1KRXA

Solution structure of beryllofluoride-activated ntrc receiver domain: model structures incorporating active site contacts
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
124
structure length
124
Chain Sequence
MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAISHYQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITROGEN REGULATION PROTEIN NR(I)
publication title High-Resolution Solution Structure of the Beryllofluoride-Activated NtrC Receiver Domain
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Signaling protein
total genus 35
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2002-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1krxA00
5CNKA 4YLEA 1FFGA 4KK3A 4JAVC 1Z2EA 3EULA 5EWMA 4EGSA 4S05A 1F4VA 2FN9A 4XFKA 3OQMA 2PLNA 1RNLA 3M9WA 4YRZA 4LE0A 1A0OA 2E4VA 2V0NA 3FFXA 3SM9A 5IULC 4MR9B 3HDGA 3QEMB 4RY8A 5TQ0A 3CKMA 3C3MA 4RSMA 2W42A 1TLFA 3CG0A 1GUDA 1SXIA 5DTEA 3RQIA 1MVOA 1YK1A 1P8AA 2LUOA 4QICA 4Z4IA 2MYUA 3O74A 5KQGA 2LIVA 2ID9A 2JB9A 2VK2A 3OLYA 5JNRA 2JBAA 3EAFA 5IC5A 2PL9A 4NICA 1YS6A 3HXMA 1E2BA 3CHYA 5EWMB 4QPJC 3T8YA 4RK0A 4Z9AA 2QSJA 1C0EA 1FFWA 1TVMA 4MLCA 3Q7RA 3KCNA 3RVNA 4W5RA 2HSGA 3SG0A 4EUKA 1C4WA 2CWDA 3LUHA 4YWHA 4LE2A 5JS2A 4FE4A 4P98A 3IPCA 1TM2A 1U0SY 4EY3A 1FFSA 1GCGA 8ABPA 2JVIA 1M5TA 3A0RB 3CZCA 5TQ0B 3TB6A 4RDCA 3LKVA 2MSKA 3ROTA 3EQ2A 2IKSA 1AB6A 4N0QA 5TPZA 3BRSA 2HPHA 3IP5A 4G0PA 1APBA 1NXPA 3IP6A 5KQPA 1VRVA 2QU7A 6ABPA 3LTEA 1YTUA 3BBLA 5IBQA 1PEYA 2JBAB 2NZVG 4KV7A 3CG4A 3MM4A 2H0AA 1JL3A 3RVSA 2FMHA 4W5QA 5F64A 1J56A 4YV7A 4XARA 4TLLB 1PUXA 1NXOA 2FN8A 2WJAA 2X7XA 1VPWA 2NUBA 1GLGA 2IDMA 2P4UA 3BILA 4ZYLA 9ABPA 4JA2A 4RU1A 1KRWA 1P2FA 2ZWMA 3NNNA 2IPAB 2GI4A 3G85A 4DN6A 3KKEA 4N0PA 5TQ2B 1QQAA 1NXXA 3EDCA 4H3HB 4RY0A 1JDNA 1F51E 2JRLA 4L4UA 4G0XA 4NQRA 4RZSA 3HS3A 5CNIA 4RXTA 5KI6A 3ILHA 4Z0NA 5IUKC 3N8IA 4MQEA 3GL9A 1HEYA 3QLTA 3H5TA 4MYRA 5T7BA 4Q6WA 4GPAA 4W5TA 3URMA 2P9HA 3OMXA 4RK5A 3EGCA 2VUHB 1NTRA 5CNJA 3W9SA 1D5WA 2FQWA 3BRQA 1JWLA 4RXMA 4O1HA 4E7PA 2L19A 3RVQA 1DBWA 3I42A 2PUGA 2FVYA 3KYIB 4RXUA 2L17A 4OG2A 4D6YA 5FWYA 3ILYA 4IF4A 4QYMA 2AYZA 4IMIB 2QVGA 4RK4A 1JDPA 2HQOA 3HM9A 3GA5A 1RPJA 2FEWB 3MQ4A 1ZGZA 1ZESA 1E6MA 1P6QA 3DGEC 2F8SA 4Q7EA 1ZY2A 3E61A 3DBIA 2NT4A 5HM6A 2FQXA 5KWSA 3LMKA 3LUKA 5JNUA 1QO0A 2FMIA 4N03A 4MQEB 4NV3A 1JBEA 3LOPA 2JK1A 4Z99A 4KMRA 4EVRA 3IPAA 5JNSA 1U2QA 1DC7A 1U8TA 1ZITA 2HQRA 3KLNA 4IILA 5FBHA 4LDAA 3UUGA 5JS1A 3GYBA 4YR7A 1M5UA 3CS3A 3LUJA 1JF8A 4RK6A 2J48A 3NNDA 4MPTA 1M2EA 1NATA 4RWEA 2L2QA 5FWYB 3JPYA 3RVMA 3D8UA 5B3JC 3MA0A 4FB4A 1Z16A 3GV0A 3OO0A 3M9XA 4KQ9A 1ZHHA 1CHNA 1ZH2A 1YMUA 3QLVA 1D4ZA 3CFYA 2NT3A 3NNSA 5JNVA 3HO1A 4XLTA 3D02A 3RVJA 1LJLA 1DRKA 1VKRA 3NBMA 4YGXB 4W5NA 1DCMA 1DCKA 4KPYA 4XASA 4TN5A 3CU5A 4G0OA 1Z17A 3N6VA 1BDIA 1JYEA 4B09A 3LKBA 1D2AA 2WMYA 1URPA 2QZJA 3H6GA 1D1QA 1W9HA 2FKAA 4ETNA 3H6HA 4RV5A 4EYGA 4ZJPA 4OLBA 3O2SB 4MS4A 3FFWA 3HJFA 4WWHA 1XHFA 4UHJA 4D74A 3OLXA 3QLVC 1DRJA 4D6XA 1YK0A 5TPWA 4KQCA 4S04A 3RVRA 1RZRA 4JP1A 5DLEA 5HSGA 3OQNA 3S99A 4G86A 1U04A 5GQSA 2VUIB 4EYKA 2LP4Y 3CRNA 3UK0A 1NXTA 4RK7A 2A9RA 3GBPA 4RY9A 5DGCA 1JFSA 4ML3A 3F6PA 5IEBA 2MYTA 5D2CA 1Z25A 5C5EA 1D1PA 2O20A 3KSMA 2R48A 5CHYA 1QP4A 1PNTA 1JYFA 1S8NA 1E6KA 1CYEA 2RJNA 1ABFA 3LFTA 2GBPA 2CHEA 1RXIA 3C3KA 1QKKA 1SRRA 5DKFA 4DADA 1QP0A 3C97A 3N0WA 3CNBA 5EWLA 3F73A 4MS4B 3GRCA 3MYYA 3EQZA 2OQRA 4FE7A 1YVUA 1Z18A 4H60A 1I3CA 4P1ZA 4PICA 4PZ0A 5EWJA 3LUCA 4YCSA 3DLHA 2DRIA 3DZDA 4OBBA 1FQWA 4N41A 2F8TA 4LZLA 4KK4A 5TPWB 1MB3A 3O21A 1DZ3A 1ZVVA 1ABEA 1JFVA 1ZN2A 3QEKA 3O2QB 1E6LA 3OO1A 4G0MA 4WUTA 1A04A 1IIBA 1BA2A 2IYNA 3O1JC 4M88A 3IP9A 4F3TA 3SNKA 4KRFA 2MSWA 3LUFA 5PNTA 5JNTA 2R4QA 1QP7A 4IRXA 1EWTA 1DBQA 4KNYA 1DP4A 5FWXA 2CHFA 4G97A 4Z4FA 6CHYA 2PL1A 2NZUG 3KHTA 3O1HB 3GT7A 5CNMA 3A10A 2H3HA 3IDOA 2FQYA 3H5VA 2KYRA 4MR7A 4WZZA 4JOQA 3IP7A 2WB4A 4NCAA 1B00A 1TJYA 1JLKA 1BAPA 2FXIA 4G0ZA 4JB2A 4PEVA 1USGA 4MQFA 4N47A 1L5ZA 5IX8A 5EWJB 2ID7A 2LBPA 5BRAA 1Z13A 3VNBA 4YS6A 4RKRA 1SXHA 3O75A 3MIZA 4O5AA 4EVSA 4DQDA 5TPZD 1NXVA 2YHAA 4F11A 4Z4HA 2FLKA 3Q15C 4QYWA 2N9UA 1FSPA 1KRXA 3HDVA 4MR8A 2PE5A 4KREA 2TMYA 3OLWA 2E4XA 4HYEA 4PYRA 1LBHA 4G0QA 3R0JA 3QLUA 5FWXB 1NXWA 2ZAYA 1Z15A 2GWRA 4F06A 3FFTA 4CBVA 4MR7B 3RVOA 3H1FA 3OMWA 3NHZA 5E3JA 3FDFA 2HJ9A 4MQFB 3H5LA 2Q5CA 3G1WA 3L49A 4HNSA 1WETA 1P6UA 3A3KA 3FGZA 5KC8A 4WT7A 3JPWA 3RVPA 3TD9A 3K9CA 1LJUA 1MAVA 4UHKA 5HKOA 4JB0A 4ZMSA 5TE9A 5TQJA 3QEMA 5BRJA 1ISRA 3N0RA 2PUBA 3CZ5A 4LDZA 3QLUC 4MR8B 2OENG 4XXHA 1K68A 2I6FA 3HSYA 2GX6A 1SXGA 4WXMA 2M1ZA 1JFTA 4Y9TA 3HK2A 3H75A 1ISSA 5DCLA 4G0YA 1YIOA 1QMPA 3KS9A 4F8JA 2PUDA 2IPMA 2WWVD 4IMJB 3F7NA 5C5CA 4RS3A 3HUUA 2JVJA 3CLKA 4EYQA 4OATA 2FTKE 4KZKA 1W25A 3CTPA 5KC9A 2A9OA 2IOYA 1DBPA 3EJWA 3E3MA 1GUBA 3UKJA 2PAFA 4NCBA 1R8JA 3C6QA 3JY6A 3OLZA 4LRQA 3H5IA 4Z4EA 4WXEA 1Z2DA 1A2OA 4MLDA 1UDRA 3TMYA 1DCFA 3JVIA 2XDYA 4ETMA 1SD5A 3I45A 1MB0A 1QO0D 2FW0A 4GNRA 4LE1A 3JTEA 4MGEA 4JASB 3H5OA 1OXBB 1Y1LA 5KQLA 5HQJA 3RVKA 4TMYA 4LX8A 3SY8A 4F12A 4TLMB 1PNRA 3O1IC 4EVQA 5BR1A 2QW1A 1QQBA 5ABPA 2RJOA 5FBKA 3ROFA 3C3WA 1LK0A 2PUAA 3SQNA 2E4WA 3HZHA 1USKA 2GKGA 1KGSA 4MRMA 1OXKB 1ZGGA 2R47A 5GOTA 2PJUA 3H1EA 1ZH4A 3OLVA 4KVFA 2PUCA 4H3KB 3GBVA 3KJXA 1JH9A 1Z12A 2AYXA 1QNLA 3M6MD 2E4YA 3FMVA 2VYCA 3H1GA 3Q9SA 4PE5B 5IUJC 5KQMA 3O2JA 3HCWA 1DC8A 5TQ2A 3K4HA 3MMNA 3BREA 5IEJA 5BQ3A 2MSLA 3QELA 1XWWA 2A9PA 2WY2D 3NHMA 2IPNA 3HV2A 5JNWA 3Q7TA 1GCAA 4OLAA 3MF4A 1U2PA 2FEPA 4MS1A 2PMCA 2RGYA 2QV0A 2QXYA 3HEBA 1NXSA 4MS3A 3KLOA 3N53A 4YO7A 3OQOA 2E4UA 2FMKA 3F6CA 3T6KA 3QX9A 1ZDMA 4W5OA 4MAAA 4ZPJA 1RZRD 2PKXA 4MRMB 3A0UA 3KTOA 3VNAA 4Z4GA 2MYPA 3LUAA 3T95A 3HUTA 1USIA 4YP9A 2JVKA 5EWLB 1PHRA 2YHBA 3I5AA 3T38A 4Z4CA 2MYNA 1EAYA 3N0XA 2QVCA 3LUDA 3I09A 3P9YA 2A9QA 4IGAA 1L5YA 1BVHA 4ETIA 1ZAYA 2R25B 1DG9A 5IUNC 3QELB 1XHEA 3OM1A 4Q6BA 1EWVA 3DGFC 1H9CA 3KG2A 4Z9BA 3H5WA 1YS7A 2CD7A 4HNQA 1M2FA 4MS1B 3SAJA 2HQBA 2IPLA 3B2NA 1NY5A 1BDJA 1LBIA 2JCGA 3N75A 3Q41A 4MS3B 1K66A 1EFAA 1BDHA 5I4CA 2RDMA 3QK7A 1CEYA 1Z26A 2WJWA 3EODA 3TX6A 2WRZA 1PEAA 2QR3A 4XAQA 2FMFA 2BGGA 5T3YA 1YMVA 3HVRA 4OTZA 1JX6A 1JHZA 4N76A 1TMYA 1KMIY 4KFCA 4HNRA 4O1IA 3JVDA 4RK1A 1EWKA 3JS5A 5B3JA 3DLBA 1DJMA 5ED4A 2FEKA 1RXEA 3L6UA 2B1JA 4MR9A 2PUEA 2LPMA 2FLWA 4RKQA 1QPZA 2E4ZA 3LUGA 1AB5A 3KYJB 3OM0A 2M98A 3QX8A 3Q7SA 3TO5A 4ZMRA 4E7OA 2L18A 3GWGA 3RVLA 2PUFA 1EHCA 1T34A 1VLZA 4EYOA 4L85A 1MIHA 3RH0A 2FSPA 2B4AA 7ABPA
chains in the Genus database with same CATH superfamily
3JD3A 1CRWG 1UZLA 4ZYTA 1H1TA 2AFIE 1TUIA 2WSYB 2YHUA 3TI9A 3G23A 2HLPA 1WVMA 2JAUA 2QVLA 4HMQA 3CINA 3WLEA 1NNSA 2HCRA 3UJHA 1ZA2A 1L5VA 1EYZA 3BJZA 1FB5A 2PX8A 3QKIA 3R9IA 3NDPA 3K9GA 1R5BA 5CYGA 4EGAA 2PG3A 3A25A 2O2XA 1U65A 1C29B 1YQQA 4D0LB 3K9BA 2OLJA 3FPGA 3WXBA 1PE0A 2XUPA 3WL8A 4M0CA 5CYOA 4KMSA 3RKUA 3LC7O 4MR9B 3E70C 5G4LA 4BO5A 3AJEA 1CY8A 4YQEA 5KQSA 4ID9A 1L5QA 5GM1A 1XWIA 3VI3B 3PFFA 4IDBA 3QW4B 2ZRNA 1J7JA 2X8BA 1H4TA 2ZTVA 3ENQA 3NJ4A 2OMEA 2A4MA 2WE8A 5F21A 2ID9A 4AG5A 5CDHA 3JSXA 3QI2A 4R1MA 1R6TA 1WU8A 3FSEA 1OBFO 2OR3A 3LHIA 3U4CA 1B73A 1GA4A 2HK6A 5IC5A 3D8TA 2IVFA 2BFCA 1VLHA 2PL9A 4XE5A 5FPTA 5JZVA 4KRYA 2C3MA 5MN6A 4P7JA 4TLDA 5GV7A 1WCIB 1AKMA 1L5RA 2EV9A 1LPAB 3D2CA 4OLHA 1Q44A 5A0VA 3WYBA 2WQ7A 2SCUA 3OZWA 4OHUA 5KMGB 4R1OA 1M1UA 2VUSA 1MO4A 4OU4A 4YWHA 1LGYA 2YXNA 1AZLA 3D31A 3H2GA 2Q7XA 4DJJA 3FLMA 1ZRNA 2JEOA 3QFTA 2RH5A 1PTJC 1U5BA 4JUBA 1ORDA 3R0ZA 4A8JA 5LVAA 5CA1A 5JDIA 4ZOLB 5DWDA 5KTSA 1W46A 2WIBA 3DBLB 1FTSA 1UAGA 1VCOA 2ZB3A 2C94A 3R23A 4IFBA 2C77A 4ZVTA 5CVJA 2Q5FA 1ZIYA 4HVTA 1TFUA 2Y93A 1EFVB 1T8TA 3LTEA 1NQXA 4XRRA 4YASA 5LQRA 5PGMA 2QAJA 4FYJA 5T67A 4EAQA 3NWJA 1DBIA 3F6EX 3QTBA 4O4IB 1EGMB 2XCTB 1G5IA 4KLNA 4EAAA 1F2TB 4NZYA 2X9GA 1IATA 2XI4A 1ZLYA 2GAAA 1F6WA 2OV8A 5IDWA 1C7QA 1PR9A 2PRKA 3ZDRA 5LFAA 3N59A 2X3YA 4ZYLA 3DXXA 3HYSA 1R9NA 3SEAA 4W8OA 3PDWA 1K7EB 2WFZA 4XIGS 5GONA 1SHZA 4LC9A 2I3ZA 2OKGA 4G36A 4F4HA 3MJFA 2VQ3A 1FNSA 2OGWA 4UNSA 5JXIA 1Z4JA 5EINA 2JRLA 4G0XA 5KPDA 2JGKA 5K03A 4NE2A 3WGTA 5CVCA 1IN6A 1VPVA 5FPKA 1FSGA 1UKVY 3AXTA 2FPWA 3D6TB 4FDMA 4TV9A 1M1YB 4NFHA 3NBKA 4CEJB 1M2GA 2V4UA 3CF4G 1TEXA 2W8BA 1EUCA 1E7RA 2GYVA 3AOGA 4H0CA 5JHHB 3BE8A 2PZMA 2DQ4A 3EQ9A 2IOQA 2PUGA 4FYXA 3VO1A 1JWLA 3K8QA 7AT1A 1AG9A 2GF0A 3BEDA 3ET5A 3H05A 3A4TA 5AXAA 1T9DA 3RYHA 4ESVA 3VPDA 3KAJA 2BL4A 4N01A 3ILYA 5C18A 1T0JB 1T10A 3GUHA 3STWA 1RPJA 3ENVA 2YV2A 2WZBA 4U2BA 1LB1B 2ODTX 1Q95A 1IAVA 3MQ4A 2ZFUA 1ZGZA 3QVKA 3UV6A 1NQUA 4D3SA 3X3HA 4R0NA 5CYFA 5AVXA 1DWUA 3I6QA 1T8RA 3TX2A 3VJRA 3L7MA 4Q7EA 1RDFA 4L08A 1XKXA 3RUFA 4EF5A 1SQSA 1NL3A 5F51A 2G77B 3ZBTA 1J07A 1S2MA 2I66A 1QZXA 3NEJA 1EZZA 2GZAA 2QLTA 3OCUA 2IGBA 2FPIB 2WIJA 3O92A 4N03A 1GZ7A 2M9MA 5EJIA 4XGQA 1C0LA 2PWAA 3KWFA 4V1CI 1U2QA 2H1HA 4LHXA 2OHVA 2BFPA 3PFCA 4MVJF 3WVNA 1PQUA 4NV1A 4NMLA 3ABZA 3GQVA 4JC0A 3HJRA 4HATA 2JZNA 4HWTA 5BURA 1B42A 2D4AA 3PUKA 1VCIA 2Q2WA 3DP9A 4R71A 3RFVA 5TT0A 3U4IA 4DDMA 1JQEA 1ZQ9A 2JIQA 4XWKA 1Z06A 2ZRFA 2F1HA 4I1RA 4OD0A 1QZ3A 2FB9A 2ZJ0A 3GV0A 3HA5A 5T41A 2Q7DA 1FFYA 4S2UA 2AVDA 3EOBI 1ZH2A 5EXPA 3L1JA 3GOQA 4CMIA 3DE2X 3GDHA 5JNVA 5D6NA 2YVAA 1QNFA 2BHRA 5CURA 4HNGA 4MGYR 1EHIA 1P62B 4ALLA 1T6NA 2CZCA 4JD5A 4DANA 2VP6A 4BLRA 3CU5A 2WTEA 4ZAGA 1EK1A 1IL0A 1JYEA 4J0CA 5CXXA 2ZIZA 3Q7PA 2ZCJA 1CR2A 3WMGA 1H5NA 4UZEA 3E8SA 2QZJA 3ZVKA 2BZ1A 2RGNC 3AXSA 3NONA 2VWPA 5IMBA 1UANA 3DE1X 4FI3C 1YHZA 3TTSA 1RBQA 1U4NA 4H6WA 4LJ8A 1EZ4A 3FUWA 3GT0A 2HUNA 1YR9A 2ZU6A 1DRJA 2W2KB 2WJPA 3W5HA 5IASA 1B8UA 5J1TB 5GIPE 1KH2A 3MINB 1HQDA 3OQNA 3LQ2A 3QY0A 2C2MA 3KX2A 3LWZA 5DEOA 3BDIA 2VPQA 2FX3A 2JKVA 2ZJ6A 4G5YA 4JHLA 4EA8A 1EWYA 1QBGA 2VSFA 3HBLA 3KUDA 4ZIRB 3R5FA 5EGNA 4NY1A 3CLVA 4E94A 3VNUA 5EOVA 1F60A 2ZUWA 3KB8A 3BJRA 4U4AA 1HE2A 1IULA 1RAAA 2UUOA 4BX8A 5BN5A 4NCKA 2X8JA 1N4AA 4RBNA 3NMUF 1EK2A 1K08A 2WJ3A 1QO9A 4W7IA 4YMWA 3U3MA 4D4GA 3U2QA 4G9EA 3BTVA 4QPNA 1GPH1 3H4IA 3PNVA 2CCJA 2PZAA 3CRQA 4G56A 2P9BA 4I55B 4X8OA 4XPIB 4F46A 5CFMA 2HJVA 2QG4A 1O94D 1UOOA 3I8XA 2HFJA 1Z18A 3I3SR 3LLUA 3WQRA 2Y0PA 4Q3LA 4XX1A 1ORWA 2GEKA 1T6ZA 2O0MA 3IAEA 1J70A 4HSGA 4MI9A 4O29A 1GTL1 1TZCA 3EGDA 4RA9B 3H9UA 4EHKA 3TUZC 1UKEA 3DF7A 4NXMB 3HPRA 3OCVA 1E0DA 4IF6A 1U3TA 3GJ5A 1IXSB 1D9XA 1H05A 1JPVA 4NBTA 2VQFB 2Q6TA 4DLNA 2O2ZA 3ECAA 4RD3A 1I7NA 3VTKA 1RMQA 1T9KA 4QZVA 4F3TA 3TRJA 4F5YA 4MQUA 1RT9A 4XIJA 3UJ3X 4AL4A 3EMKA 5A4IS 4KRFA 1PU2A 3DTVA 5A7FA 1QZZA 4P80A 3GVPA 2C9BA 4YAKA 3LQFA 1XMSA 1FYEA 2FX5A 5C31A 3LXUX 5ADWA 3REOA 2SNIE 2DQYA 2JC3A 3CR7A 5COAA 5AHXA 4AXXA 2QMQA 4BMCA 2R65A 1R9JA 1RP1A 2OO5A 2QPLA 2YWBA 2Z95A 4LV8B 1F48A 4ZD6A 3NFYA 4XRGA 3X1ZA 4IXMA 1HZZC 4G0ZA 3UK1A 2ZVDA 4DUGA 4TZTA 3IE0A 4N3AA 2X41A 3E9QA 3RJTA 3VVCA 4QWWA 4N47A 2OQIA 3CJTA 4BBZA 2EX0A 1RYDA 3GZJA 4K0RA 2HI0A 1FP4B 1QTIA 5LZ9A 1FVOA 2QM7A 3I2FA 1P4GA 5FYDA 1SCQA 2UVPA 2IH2A 1D1TA 5KSYA 4P7BA 3O75A 2I91A 2Z43A 7MHTA 2HEIA 4OK5A 3LX5A 5B4TA 3QVJA 4B3FX 1LPMA 2QNRA 5K0SA 3CUSA 1LDBA 1SUWA 3TEJA 5GVRA 1W5AA 4S1OA 4ND8A 4M54A 2A30A 1QBKC 4H18A 3D0QA 1UMDB 3ZPXA 1RWNA 4QFCA 2ANBA 1LBHA 2PK3A 1D07A 2AG1A 1NXWA 1E79A 1NSYA 1K3FA 2H07A 2OE2A 1H0KA 3JYHA 1DC5A 4NH4A 1S89A 3SC2A 1I6KA 2EWMA 2ZS9A 5A3JA 5HTOA 4LXXA 1II8B 5F9HA 1ZRMA 1FY2A 1M7HA 2PJZA 1WBDA 1V6SA 2XEXA 3E58A 2XKJE 2O0HA 4C7XA 1ICEA 3T1VA 5ALLA 1T5IA 2V1XA 3IBTA 4M21A 1M6HA 2BH9A 4GI7A 4BO7A 1E6UA 1FL9A 3HY6A 2XCQA 3OZFA 4AF8A 4ETWA 4BGDA 3EPHA 3G1WA 3QUQA 2F8LA 1E5XA 4N1AA 3HEMA 1FQKA 3X1DA 5A04A 2ZZNA 1G8KA 2NU6A 3A3KA 3TR6A 4NBWA 3RVPA 1R4MA 3CPJB 2R85A 1YACA 1FMFA 3S55A 1PJSA 4B5LA 4MR8B 3G8AA 1NN1A 2ATIA 3GEHA 1V8PA 2VJQA 3E82A 1U7PA 1ZSYA 2P6UA 4G2NA 1JFTA 1OYOA 4Y9TA 4KWCA 1SBQA 4HMPA 1L1RA 2Z2ZA 4XWYA 2FMTA 2PRJA 5L3RA 4RLSA 1U02A 3TR5A 1Y9DA 4XQ0A 3RIGA 1GQFA 1G20E 1CP2A 3AF3A 2JVJA 1SD1A 2O50A 3OU2A 2OYRA 3GPCA 3ASYA 5J2UA 1P7WA 1C1YA 4JZYA 3C3JA 2I6XA 3WIUA 1U5CA 5CIYA 3A9WA 4W5HA 1U94A 2ZJ4A 4ILEA 3SE0A 1YC2A 3FW1A 3U49A 1KBZA 4QUKA 3H18A 4Y9RA 4PG6A 3GAMA 1A4UA 3DE6X 4IIJA 4AT1A 3REQB 2EBWA 1P74A 2GARA 2YVLA 1UDRA 3AL2A 5FL7A 2WFAA 3JARB 4HWGA 1DCFA 1WMSA 1DMRA 1EKXA 5CDFE 4YI5A 1QVRA 5TEWA 3EF1A 5KTNA 4R2XA 1KDOA 1PT6A 2WU8A 1M6WA 3LW7A 3PQ6A 4XWGA 1QZUA 5HQJA 1HWYA 3LKZA 1XRPA 3UAXA 4GPIB 1BU5A 2NV6A 3KQMA 3OZRA 4PLFA 3MUEA 5CB6A 1KYXA 3D7LA 5ESRA 5KYYB 4NIMA 3RG2A 3SEFA 1UPXA 3HB5X 2X58A 1TA9A 4PLCA 2CLKB 2GXUA 1JNYA 2QSZA 3NEPX 4Q16A 2I8LA 3B3GA 1N5IA 1ZM3A 3H1EA 3Q6NA 4NSNA 4FFVA 3RYIA 1JEYB 3IOYA 1G2PA 3VR5A 2R5NA 3BK1A 4H3KB 5L6LB 1JH9A 1BJTA 4QPZA 4WASA 4P33A 1RZUA 4Q15A 2DVMA 2VO1A 3RABA 3VPSA 1TGYA 4PRYA 5FPPA 2BTOA 3AJ8A 2WOJA 4EPVA 3A1SA 1I1OA 2Q8QA 3BSSA 5JFOA 4UBNA 3T5BA 4DBLE 1NE7A 1Q0LA 4PRKA 1XKQA 1HPLA 3O91A 4H4EA 2J7PA 3TSCA 1SQ5A 3GJQA 2QRUA 2VJMA 3DG9A 4J1NA 1JIUA 1P1CA 4IGKA 3VKGA 5CMLA 4AROA 4Q4DA 4K05A 3FNQA 1GQRA 1XOIA 2ZLBA 3GJTA 5DYTA 5IAAA 1EFUA 3W2GA 1ZKDA 2W58A 1L3BA 2A5LA 3AFMA 2ES4A 1C4KA 1BXRA 2DHDA 3MWYW 4NG5A 4XUCA 4W5OA 1WBBA 3D1JA 4Q18A 3C6YA 5BT9A 5HZKA 1GV0A 1KMCA 4X41A 4OHYA 2O2SA 4P9NA 1CNFA 3FVWA 3L0YA 3AEQB 3ZHVA 1QU3A 3ENWA 3T3EA 5A9RA 2FWMX 2PTHA 5DB4A 2Y1LA 2IYZA 1EMDA 4OGWA 1OYVA 1O58A 1PJZA 1EFHA 3IAUA 3QPWA 4TL8A 3CR3C 1DDIA 3Q3CA 4IG9A 2VHWA 1NVAA 3N0XA 3TUIC 2QVCA 1KEEA 4CM5A 3P9YA 4ECAA 2IXTA 1FW8A 3GK3A 3ZHBA 5K3BA 4YAJA 5HDBB 3JQ9A 5AW0A 1DUVG 5IUNC 1PT8A 2CFOA 3M5WA 3QELB 4BMXA 1PP4A 1WL8A 4XUDA 3STVA 2WT8A 1L1FA 3IO3A 4I8IA 5BPHA 4HHEA 1VL0A 2G0NA 2Y76A 1ADFA 4Q4CA 7GPBA 3PF9A 1BE8A 1MEOA 2YJ3A 5EJ2A 3U7HB 4QYXA 1UODA 1WX1A 2HHAA 1BDJA 3DA8A 1F0PA 4JKIA 4ARCA 3F96A 1Z0IA 1M8FA 4INJA 3CVOA 5B58C 1X9IA 2V45A 2A94A 1D4OA 4PX3A 2IV3A 3WRYA 4XAQA 3KELA 3U9LA 3M33A 3PITA 1HC7A 4WCFB 3GAFA 4P4SB 5AOCA 5K0LA 1ECCA 2VJNA 4UNRA 3B78A 3W5BA 3RUEA 2GESA 3FGOA 2PS3A 3C6KA 1JX6A 5FTWA 2O7QA 3DTVD 2B78A 3DTTA 3OAAA 3PICA 4JLPA 3JRWA 4NJOA 3UGTA 3K9FC 5AJHA 3QOXA 2I2AA 4RK1A 2CFTA 1EWKA 4J29A 2QTZA 3RIMA 2ZIGA 4B3JA 5AVSA 2GYYA 2BZ0A 1MRSA 2AWOA 4LXHA 1YIAA 1S8FA 4YJ3B 3MJ4A 3P9XA 2WAMA 3B6KA 5BUQA 1QQ7A 2JGAA 4J8PA 4B6SA 2FLWA 2CV0A 4XJSA 1H4VB 3I5UA 4DUGD 5CJPA 1BMFD 2B35A 2ZK7A 4YDRA 3LUGA 4XD2A 4XWTA 5BSTA 2BFBA 4N5NA 3R3JA 3UTDA 1BS2A 3T5PA 4HMOA 2X0NA 4ZMRA 1L5SA 2VJYA 2R96A 4IDPA 2ZE8A 4N6OA 4AYXA 3ZDQA 2G80A 1NM5C 4UBMA 4PLHA 4A6XA 4EYOA 2BGLA 4HY3A 2AN3A 2B4AA 1SPBS 3JYNA 3EXHA 3EWNA 4HGYA 2PX5A 1D2MA 4MUMA 1AUVA 1IZ0A 2DKOA 4B3HA 2Z2IA 3LWDA 1R00A 4WNIA 5KVCA 2G9RA 2PY6A 3B6IA 3LPAA 3EXG2 4G85A 2YCLA 5J4VA 5B30A 1H5QA 2IDJA 2JFPA 1RD4A 5EJ9A 3U7RA 1XTQA 3DMNA 4GKAA 4LN1A 4O4LB 2RHLA 3FUXA 4MRVA 1XVIA 2DHQA 2JFZA 5EIAA 5SV2A 2NUAA 3OQVA 1ZOPA 4C05A 1HGXA 2M1XA 1QGUB 4DQKA 1XZNA 3I9V1 1SR8A 3M82A 1K75A 3B53X 1OAAA 3WFZA 1HYBA 2H08A 2LDBA 1GUDA 2HHHB 4DM4A 4EOGA 3RK0A 3TDKA 2IELA 4EW6A 3IAM6 1GUYA 5KYTA 1VRCA 3WIEA 3H2YA 4D99A 1PQYA 2ONCA 4JOCA 1XZDA 2JB9A 1SKQA 3FCCA 3I8OA 3SK0A 1FFXB 4B43A 3EEOA 4WKCA 5MF6A 4XUGB 3FCAA 4AYTA 2FKNA 3BWCA 3OCWA 2EEPA 5AHOA 1MB4A 1NV9A 4FEGA 4D0GA 4YPVA 3DZKA 1VSVA 3SC4A 3T9BA 1G4HA 2P5TB 3MRXA 4U39A 5ELLA 1P4JA 4LDJA 2JLQA 4JBWA 5DSZA 1Z4OA 2J5KA 1C0EA 1PGQA 2ON6A 3AHCA 1H22A 3DZ8A 1Y6JA 2PWYA 8MHTA 1RQ7A 1QG4A 4KRXA 3ORYA 5BXYA 3ETHA 4JU8A 2I3AA 3WSWA 1KAGA 1XMQB 3L8DA 3OJEA 2KS6A 3BSWA 4BUCA 4L0DA 5JSZA 1GR0A 3C4JA 1O97C 3FJOA 5F52A 2ZTHA 4AP6A 3LKVA 4OX9B 1CUEA 3HCDA 2NP7A 1QANA 1RXYA 1WULS 1CY7A 3LFUA 1ODLA 3S2SA 3PHCA 3PXBA 2YY5A 4D1YA 1VB5A 1NXPA 3ZH9B 1PL0A 5K3AA 2GNPA 5FL7D 2IF0A 2ISCA 2OUKA 5DP1A 3K6KA 3L6OO 2NZVG 1EQAA 1SC3A 1U7WA 2BFCB 4MUBA 1E61A 1D09A 4RIHA 4KAAA 1KDZA 3I8SA 1CEQA 4JBYA 3HJUA 1MXHA 3FNRA 3RF7A 1RJ9A 3CF4A 1V3UA 5GJWC 2SCUB 9ABPA 3E9DA 4KMMA 3K0CA 2OV6A 3WZMA 4MPPA 4YRFA 2IPAB 1XN1A 4JUFA 4JI6B 3NCHA 4KUHA 4RY0A 1IN4A 3I05A 4QNMA 4UDXX 3TLCA 1BCSA 2RONA 4KC0A 3CYFA 3EBPA 2R79A 2TRSB 1EQ2A 1U5BB 4CM9A 5AW4A 3R9XA 1ULZA 3NDRA 1T3ZA 2GYUA 3KV1A 5G0TA 3VR5D 1FDVA 3H2KA 4A8JB 5CA1B 5FUQA 4RTKA 3VR5H 4KRGA 5F1YA 1A7JA 3O8DA 3GRZA 5F2KA 4JLWA 2DWCA 5G1OA 2X9NA 1WUKS 2QTHA 3AR2A 4K40A 2BGWA 1WWKA 1XMVA 2ZXFA 4ZKDA 4IJ6A 1GDDA 1II9A 2O06A 4R1SA 3B52X 3W79A 4EITA 2YYAA 2COUA 2FQWA 4RXMA 4O1MA 2FPSA 3I42A 5A4JA 2J7PD 3D8RA 5B57C 2YWXA 4LMAA 5CXSA 4X1IA 1J5XA 3PCRB 3UK2A 5LR6A 4CEJA 2CDAA 2I3DA 2UZ1A 5IKXA 1LSUA 2CXUA 2WWXA 3CBQA 3C98A 2FEWB 3ISVA 4PNHA 1XRMA 3RF6A 4Y30A 2ZJ1A 5GONB 4TTPA 1S02A 3M3DA 1KK0A 4RMHA 2BSQA 4FMDB 1ZUD1 3QQ5A 1W0CA 1YDMA 3QU7A 4IQ4A 3W77A 2IEYA 2JAPA 2CJYA 1M5RA 2IH4A 1Z7WA 2JHPA 1ULSA 5HMMA 5CGZA 5C8VA 2WDPA 3W2TA 3EXFA 3IIJA 3B9BA 5JNUA 1BC5A 4M22A 4OHFA 4LWQA 4TV9B 1BROA 1CZNA 2GO7A 1KVUA 2I22A 2W8BB 3OH8A 1EUCB 1CUHA 4UATA 1GAEO 1L5WA 2GTIA 3GYBA 4FNMA 1M5UA 3T9AA 1Z35A 1DPFA 4NATA 4KU4A 4ALKA 4GBJA 4RGBA 4YYZA 2CXPA 3LLSA 2HMVA 4UULA 3KOUA 2KLHA 1AMUA 1YT5A 1POXA 4KVGA 1IC6A 1WXXA 1NMYA 1VMKA 1OFVA 2BI7A 1JG2A 3BL5A 4KPGA 4OJTA 4YRGA 4ZVKA 5EXSA 4ZI5A 3W5SA 4ZCRA 3KQLA 1NYTA 3X1XA 3FR8A 4J0DA 2P7IA 2YS6A 3NH6A 3U4HA 5JY6A 5L45A 4UU0A 2OAQ1 1SOUA 4TMZA 5JD5A 1PGJA 3IIIA 1DCMA 1DCKA 3MZ0A 4PQEA 5IRCD 2AQ8A 1SUAA 1RBYA 1COWA 2H2IA 3JVUA 4OI4A 1G8MA 2J0UA 4WINA 3DVLA 4EG0A 4B09A 4E5NA 3OAAD 3WWZA 2WMYA 4FWTA 1UKZA 1ZL2A 3TIIA 2VR1A 4YC7A 1JFRA 2IYTA 4IPTA 1DBVO 4Q3DA 3HVIA 4BQNA 1ZQ1A 2BEUA 5KVVA 2NZ2A 4OQNA 3W6NA 4FBLA 3DFIA 4FSXA 1UF9A 4MS4A 1AJEA 1CUWA 1ADBA 1LZLA 2GZ3A 3CJQA 2ZU0C 3LGSA 3OZEA 2JGEA 2NZ8A 3MB8A 3K92A 4F9FA 5A05A 4MW4A 3E9RA 1C9EA 2IYPA 4JGGA 3VYUB 1I94B 3TSAA 2ZUFA 2A7XA 3ON5A 5FAXA 1FJHA 1DX4A 2HCBA 3G0OA 5HF9A 5B1YA 4ZXPA 3E3LA 5EIBD 1HTWA 1RPNA 2JZOA 2LP4Y 4CMIB 3DPSA 1OASA 3FSGA 4K9MA 4A73A 4Q82A 1U6IA 1MJ5A 2HHCA 2Y9MB 4YJ2F 3F6PA 4X9XA 2COKA 5AK4A 1Z25A 4G1UC 3WGIA 4GX1A 4L5BA 3DL0A 3G2MA 4IJWA 2CLDX 3N7UA 4UEWA 4DIDA 4FHFA 4WNAA 4Y2GA 2NU8A 1CRPA 2PQ0A 2Z1DA 3QXHA 1EVLA 1VMAA 4PQRA 3ZYCA 3HBNA 4DRXA 5JSHA 4PXYA 5ER6A 5LD2C 5ICSA 4O8ZA 4PPGA 3QFRA 2JJ1A 4MYHA 5D5QA 2X0EA 4GWKA 2JFGA 2VSYA 1YVPA 1RI4A 2J9ZB 3PGA1 3TXAA 4E5MA 1ZMBA 4Q48A 3AVXA 2PFSA 4KXUA 3PA6A 5F77A 1DZ3A 3WSTA 3AWDA 1ZN2A 3LE8A 4IYRA 3O2QB 4XGRA 3LIIA 3GELA 2Y77A 4XR9A 3M1YA 1FLAA 3RIYA 2YKGA 2AEMA 3K35A 3LUFA 1E5TA 4JS0A 5BYJA 1DHRA 4KYVA 1Y8RA 4IRXA 4II3A 4UU8A 2J32A 4XX0A 3ZWWA 4TKZA 3IJPA 4FS8A 1ZOOA 2CL5A 2PVCA 2BFAA 2G82A 3PU6A 3SHVA 2XBLA 4W8GA 5BN5B 2X8JB 4X8MA 4EB8A 4FGLA 2HCJB 3LK6A 4EW1A 2WTAA 1NW7A 1BFKA 2EVWX 3DQZA 4KO3S 4COKA 3EPLA 3LSYA 3AUXA 3H3XA 3E27A 3LY8A 3NHJA 3O0TA 3QOYA 2HU2A 1NI4A 3HACA 4MQFA 4CI9A 3EB9A 4V0SA 1KS2A 2YNMA 5DNVA 1TD9A 1NPYA 4DSTA 1JQKA 3R0QA 3EGDB 4OLFA 3RROA 2VJDA 3GD7A 2ZRHA 4V1CB 2AOTA 2L82A 4X1YA 1XMJA 2Q5OA 2Q4TA 3PPIA 4RJLA 4B3XA 3KUXA 1BCRA 1Q22A 2Y1WA 1MXFA 4ZQBA 1YJ5A 1MRNA 4BX2A 3GGDA 4IX1A 4B7AA 3VR2D 1QKIA 4J7UA 3PUHA 5IM5A 2YFQA 2Q6OA 1JDBB 3WRXA 5KOHA 1ONNA 5A4AA 1NRWA 3U3DA 1W8DA 4EKDA 2A0UA 2LKDA 4P54A 4HBZA 3UW3A 4GE0A 3K0BA 4C4PA 4MQ5A 2WD8A 4OQYA 1JZQA 3CF6R 4E08A 2CL7X 4CV1A 1Z8HA 2A59A 4IV5A 1NC1A 5EP4A 2W7TA 3UB2A 3OMWA 1ODCA 2JRCA 2RB5A 5AH0A 3ANYB 4JVMA 4RKWA 4HAYA 3CPHA 2YRWA 1U0BB 4G4SO 3IPLA 2O2HA 4CM9D 1CXZA 2Y3IA 4C08A 1C41A 3V6LA 2YW9A 3QBJA 4IAOA 1QFSA 5TE9A 3TNDA 3B6ZA 2PUBA 1Q7RA 1AV7A 3GUUA 3R5JA 4F56A 3KCQA 2OHGA 2GBFA 4BJ5A 3I01A 2XNJA 3KKLA 4ND8B 5AVVA 4UMDA 3K9WA 1AXGA 1PV2A 3NVAA 2QD3A 4FIDA 4ZV4A 3H5RA 3BL8A 4BPRA 2MSEB 3KS9A 2A8YA 4NK5A 2OXIA 3N5KA 3SC2B 4Q93A 2VJBA 3MJRA 3N7TA 1XALA 4ND4A 5BQXA 4BQQA 2OYSA 2YRFA 3E3NA 2ADMA 3OD1A 2JI4A 4JI7B 1AS0A 1JKXA 1W25A 3GNQA 4LSMA 2D1FA 1GD1O 5GGYA 3THSA 3U4GA 3JVEA 4X8HA 3GRYA 5J47A 2GZ2A 1ISPA 3HTXA 4AN1A 3JASA 2H5EA 3OPNA 4GECA 4KITB 4A1OA 3I9MA 5AVRA 1SC1A 1H5UA 3GCZA 3O4GA 4AB1A 1OX4A 3NWEA 4GKJB 1R4MB 3T4XA 1MB0A 3SJCA 4IIYA 2X77A 1V16A 2YX1A 4HYTA 1VHQA 1YFZA 3U7FB 3K2QA 2JHGA 2JGFA 4EY5A 3KL4A 4CLRA 3L6CA 3SXJA 4EHHA 1DXYA 5EMHA 1E7MA 1CUIA 1PNRA 3L7YA 3SX4A 4DMHA 3TZ6A 1VGQA 1YAHA 4EP1A 2E49A 4IP0A 1D6SA 3AUAA 4NCIA 3IQEA 3OCXA 3JWIA 4JITA 2H57A 3NZEA 5DBOA 2Z4SA 3VNSA 4GPZA 1CY6A 4XDZA 3WV4A 1OXKB 3VYVA 2PJRA 1QGZA 4MPDA 4FYIA 3WP0A 4BRWA 1NQAO 2DUWA 3OLVA 3TM4A 1O2DA 2ZIVB 4NCXA 4RTQA 2J6HA 2F43A 3I9JA 2CDCA 2R1ZA 4NESA 5DI9A 4US2R 1HRDA 4FR5A 4R16A 3KXIA 5JQGA 4FUQA 2OB2A 3L0BA 1XVUA 4Y67A 3GW8A 4C3UA 4U6QA 1COWD 2J0SA 4G0WA 2XUOA 5A02A 2E6KA 3S2EA 2OCBA 4ZK2A 1YR1A 3ZUPA 5K6TA 3EVDA 2QN8A 3DM9B 5DLDA 3D4NA 2QVXX 4HX2A 1N2BA 1XWWA 4E15A 3S2GA 2BE9A 4FCTA 4HK4A 3FY4A 1KR2A 3L01A 1MO3A 5DE3A 1I1NA 1NZDA 5F1PA 4X6LA 1RCTE 4CMBA 1LV8A 3Q8WA 4A2QA 2OESA 3UMRA 1IRXA 4BBPA 4MS3A 3WLHA 4RSGA 1JEDA 2CWWA 1GPAA 1N1DA 1LXCA 3DFFA 1QHEA 2GFHA 4MAAA 4B4DA 5G3YA 5CDUA 3H4VA 2FW8A 3Q88A 4AJLA 2PKXA 1S9DA 4KE6A 3CY6A 3IIMA 3H2ZA 3KSZO 1YR3A 3AR7A 4Z8XA 1C9YA 3KO8A 3PA8A 1ZA1A 1DWQA 3HR7A 3FSGD 3DE5X 3RYIB 2Q1XA 1USIA 3NJ8A 1E9FA 3N3BC 3ESBA 3TG8A 3F78A 1I1QB 1PFUA 3Q3EA 1T6BY 5L6MB 3P9QA 1PKXA 4BP1A 5CDSA 1RJFA 1GFZA 5FKJA 3WWDA 1VE7A 1XXHA 1NRXA 2ACVA 1CCWA 2EL9A 1ZMRA 2VNSA 3O26A 4KLRA 3ZS8A 4GPTA 3U6KA 2BTQA 1JDJA 4K46A 4UJ3A 5AKYA 5LXTF 5GTDA 3ZV6A 1IBKB 3ITKA 1NVEA 2R2GA 3TNYA 1H9CA 4NRDA 2VJMB 1E3LA 4ZU6X 2JJ1D 1WKVA 2XA9A 3OKAA 2YN4A 3WTBA 5I7FA 3QEBZ 3AJRA 3WGUA 1FW6A 3IDAA 3G59A 5TNXA 2I9KA 4PQYA 2Q9AA 3KVRA 5BSWA 1BXRB 4NBVA 1KZ9A 4PGFA 3AUUA 1CEYA 5D8DA 4WK4B 2WRZA 3CNHA 4REQB 2PWZA 2IOFK 2FMFA 3ZXXA 4WFKA 4CQNA 4DQXA 2YYSA 3QBVA 3L0ZA 4QT0A 2QE7A 2G4CA 2RB4A 4BNKA 4Z9XA 4EBBA 3PRJA 2O8FA 1HEUA 2I6GA 4NS4A 1TMYA 5EPUA 5ALGA 3B5EA 1PLLA 2IUEA 1KEEB 3WIBA 4AJEA 4N5IX 5IN4A 1USWA 3ZE6A 2QIPA 1KYZA 1RAEA 3FLBA 3L6UA 3AU9A 4EATA 1CJMA 2CLIB 2LPMA 1DKNA 1E2NA 3BHMA 2C04A 4OA8A 4DMKA 5MN4A 3LGXA 3ZDAA 3UK6A 4OH7A 3PIDA 3RFXA 2OK8A 1RYEA 3S2IA 2JGNA 1AB5A 1RE0A 2RGEA 4O6VA 4QYSA 4KLCA 2ZYWX 3VYRB 3WYDA 2BGTA 2RI6A 4BMVA 2FSVC 2C5LA 5ER9A 1CY4A 4DBVO 1SQ6A 3RS8A 1UL1X 4OM8A 3T7SA 2FFHA 1DTEA 1OU0A 3A11A 1BWPA 1W19A 1R15A 3C1OA 2FSPA 4HAUA 3RH0A 3SHOA 5BV8A 3PC6A 3F46A 4DV1B 2E82A 4ZVSA 1WA5A 2GHTA 2QYHA 2R66A 3FTNA 2A92A 4EGSA 3GJRA 5DYGA 4S05A 2A1UA 4MYUA 2VNHA 4RHYA 3V48A 1I51A 4M1QA 1OGYA 2ID4A 3KTFA 1ESZA 1JAZA 3QU2A 4JODA 3ZU2A 1P4SA 4B35A 4KI7A 2QW8A 3ZU5A 2ZSDA 5I3CA 1M1XB 2JANA 4NAUA 4AMBA 1JEAA 3FFXA 4KPEC 1UBEA 1TTHA 2PT9A 3DOEA 3FTFA 2CFCA 1AM4D 4OL0A 3CKMA 2HU8A 2Z6UA 1O5OA 1WZIA 3RHZA 2V74B 1X3SA 2ILTA 2MSDB 2RHMA 4UHFA 3GF4A 4K87A 3SPXA 1LVUA 4E5UA 1U0JA 2AI2A 2I6UA 5AXDA 1E96A 1GLNA 1T5HX 1YB6A 2RHDA 1OZGA 3A6GA 3OCYA 5NULA 1JTVA 4UPDA 3K1JA 4CKEA 3EXHB 3SMVA 4AMYA 1TRHA 4FONA 1YS6A 4NICA 1IU9A 4HS4A 1CPYA 3NANA 5I5EA 3PEEA 4HVAA 3T7IA 1LY1A 2EQAA 1PW7A 1NSTA 1Q7EA 1Z0ZA 2OT3B 3DVAA 3JWEA 3L9WA 5TS2A 3RSCA 3W1VA 5LMUB 2LIPA 1TECE 3KCNA 2XNDD 4MV9A 5AI9A 3GVIA 1D5CA 2WQZA 3AKYA 5C34B 2ZAMA 3BXFA 2NUAB 3VC2A 3Q7EA 3NYWA 4EY3A 1FFSA 3UMMA 1ODSA 1MH1A 2C3OA 1PWXA 3ELUA 3MJVA 2G83A 2ZUBA 4LSZA 4YQFA 3ME5A 2MSKA 2GCEA 1A8PA 1C14A 1XAHA 2O57A 1ZUIA 5DTJA 5TB5A 2F8MA 1JXQA 1M7BA 4G8BA 4DV3B 4KW7A 2P9CA 3FZEA 3NBYC 3D6HA 4N18A 5DHQA 2NTEA 4CM8A 5LUAA 5TIIA 2C4HA 3N8HA 1CQWA 4KV7A 4LOLA 1UCFA 3TDMA 1YF3A 2J6CA 2QP9X 3AESA 1WCWA 4DPMA 2NO0A 3G82C 2YH2A 3SQLA 1Z5NA 5DGXA 3SFVA 1QFYA 1NQTA 2VYNA 3JQEA 3HYCA 1GLGA 1SD2A 4PHHA 3N2EA 3QVGA 4TM7A 4D81A 1ND5A 3GFTA 3DVSX 1M0TA 2H7YA 2XTAA 1OAOA 5FR2A 3KKEA 3THXA 1C8BA 4D0RA 3L5OA 4KDEA 1XQ1A 4QHYA 5CFNA 5JCOC 3NHRA 3OZDA 4BVAA 4YLYA 1UM9A 2I4NA 3D6UA 1YR8A 4FFRA 2Q07A 3OBIA 3HS3A 1OW3B 1I9CA 4M9UA 4UZSA 1Z0FA 1BO6A 2WIGA 4V24A 4Y0VA 1IY9A 1I2CA 1SCKA 2H1RA 2GPBA 5AWFC 1DBSA 1HEYA 2QRLA 1GQQA 3FWZA 5AW2A 1DKMA 3ESDA 2TMKA 3F6YA 3FAKA 1AKTA 4GPAA 1X6VA 3P2OA 5AM0A 4CN8A 3WK9A 3ZD6A 4D92A 1PT5A 5BVHB 3IHWA 3ZWYA 1JAHA 3BRQA 1RAGA 2H2FA 4HH0A 1DBWA 4X00A 4NH0A 3U13A 2HMSA 4GR5A 4IDAA 2D0DA 5TJ9A 2L17A 3EXIA 4C5CA 4EI8A 1YOVA 1WAMA 3ZXUB 1SOVA 3CUUA 1RJ9B 4IMIB 1R0RE 1SUSA 3F71A 4IGEA 4RPIA 3ZJYA 3HYLA 3ZR4B 4AJ1A 1YKSA 4S35A 5HZHA 2W6QA 4K9LA 1WP9A 4RPLA 4S24A 3TZKA 3V8MA 1J21A 3GB9A 1CFJA 1BVYF 1BCSB 4FDTA 4HWOA 2IEAA 4A10A 4XI9A 5BYKA 3RYFA 1DTSA 2NW6A 2D5CA 4KBGA 4XTRA 3GJSA 4DYHA 3LCRA 3M34A 2BCJQ 2FW6A 2GZRA 3K53A 2CYCA 3QVWA 2BMEA 4TQGA 3VU9A 1KQFA 1CF2O 4NV3A 3VOBA 3ST7A 3R7SA 1Z8FA 4UNQA 1QGED 4X3PA 3UXHA 2ZAOA 5FBHA 4DDKA 3KLNA 3UUGA 1RVDA 3GLFE 1ZK4A 1R6XA 3U4AA 1AKUA 3ZJ5A 4C0LA 4X64B 4ZAYA 4YACA 2BMWA 3Q3IA 4LHSA 3HLTA 1V8DA 1DADA 2RSLA 4C6TA 1O0CA 3TMKA 4X1IB 2C29D 2DETA 1Z16A 2VJLA 3ZI0A 4KMOA 1IPHA 1U0TA 2NSYA 1F6DA 1SRQA 2UZ1B 2Y1EA 4CGYA 2WV9A 3RC9A 1L0BA 1T5DX 1W96A 1T4DA 1H1LA 1S2NA 2O6LA 4IUBS 3PHIA 4BIIA 4NMWA 2QNBA 4XFJA 4ZYUA 1SKYB 4MWDA 1VKRA 3NQ41 4YGXB 2X8AA 3BMXA 5BR4A 1BZYA 2HSDA 2IBTA 1A7KA 1NJGA 3A04A 1TYZA 4ITVA 1E99A 2QE7D 4WK0B 4JYMA 2IQ5A 1UAYA 4J0FA 3VYSB 3EXFB 1IN7A 2MMGA 3IC5A 3H6GA 1OX5A 3KAQA 3S0JA 3X1JA 3RS0A 5A9SA 3G8CA 5BNFA 1DLIA 5FNVF 3TIGA 1I0ZA 1XHFA 3F2VA 4JT4A 4DIEA 2G1PA 3D8BA 1USUA 2UKDA 1A9ZA 4GH5A 1ZUWA 2KQUA 5TPWA 1ZW6A 2DGDA 3OP1A 2D4HA 1AS2A 4A0RA 1NW8A 3G7SA 2IZOA 3I23A 1H2FA 2WSIA 3SQWA 2IXFA 2PMWB 2GA9A 4K86A 4Q9NA 4AWAA 5CG2A 4JL6A 5L9AA 2N42A 2DLNA 1NXTA 3UK0A 3TGPA 2OZLA 3P0RA 5J5CA 3KYDB 1U5AA 1XL1A 2P1DA 3T1YB 3GVXA 3LF1A 4HQLA 3KPWA 5BNWA 2B99A 2J0UB 1RXWA 5EPOA 5B5SA 4FOSA 4BV3A 1NPTO 2HRQA 4ZODA 1ABFA 1NVMB 2ZIFA 1ULUA 2DB3A 1CJUC 1Z5VA 2RJ3A 1XNHA 2VDKB 2DT5A 2BEUB 4XYMA 4MS4B 2PO7A 4YUVA 2YWRA 1KZ1A 1AKNA 5DN6A 1U8FO 3RWBA 2H48A 5DW3A 3DZDA 1O0BA 2V7WA 5AOVA 2C96A 2Q62A 2XIQA 1ZK2A 4F71A 1ZVVA 3H8JA 3QUSA 4QREA 2JARA 2OGTA 4G4IA 3AHGA 1KO7A 1G5QA 2A5GA 1MEEA 3NIBA 1N9ZA 4MX8A 4E07A 4QEKA 1AZWA 1QYCA 1J2JA 1V71A 4KGZA 3TPCA 3BUSA 3R3HA 4A6EA 1PVVA 3ZX4A 3UUEA 1C4OA 1V95A 3ITNA 5DCYA 3BXOA 5CLJA 4V2UA 2PV0A 3DWIA 5DSXA 3T4PA 4V0KA 2UXCB 2CHFA 1GJRA 4CV0A 2G63A 1VXOA 4AK9A 2Q27A 2QTWB 1ISJA 3EG9A 4AULA 2Z1MA 4FOOA 4WNAB 1VE1A 4XJXA 2P3SA 2NU8B 5MHTA 3H5VA 3E3AA 4XKJA 4UCWA 4CNQA 4DRXB 4NCAA 1VFPA 4QXAA 1CJBA 3OZGA 2B8TA 1NN0A 2NQ8A 4PZUA 1NTOA 4B3DA 1Q11A 4QQ8A 4EQ6A 2I3GA 5A62A 3AHIA 3M4ZA 5KHAA 1EHYA 1VRWA 1SHTX 2G0AA 2DCUA 1YVEI 2GEDA 4N12A 3TQCA 5J23A 4F8EA 4IZOA 5C81A 1JKFA 2AZDA 2BYTA 3IOBA 4J1SA 2G07A 1C30A 5FTLA 3NH9A 1LKZA 1U2GC 1N77A 2EGHA 4J4TA 3TBKA 2GWHA 3SC3A 1K7XB 4MIYA 3SSOA 3WFIA 4D8UA 4NHEA 5ITZA 2H1VA 3RYTC 2HRZA 3MNFA 4XX0B 4PO9A 3ZWKA 4D9BA 4BY9E 4M0DA 4R2IA 3DE4X 1AHPA 2XAAA 2OBBA 4MQ6A 3CUWA 1P80A 2HR1A 3T99A 1I4TD 4RKFA 2XBMA 2GWRA 4G1VA 4PZ9A 4TSFA 2VYND 4F06A 3WLKX 1FEZA 4HN2A 1K7YA 4NU0A 4AJHA 3QU9A 3H1FA 2OC9A 4HO1X 4DWOA 1NNLA 5HIMA 1NI4B 4MQFB 3ZCRA 5FOVA 3WNDA 1BRMA 3UF0A 4R6XA 2G1JA 3SKYA 2O48X 2QX4A 3MXOA 2AOTB 3LP5A 4X1YB 4W99A 1UDXA 3G89A 1MAVA 3U19A 1Z08A 4IICA 4KSBA 3SEQA 5BRJA 3A2LA 1N36B 1JG3A 1CZHA 1MJGA 1BCRB 2O5RA 3TCNA 3EDQA 5I8ZA 1YQXA 2OGZA 2A0YA 4GOJA 4JSRA 5HS4A 1MOQA 1XE3A 3EPRA 4B44A 2WU0A 4L75A 3TS1A 4CE6A 1T1RA 2JHAA 2VAVA 3M8KA 2XODA 4JP2A 2OBMA 2QRJA 2XCUA 4XIYA 5KOHB 3CIOA 4ARVA 2JJ2A 1FXWA 5K4HA 2EKQA 1CB7A 3ORRA 4P7GA 1B2LA 1NJFA 5K05A 5LNK6 1UMCB 3BFKA 2Q5JA 2KI5A 3F7NA 3VZPA 1ACLA 1HBJA 5CB8A 1VSUA 4I50F 4LRTB 4I9UA 4BV9A 1MMFB 3FUUA 3TLEA 1OZAA 1ULAA 1ZNYA 1HDXA 4ZZ0A 2Q2NA 1MJFA 1L7MA 1DBPA 1DINA 3EJWA 2WM2A 4NTZA 3RK1A 3FUTA 5CX4A 1FFBA 2GM5A 2DPGA 3ZDXB 4UAVA 4GL2A 1Z2CA 1ENZA 2FX2A 1I6WA 3HJFA 1J39A 2GS9A 3K7EA 4BWVA 2AE1A 2JLRA 1AN0A 1J09A 2QUAA 4C6RA 1SCUA 4HWSA 1FPMA 2CK3D 4JASB 2W83A 3H5OA 1LRLA 4QOSA 3R8CA 4D4LA 3UPTA 4R0VA 1QOZA 1X1CA 3OEYA 4UHDA 2QTAA 4CF5A 2WABA 4MV4A 1T2AA 4DV4B 4JA0A 1UPFA 2DUMA 3EPPA 2QW1A 3NC1C 1C7RA 1PTJA 1ZC3A 2P2YA 2Y99A 2QSYA 1X1DA 3P26A 3QFFA 4I4IA 4M8NE 3C3WA 1RBZA 1S7CA 2ZBDA 4DCTA 2WG0A 4DMFA 1M2HA 1N2GA 1TF5A 1YQDA 1ZGGA 2D2EA 2J5RA 1D03A 4Z53A 5IARA 4WZAA 2XBUA 4FFBA 3ANLA 3D6MA 4GFDA 4L4YA 1B7GO 1R6UA 1U11A 1QORA 4QXMA 2Q4DA 5C7IO 3B9RA 1R9MA 3JASB 4O2RA 3FPFA 3EPKA 2EQ5A 1TMGE 2J87A 4EG1A 5CDGA 4AG6A 4FR2A 4DCSA 4F9GA 3GLIA 3BREA 2FZEA 4QUBA 1OX4B 4W6ZA 4ENRA 1XZIA 3DBHB 3UJCA 3LX4A 3ID6C 1ND6A 2HCFA 1TJ3A 1V16B 3KDAA 3AW8A 4FWIB 1JV2B 4G25A 3M3HA 4MQBA 4B4UA 2W4MA 5BNZA 1PZFA 1JBQA 3OTHA 3SVLA 1Q0ZA 2N1MA 3DTNA 3IELA 3QX9A 4HSEA 4LOAA 4M7RA 1MVLA 3D5TA 3KLMX 1RXSA 4RV4A 1PVOA 2Y71A 3G2HA 4RZQA 1A1VA 4W8HA 4F4IA 5KBYA 5I7HA 1MGPA 4WOBA 5JS8A 1P0IA 1GAWA 3NU1A 1XCPA 3FHOA 1NA5A 5AVQA 1J1IA 3ONWA 1KNXA 3J7TA 1OH6A 1WSBA 2F43B 4P32A 2QGFA 1WNFA 4BFTA 3U4MA 5FI3A 1KS9A 1B6SA 3IMEA 1JAXA 2VZEA 4W7HA 5AJTA 3TBHA 4EELA 4W9RA 1L9XA 1Y1TA 2OVBA 3A9VA 3SBDA 3T0IA 2JDID 5GADl 1JN0A 5DOVA 4C43A 3PXGA 5I9TA 2NWQA 2DKNA 3DEJA 4B7ZA 5ITWA 3DUWA 2C3YA 4FNAA 2B37A 4UE2A 2GPWA 4HRXA 3UAOA 1ZI8A 1RLMA 3AM4A 4M7PA 2KJQA 3R5KA 3NXSA 5DN6D 4IM7A 3CLUD 3P0HA 4IIVA 1LBIA 4MS3B 3GLHE 1YZ3A 3SE7A 2E4AA 4MB2A 1TUBA 2ZE6A 3W5UA 1DIAA 4UBOA 1KI3A 3N6RA 4KDRA 2QUZA 2O8CA 1PEAA 1NC3A 2ADOA 2WHQA 3AIIA 2WJIA 2HY7A 1BQ3A 4KIJA 5KCMA 3EIUA 4Y6PA 3IUYA 4H7EA 1Z34A 4JLNA 2GK6A 4CRWB 4BMDA 1M9NA 5DHRA 5FA5A 2D6FA 1P75A 1K3TA 1WZUA 2GD0A 3RJ9A 3UV3A 2LCFA 3IAS1 2X2FA 3JVDA 2PRZA 1NVTA 4V0MA 2EC5A 2WA1A 1XXHB 1GNLA 3P27A 4D7AA 1E77A 1G17A 5FBWB 5T4BA 3F5MA 3PLAE 3WKCA 2BTQB 1L7BA 3MELA 4IVQA 4Q47A 5B7NA 3WRVA 2ZJOA 2PH7A 4ENQA 1MGOA 2WILA 1DJNA 721PA 3MSXA 2IHTA 4UTRA 3QKSA 1ZP6A 2D8AA 2LVBA 5FHQA 4HUQA 2WU1A 4CIXA 3EMBA 3A6LA 3Q4GA 4AVYA 2IP4A 4CHGA 2D0IA 3ZJVA 4WBNA 1RIIA 1NQ5A 3DONA 2F1IA 2UVDA 1N3LA 4EPTA 4MEJA 2RGNA 2YW2A 4MB6A 4XWAA 2EX4A 5DXFA 5KHLB 4ABTA 2BKLA 5B3AA 5EWMA 2I4TA 1EUYA 2B30A 3CBGA 1KSGA 3SM3A 4BVFA 2NZWA 1PL6A 3E3OA 3GFSA 5JS6A 3D3JA 3Q3HA 3N9IA 4D43A 4HAWA 4E3ZA 1OTXA 4I9HA 4U1RA 3ZCUA 4EARA 5C7OO 2GT1A 3JYQA 5EP2A 1LFAA 1WTAA 2QUIA 4TSFD 4IDCA 3RIHA 3MWGA 3SM9A 5LYJA 1EEXB 4BLSA 3U17A 4DWVA 2H52A 3QEMB 5K8UA 2GBCA 3V2UA 3QXCA 2ZTUA 3ZWQA 4BNZA 1YU9A 3QIVA 2HWXA 1GFSA 5DTEA 2DWOA 4YT2A 2CBXA 2P2DA 1NNUA 1PJ3A 4TRRA 2PKYX 5AHWA 5KDOA 2D2XA 3O74A 3BGOS 3ZDFA 1TD1A 1GP2A 3EAQA 1J1ZA 2OBNA 3EAFA 3QHPA 2P6PA 3OQBA 4BMOB 3BQNB 1L7OA 1N2EA 2JBHA 1G0NA 1Q7CA 3EARA 4QDUA 4OFWA 3HXMA 3IMCA 3N8KA 4BMZA 1FYFA 3EH2A 1U8AA 3T1HB 4HZUA 1J6UA 4MP6A 3DZFA 2A1UB 2NQTA 2ZUTA 5INTA 4EMBA 3DMFA 1P5RA 2JJ2D 4CI0B 4BZWA 3SIRA 4F8YA 5J2UF 4RZ3A 1Q83A 5JC1A 3R4VA 1ES9A 4BX9A 2YQZA 3QKTA 4HP8A 2H9YA 3PQ4A 4OQLA 5LBTA 4BZQA 3BIJA 4LXGA 4IIJF 4PPQA 1SG6A 3RAPR 2JI6A 2IKSA 1AB6A 2B9VA 1PAUA 4K8RB 2OCIA 1XMXA 2CMFA 4GS5A 2F6RA 3EVBA 5F5LA 2GM9A 2RG7A 1X42A 3D8NA 1M67A 4ASUD 1OLUB 2FPKA 4NVRA 4C88A 5KSOA 4CKEB 3DQQA 1Y4ZA 1H6DA 2VEOA 4JBLA 4Y6QA 1A4XA 3WV5A 4RTRA 4W5QA 4IJKA 3NORA 3NP9A 4XSGA 1HZZA 3CQ9A 4PYJA 3FJYA 1XZKA 3K8YA 1M2OA 2FN8A 5JWHA 3FPAA 5L8VA 1RPZA 1TEVA 3ZNQA 2A5FA 5TMEA 1JE0A 3DDNA 3DVAB 3W9YA 3BGSA 3GGJA 4NWIA 4YHHB 3E2IA 3OOSA 1VCNA 4LCJA 4ZEMA 2VXOA 4ZJYA 2A4KA 1JDNA 1G3MA 4MEBA 3JQ8B 4R9NA 4WOCA 1UBOS 4U02A 1H1DA 2W98A 3BBPA 4FYVA 1RQLA 4WPGA 1P9NA 2EZTA 1U8EA 3IQZA 4TYQA 3U7JA 2H1LA 4L51A 2YV1A 2X0JA 4WNYA 5AJXA 1FMCA 1ADCA 5J59A 1JHRA 3ORSA 3GUCA 4X94A 5FEMA 4DLZA 1UPCA 4M1ZA 2KHZA 3N6XA 1OZHA 3EA5A 3NCTA 1A1SA 1VHWA 1Y81A 3G6WA 4DLVA 1O96B 1P1KA 1VGVA 2I2FA 2J33A 3AESB 4Y3UA 4CFYA 2FVYA 1B8PA 2P78A 4L57A 4RD1A 1JTEA 2VZ0A 4OG2A 4TMVA 4WHMA 5DI3A 5K0ZA 3F9IA 4IHJF 5LZ8A 2AYZA 2QQ0A 3T7EA 2ZWIA 3QVGB 3RIEA 3G9UA 1WPXA 1U3DA 4AUKA 4NU5A 4MGZR 3OFSA 2VP2A 4K6CA 3NT4A 1MNQA 5ESXA 4BO3A 1C0PA 2G7MC 1FU7A 1RC1A 2Q49A 1PFGA 1UM9B 1J4AA 3OY2A 1XU9A 1ZY2A 3QITA 2C3PA 3M0EA 4LMPA 4N3BA 1QRDA 1YHNA 3HCFA 3NJRA 3WHIA 1A95A 1SOMA 2FH5B 1VMDA 1E0AA 5E2AA 1DAMA 1R0KA 5KWSA 1JB9A 1GTMA 3KVOA 2B8WA 2X7HA 2WBLC 3B3QA 1E9VA 3K8ZA 3RBZA 3A4LA 4QBGB 1Z5ZA 1RYNA 1IDOA 2V58A 1QCDA 1TCUA 2VCYA 2VBCA 3CLHA 3MQ2A 4C07A 4RK6A 5B36A 5LIRA 4LAFA 4E88A 3DV9A 2I3BA 2RGWA 1C3EA 4XGNA 1Q21A 4PNZA 4RWEA 2L2QA 4CCWA 1BKYA 1I8TA 4RDHA 4GDFA 3WLTA 3EXIB 3IIKA 3GFBA 2HIGA 1M10A 3RVMA 1YOVB 3NWBA 1PR0A 4U5XA 5FEUA 1I36A 3VKVA 3RRYA 3O3NB 3QLVA 3ZY2A 4EZEA 5KAMA 2UUBB 4M9CA 1LSOA 1R3UA 4W1PA 3KR1A 1ADJA 2B8EA 4B7CA 5AVOA 4IFIA 3EWIA 1R4AA 2H2DA 4LKRA 5BP7A 5KHOC 3QXXA 1Y0BA 3BGVA 4GO1A 3PGKA 1B0UA 3KD3A 2LKCA 4L5AA 3RYFB 3A32A 1ZN8A 2BC9A 1XB2A 3BERA 3DS8A 3UZUA 3ZHSA 4NMHA 3PDIA 4R3WA 1D2AA 3EQ6A 1G2QA 4U63A 3VU9B 2WKRA 1G41A 3DZHA 3TL6A 2F8TA 1JFFA 1D1QA 3OFKA 2ATXA 4UUQA 3PIIA 3HKEA 4F7WA 4E2XA 2XF2A 2EU8A 2FZ4A 3ROQA 4D74A 1WCYA 5DK6A 4RIFA 2QVZX 4II2A 4F0JA 4EO9A 5GZ6A 5FRDA 4D6XA 5C4MA 1OHHA 4C4SA 5J58A 4C6TB 2MT9A 2X2OA 2QXTA 3ZCTA 1NU8A 2B0JA 4AO6A 3GR6A 3P2IA 1GTG1 4RWZA 4QWMA 3D4OA 1BMTA 1MFPA 2PANA 2VWQA 1KEWA 2RD2A 3FPLA 2ONJA 5JXGA 1OUMA 1X0XA 1H1LB 3H19A 1G38A 3UO8B 3SZRA 1KK2A 2IYSA 2XZPA 3EHEA 2VPWA 3O2NA 3QJ5A 2PL3A 4MVWA 2HV8A 3J7AC 4BYMA 2E1PA 4E2ZA 5EZYA 3AG6A 1BHSA 3PHBE 4MDHA 1JYFA 3FMOB 4FMCB 4BEJA 5AJYA 3DPIA 1CUYA 4WXPA 3ROKA 3F1KA 1MQAA 3N76A 1WP4A 2GPTA 1QKKA 3BMCA 2ODBA 3K30A 5AJUA 5DOZA 2EW2A 4JN6B 5A9SB 1TZJA 2I6TA 4DV2B 2FHPA 4NABA 3CNBA 1KDRA 4MUGA 1B6TA 2PJDA 2W2OA 3BF7A 1MJNA 2RC5A 2ZE7A 5DZSA 1M72A 5K4GA 3IAHA 3RS5A 1KK3A 1QE0A 4D56A 1A2QA 3HCBA 3V2IA 2WJJA 2CF5A 5TPWB 3W8FA 4CMCA 1QPBA 5LP6F 2DT8A 4WJLA 1L3IA 4TV8F 3PKJA 2A5JA 4I9GA 3NBZC 2G1UA 3GRKA 4RZXA 4GLFA 2P3LA 4WKNA 3L7BA 1KO1A 1WO8A 3FLEA 1D6MA 2OZLB 3QVUA 1L4LA 3G79A 5JNTA 4FKBA 4J3JA 2MJLA 1XZQA 4PINA 1OIVA 2B3DA 3A05A 3W4KA 1MH9A 3FWYA 3D59A 3H4TA 3VBEA 5FWXA 4MDEA 2ZYIA 3T7CA 2FP3A 3JYOA 3K15A 2VT7A 3QFHA 4Y1GA 3UFXA 3WI7A 4LI0A 3HYTA 1VBNA 4I66A 4B83A 1N5LA 3AH8A 5HJ7A 4YBZA 2AUNA 1W76A 1J25A 5EP1A 1M73E 4TTRA 5SY6A 4BNNA 3FBWA 1GTRA 1K27A 2W2MA 1QUEA 2B2XA 1KYTA 2GRAA 1RYYA 3C39A 1KJNA 1N5MA 3NAMA 4HQOA 4P4UA 4AJOA 4BVHA 9LDTA 4B79A 3C1UA 2R97A 5B6IA 1I3LA 4DUYB 2GXAA 2YZ2A 4YY3B 3CX6A 3G1UA 4R8MA 3MTQA 3OJCA 5TVGA 1JPUA 4DQDA 4F11A 2YZNA 4ND2A 3VAYA 5ALVA 2ZI3A 1FSPA 3D4LA 3WK4A 3GPDG 1K4YA 1G5TA 1V5FA 2DFDA 4IOJA 1Q1NA 1S9HA 3NGMA 3GZNA 3QTTA 1KJ8A 1PFYA 2X0IA 2XA1A 3HP7A 4M9SA 1KO5A 3K09C 1IHXA 2XMZA 5C46F 1BG6A 2AMFA 2V59A 2ZPTX 4TL7A 3K5PA 4EGJA 3W3ZB 1U2ZA 4JROA 1EBBA 2BR5A 3L1IA 2CXXA 3WG9A 3EG9B 4JJ4A 3WWPA 3FYUC 5CVVA 5C8DA 4LJ5A 1XVVA 2ZSBA 2VG8A 1UADA 4FKMA 3PFKA 4CHTA 1OKKD 4A0GA 4BU1A 1DSSG 2ONYA 1IMOA 3M9LA 1GYRA 3NM6B 1VG1A 4HRAA 1NM5A 1NYQA 2BZGA 4HH1A 5E3JA 1EPUA 1XD9A 3EUWA 3WP1B 3R1IA 1W6RA 4MUHA 4DIFA 4EQ6B 3C5VA 3ZDBA 3EDRA 2TS1A 2OSBA 3MTAA 3GYGA 3H6KA 2C7BA 1UBSB 1AKYA 4PGHA 3OZCA 4F4JA 5KC8A 2B2CA 3T7DA 1ORVA 1W52X 5HKOA 4AECA 2D1YA 4QOEA 1NVKA 4R9UC 2OV1A 3NB0A 5AOAA 2RI0A 4JR1A 4WSOA 3IDZA 4HFNA 4XXHA 2XTJA 3A4NA 5E6SB 4EB6B 1F2VA 1P1HA 2WKSA 3V7NA 4DLBA 3P9CA 5B37A 3RSSA 3WMRA 4RF4A 3MGGA 4GBGA 3WBKA 3CEHA 4TKVA 1M2KA 4U5QA 3L0OA 4CYMA 5IKEA 4GU5A 1FS4A 3CLKA 4EYQA 2P9EA 1XLVA 4DGQA 3NBAA 2HQ1A 3FUVA 2EYUA 4YDHB 4E1VA 4URYR 2XTMA 2R8EA 3VU0A 1X1TA 2IEZA 1DXOA 3AZPA 5C1DA 5DGTA 1HNZB 1H8ED 4IY1A 4RYLA 4CCYA 2YC4C 3G9ZA 3EY9A 3OIVA 3L7AA 2DTEA 3GD5A 1X70A 2C4WA 3T9CA 2EW1A 5E4TA 1JIKA 5LU8A 1WXHA 4R8SA 1ADYA 3EIHA 4J0IA 4UUOA 2FW0A 2PUWA 4DZTA 4JIMA 2XCLA 4OXNA 1AGNA 1WCV1 3LZDA 5DTMA 5AUOB 3SX0A 5IJ9A 2O3JA 2WLTA 2AI3A 3UGKA 1XGKA 1VI5A 2PQMA 2YWGA 2FGJA 5AO9A 4QU5A 2AN1A 4TQUS 5BR1A 1G20A 5L7YA 1YQEA 1Z2OX 3V7UA 3WNBA 1QQBA 2RJOA 4HGNA 5TF0A 3C70A 3FOZA 3L4JA 1R16A 3VI4B 3A06A 1SCBA 1AMOA 1N33B 4A2CA 2YQ5A 1DMSA 2VZ9A 5ED0A 3K0HA 3LCVB 3BRWA 2YOHA 5AI5A 1P19A 1XAIA 1F17A 1OBOA 4QDTA 5KJEA 4CLXA 3BG5A 4OFZA 3FIJA 3ZXYA 1VIYA 3MEQA 4WE3A 1M8JA 5CDFA 2VYCA 3DCJA 3Q9SA 4O4HA 5HNKA 1THZA 3K5HA 4O2BA 3UA3A 1FU4A 1CBUA 5TDHA 1VJCA 4B4OA 5JH7F 5G41A 5H82A 3L6DA 1N57A 3BD6A 1SCUB 2ZYSA 2DXIA 2HLNA 3ZDYB 1HLGA 3RSLA 2H4XA 2YWHA 1YCGA 5IAGA 2PFKA 1B43A 4OLAA 2XUGA 3PJRA 2PGLA 2Z5LA 2V5AA 4X44A 5LLDA 2F7SA 5A3RA 2YWJA 5KNBA 5F5NA 1NXSA 1QVWA 2B1RA 4I4LA 4AW9A 1WHSA 3PNYA 1I3OA 2LW7A 3CO5A 3PZRA 4DMCA 4G09A 4XW2A 3EA0A 4MKGA 1KIFA 1JIXA 1VYTA 5SZIA 3T0FA 4EW2A 1T5BA 2VKQA 1FTGA 1OT5A 3LY7A 2IWRA 5JANA 4YP9A 2WWTA 3O9VA 4WZAB 4FFBB 2A6PA 3EFEA 2J4CA 3T38A 1Z62A 3ISTA 1Q6YA 2ATCA 1KTVA 4K88A 2Y6VA 1V35A 5FUWA 1FDSA 1Q7GA 1YV9A 3CV3A 3NO4A 3TLGA 2PN1A 4Q1DA 3GLIB 3PDHA 1ZIOA 2H2AA 2WTUA 3V5NA 1BVHA 2KM1A 4LZWA 5FTMA 1F2DA 1E7SA 4E5DA 2FPPB 3OM1A 1PTKA 5F9MA 4ALNA 2H2HA 3PZBA 4GLLA 1UBHS 2MINA 4R8LA 1J23A 2VP3A 2ZSJA 4Z9BA 3U60B 1JFLA 1PLJA 3C1TA 5L3VA 5EJEA 2HQBA 3GDGA 2VF7A 1JNXX 3TJRA 1W0KA 2YMMA 3HLYA 3L6EA 4RIIA 2PZKA 1M8KA 3C87A 1EFAA 4UEQA 1NGSA 4C30A 1FDOA 1FX1A 2NO7A 3CLTC 5EHQA 2RBKA 3G7UA 4GP6A 2BZSA 4B81A 3L8HA 3C3DA 3AETA 3FMFA 4D9JA 3VDRA 2HHLA 1WM1A 1XZHA 3TWOA 3ETNA 2V9ZA 3DB2A 4EZIA 4A82A 2IEBA 1JBKA 1VSQA 2OVFA 4N76A 1Z6TA 4KFCA 4DA8A 2VSOA 2WWIA 3LC0A 4QOFA 1YB1A 1TKRA 2HA2A 2W4QA 3PPVA 4M8IA 1U9IC 4O1IA 4OM7A 3VH1A 2P77A 3EHDA 1P9RA 1WXIA 4AY5A 1G5PA 1RXEA 3DHYA 3WQSB 3AIMA 3JALB 4KJZA 3H0KA 1T9GR 2VPZA 3QMWA 3G0HA 2AG0A 2Y0EA 4H7IA 4TTQA 3WLPA 4F45A 1FP6A 3ORQA 3COVA 4DXAA 5HJEA 1HFEL 2C03A 5H9WA 3JRNA 4IUCS 1Z73A 1YRQA 1HTTA 1UWLA 1JW9B 3M6IA 1GN8A 2NVWA 1JHPA 1TUBB 1ZOIA 3PJDA 1FQJA 1JR2A 3DCIA 4NOKA 5G0UA 2W5UA 3MAAC 4YUAA 1SXPA 5I7SA 4DV5B 2PPVA 1JIJA 4I1PA 1RZ3A 4MAFA 2O8CB 2HBRA 1UK6A 3NRBA 3ZGNA 3AL3A 5GV8A 4FM9A 2OBXA 3G13A 1ZIXA 3QV2A 4JU9A 3CUEF 4CT4B 1NBMA 1UH5A 5HIIA 1F4VA 3HKDB 1L7PA 2FN9A 5C1OA 5AP9A 2AD5A 2N47A 3MTBA 1NJSA 4CEIA 1COZA 4JSTA 3U31A 2GERA 4OQMA 1Y3BE 3LHFA 3M9WA 4Y2UA 1IDN1 4PO3X 2VTEA 2WUFA 3B9PA 1KI7A 3MUFA 4HXYA 3TJMA 4IZIA 5CX1A 5ALEA 3VR6A 4B6RA 4JDPA 3RHFA 2IOHA 1QHNA 2WINI 1DIGA 2GAIA 4MUYA 4R2MA 4RY8A 1E1LA 4RL6A 4HX5A 2W42A 2E48A 2EG9A 1A8UA 3DSRA 3FDXA 1CQXA 4RM2A 2CY0A 4Y6OA 3AY0A 2VDJA 1EFKA 2JGDA 1VKZA 2Z1NA 5TR9A 4FUTA 1B2RA 1OXSC 4HUQB 1OCEA 1N2XA 1T9HA 4S1PA 5KWVA 4QLOA 2VHYA 2C1ZA 5DNWA 2HMTA 3HXOA 3KQUA 3ASZA 4OAQA 3AI1A 4JVLA 1AO0A 1VGRA 1JXMA 3CHYA 1IRIA 3HDQA 2GN1A 4RA6A 5EWMB 4BWYA 1JPJA 1FFCA 2EAUA 1HZJA 3Q8LA 4LRUA 5EKDA 3B1JA 2AJTA 3TQRA 4MLCA 4FKZA 3Q7RA 3K2EA 4URFA 1V96A 4W4TA 1XZCA 4GM4A 3X1KA 2CWDA 5JS2A 3ROGA 4WRRA 3SLKA 1MORA 3V4LA 3HFSA 3TR0A 1DAFA 1EJ2A 5LYJB 8ABPA 1VLVA 5AW5A 4AS1A 1M5TA 3C2QA 1YGPA 4U6SA 4BMNA 3TB6A 1Y1QA 4F3NA 5CB4F 4EHBA 3N8DA 2WMOB 3Q5GA 4PVCA 2XXJA 1M66A 1QONA 1N6LA 3L0SA 4W82A 4MA0A 3ZEAA 1Y7HA 2O0JA 2ZT8A 2ZUVA 4LGYA 4DT1A 5DXAA 1JLRA 2REQA 3CH7A 2C4TA 1H3NA 2E5WA 2I8CA 1AA9A 2VPPA 3PNOA 4Y0AA 1WLSA 2CLFB 5BW6B 3TKYA 2XYHA 5FOQA 3BHIA 4HLCA 3R8FA 4C9BA 1N1GA 3RVSA 2ATEA 1ZSNA 3KT8A 4R41A 3VV3A 1T8SA 1U3UA 5KKNB 1CQIB 4HZUB 4JQOA 4LZAA 4Q9HA 3ZGVA 3OZ7A 1Q0SA 1A9RA 5DX1A 2RBEA 1H4QA 4DL9A 1V3QE 1EE2A 3HO6A 4A8JC 3MCVA 4DN6A 1AF4A 1O9HA 3GFGA 2V8OA 3R3VA 3STUA 4BVJA 3I12A 1TTPB 3ZJ4A 5IDQA 1DJQA 3S2ZA 3TW6A 1B15A 2BD0A 2DFPA 3KOWA 4S2EA 3AW9A 3MBIA 3QBTA 1Z68A 4CM3A 1DL5A 4KP7A 3RU2A 3U3OA 5LU9A 4DV0B 3BSFA 5KREA 2JHCA 2G08A 5F2OA 1OXMA 1U4SA 2ISSD 5JI2E 3DO8A 1A7AA 3A26A 3HCEA 5EUMA 3PPXA 1Q84A 1N1EA 4W5TA 5EAIA 5A3QA 3OMXA 1EK6A 3MPOA 5C8YA 3QMVA 1QRRA 4QDZA 1ZD2P 1MOSA 1CY0A 1SC4A 3ANXA 3BOSA 4ZVQA 1O6CA 1M2OB 1IQ0A 1DEOA 3LP6A 5FA6A 5KNBD 2I6QA 1QHHB 4Z1MA 2HA3A 4O0MA 3I6IA 2YVKA 4Z7JA 5KTTA 2NACA 1E6MA 2BEWA 4H08A 4J0QA 4PHTA 5DP2A 1Q77A 3DGEC 1P45A 3NYIA 1Y80A 4LV5B 3URKA 2F8SA 1YBMA 3Q1LA 4M1YA 2J31A 4OB6A 2JGLA 2IW3A 2W6OA 2FW1A 1AGPA 3IKVA 1ZHFA 4ZTBA 3TK1A 3ZWPA 3NTVA 3CMCO 4NECA 3NHFA 3KP1A 4L9WA 1BSVA 5KYGA 1PL8A 4DCVA 3X44A 1NHWA 3OCJA 4ZVVA 3E5HA 1JF8A 3RV3A 4Z9YA 2JFWA 5DYWA 5JQGB 4DSNA 4QOHA 4N5MA 3NV9A 4IQGA 5F7JA 2D1TA 1QDLB 3GMIA 5ULLA 5IFKA 4YRJA 1C4XA 1E9BA 1T8UA 1ZX1A 2I67A 4BNJA 2WJZB 3M9XA 3D5QA 1W0KD 4GE3A 1L4GA 2KSQA 3QEAZ 1S2LA 4HGZA 4EBFA 5BN1A 1TAHA 3TLMA 4I1VA 4FFNA 4XLTA 5LCXA 4B75A 4R01A 1QQ5A 4Z5XA 3VHLB 4MV3A 4DVGA 1MHPA 3ELDA 1FDIA 1EG2A 2J46A 3IS3A 4NFLA 3WHLA 3G0BA 1L8XA 5K2MA 2CNNA 1TTTA 2V0GA 5JW6A 3L2OB 1T2FA 3WGNA 4JNKA 1XA0A 3UY4A 2ORVA 1XZBA 2P67A 4N7BA 3NTRA 1NASA 1W9HA 2P5YA 5H80A 2WJVA 4RV5A 3OA2A 3OM9A 3UJPA 1ZCJA 3LY9A 2BGJA 3O2SB 2FZVA 3ZV4A 1QR2A 2HJHA 2BHTA 1KDPA 4CMHA 4E51A 1ISMA 3OLXA 3A4YA 4YJHA 2YICA 4PSDA 4QRHA 2YUTA 4NK4A 1W94A 2E85A 4E1BA 1AZSC 1KAHA 4B47A 2JA2A 5EQJB 2I2WA 4B9EA 1UT6A 3QSYA 3R3WA 1M74A 1UFKA 1K0UA 1T13A 3QRWA 1T8PA 2O7NA 3E2MA 1V39A 4EMSA 1W5TA 2E2WA 3NALA 3PQCA 4BNTA 2CMHA 2MYTA 2HJRA 2O8NA 4MP8A 3KSMA 2LZ0A 5E0KB 4B74A 4M2LA 2QN6A 3ZDEA 1ZXBA 1U90A 1NR7A 2PRYA 2YJNA 3QBDA 2JHFA 2HU5A 3LFTA 1O7JA 3PDIB 4WADA 1YUMA 4OKIA 1CYEA 2F55A 3QE2A 3U5ZB 1XBTA 1JFFB 4F3YA 3SOPA 4KV9A 1ATZA 3ZIDA 1NXQA 1P4RA 2WQ6A 3HKEB 5IKPA 1M1ZA 1RYZA 5LZ4A 1OA1A 2NUPA 3DFMA 2GETA 3H2BA 4Q7JB 5KVSA 1K86A 2ILVA 3LUCA 3HU1A 3SXUA 1E2DA 4I08A 1X1SA 4V2IA 4I3HA 1V2GA 1K6EA 4KCGA 4LECA 4I4CA 4HGPA 3R40A 4ZAFA 3VGJA 5EJ8A 1FSFA 1E6LA 2GNOA 2IIVA 3HL0A 1RTKA 4M88A 4XIFA 4YMIA 1OPRA 2VN8A 5EC8A 1NLYA 3KDPA 4ZDKA 4MJLA 4P6VF 2B1QA 2VJAA 2Z56A 3N1UA 3VUEA 2PSSA 5AUPB 3L93A 2H7XA 1VHJA 2PWBA 1XZPA 3PD7A 1DBQA 4EKNB 3PQDA 2P79A 5EZYB 1Z5UA 2Y2VA 1ZJWA 3L4KA 4FU0A 1VG0B 1SBTA 2WSBA 1VJDA 3QHAA 4HAOA 1GCIA 3BJEA 4IMRA 1PSWA 2XVMA 3KHTA 1R9GA 2EFDB 2VNAA 2XUIA 1FJ2A 1ISGA 1TL7C 3GMTA 2F62A 3O1HB 4URHA 3GUZA 2PSJA 4RTOA 2PCLA