMDA 1OB2A 1FX0B 1ZUHA 4GDMA 4DMFA 1EZ1A 5EWLB 2I6FA 5PNTA 3TZQA 4MITA 1ZFNA 2J33A 1JJ7A 4LCBA 1E0AA 2O5VA 2ZJFA 3K96A 3JQRA 3OM0A 1UH5A 4MS4A 2D8MA 1XQVA 2IPNA 3NTRA 5K0FA 5GJVC 3OKPA 2BKAA 5K6AA 4O0LA 1Z36A 2A9KA 1QYVA 3BKXA 5TB5A 4BAGA 3B6JA 3I2KA 1IHXA 1CS0B 2IWHA 4DCTA 2UZ1A 1OOEA 3KU4A 1ID1A 5I9LA 2DERA 3USZA 4RKFA 4L9AA 4UKDA 4WCFC 5JAZA 1DPGA 2R00C 1STOA 3RSOA 4U7TB 4EI8A 1C1YA 3OECA 4Y30A 4BZWA 2P77A 4B2YA 3TW8A 2C95A 1Z9BA 3HXPA 1JEQB 3NUQA 3OJWA 2QJFA 1UAGA 4HDSA 3AUFA 1QLWA 2K7ZA 4MEAA 5EWLA 3FW1A 3U2QA 4XYEA 4MQFA 2QL7A 2IOFK 2V7EA 3H5NA 1RC1A 2B2XA 1NRIA 2A1IA 2PSJA 4C5AA 1U8TA 3A25A 2XOKD 1WV0A 4NCXA 1MW8X 3H87A 1TA4A 2RHWA 1M8KA 1EDEA 1G5IA 4CFYA 1QJ4A 1T8WA 2JKYA 4YQEA 3RS9A 4B87A 3HR8A 4WL0A 3FPHA 1Q0LA 3F2IA 3N0XA 1GILA 4NJMB 3L6RA 4RJJA 2Q29A 3OC0A 1QGED 3ZU3A 4C7MA 2Q4TA 3FNBA 2RE8A 1DX9A 2W83A 5DX0A 3W5DA 2E49A 5J4VA 2IHJA 3I8OA 4HPXB 5DXJA 5T41A 1DKRA 3E18A 1RQRA 1UFVA 1SBZA 4DC1A 2EC5A 5BVHA 2IW3A 1XJWA 3CVWA 1TIKA 2LD4A 1TTQB 2ANBA 3OM1A 3PXDA 4P38A 5G40A 1XVTA 1PLJA 1U4SA 5EQDA 2DBVO 3PFFA 3V32A 4BATA 1BRTA 2JGIA 4LJ5A 1N77A 2XHEA 4OSEA 1L4EA 4UTOA 5K3DA 4KC0A 2NXNA 4IIXA 4S1NA 4M9ZA 4OKSA 4ZGBA 2FPWA 4R4JA 3JWGA 1G0OA 1XRPA 2EX4A 1RRKA 1D0IA 4FW9A 2X1HA 1AIPA 2VRCD 4YJFB 4YIHA 5A5GA 1AQJA 1EQAA 1GUYA 1YBAA 3OHSX 1YQDA 2P9FA 2QTAA 2H1WA 5JAOA 2FSPA 4IXTA 3HJTA 1NONA 2Q3MA 3OQPA 3IVMA 4UPEA 3PX7A 4JJAA 4QPPA 3G2HA 2HF2A 1VI2A 3MTEA 4I50B 4JOCA 3VNSA 2C2XA 2AQ8A 1FRFS 4JB3A 2C0PA 1Y0BA 3S7TA 4EW1A 3U16A 4HC4A 3CZCA 3MD9A 4X20A 3VR2A 4DCPA 1X1RA 1W6UA 2AEEA 3K1AB 4R54A 1A2QA 1M2VA 4IUYA 2HWXA 5G3ZA 2NZ8A 2RJNA 3G2MA 3I2JA 3N05A 5BV8A 4INJA 4MX8A 4E31A 5MN6A 3T7CA 3THXB 1T3GA 1W96A 4UJ5A 4QU9A 4QYXA 4RVDA 4JJEA 4EKIA 1FFYA 3IBTA 4QU5A 5KO2A 3QF4B 1NBHA 1A04A 4FGUA 4KE8A 4OH1A 7REQB 3TPCA 3FOFC 4TSFA 3CZAA 2CV0A 4D9GA 3FDIA 1R6VA 4Q12A 5HFNA 5BSFA 2ZGVA 5L8VA 1NUSA 5DBGA 3ZGVA 1MH1A 1F4VA 3W2GA 5HF8A 2ZS8A 4PGAA 4LOIA 4O08A 1IOWA 1CW2B 1PI3A 4DV5B 2F1KA 2O2JA 3IALA 2OHXA 1PCXA 4GE3A 5K8UA 3JQCA 1MA3A 1OE0A 1RR6A 4G4GA 4JOQA 5FQOA 4CQNA 4MUAA 4Z3DA 4NMHA 3OEEA 1T9AA 1JQJC 2K2WA 4IL5A 5E6SB 2V6IA 2WU8A 1GZHB 3F71A 1PUXA 4CWAA 1PJAA 2AN4A 1IG0A 3B12A 2ZE6A 3CURA 1H2EA 4FYWA 4N1AA 3OJEA 1E4OA 4YV7A 5CCXA 1MJ5A 3C1TA 3M34A 4M6WA 2P0YA 1MC4A 1O95D 4QDTA 2HCRA 3MM4A 5T67A 1DC3A 4QXOA 4EDFA 2VAMA 4QYIA 5EZSA 3F4LA 3RVPA 4EOGA 1BDBA 3KZVA 4XX0A 1O0CA 4JQOA 2R6JA 3U80A 3GCXA 1LRJA 2HWUA 1PV2A 2I5PO 3FOZA 1IWOA 4F93B 2H8KA 1N2EA 2FEPA 2HXGA 5FI1B 4R1NA 2J0UB 3GGPA 5KSPA 3RRBA 4J9UE 4JDUA 2XE7A 4OMCA 5DGTA 3VKVA 1M6NA 3O2NA 4KQ2A 2C4MA 2GHRA 1GR0A 1ND5A 2J0VA 2Q1YA 3CUVA 3FPEA 4XFKA 1U99A 2A0FA 3Q9SA 3O3MB 5BPHA 3AUUA 2XA9A 5IMBA 4BX8A 2JBWA 4WZAB 4AF6A 1VB3A 2CW5A 2Z6VA 3WZLA 2CL0X 2XTAA 5IM4A 3HR4A 1CG6A 3IHLA 3B5IA 4INOA 5M29A 4WJKB 3IEMA 4H17A 5JAPA 4B7ZA 1GZVA 2IU3A 2AC2A 2BFPA 1XZMA 4BFVA 4DSUA 3OIUA 5BNIA 5HXAA 3LDUA 5KC9A 4Q3LA 5F1YA 1HG0A 1QVWA 3HB5X 4RJLA 3URKA 1CWUA 2UYQA 3L8DA 2B99A 4YP6A 1KERA 4B7CA 1PDVA 1AKTA 2IZ0A 4TLDA 4EZBA 7MDHA 4XZ3A 1U2GC 5J1TB 5TT1A 2O1SA 2R7LA 3VBCA 1S8OA 1M54A 1PJ8A 3B38A 1TM3E 3FYTA 3TMYA 4A0RA 2B3TA 2QV0A 4FOPA 4XTRA 5D84A 4DBLC 1KEKA 3MJCA 3ESDA 1N1GA 1D9XA 5BXYA 1RBYA 3VU3A 1R6BX 1BYIA 1A5BB 3AP2A 5FD8A 2EARA 4JHLA 2OD2A 1CUXA 4JA2A 1R18A 3OICA 2G70A 1YZQA 2JGJA 4NE9A 4OJQA 2PXCA 3A6DA 4QD3A 1L5QA 3LPMA 4ZOBA 2DKNA 1BC5A 1DAEA 1UFQA 1WDKA 2B4RO 1LDYA 3BORA 3MQ2A 4M0FA 2CBZA 3JQPA 3TTUA 2XWQA 4CETA 1K3FA 2QTHA 3LUKA 4EUKA 4NCBA 2F6RA 2FQWA 4C0SA 4OYHA 4MYRA 1QHSA 1FFGA 2HSZA 3OLWA 4TLCA 3C6MA 3GPLA 5EJ2A 1PQPA 1YIDA 1GFIA 1IG3A 2AG1A 1A5ZA 2EBFX 3O8OB 4C3ZA 5AM3A 4LJRA 5F98A 1WTAA 5CRIA 1EFRD 4PX2A 3VTZA 1N2BA 1N9GB 2GBIA 4P7GA 4O2BA 3QWAA 3BD9A 4OEHA 3VPSA 3MA0A 8ADHA 4FBLA 1RI4A 3EG5A 2HJVA 5CFZA 1Z5WA 2WZBA 1KYWA 1VG1A 4MV0A 3B2EA 3GPBA 5KPJA 1SELA 2P9BA 1QUEA 4P7FA 2AX4A 1QJCA 2C5GA 1YRAA 1GAXA 1KO1A 1E1CB 2OO3A 3IDZA 1QO0D 2GPJA 1RMTA 3KDPA 1QYRA 3O2SB 2VHQA 3LWNA 3QX9A 2OCAA 4EYQA 4PLTA 3I45A 5EXPA 3PX3A 2DWQA 1ZIDA 4JAVC 1T0PA 4D96A 3QPCA 4GP6A 3ZHBA 2YOFA 2W2PA 1UIRA 3IIJA 2GJSA 3RD5A 1BKSB 1F8YA 1R6DA 3PQ7A 2NIPA 2NNWB 4N39A 5BQFA 1OIXA 5K8TA 3AFGA 2Q5CA 4TWZA 2P2YA 2DMRA 3PNKA 1KK3A 1YCHA 5F5LA 4RTNA 2RAFA 2G76A 3LKVA 4FEGA 5DTQA 2O8BA 1XMVA 4J7AA 1ECCA 3AF1A 1MB9A 1MT3A 2Y1WA 3AIOA 3GBPA 3KT0A 2V4MA 2H29A 1LEHA 3OZXA 5DGCA 1SA0A 1MX3A 4ZAGA 1Q0UA 3QMPA 2CLOB 4ZU1X 3VSCA 5JBIA 4FOTA 2VNAA 3EXHA 2P4QA 1G4HA 2V6GA 3SDBA 3DFMA 5LZ7A 3FYUC 4FQ8A 4CG1A 2G09A 4AO8A 3CTPA 4E5VA 4GSYA 4ZDWA 5HKBA 4OXKA 1C81A 3CNBA 3SS9X 1V5FA 4X00A 3EZ7A 4HGPA 4X91A 3V33A 1JXMA 1IBMB 1TT5B 3WSTA 1P0PA 2NN3C 3LBHA 1OXSC 3ZLUA 2BFFB 4DG8A 3NBZC 1OFIA 1BMTA 1XQXA 5AW2A 2DUMA 5FXMA 3EODA 3Q85A 1AQUA 1TD1A 4MCAA 4IFTA 5BW6B 3TXXA 3G0BA 7GPBA 3U3DA 1N3LA 1Z2DA 4NFLA 3V4FA 4WFJA 4XWKA 1F9EA 2A92A 3VYTB 2OQIA 4RK0A 3CH7A 1DG1G 5FWYB 1R4NA 3OE7A 3ROGA 3T7TA 3PF9A 2VLBA 2REOA 4XSGA 1HFWA 2DWCA 5EJGA 2ZR0A 1USIA 3A28A 2C2KA 3OJOA 4OQFA 3OJXA 1T2CA 2BFBA 2YFHA 4PX5A 3QX3A 3IBCA 1PW5A 1NXSA 2BDUA 1U0BB 3TYXA 3ZEAA 1AE1A 4M22A 4H7FA 3AKDA 4MW2A 4ODIA 1NXWA 1O8CA 4OHXA 3GDFA 2ZU6A 2CUTA 4UEQA 1YBVA 5FR2A 3D8BA 1NWHA 3D8UA 2VPYA 2AHOA 1OAKA 1WO8A 3DEAA 2QTRA 1ENZA 4X6UA 4BMZA 3AVQA 3VAYA 5FUMA 3T9DA 3OQOA 4GDFA 1NMZA 2DR3A 3B51X 4JB8A 1FMTA 1WDWB 4M8SA 5J5CA 5IT0A 3ZW8A 2XXBA 1UWCA 2E87A 3BL6A 5B6JA 4KBFA 1AKYA 3IEUA 4YAOA 4FWTA 3LCCA 4YN3A 2FSFA 2HGSA 3KYCB 1R9NA 1JV2B 3ZTWA 2WSSD 3QGMA 5LMZA 3MOGA 3K3PA 1K5PA 2AC7A 3P20A 4ZJZA 1CZKA 1L1RA 2DHCA 1XMQB 4HS9A 4ETIA 4N3NA 3HRKA 1UPFA 3BRWA 1NW7A 4HDNB 1RQNA 2LXNA 3BERA 4HX5A 2SECE 4Q1DA 3H9CA 4RSMA 3WLTA 2GXAA 2O3QA 4ZI7F 1Z7WA 5HZHA 1K8QA 3FJYA 3RC9A 3GJXC 1DMRA 1CNEA 1O08A 5FAXA 5BWOA 3IB3A 1JSZA 4JH0A 1QS0B 6NULA 2OB2A 4BPBA 1YDFA 2O06A 4YC7A 5FOXA 3KAKA 1V35A 4BQNA 4ZZ2A 3KALA 1I3OA 2BMJA 3R74A 1EA7A 1VXOA 1UBOS 4LZJA 4URXR 5KNCA 3GBSA 2WJ3A 2FWRA 4FZ5A 3NOVA 1R64A 1S8FA 1SOUA 3HEAA 2E4AA 4HDQB 4NZPA 5DM0A 1DIAA 2EATA 2RHMA 2VF2A 4LNUA 1SWVA 5CLGA 1R27A 1NL3A 4GG1A 1QHIA 4PFQA 2N75A 1X1SA 3FAZA 3JD3A 2HRRA 2Q8QA 3OX4A 2XMBA 1NJ8A 1RIIA 1VI5A 2C4WA 1Z2CA 3Q8XB 4KO8A 1YVRA 3THRA 2REBA 4OGFA 5HIKA 3I9OA 4WZBE 1OZFA 1V71A 4J94A 2C9MA 1LA2A 4PYNA 2R8XA 4CZ2A 2JASA 2YJNA 4GC9A 3GLGB 1GT6A 4WK0B 5CLIA 2A88A 3WLQA 2FKNA 2IYXA 2VRNA 4LSGA 3O75A 1RSZA 1WHSA 4MZXA 5G3YA 2Q7DA 1TCBA 2V5VA 2ZPUA 1U3UA 4KACA 4KK3A 2HIHA 3MYYA 4C08A 4C7BA 4DLLA 4F1JA 3ZVKA 3FPLA 1BJRE 3EOAI 1DPFA 3OZEA 4EO9A 3NC4A 3WC4A 1IL0A 3DD1A 2GXQA 2PUTA 2ZRFA 3C85A 4HN9A 4MWOA 2YYYA 3IUBA 4MW7A 5LNK1 3R0ZA 1RRFA 3LMKA 1U1EA 1F0NA 3GLKA 3H1FA 3GFOA 1YU6A 3IAM6 3PF8A 4R2JA 1R10A 2ERXA 2DU8A 2VWGA 4OY3A 4LKOA 3U44B 1WULS 1LCIA 1ZCBA 1KEVA 1YJBA 3F1KA 4H7KA 4JQZA 3AF6A 3QE4A 3KG2A 3H5IA 3N9IA 4PZPA 2HYIC 2PZLA 5A6SA 2RBEA 2UXCB 1WHSB 5JUWA 2R96A 1X7WA 3CKYA 2GJ9A 4C0LA 4X1KA 4RTOA 1SNYA 3MCAA 4XPIB 1A8PA 2PGNA 4ACBA 4B82A 4CL2A 1JPNA 4FC7A 5AW6A 3BX1A 1BU8A 2BFMA 3TB6A 1HYQA 1MEOA 4ZWNA 3UJCA 2C4HA 3IRUA 3NDJA 4LFCB 1TFUA 4IOKA 3DDSA 4JD5A 2ZAOA 4KO3S 4XWWA 2UU9B 3D0OA 2OFFA 1CR0A 2IV3A 1WLSA 3AVOA 5A3SA 1M2WA 1WVIA 2ZPAA 1UDWA 4D4IA 1YKGA 1MEEA 2XZTA 3L40A 5DN6D 1JAHA 3U7RA 1N4AA 3QVGA 3BB3A 4QHTA 5E2BA 3U39A 2ONYA 1L4FA 4PLWA 4BE4A 1OLXA 4XIIA 4EY4A 3KO8A 3R1IA 3II6X 2A9OA 5FPYA 2VJYA 1LQ2A 5E6RB 5K2OA 2A0UA 4GPIB 1JQKA 3OSUA 5DFAA 2QGNA 3W6OA 5F73A 2FN9A 4GS5A 4PW0A 3V8VA 2FSHA 4AQYB 1CUVA 2PGLA 1PFWA 1PR0A 2A0WA 3C1UA 4DNPA 3VUEA 3DV9A 4W5JA 4WTOA 5KWSA 1U2DA 2IX9A 2UVDA 3NNSA 4IOJA 3U3MA 3WOVA 3ZKWA 4AY3A 5LKRA 1DEXA 1KEEB 2AEMA 3ORQA 4AMZA 4NOJA 1EESA 1UKYA 2GD2A 1JLMA 2A58A 1KIFA 2XRZA 1QB7A 3PXUA 2R8YA 2E4WA 5L3ZA 2NZWA 1SVIA 2YXPX 1RI1A 3Q7EA 3KSBC 5AHOA 3VR0A 1OGJA 3P94A 1PR3A 1V5IA 1OAAA 1GTG1 2FFHA 1POWA 2PRYA 3I9KA 3TTVA 4CLXA 2R1TB 2C5SA 5JARA 1XDSA 4YV0A 5JLJA 5JJ5A 5IT4A 1OI2A 4D4HA 2FEAA 4B3FX 5B1EA 3L7AA 2YY5A 4QM6A 2WTAA 3FOWA 4C1BA 3IDOA 3LECA 1Y42X 1YCGA 7AT1A 3GUCA 4BNMA 1KY4A 4IV0A 1G291 1LZLA 1Q92A 2ZDGA 3GA0A 1II0A 3GH1A 1EUZA 4BN4A 3ZVNA 1TM7E 3D6AA 3ILYA 2BP7B 3LNTA 5EZ6B 5KNBD 5LMUB 4DSAA 1DAGA 3DYIA 2GFIA 4MKHA 2BKUA 4ZHQA 5JPDA 4M1YA 1ZJ4A 4W6QA 4CTNA 2H18A 1Z4QA 4DIEA 4ZT5A 3WMRA 1PZHA 4D9BA 2D13A 2ZSAA 3NHZA 5TQ0A 1NYRA 2QR2A 2ZIXA 4OREX 4YJ3F 2H5IA 5GZ1A 1ONBA 2X40A 4BVGA 1HR0B 4XUGB 2LV8A 5TARA 5JJBA 4RXTA 1IZZA 1BVYF 1Q0SA 4QOEA 2YICA 5KTTA 1JJIA 2YNMA 2PA0A 4KTVE 3B85A 2P67A 4JJGA 4U3JB 3AY0A 4LGVA 3QF7A 3I23A 4R1SA 1XEAA 5C5DA 5AKXA 4MUMA 2EP8A 3UG6A 3Q6MA 4DM7A 5LDDC 1MENA 2HIMA 3C5WP 5IJXA 3L0PA 3LRXA 3BFVA 4JLOA 5EWJA 4Q15A 1QQTA 2WLSA 3GW8A 3TLJA 2Q2WA 3DH0A 2VBGA 1NR5A 1JFFA 1TECE 4DL9A 4OQYA 1KA9H 4Q9AA 1XKXA 2JK1A 4RKWA 2WJJA 5CH5A 1SBTA 3PEEA 4MHOA 5C51B 3NT5A 1G7CA 4H4CA 5IVDA 2CJXA 5KJCA 2QI9F 1CQIA 1QZUA 2EHDA 2R48A 4L75A 3PNPA 5BR1A 5C1OA 2FYTA 5HJ5A 4NTZA 2GYUA 4W99A 4N7MA 4Q1FA 3LW7A 2JDID 5E3HA 4C2UA 1DWOA 3ZDBA 3ASVA 4L6IA 1G3IA 3GWZA 4YMIA 4BNGA 2XTJA 3BDAA 2BE9A 3BH7A 4MQFB 4ZQEA 4JUBA 2ZI9A 4WNAB 2Q50A 4EUNA 4A23A 4B33A 2AJ8A 3N5CA 4I14A 4EJSB 4M21A 2ZATA 3DF7A 5A1JA 3E9CA 5ECYA 2GESA 2QQ0A 4NI5A 4XWOA 2XT0A 3HU5A 2JAXA 3G89A 4GP7A 4BVLA 2QTZA 2REXB 1Q3HA 1D4FA 1RE1A 1X15A 3RF6A 1GPMA 5J2TB 4OM8A 2D0PB 3C3WA 5KS2A 4UCXA 1Y9JA 1M6HA 2EW8A 2GXSA 3QVSA 3C3YA 1I7SB 3P0JA 3ZEIA 2KLBA 4P7BA 3RPEA 5K6TA 1KC1A 2XGGA 4JUAA 3K5HA 3GGSA 5LYJB 3AMVA 5GGXA 3WL7A 4RVSA 2FSUA 4YDHB 1LW6E 1RD4A 3FRJA 5FULA 5JFOA 1WQ3A 5AUNB 4E09A 1OIWA 3ZBQA 3PQ4A 2W9XA 5KHAA 1EGQA 1JR3A 3Q8WA 4XPZA 2IV7A 1HDGO 2P6OA 2XB9A 3C5VA 4J0CA 1GR1A 2Q5JA 4M6WB 2PX3A 1XA4A 1LTHR 4MB0A 4P0QB 2EG9A 5FF9A 3L77A 3VI4B 4AJ1A 1VMEA 3GLFA 5EG5A 4Z7OB 4DB2A 2VA8A 1HKUA 1U6JA 3ELDA 5AICA 1YDMA 1ORVA 2C8JA 4L6CA 4CLOB 2EIXA 4PN7A 1ONSA 1LBQA 5M2QA 3S8YA 4QVIA 2IBTA 1XZJA 1CR6A 4KDRA 2G82A 4NMLA 3ZHQA 3E3OA 3L7NA 3PU6A 3AR4A 4ADSG 3G2QA 4K3UA 4AJJA 1I0ZA 1GCOA 2FN4A 2F3RA 4DABA 2O3JA 1E9CA 2W6QA 4URUR 4EPYA 1NG9A 2REQA 4RPKA 4MKFA 2AMVA 1S1CA 1CJSA 2WJ4A 3ONVA 2EIHA 3DGEC 1BO6A 1LRLA 5AK3A 5EPOA 1MJHA 4HQOA 4E7OA 1JSLA 3ZWQA 2XRYA 1I1NA 3B82A 4MYCA 1A97A 2EWMA 3ESQA 3NEYA 3FGZA 5FOWA 4EL5A 1XF1A 1GV0A 4E2FA 1UBKS 2BFEA 3C0KA 4E5SA 1BXRA 3H5OA 1EWVA 1JDZA 3QF4A 1MT0A 2G9UA 4EG1A 4DW8A 4URVR 4XH9B 3R8CA 4CKEB 2PKXA 3SEZA 3BD7A 3SKYA 2OSBA 3KJGA 2WABA 1Q7BA 3ZN2A 4MVXA 1WCV1 3UMCA 5JSYA 4EFDA 3V2GA 1BEZA 4BE7B 5JJCA 2IOHA 3DPSA 1E9DA 1YMVA 5K3FA 4EEXA 2GTHA 4BCCA 4IGEA 3JVIA 1MPXA 4KXFB 1LVGA 2H4WA 4N5NA 2P79A 4I5DA 3SYRA 3QPDA 4EMSA 4WZAE 4AP6A 1B6SA 4YUVA 3SJBA 1L6IA 1KOFA 3D3EA 3LOUA 5F7XA 2WF6A 1TZKA 1FSGA 4QEDA 2PUJA 2QIOA 3GGOA 2NZUG 4YJFA 3N6RA 4Q7QA 3GQBB 3V8NA 2GZAA 4JBHA 1T9CA 4AUEA 4DR7B 3IP5A 5LDGA 1Y5RA 3O8QA 1U0RA 2YYZA 4XARA 4JIGA 1H1DA 3A3OA 4OI0A 2XQIA 2WJPA 3H6KA 2W2KA 4UMEA 1JKMA 1UK8A 2V4ZA 2QLMA 2UZAA 3P45A 4K9SA 4OXYA 4AJOA 5LP6A 4CIXA 2P4HX 3GFBA 5TQJA 4OHRA 4BP1A 1G4AE 4KLZA 2J7PA 3IMFA 3V4ZA 3H5RA 3N2KB 1W48A 3O2QB 3ZWOA 1L5NA 2CLEB 1AA9A 2GLTA 2QLBA 3R5XA 2OCGA 5HZMA 2H2WA 4DT1A 1QMPA 2WSMA 3Q5DA 1NJ6A 3TIVA 1ZD9A 1SG9A 2WKQA 4D4JA 3LPLA 3RAFC 2IBMA 4MRNA 1I3LA 3ND8A 4ZAFA 5DT2A 1G1AA 1S9DA 5HA5A 1IJEA 5IM5A 4CTJA 1XOIA 3UJNA 1L7PA 3L04A 2IYOA 3I2GA 4US1R 5BWMA 2ONKA 1V16A 4RQBA 3SLRA 4BLOA 4J1QA 4K8OA 4R0MA 5K8IA 1TA9A 3LVRE 3UGQA 4BNLA 4EB8A 4BGDA 4Q1VA 5DBEX 3UB4A 1GRQA 4BNHA 4MDFA 4QFCA 5TNXA 4MKXA 3UB2A 1JHXA 3O7MA 3AM4A 3UW1A 3HXKA 3OQNA 3OZBA 4MIYA 1MHPA 2PQ0A 1ZH4A 1P0MA 4OB8A 1PS8A 3KOZA 3QFCA 5CEFA 4G89A 4L4XA 2FMIA 3A7EA 1PT7A 2O14A 3K32A 4O5AA 2Q6OA 3OKCA 1ZVMA 3QEKA 4D5GA 3FCAA 2ATEA 2Z2YA 5AQEA 1QQ5A 3OQHA 1UBMS 2BZSA 2LBPA 4JLJA 4E33A 2FA9A 5B2EA 1Q1BA 2PL3A 2P6NA 2GK7A 2H1HA 3C97A 3FMFA 4AN4A 3CNLA 2ZZKA 3Q3JB 3WDMA 5IM4F 2BFDA 4A91A 3ZTYA 4FCTA 1H4VB 4W9MC 2MSLA 1W75A 4R9UC 4A92A 1WKBA 4YQZA 2BEWB 1QDLB 4FYIA 5DYWA 1OA0A 4XRRA 5KJEA 3EPPA 8ABPA 5LQJA 4DV7B 2CWWA 5TF0A 4B6FA 3HP7A 2E37A 1LV7A 4OHMA 4MW5A 1JDJA 5I9MA 4BVHA 1Z2AA 5BNZA 1FUIA 2CL7X 1AXRA 5E0KB 3CW9A 5I51A 5JFGA 2R1UA 3RWBA 3WLMA 3KKQA 1Q6YA 3BCUA 3G79A 4JBXA 5C8XA 2EFCB 4ZT4A 1SGWA 1PZMA 3CUEF 5JAIA 2OYCA 2G5TA 4YCMA 1KK2A 4TZTA 4EVSA 1YFKA 3FJOA 1JUDA 1DKNA 3DE2X 2Q9BA 3SXJA 3TFQA 4JC0A 3TSZA 1VPEA 4YAGA 3GA5A 3PITA 3BJRA 4CV2A 1Z7GA 1E6UA 4LBYA 3A1CA 3CONA 1PS9A 5TC4A 4KB5A 3UKJA 1EJ2A 2HBYA 2UUOA 1QIKA 3IPCA 4ZT2A 1V3TA 3GZNA 1IONA 1N2OA 1X1TA 2HNAA 3DOJA 1I5OA 1SXJD 2FP4B 5CFOA 4Y1RA 2M98A 2Q07A 1KYIA 2OTCA 3HKDB 4LZZA 2HU7A 5L7WA 4MR7B 4FDLA 1TQDA 2VQ3A 3LQRA 3LGXA 3OIYA 3HCCA 4WK2B 4GQIA 1F20A 2YJ6A 4DCCA 2OGSA 2ECPA 4K9OA 5LLDA 1VKJA 2XTMA 4K1LA 1ZR4A 1ZMBA 5CVJA 4JOBA 2B36A 3FPJA 1G17A 3O4FA 1WUTA 2NGRA 1T0IA 3EZ2A 4OVKA 5DCWA 1U0TA 3TW8B 3PXAA 4PM4A 3RVBA 4GYJA 4C6SA 1AQNA 1YQQA 4OKNA 2WU0A 4PTYA 4CUJA 5CHYA 3RIYA 5LQMA 4GU5A 4KCGA 3AYZB 5DW3A 5DTRA 3ZZMA 2BWJA 3HA3A 3OPQA 4L1KA 1ZNXA 1IBKB 3B6EA 2KBEA 4BLPA 2AC4A 3IP6A 3N58A 1NU8A 4O63O 5M34A 1QGOA 1Z6TA 4I5IA 3AOGA 4HRXA 5FO1A 1VE6A 4MCHA 2R68A 3BWVA 5EMJA 1RIFA 1T3TA 1FLDA 3HDQA 2V9ZA 3BZWA 1J7KA 3G59A 4JNKA 4X7PA 1N7JA 3I9LA 1G64A 1NQUA 2BBSA 4MULA 5LB4A 5JS6A 2POCA 2AXQA 1II9A 1C80A 2CK3D 2D3TA 3NNDA 3HLKA 3PDWA 4LF7B 4H3VA 4Y67A 4X41A 5JW6A 3ER8A 4DBZA 2VCYA 1T91A 4Q7EA 1ODTC 2BR4A 1H0SA 2C94A 1J97A 2B8TA 4JR1A 3REQB 3UATA 1TF7A 2PSDA 3FYHA 4PXAA 5CT6A 1FL9A 3CLVA 2OKCA 1HETA 2XLCA 4G2NA 1WU7A 1GXSA 1UBLS 4BECA 4NBUA 2VJDA 9LDTA 3RS2A 1JJFA 4TSFD 1JBKA 1PFQA 1TGYA 1QCDA 3RFTA 2AR9A 1ESCA 4FMCB 4Q3NA 2AKYA 3QUQA 3PRJA 3UJ7A 1J0BA 1U8ZA 5K0NA 2J9FB 3ZDAA 3LVQE 1PW7A 2QDKA 5B7GA 4AW9A 5BOSB 2WD9A 1Z4OA 2HMYB 3GLGA 2QLNA 3EGIA 1NVWQ 1YJ8A 2OGZA 1U0NA 2PFSA 2G4LA 2VNKA 3IXQA 2OBYA 4O25A 3WLRA 3QVGB 2FHSA 3LIPA 4KI0A 1UEXC 1G20A 3GD5A 5KJFA 1KEPA 5D5PA 5EI5A 3OOSA 1SZJG 4Q02A 4RL6A 3SM3A 4AYXA 5B12A 3TE7A 1SKAA 2X0NA 3ZJ4A 3F46A 1J1IA 1BWRA 4CKCB 3IPLA 3RVDA 3R7FA 2EP5A 3HK2A 1B3RA 4G5HA 2JJ2D 1QK4A 1RI2A 2VQ6A 1W5FA 2DP4E 5DWQA 1T9HA 1ZZEA 4PGFA 3SX0A 2FZEA 4DAOA 1C9KA 1S7GA 4BWYA 2FOXA 3Q3EA 3KUXA 3AJAA 4ZOCA 4JROA 3EEBA 3J81k 1IOZA 2HO4A 3AVVA 2IYFA 3DE0X 4TWAA 4NCAA 1J42A 5A04A 4Y9UA 5HDBB 4YJKA 1AK2A 4M89A 2GEBA 3PQ8A 1XRNA 4TTIA 4U7WA 7MHTA 3KP1A 1QH1B 1S7CA 2R5WA 5KQPA 4UMDA 4QJ5A 2H7XA 2IDMA 5L3SA 3D64A 1XHEA 4FGKA 1OU4A 1KQPA 2PSEA 4IHJF 2F9FA 1TM1E 1P2DA 2KX7A 1GQRA 1AMOA 4LTNA 4B79A 5FOSA 4C0HA 4TTVA 4D41A 3O73A 4F5DA 5BN5B 3HNPA 4DXDA 1TKBA 3EQ7A 3KYCA 2ZJOA 1ECFA 2AG5A 4J2TA 1BD3A 3WGKA 3DAHA 4DA6A 1B8NA 3R77A 4Q1EA 3WO0A 1J56A 3P71T 1WMFA 2DULA 4XVRA 1CUGA 3FLBA 4H3SA 4MB6A 5AKGA 5HBRA 2ROQA 3O95A 4EWLA 1F0KA 4W82A 1LU9A 3HBMA 5C5CA 4KW7A 1CUSA 1VYTA 1SU6A 3REOA 1AKMA 1F8XA 2HXYA 3I6BA 3ORYA 1JAXA 4AD8A 3W5BA 1AZSC 2EZ9A 5JEDA 4Z4QA 4BRZA 1WXXA 4TVKA 4PPGA 4YEDA 4QG3A 1UJ6A 3Q7QA 5C8VA 4RIFA 4G9EA 1E59A 1ZRHA 4YMVA 1CFZA 1PYDA 2FW0A 4LHZA 2IKQA 3WVNA 2P62A 5IPFA 1OSNA 5JDCC 2QQFA 3RRJA 3S40A 3IUNA 3EVEA 5GIOE 1ZO8A 4TXJA 1UWKA 2IEIA 3J80A 5JS1A 2FZ4A 1UWLA 5FJJA 1W6RA 4LTDA 1L5SA 3PG5A 5SYAA 3L0BA 1J6UA 1SVWA 2VSXA 1KJYA 3VNAA 5KPDA 2XDYA 2ZQYA 4B6PA 4FEYA 4RQAA 2PAAA 3ICCA 1ONOA 1N9ZA 2OPBA 4L27A 4WA7A 4WKNA 3SHFA 1QFJA 4YJHB 1B3BA 3EH2A 1D2MA 5ALJA 2R6CA 4AJKA 4GVPA 1SOMA 2YVLA 3EF3A 1NF3A 1ELOA 3ESCA 1IB6A 3EF1A 4HQRA 5KAMA 3SPXA 3UCXA 1MN6A 5IF9A 1Q15A 2PYDA 4L51A 1KRHA 2W6MA 5G0SA 1YFJA 4BLVA 4AWAA 4W8HA 4E08A 1PG0A 2VPZA 3VYUB 2PEZA 1OYVA 2K7FA 2JZOA 2BJVA 1V4BA 2B5VA 1VP3A 1P1JA 4GF5A 2IYRA 1XAJA 2I4RA 3D8TA 4IJUA 4L78A 3RS8A 1NVXQ 3B1XA 3QPAA 2Y2UA 1EE9A 1P1HA 3SQNA 3PCTA 2V7PA 2ZUEA 3O4GA 2CLHB 2YY7A 4MO2A 3L4EA 3ZE1B 4DG9A 1JFRA 3TVTA 1NPDA 3GPDG 3ZWKA 2P9CA 1GKUB 3CCFA 3L06A 3HGQA 2BCGY 4K5QA 1V5GA 1AQLA 1C9JA 1QIHA 1ZUNA 2RC5A 2HV9A 1JQ5A 4UULA 4DEYA 4HT3B 4BAUA 1SUEA 2A3RA 5IXJA 3FUTA 3FIUA 3ZNQA 4OPMA 1ZGJA 1L9KA 1XCBA 3O92A 1PG5A 4PHCA 2AZMA 3V55A 4BRWA 4BU0A 5IK2D 1YGPA 4EIWA 3EPJA 2Y0PA 5F2OA 1IVNA 1UJ5A 3U3ZA 4OXNA 4I08A 4FMBB 1QO0A 4RE6A 5JZMA 2GZDA 3TEJA 3MT7A 3TAUA 1O4WA 3TTWA 1N6RA 2KWIA 2P6UA 5ECDA 1BDHA 1RWVA 2H00A 5F78A 5ALMA 3WWYA 1JB9A 1MO3A 1MORA 4B4UA 2C9BA 4G2TA 4ND1A 2VEOA 3S6JA 2P40A 1NTRA 3WGIA 1QVZA 3BN3A 3QX8A 3CA8A 3AUXA 1LDMA 1UMBA 2YCLA 2PNJA 4RHYA 3PXXA 1ODFA 1XWFA 4X95A 3WL6A 2FLWA 2QD5A 3K53A 4H0NA 5IJWA 2E4ZA 1DBIA 3JTMA 2V03A 2ZSBA 5KYGA 4UMVA 5CK5A 5EKTA 4Z0HO 2EF1A 2ZE8A 4WLFA 4CDNA 2YC4C 2GVDC 3HRIA 4M99A 5IAEA 3VR2D 2BTEA 3Q40A 4YJ3B 1O7JA 1DOHA 3I05A 3HL4A 4DUYB 4L50A 2VNSA 5JCPA 2SKCA 3UAYA 3PC3A 2VWPA 4PO8A 2QF7A 3KQTA 4KBGA 4G1VA 1OWOA 3T3NA 2JH9A 3DB2A 5AOBA 4YTEA 3RU3A 1BU5A 5LC1A 1ZD8A 1PFGA 2VYQA 3K1AA 3K73O 5HZGA 5JD4A 2I62A 2Q1SA 2DQKA 3EZLA 2BF7A 4JUIA 3KE8A 4MCJA 4NYJQ 1F6WA 4UPVA 4RS3A 1UC4B 3BWYA 4Z99A 1WWKA 4ZVPA 3RASA 1RWQA 1U04A 4RF4A 3T7IA 5FAKA 1TMKA 2PMFA 5IAOA 3GH3A 3LVFO 2XCIA 4ER7A 2RCYA 3H16A 1DBPA 1HT1E 1NVGA 4FMDB 4KPGA 1RHQA 1HO3A 4JC4A 5BN5A 1TU4A 2ACEA 1CUDA 4X8HA 2JNWA 2CHGA 3T3PB 4YP5A 4JI2B 4FS8A 4TT8A 1IBRA 2VCEA 2DTDA 1YIOA 2JLBA 3E1GA 4M0DA 3GOHA 4C7OA 1Q0QA 3OVMA 4Q24A 1E1CA 2HK6A 5LYYA 4Q9NA 1LDEA 1SVUA 4HNGA 5K0ZA 2LPMA 3IHTA 1P0IA 3TRFA 3TCXB 3UUFA 4F96A 2E5LB 3EBLA 2LVBA 5FNVF 4FWBA 4R8LA 4MUGA 1NGSA 1E0SA 2GZSA 1QYCA 2VR1A 3BMCA 2X14A 4QAJA 1Y8ZA 1DAKA 1GUBA 4TV9B 4C7XA 3RVRA 3WICA 1JZTA 4LDZA 1H3EA 1C9DB 3R41A 3KKZA 2HEGA 3LKZA 3D6UA 3FWZA 4J0FA 1JDTA 2Q5EA 2I4MA 3V6LA 1FP1D 3UEOA 1QG2A 4JYZA 4NCIA 4LF5B 1SG6A 1SXIA 2ZRMA 3KB6A 1CD5A 1I2AA 2EVWX 3UICA 1Q3TA 2PT6A 2J5XA 5A4JA 1JBQA 1I3KA 4UOZA 4M55A 4YAEA 2FX5A 3G0OA 1QH0A 3PUIA 2J5BA 4IOMA 5JZ9A 4P2BA 1POXA 4AFNA 3I73A 3QUTA 5CA1A 3SQOA 1G9TA 4IIHA 1GYRA 1H0HA 1UF9A 4RD0A 3ENZA 2XA1A 1VBKA 3E9MA 3URMA 3E5MA 4M7PA 4DMGA 4EGAA 1TZBA 5BYKA 3E8SA 2H08A 2VT6A 5IP5A 5LQDA 3PDHA 4CMIB 5K3CA 3RUCA 2OLKA 3GEDA 4DXHA 2DAPA 2DF8A 4H1UA 2CE7A 3U60B 1FIUA 3UWDA 2BGRA 4K2AA 1Z75A 3GGDA 3P2MA 3C3PA 4AY6A 4EG0A 4O4LA 5F5NA 4LE0A 3M9WA 4WFQA 4QU8A 1SHKA 4Z86A 3UV3A 1E18A 2WR8A 1WEHA 4XD7A 5C2JB 1E1KA 2ZXEA 4PZAA 121PA 3DWIA 3TQRA 3ESYA 4LISA 5FBHA 2A4MA 3ETLA 1FUUA 3LUPA 4N6OA 1EFAA 4C89A 1IN8A 3L1UA 2YDXA 3P9QA 5CNKA 1F2UA 3TQSA 4G84A 1T0HB 4OJNA 1PR2A 2G1JA 3GRVA 1YS2X 4WCFB 3KUUA 4ZYWA 1RAAA 4FLEA 2HQBA 2ZI7A 4PQRA 1AGRA 1ZC4A 2WU1A 1Z22A 2ZBGA 1EFCA 1IHOA 2UKDA 2W5UA 2GHIA 1YNOA 1JPJA 2BFAA 3CZMA 2BSQA 4QOSA 5HRUA 4YCBA 2ZRKA 1II8A 4HTFA 2FFRA 3JZDA 1SFRA 3OZUA 1PKXA 2YKGA 2VO1A 4Q21A 5MHTA 1ZWKA 1SK8A 5GQSA 3OIFA 4B17A 4PV7A 3UAZA 3DHYA 2C2YA 2F00A 2XODA 3NYQA 3KQSA 4GOLD 4I99A 2I9KA 2ZT8A 4ZC1A 1E63A 3U19A 3A6LA 1FYVA 4IWYA 2PRKA 4RNDB 4WKCA 1S2GA 3PSHA 1VBMA 1KI9A 1KQNA 2CLLB 1F60A 2ZIXB 1F48A 1GGVA 4IDQA 4KXLA 4MTCA 2BLLA 4RPIA 3H0EA 5C4GB 3UT5A 1E6LA 4QPZA 3ZR4B 3QLJA 3W5HA 2HPAA 4N54A 4ND8B 1O58A 4NVRA 4DSOA 4ATNA 1N33B 3G9ZA 5THKA 3IX7A 4RKRA 3VU1A 2WM2A 1YOBA 2FE4A 2I4NA 1ZJZA 2UV8A 3MFQA 3PUYA 4PQGA 3FCUB 4JBLA 2J6CA 1Z33A 3KKLA 4UHJA 4JLNA 3D43A 1BNCA 1RYYA 2FV8A 2W2QA 3B1WA 4EO4A 4RM2A 4TYYA 2VHTA 4RVUA 2FETA 1TLLA 3CF2A 3FI0A 1MHTA 1JKXA 2V0CA 3UJBA 4MA4A 4PZZA 1OBOA 4U2CA 4P54A 3VU8A 8GPBA 1USGA 3P32A 1N6OA 3JQ9A 4KHPB 5P8WA 3VZDA 4KV7A 2JPDA 1CFJA 1HSOA 1HQKA 2AFHE 5KVQA 1IXZA 4YV2A 4R1OA 3L6OO 3IQXA 4B4DA 2GCNA 1MIHA 1V25A 2ONCA 3HPRA 2J9GA 1TVCA 2WE7A 4JGBA 3UVEA 4NAUA 2FHPA 3QFTA 1JJVA 1FTYA 4RZIA 1OWMA 1YR3A 2JEOA 2ZKIA 1FY2A 3HBAA 1E8NA 2PBLA 2D5AA 5IJ9B 3UYLA 3EXIB 1FQKA 5K3SA 1H0KA 2Q4EA 2W2LD 5JH7A 1ORDA 2NTEA 2EFYA 4NX2A 2YVUA 4L8VA 1JU4A 1JILA 3AEXA 1QGDA 1KAEA 2YVKA 3N8HA 1HE5A 5ERYA 3TVYA 3UAGA 2XNKA 3U61B 4E0BA 1DAPA 4OHWA 4MDEA 4ES6A 3EW9A 5AJHA 5IS2A 1RKQA 3BSSA 3AR9A 4G4SP 5IHXA 2FY8A 3GDOA 4WKGA 1DIGA 3GXOA 3EXG2 4KFSA 3ZU2A 1OVGA 3KB8A 2GDZA 3MEQA 3LPNA 3T9BA 4EY7A 1S6YA 4G86A 4I6EA 3S5UA 4B3XA 4CG2A 1KEUA 5B5SA 1Y1RA 4GSKA 2BL4A 1C3JA 1GNPA 1NBWB 2LW7A 1UBGA 2ZR9A 4KFCA 1E2GA 1E5QA 1XT6A 4TUYB 4OQNA 2I7DA 1EX1A 4YQYA 2HWYA 4J2OA 4CM1A 5EIEA 5AH0A 1VB5A 2NUAA 2XXAA 2ZYIA 1S2OA 5J4LA 3BXFA 2Q5QA 1YRHA 1H2WA 2LTAA 3CLUD 1D2AA 4D02A 1MX1A 3WDKA 3ZJVA 4W1RA 5JBQA 5ITWA 3GRFA 3MHPA 4XWYA 3ASUA 3WLOA 3BK1A 1ZGAA 3G5UA 4R6XA 5ALNA 3RWMB 3TUZC 3SYNA 1WQ1R 1OW3B 1KMMA 1XVIA 4HLNA 4LBZA 4RZ3A 4BEBA 2DEUA 5H59A 3EQZA 3P5BA 2IUFA 3E03A 3QKRA 4D7AA 2QRVB 1ACMA 3OLQA 3JQBC 4TVBA 4WXRA 5HWSA 2JATA 5AVTA 3LC7O 4DYVA 4ZCTA 1PO7A 4KOAA 3FCCA 4HGOA 1P2FA 4CDMA 3LA8A 3P9IA 1OLUB 1KJ9A 4RIGA 3T95A 2HD4A 3BCHA 7REQA 2H4FA 5IC6A 3JALB 1G6Q1 2WF9A 3RJMA 1KBQA 1N5OX 1ZMTA 3FFWA 4LI3X 4NWIA 4WFKA 5C8YB 1JGTA 4H31A 4P3XA 4DUGA 1QAQA 1U9ZA 2FAXA 4PONA 1VPVA 4P3OA 3GL9A 1UP7A 2UAGA 4Q37A 5DYGA 3WLPA 3FE2A 5FBKA 1NG1A 1D4ZA 2PK3A 2XTNA 3EIFA 5T7BA 2NTNA 4OX9Y 4KZKA 2FXIA 5IJ9A 4LYDA 1Z8FA 1PJRA 1U3GA 4FE3A 1QZ3A 4HDKA 2DBQA 1GARA 4DOMA 5ITZA 1Y6GA 3U40A 3H6HA 3IDAA 1R0KA 4BNZA 4OFZA 3WYDA 3GP8A 4UDOA 5CP8A 5UKDA 2PKEA 2C7GA 4YCNA 2BEVB 2G6BA 5DMHA 5I9BA 4O8CA 3CX8A 4L6AA 2JI7A 1RLJA 3T7DA 3X1JA 5KUTA 1L7DA 5FKJA 3HL0A 4CKEA 2E85A 1YHYA 2OL4A 2PVSA 4HLUC 4DJJA 1O97D 5I4IA 2ZVPX 3LXRA 4G8BA 1GQOA 3G9TA 1FC0A 1FPQA 3OETA 3SXUA 4BY9E 4M7OA 2J7KA 5DHSA 1U9JA 3NHYA 3ZWXA 3GAMA 3K1YA 4BV8A 1U28A 3PDIB 5B6IA 4DCGA 3QW4B 1B8VA 1AGXA 1XC7A 1R0WA 4HZUA 3CQ9A 4F9FA 5I7EA 3OQJA 1C9YA 2QTNA 4OI1A 4ANFA 4S1WA 5FIUA 1NW3A 3E35A 1QF9A 2BGUA 3ZQJA 1P77A 4HNRA 1YKFA 3T5AA 4CEJA 4JCCA 5CH8A 5K99A 3K8YA 2V9PA 1FFEA 1J1UA 3RUPA 5CJ2A 3CW2A 1YS4A 1YOVA 2GZHA 4BNJA 5KTSA 1A3CA 5JU6A 2X3UA 4TPKA 4FVTA 1P4GA 2ZZNA 2Z2XA 1WZEA 2A5GA 3UT6A 1TLFA 2C99A 1R6AA 4JUCA 4GKJB 3B48A 4D4KA 2HSEA 3ILHA 2HF9A 3AU9A 3RVMA 4N9QA 2PDAA 3UB3A 4LRSB 3JWIA 2DWUA 3SSAA 3GFQA 1EJBA 2YMPA 3GEHA 4C14A 3DHNA 1VHQA 5DIZA 1OTXA 4F38A 4KGVA 2B83A 4DLXA 1VBFA 3ASYA 1QKKA 4RTJA 3WWEA 1KVSA 2R8BA 5JHGB 4KGDA 1T3LA 1DUSA 1ZA2A 5T3UA 4C78A 1QH8B 4I5GA 3E7XA 4HADA 5CFQA 1CZUA 2H2AA 4MRRA 4YP7A 3LE8A 2Y0BA 1TUIA 1PUJA 1Y8RA 2NX2A 3I58A 3QBDA 3I9V6 4RAQA 1U8AA 3UJ3X 2HJ9A 1FDIA 4F92B 4B3RB 1MAVA 3NG1A 2G7MC 2QX9A 1RAGA 3PD7A 5FL7A 4G56A 3CY6A 1NLYA 4JSRA 4GZ3A 4K7JA 3LSTA 3HKBB 4FNGA 3L92A 1QIEA 1MTOA 3ZUGA 4XGQA 4DIKA 3LIIA 3N0TA 2GEUA 3WKAA 3GJ8A 3ZE6A 2P4EA 1AV6A 1AZLA 2X0FA 4BKOA 4BKQA 4FDVA 3WV5A 4IO0A 1RHRA 4AVYA 5INTA 1VPWA 1KEEA 2JJ1D 1NJGA 4HFNA 3FWKA 4V2UA 1JI0A 1H85A 2QMHA 1XG5A 2Q9UA 5EKXA 2PG3A 3TIIA 5CEJA 4WOPA 2WD7A 4EUSA 5B1HA 2Q1XA 1GL7A 4BGEA 4E1AA 4P1ZA 2PQMA 1NXOA 3RTEA 1VCMA 4OB6A 4ZQGA 2GPSA 5DTIA 4MYTA 5AW0A 5IDYA 2V58A 2VDVE 4FFSA 1UMCB 2N0SA 3QIAA 4MP8A 5EPUA 3TZCA 4DMHA 2XWSA 1E2PA 1V7ZA 5MFPA 3CZ4A 3E61A 3GNLA 3KKOA 1R0BA 2XRFA 1P75A 2Q45A 4FQ5A 5CA1B 2OAP1 5I7HA 3E3AA 4MIEA 4UXJA 2O6LA 1BFKA 1TNDA 1TADA 1I36A 2VDRB 2YWXA 4HXYA 4J4BA 3T3DA 4CKBA 1W36C 2PUDA 3UMVA 2H2GA 1G7RA 4B4OA 1RPAA 3FMGA 3EGWA 1F8UA 2J6BA 1GKLA 1ZK4A 2R8RA 3ZU6A 2JW5A 3EDQA 4B43A 4OIMA 4BPRA 3ZLBA 2JS7A 2HRDA 1H8HD 1Q7GA 4YB8A 3C8ZA 4URZR 4NATA 1CUJA 2WIJA 4QUHA 1I7QB 221PA 2RHJA 4JY7A 4PSDA 1CP2A 1CNMA 3KEOA 3DMPA 4WW0A 5DWVA 1B26A 1NMXA 3OZFA 3FUUA 3MQ4A 4MB2A 3ITEA 1EWQA 1RYNA 4RJTA 4MS3A 2P68A 4KBYA 1ZZGA 2QTBA 1L4LA 3UAVA 5GJCA 3FTEA 3C3BA 3UM9A 4L02A 2CGEA 5ES4B 1J0CA 1Z74A 3WGLA 3IURA 1KI3A 5IVKA 2W00A 1DBVO 3QUCA 1CQPA 3BFXA 1JNYA 3O9MA 1T8YA 4EABA 2IOQA 2I8CA 2ZLBA 3WYNA 3K4HA 3JSAA 3WKBA 3EZFA 4MH0R 4ZAZA 2CV1A 4C0BA 2NSHA 1RTTA 2H4ZA 1O4VA 3E9QA 5FR1A 3L7IA 3PNMA 3ZDXB 3GNTA 5EJ6A 4IH9A 4NZZA 4IZOA 4ONEA 4WPGA 4LXXA 3S8EA 4KWTA 1H69A 4PPYA 2PFKA 5AXBA 5BW5A 1FYXA 3EFHA 3WIVA 5JAHA 4FFWA 2OP1A 1XAIA 3FPCA 3P4YA 3JQBA 1G63A 1TM5E 1G8PA 3F7NA 3PE4A 4HWSA 4XSVA 4G4JA 4H27A 2NU7B 1VBNA 3C3MA 3CX3A 2FEKA 3T3GA 1RPJA 3MB8A 5HP4A 4IRXA 3RG2A 5CGZA 1Z6PA 2FFAA 1QYDA 4ND6A 4R16A 2JA1A 1PDOA 2ZUUA 3OWOA 4D43A 1GDTA 4KQIA 1A8IA 3SF8A 3ADDA 5H3HA 3QUSA 4M1EA 3HXQA 2ZI3A 3ILSA 3I01A 3AT1A 4NJOA 2AG0A 4CV3A 3AEKB 3SVLA 1A7AA 3REFA 4R69A 5EHQA 4WOCA 4I1SA 3AR3A 3CVOA 3SX2A 6LDHA 4KGXA 4LYJA 2PLFA 3ENVA 4NCJA 3UPDA 3PUKA 2D3WA 4O59O 1DOZA 3KZKA 1GA4A 1C2YA 1JEAA 5CA0F 1EK1A 2IZ5A 2JCBA 2O2CA 4V2IA 1IIRA 4MEBA 3DAYA 4HYYA 3ROFA 3UZUA 3VOAA 5JAMA 2OMKA 1W93A 1SKYB 3DPIA 4IXMA 4YRTA 5B6PA 3HB4X 4RANA 3EQ9A 1KETA 2CJPA 2I1LA 3IJ5A 3L1HA 3VHXA 1OBFO 3D2BA 2GBLC 1B00A 3U4MA 1FUEA 2OP0A 4QX6A 4EKGA 1HMPA 2QOEA 3DDOA 2PGXA 4Z7QB 1W0JA 2WHQA 3WKEA 5A0TA 3IQFA 4GXTA 1LLFA 1R88A 1WCWA 3A9UA 2J5KA 1ST2A 3L1KA 3SFTA 3ESRA 3LVBA 4AXBA 1E2UA 3EQ2A 5DLYA 1YS7A 4FN5A 3PFBA 3UA4A 3L7KA 3DQZA 3ZY5A 5JNUA 1S2MA 4YPFA 2CXUA 3OE7D 5IVHA 1YZ3A 3CUWA 5AKIA 3PTLA 3QWFA 3OCYA 1AGNA 2XTZA 2C1ZA 5DH9A 4LHXA 1IZYA 3L8ZA 1FDUA 1O6FA 2NPOA 1GU7A 1GUDA 1GA6A 1PX0A 1S01A 1JIXA 2WKRA 3JX9A 3N6XA 4AJ4A 3H18A 1KVTA 1XZCA 2CDNA 2GCOB 4J0JA 3IJEB 3FCOA 5ALHA 5C7LO 3NHRA 4YRGA 4J6FA 4ZAYA 4JLWA 1BE8A 1T2AA 1FNMA 1QF7A 4ZYVA 3QG1A 1Y80A 3LJKA 3UXYA 2WAOA 2RGDA 3EFOB 2WJIA 3NHUA 4D8YA 5C9ZA 3O8RA 4ARBA 1SAYA 3BE5A 3MFYA 1NVKA 1ZC3A 3K8QA 3M6MD 3AFOA 5ALOA 3NBUA 3PA8A 1NKSA 3DZKA 3H1AA 1CRZA 5AIBA 2EQBA 1HZZA 4D92A 3HBJA 1NOKA 3CUKA 4NBSA 1I80A 4YRFA 1MO2A 4BO5A 3SLGA 1PWZA 3A6KA 3USCS 1YO6A 5JQGF 1EAYA 4Z1MD 1QCCA 1S3SA 4Q4JB 2PUFA 5ERXA 4BVEA 2YJ3A 3BRWD 2W2KB 1VJRA 4OA8A 3NHMA 5DLEA 5C5EA 2NQTA 3RW9A 2BY4A 1T13A 1PWYE 1JXOA 1QZZA 4IFBA 3HA5A 3T38A 4IMPA 4HDMA 1W76A 5KX5A 3M3DA 3ZBTA 2Z1MA 2O1EA 1QF6A 3HKDA 1G18A 1HNXB 5K3AA 3VDQA 2IL1A 1IUPA 1XDBA 4G0NA 4OMDA 4CF7A 5J47A 3LPDA 5DT9A 3KOUA 4WWHA 2VPPA 2Q7OE 4YUYA 1KYTA 1AKQA 1NN1A 2C9YA 1V11A 2BH9A 1QIIA 3K5PA 3TNLA 4EKYA 1ZHOA 3MT8A 1XNQB 3BWDD 3AONB 4B34A 2V74B 3LPCA 3QPBA 3I2IA 5FWAA 4CUKA 3ELYA 3FVWA 1W4CA 1DNPA 4F06A 2P1ZA 4NJEB 4RCZA 2AL7A 2F9MA 2VTKA 1M7GA 3KWLA 3O03A 3SDSA 5BVGB 5DBHX 3LY7A 4DMLA 2F7SA 1HYGA 3IULA 3G49A 1KXJA 3EQ6A 4MMXB 2KSQA 3KLBA 4MUEA 2PSSA 3OEWA 2CYCA 4A73A 4QQKA 4Y7DA 4JFAA 4B0OA 2P0EA 1GSAA 2R8ZA 5HDQA 1WSAA 2WZCA 3FUWA 1SB8A 2CUNA 2OM6A 2GM3A 2OZVA 3LBIA 4LYYA 2JGMA 3RARA 3FBTA 4BQOA 1ORIA 2C20A 5L4LA 3FHOA 4DWJA 5IT9A 4M9QA 2GASA 2XCOA 4PG6A 3OQ6A 3M1AA 2QE7A 3I61A 4US2R 2BD0A 4OSOA 2EXXA 4X90A 5LFAA 1Y7IA 3AVPA 5CR9A 2ODPA 4RFSB 2JHCA 3JQDA 4M86A 5FORA 2NWQA 3IAHA 5L45A 1A2BA 1K6IA 3G3EA 4OBEA 2Z8XA 3PNBA 1DEOA 1ML4A 1LLCA 2J4DA 1X2EA 4OLFA 4JJ8A 4WACA 2J8ZA 1E60A 2AB0A 1LS6A 3CRVA 3CR7A 1KK0A 1L4KA 5AXAA 3HUDA 1VJ1A 3HB7A 1SQ0A 3ISVA 4AKTA 5D7BA 1TT5A 3EIEA 3M6WA 3BCRA 3MTGA 3F96A 1KYYA 3IMKA 4FFBA 2I55A 1VJGA 1XNHA 2QU8A 1P8AA 2XNDA 4LHEA 3ONEA 1LS1A 4PZ0A 3RV3A 5C7OO 4YCLA 4K9KA 4L85A 3U4IA 3STUA 2BEJA 3KZCA 1FCJA 1FTGA 3QELA 3UAWA 4CMKA 1OH6A 2IIBA 1GQFA 2ADMA 1KIMA 5D3KA 2VWHA 1A69A 4YJDA 4UREA 3CR8A 3FYDA 4QNNA 1ZD3A 3E3LA 4KR9A 2FTKE 2FPRA 2AE1A 3ACBA 4EP1A 2G4CA 1Z8NA 1H8ED 5K8LA 3RS4A 3EGDA 2X8BA 1V3UA 4HBZA 4D2IA 3T1HB 2YR0A 1QYWA 4JT9A 4GZ5A 2XCRB 3H84A 3F3KA 2YFQA 4BEVA 3QVWA 4IIGA 1FS5A 3UOAB 1Y3AA 4D9NA 4EB6A 3O31A 1PFYA 4BBAA 4J7UA 5DGHA 3RFFA 4ER6A 2J4CA 3WB0A 5JO9A 3DBOB 4XIGS 2QQ5A 2MMGA 3WGGA 4A1FA 5FHRA 5ALUA 4DCUA 2W48A 3ANTA 3W9SA 2X0DA 1J22A 1TA0A 3BHJA 4IDPA 2ZYSA 4R2HA 3VJKA 3TX2A 5IJZA 1U0LA 5FUYA 2RHRA 4HP8A 2ZRAA 3Q1KA 5FOUA 2QENA 4NZOA 4DLZA 4UBKA 1P6UA 2PWZA 2DHEA 2HADA 3CGGA 1DRUA 4XVQA 3SIRA 5D01A 4KDFA 4QXMA 1OC2A 1YUNA 2ZB7A 4CMHA 2IHVA 3IUJA 3F97A 4O4JB 2X8LA 3DBVO 2BYTA 1DCKA 1XLVA 4UAVA 3O3NB 2Y1DA 3KS9A 2J3MA 4KUHA 5DX8A 4BFLA 1VKHA 3V4PB 4CNQA 1C8BA 3MRTA 5IWCA 4R41A 3SWWA 2CNOA 2CXTA 1UCFA 3RU9A 3U49A 4TL9A 1XVLA 1E66A 3VNBA 4WA8A 4RWZA 3BS4A 4JKYA 1XBTA 1XTIA 3H9GA 3T9CA 2IEBA 1JAIA 1Z08A 1V26A 3BA1A 3ZHXA 3RYIA 2KB0A 1UT5A 1C7FA 2R1VB 3I1FA 3PJDA 2O0HA 1DBQA 4YGYA 4BLTA 2GCIA 1KH1A 3AB8A 5D3MB 2WSBA 1XPOA 3ELUA 1OYWA 2XRMA 3RUDA 1M75A 4WN3A 2O3UA 2JFGA 4BZZA 3DLAA 4P5EA 4E5DA 2PUCA 1T9KA 4C4AA 2PH7A 1U28C 3GLHA 4OHUA 4YXWA 3AH8A 2J1LA 1GJRA 3BBLA 4ZODA 1C7RA 3K20A 4DM3A 3ECSA 3K09A 6ABPA 2NT4A 3CW8X 2QRQA 3FLEA 1L7OA 3PFKA 4FHDA 1CIPA 1XZAA 4IIJB 4I3GA 3TKAA 1D2CA 1ARZA 4DQVA 5C8DA 3BRCA 4NQRA 4P4NA 1Q16A 1GEEA 2VUSA 4J29A 4MUJA 4CM7A 3OEYA 2FDXA 4TKZA 1ZJJA 1UAYA 5FHQA 2Z0MA 1C4WA 4JBGA 4KXXA 3GOQA 1N8NA 4HGYA 3FNIA 3GVIA 4D0LB 3M4ZA 1K89A 4FS3A 5HW0A 3RYFB 4K46A 3ICWA 2W70A 1ZNZA 4MJ7A 3NTQA 2VUIB 4B3DA 4OJYA 3NAMA 2H3EA 2B34A 4R3NA 2NZJA 2ZYUX 4TV8F 4CLDA 4HNVA 3KQUA 4PRYA 3U7QB 3MS7A 4E6PA 5ICEA 3AM5A 1VLMA 1OVMA 2ZUWA 2AH5A 4S3MA 3GJSA 4TRMA 3VH3A 1PLKA 4ZFNA 3X1XA 1E1MA 4C4XA 2ASEA 1QP0A 2ODAA 3KHTA 3EVDA 4EUEA 4LBWA 1EP1B 1DHRA 3ZUPA 3D6VA 3VZQA 3T7SA 4UUQA 3DEJA 2QG6A 5HS6A 1ODIA 3DE1X 2YZMA 2ES4A 3V9AA 1EXMA 5AXDA 3AJEA 3GJ7A 2FZWA 1RQXA 1CY8A 3VC7A 2Q3CA 5AVYA 1YXMA 2VF7A 1VM6A 2A5YB 3H1GA 4HAUA 3DZ8A 4U2EA 5EKDA 1KFJB 4QPJC 2I6XA 1QG4A 1K8RA 2Q99A 5BSKA 5D5QA 2B4KA 3K9QO 5DXFA 3MCVA 3E82A 4N48A 1YZKA 1LBEA 2FMUA 2IK8A 3LHFA 3MRXA 3W34A 2INGX 3JQ7A 2HFKA 1VYUA 2OLEA 4IZIA 3Q0IA 4ZO7A 1Z5NA 3AY3A 3H1PA 1J8VA 3AF5A 2XE6A 2XUOA 3MXTA 4C3UA 1ENPA 1UBUS 2J46A 4W6ZA 1GKKA 3S0JA 2H4JA 1DC7A 4KGZA 3VPCA 2V0GA 1NP3A 4OQPA 5A9RA 4LOLA 4R81A 1CU1A 4R83A 3ENWA 4NLLA 3FSGA 3U31A 5J4HA 3I1YA 3BE6A 1PK7A 1T2UA 5ECGC 3TLBA 3P8ZA 1EB9A 4PINA 2YOGA 4DIFA 1ADCA 3U6KA 2COUA 2HA7A 2VH2A 3A31A 1UC5B 4UOQA 2HL6A 1QVVA 1BCSA 2BCEA 4ZVUA 3N7AA 1U4OA 4G23A 4A0QA 1GDDA 4AC9A 3L6CA 2HFJA 4EI9A 3QTTA 1XWWA 2QE6A 1DU4A 2CLKB 2QUAA 4D3ZA 3OBIA 1CHNA 1QK5A 2F2TA 4JVMA 4GM0A 3RHFA 2ZTHA 2JIQA 3PHGA 3PXEA 4TKMA 2OCBA 4CEIA 2W71A 4WDRA 4II7A 2C3UA 1RWOA 4NCKA 4Y2JA 1NQAO 2V5UA 4L4ZA 2QM3A 4EQ6B 3BHIA 1HE3A 1NULA 3RRXA 1ZGBA 3O21A 6Q21A 4UMFA 3D4BA 3DG9A 4CI9A 1W0KA 2IXFA 5B58C 1CIJA 3MGKA 2IEGA 1EJ6A 2ENUA 5HTOA 3FPAA 3CU5A 1TQ6A 2WWFA 1UKZA 1RJWA 2CXRA 3KKNA 2PGOA 3NHLA 4UCQA 3R7AA 3WAGA 2NYUA 2VHYA 1NAHA 2Y9PB 2QG9A 4IDOA 3PJRA 3EUEA 2H6EA 1SXQA 2V54A 1U2PA 2Q0HA 1XNRB 1YR8A 3ZWNA 4C0XA 1CF2O 1YMUA 3RROA 1YBFA 1NC3A 3CWQA 4KK4A 3OIWA 4X0EA 3VH1A 1YQ9A 1K66A 1MABA 1GN8A 2VHJA 2APJA 3BEOA 3DR5A 2OXRA 3R3WA 5E4YA 5CUQA 5CNMA 4N0PA 4A1OA 2O0MA 2XVMA 4WXHA 1T6XA 4M7RA 3SCZA 4JENA 2Z2JA 5HM8A 4ND3A 4QTUB 2DCUA 3QVKA 5JVDF 4Z8YA 4ZCQA 3DEFA 4QYMA 3SBEA 2Z5VA 1E9EA 3R3VA 4NBLA 5EEGA 1NZJ