1KRXA

Solution structure of beryllofluoride-activated ntrc receiver domain: model structures incorporating active site contacts
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
124
structure length
124
Chain Sequence
MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAISHYQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITROGEN REGULATION PROTEIN NR(I)
publication title High-Resolution Solution Structure of the Beryllofluoride-Activated NtrC Receiver Domain
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Signaling protein
total genus 35
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2002-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1krxA00
1DRJA 4G0OA 5BRJA 3CLKA 1M2FA 2QW1A 3JPWA 3C3MA 3O1JC 3FGZA 2QZJA 4RY8A 1ZGGA 1NXOA 1PNRA 2ID7A 1JDPA 1RXEA 1SXHA 2FQXA 4W5OA 4YS6A 7ABPA 4Z4HA 4S05A 2QU7A 3MYYA 4MS4B 4Q7EA 1KGSA 4EVSA 5B3JA 3CG0A 1MAVA 3H5WA 1FQWA 4LX8A 1QQBA 4G86A 4MGEA 3G1WA 4W5NA 3OM0A 1NXVA 5IX8A 5C5CA 1QO0A 1RZRA 4IMJB 4D6YA 1ZAYA 5HQJA 4Q6WA 2MYPA 4N47A 4ETIA 6CHYA 3HV2A 2FEPA 4RK6A 5TQ2A 1DC7A 1Y1LA 2LP4Y 4W5RA 2FLKA 4O1HA 2WY2D 3OM1A 3TO5A 1MIHA 5KQLA 1JF8A 4YV7A 1P6UA 1NTRA 3EJWA 3G85A 3LKBA 4XASA 2HQBA 4JA2A 3LUDA 4LRQA 3QX8A 4Y9TA 5FWYB 4FE4A 1BAPA 1KMIY 2IPMA 1RNLA 4MR8B 2PL9A 5IUKC 1ABFA 4MYRA 1ZESA 8ABPA 3SNKA 5FWXA 3H1EA 5JNUA 1GUDA 1Z12A 2QR3A 4ML3A 3MF4A 2HSGA 1F4VA 1M2EA 3RVJA 1L5ZA 4F12A 1S8NA 2W42A 2FMIA 1LBHA 1Z2DA 2RDMA 1FSPA 1H9CA 3ROFA 1OXKB 4L4UA 3SY8A 2MSLA 4PEVA 4YLEA 5TPWA 3KKEA 5KQGA 1C0EA 1TM2A 4MS4A 5KQPA 3HDVA 1ZY2A 4G97A 4KMRA 4MAAA 1AB5A 3LFTA 4JB2A 3JPYA 4LDAA 2PLNA 5DKFA 3UK0A 1PEAA 3Q7RA 1U04A 1Z15A 3T38A 1URPA 4WXEA 4WT7A 3OQMA 4ETMA 4YO7A 3CNBA 3H5VA 2FQWA 3I42A 2X7XA 4UHKA 1BVHA 1VRVA 4FE7A 2WRZA 3MQ4A 1W25A 2MYNA 1VPWA 5JNWA 1D1PA 4OLAA 5C5EA 1EWVA 4ZYLA 1ISRA 3HK2A 1OXBB 3QLVA 1QP7A 4GNRA 1DRKA 2R48A 4G0PA 3GA5A 2GWRA 5GOTA 1WETA 2PUFA 3IPAA 3DBIA 3EODA 4MS1B 4MR8A 2KYRA 4RK5A 3QEMB 4EYQA 2ZWMA 4KNYA 2GX6A 3OO1A 1AB6A 3GBVA 5KI6A 2AYZA 5HM6A 4YCSA 1J56A 5TPZA 1ZHHA 3BRQA 4F11A 4F06A 1CYEA 4RDCA 2ZAYA 1EWKA 3OO0A 2FEKA 4WXMA 1QP0A 1DBQA 4F3TA 4E7OA 1FFGA 5CNJA 5BQ3A 1SXGA 3QK7A 1XWWA 3HCWA 5IEJA 1U2PA 2FSPA 3ILYA 4N0PA 3NNDA 4OATA 1T34A 5HSGA 2PUAA 2DRIA 4Z99A 1PNTA 4Z4FA 3EQZA 4G0MA 3KYIB 5IUJC 3F6PA 5IBQA 1K66A 3MIZA 3NNSA 1DCKA 4LE1A 1JL3A 5EWLB 2F8TA 2LPMA 4RK7A 3FFWA 3BBLA 1YS6A 5I4CA 3BILA 3RVLA 3SG0A 5JNRA 3CKMA 4MS3B 3GRCA 3UKJA 4NICA 4RKQA 1ZDMA 4JB0A 1BA2A 1NXTA 1Z25A 4TLLB 2E4WA 4KV7A 1RXIA 3QLUC 5PNTA 5BRAA 4M88A 4ETNA 3N53A 2JCGA 1DBPA 3FDFA 4MS1A 1DP4A 4CBVA 2IKSA 3CTPA 2MSKA 5IUNC 1DCMA 3HZHA 5IEBA 3FFXA 3QEMA 4JAVC 1TJYA 3DGEC 3RVMA 3O74A 3QX9A 4MRMB 4QPJC 5KC9A 2JVJA 4NCAA 2FTKE 2RJNA 2HQRA 3F7NA 2J48A 2NZUG 4JP1A 4RZSA 4XARA 4D74A 1XHEA 4QICA 2BGGA 1MB3A 2JK1A 1EFAA 2FMKA 5FBKA 3OMXA 4MLCA 3HM9A 1ZVVA 2FN8A 2E4XA 3N75A 3KG2A 1U8TA 3C3WA 4KQ9A 5F64A 4WUTA 3NBMA 3KHTA 3IP6A 3NNNA 2E4YA 4ZMSA 3N8IA 2MYUA 4PICA 6ABPA 5JNSA 2YHBA 5IC5A 2LBPA 2JBAA 4YRZA 2CWDA 2PE5A 1QO0D 1RZRD 1M5TA 1TLFA 3L49A 3O1IC 1YMVA 5EWJB 1NY5A 3C6QA 4G0XA 4TLMB 4TN5A 2CHEA 4PYRA 4EYGA 2RGYA 4YP9A 3RVQA 4RV5A 3L6UA 3JVIA 2IOYA 4LE2A 1JFSA 3N6VA 1U2QA 2GKGA 1ZN2A 1D1QA 2JVIA 3HSYA 3MA0A 2PUDA 1E6MA 3GV0A 1A04A 3H1FA 5ABPA 5FBHA 1JX6A 3D8UA 5TQJA 2FQYA 1A0OA 1ABEA 4IF4A 2FMHA 3BRSA 3K4HA 3DGFC 4XLTA 3T95A 4ZJPA 3A0RB 1TMYA 3EDCA 5E3JA 3LTEA 2MYTA 3CU5A 3DLHA 1GCAA 1IIBA 3EGCA 3Q7TA 3SQNA 2HQOA 3HXMA 2JB9A 1SD5A 4Z9BA 4MRMA 4Z4IA 2ID9A 1YVUA 4RSMA 1SRRA 2VUIB 2FXIA 5DCLA 3KTOA 4LZLA 1USKA 3LUHA 2YHAA 3B2NA 3KS9A 3H1GA 3EAFA 3Q15C 3KYJB 3CRNA 4Z4EA 5T3YA 1L5YA 2L2QA 1ZH2A 2QXYA 2OQRA 1F51E 1UDRA 1QPZA 3CFYA 1D2AA 3OLWA 3OQNA 2AYXA 1NATA 5DTEA 1USGA 3HUUA 4TMYA 1TVMA 5FWYA 4IRXA 3N0WA 4JASB 1MVOA 2WJAA 4KVFA 5D2CA 3F73A 1FFSA 3GT7A 3IP7A 3LUCA 4EYOA 1FFWA 5IULC 1RPJA 3GWGA 3MM4A 3KCNA 1Z26A 5EWJA 4DQDA 1CHNA 3CZ5A 2XDYA 3E3MA 1DCFA 4N76A 1SXIA 1E2BA 2LUOA 3M6MD 5TE9A 1DG9A 1GLGA 1QMPA 3O2SB 4IILA 1E6KA 1EWTA 3HO1A 3N0XA 4NCBA 2IPNA 3QELB 3MMNA 4RY0A 1A2OA 1MB0A 3O75A 4KQCA 4RS3A 2HJ9A 3LUKA 5JNVA 2E4UA 3IP5A 1CEYA 1VLZA 2P9HA 4D6XA 2P4UA 2QVCA 3H6HA 4XAQA 2R25B 3P9YA 5CHYA 1PEYA 3TX6A 1P8AA 4HNSA 3RVKA 3VNBA 4RK4A 5TQ0B 1KRWA 3K9CA 4G0ZA 2QV0A 4MR7B 4MR9B 3NHMA 1HEYA 3CHYA 5CNIA 3RVRA 3OLZA 3C97A 4H3KB 2WMYA 1YTUA 1BDHA 3I09A 1KRXA 1Z13A 3M9WA 2Q5CA 1JFVA 5JS1A 2IYNA 3IP9A 3O2JA 2VK2A 4XFKA 4L85A 2CD7A 1PHRA 1EAYA 3H5LA 1YMUA 2I6FA 2PUEA 2V0NA 1NXPA 1M5UA 4MQEB 3T6KA 5EWMB 4PZ0A 3A3KA 2FEWB 2L17A 3OMWA 1P6QA 1DBWA 3QEKA 5DGCA 1JBEA 1JLKA 2FW0A 1NXWA 1LJUA 1K68A 3E61A 3H6GA 3O2QB 2QVGA 4W5QA 2JRLA 4E7PA 1APBA 2A9RA 3JY6A 1I3CA 3C3KA 4QYMA 3ILHA 4G0QA 2LIVA 3A10A 4Z4CA 2L19A 3QELA 3URMA 2HPHA 4EY3A 5TPWB 3Q41A 4KFCA 2NZVG 2TMYA 3O21A 4NQRA 1ZITA 1XHFA 2A9OA 2PL1A 3F6CA 3I45A 2PUCA 3RH0A 3DLBA 5TQ0A 3LOPA 1EHCA 4MR9A 4MR7A 4RK1A 3EULA 2PAFA 4Z9AA 4PE5B 4P98A 3I5AA 1D4ZA 5EWLA 5HKOA 4N0QA 2MSWA 2IPAB 4MPTA 1U0SY 2FLWA 4DN6A 2O20A 3CZCA 3RVNA 3CG4A 3NHZA 4MS3A 4EVQA 1JFTA 1USIA 3ROTA 1VKRA 5KC8A 4RK0A 1B00A 4NV3A 3KLOA 4LE0A 1Z16A 1R8JA 1W9HA 3H75A 3SAJA 2H0AA 3KSMA 3Q9SA 4MQEA 3TMYA 4HYEA 5JS2A 4Z4GA 3LUFA 5EWMA 1DC8A 2PUBA 3W9SA 1LK0A 5T7BA 3FMVA 1ISSA 2GI4A 4OTZA 3BREA 4N41A 4EYKA 3OLYA 2NT3A 5B3JC 2FN9A 5GQSA 1E6LA 4ZMRA 1DJMA 1NXSA 2FMFA 3N0RA 3HEBA 4B09A 1YK1A 3OLXA 2GBPA 5BR1A 1JYFA 1LBIA 1QNLA 3Q7SA 5KQMA 5JNTA 3LUAA 4KPYA 2L18A 4N03A 2RJOA 3A0UA 1PUXA 5DLEA 4RXMA 4H3HB 4P1ZA 1QQAA 3VNAA 3GBPA 3HUTA 1BDIA 1GUBA 3GL9A 3GYBA 4KK4A 4OLBA 5ED4A 4HNRA 4YWHA 3EQ2A 4MQFB 4OBBA 2PMCA 2PKXA 2H3HA 1JHZA 4RU1A 2E4VA 3T8YA 2B4AA 3M9XA 2R4QA 4GPAA 3CS3A 4O5AA 4YGXB 2PUGA 2F8SA 1JWLA 4OG2A 1YIOA 4W5TA 2IDMA 2N9UA 3QLUA 2A9PA 3RVPA 1QKKA 3LKVA 3LMKA 3QLTA 4XXHA 1LJLA 1C4WA 3S99A 4ZPJA 2E4ZA 1NXXA 3RVSA 1D5WA 4WWHA 4RXUA 4KRFA 3UUGA 4H60A 3JVDA 2M98A 3RQIA 4LDZA 3H5IA 4S04A 1ZGZA 3SM9A 4EUKA 3OQOA 2JVKA 2R47A 4YR7A 2FVYA 3D02A 1JYEA 2NUBA 1JDNA 4IGAA 4JOQA 1P2FA 4HNQA 1DZ3A 1Z2EA 2PJUA 4IMIB 3HJFA 3JTEA 4QYWA 1BDJA 1JH9A 3LUGA 1YS7A 5TQ2B 4KREA 5CNMA 4KK3A 2B1JA 4EGSA 4O1IA 5TPZD 2FKAA 1YK0A 3R0JA 4FB4A 3DZDA 5KWSA 3HDGA 2CHFA 3HS3A 2M1ZA 2WB4A 3IPCA 4Q6BA 4F8JA 2QSJA 3LUJA 4WZZA 4RXTA 4RY9A 2IPLA 1QP4A 3OLVA 5CNKA 1Z17A 3FFTA 3IDOA 3TD9A 1ZH4A 4KZKA 3RVOA 4DADA 4MLDA 3HVRA 3KJXA 2VUHB 2VYCA 2OENG 4G0YA 4MQFA 4Z0NA 2WWVD 3KLNA 1GCGA 2JBAB 3TB6A 4EVRA 2A9QA 3O1HB 4UHJA 3QLVC 3JS5A 9ABPA 2WJWA 1Z18A 2NT4A 4RKRA 3H5TA 5FWXB 3H5OA 4RWEA
chains in the Genus database with same CATH superfamily
3SOZA 3VPDA 5CTAA 2ZUCA 3KNZA 3Q87B 3N74A 3B1JA 2UZ1B 2V5AA 4W4TA 3U40A 1K5GA 1O89A 3ZVRA 4ER7A 4UMVA 1W30A 2C8KA 3AOEA 1GPKA 2HJHA 2OORA 1PCXA 3OA0A 2ZT7A 3I1IA 4L9WA 1EAMA 4YUZA 2NAFA 4QDXA 1AS3A 2A35A 4Q7EA 3TM4A 3IKTA 3U0BA 1IRIA 1VPDA 3EN0A 2ZCVA 3I1YA 3RE1A 3WWEA 4H1UA 4I9NA 1MX9A 5IG2A 1XYVA 1P0FA 3MJ4A 4YGYA 4MQLA 1QJCA 1TADA 2JH9A 3PA6A 1RZRA 4AJEA 1ZAYA 3MMXA 3WY9A 2CNBA 3AVVA 3QVKA 1RQ2A 1T9AA 1I6WA 3DFMA 3ROQA 4RK6A 4MV9A 3QLJA 4R2KA 4TS3A 3A2LA 1G3UA 2AD5A 2PXAA 1MZVA 2ZJYA 4MB6A 5L4SA 3M4JA 1DOZA 1U7DA 4CDRA 1GPNA 4Q3NA 3TO5A 2GAAA 2QS9A 1JF8A 4YPFA 1XT6A 2OV6A 3PQ3A 3ZDFA 2W6ZA 4TTRA 3RU2A 2HQBA 1ZM4A 1YR2A 1G9SA 2AFIA 4Q16A 2IELA 1E4VA 1HE1C 4KC0A 4XB2A 4Y9TA 1G6HA 4KIWA 5FWYB 5KINB 4YAKA 1NUPA 3FSGD 1ULUA 1PL0A 3IVCA 4G0NA 4A15A 3H3FA 4KKVA 2WIFA 5BYKA 2BEUB 5LQSA 1V25A 5JSHA 3AK4A 2P9ZA 3JYLA 3FG9A 1JKFA 4HEQA 1UP6A 4FEGA 1GL7A 3HNRA 2FWMX 3MJCA 3IUMA 2ZRHA 3WIEA 5DP2A 2VYVA 2R85A 2DFNA 1L5ZA 2PO5A 4I8DA 3V8RA 3ZJVA 4M1YA 4RLSA 2JD2A 2RDMA 3KQUA 3AM3A 3X1JA 3I4CA 1CUGA 1A9RA 3IA7A 3OF5A 4RTMA 1P7PA 3E3AA 1AK2A 1V39A 1LQUA 2H17A 1WW8A 3KC2A 3N58A 1J0EA 3EVCA 1EGHA 1W5BA 1N2SA 3GJSA 1L4GA 1LWOA 3PXAA 1C0EA 4NWIA 2XVAA 4ZVMA 4YCBA 4KCGA 1ODSA 3LFTA 4KACA 1A2BA 521PA 1SPXA 4WVFA 2WSMA 2WUDA 3SJCA 5KSYA 1T8SA 3CRVA 3E48A 2QN9A 4PFJA 4F4DA 5C8ZA 1JI3A 3FZQA 3FA2A 5B37A 3C7TA 4A1FA 4BLQA 4H1TA 5K20A 1HI9A 1W8IA 4UXIA 1KZ4A 2QY9A 3EXEB 1YC2A 3I42A 3LPDA 3OX2A 4PIMA 4M46A 4QARA 5A9SA 1UKVY 2I0FA 2V7EA 4U7PB 2QVYX 2F67A 1J4AA 4FYYA 2PKYX 4Z9XA 2MYNA 2CUTA 4X24A 3RSLA 5LIRA 1GAWA 2GVNA 3FRHA 1SQ0A 2G36A 3E3OA 1KF0A 4JSTA 1EWVA 4B4WA 2R0QC 3IPLA 4UPVA 4BGIA 1GGEA 2O9JA 4DRYA 5LZ9A 4LYFA 4OH7A 4WLVA 4G0PA 3FUXA 3EGXB 4CIAA 2YC4C 3UO8B 2OOSA 4MS1B 4C0XA 1P0PA 4MYDA 1UBEA 3KBBA 3TI7A 2CJXA 3RS7A 1KQGA 2CZQA 2R6FA 1OC4A 1PR4A 1YR7A 5KTPA 1Z8NA 2D5IA 3DHWC 3QV2A 4IOKA 5BO5A 3KB6A 4ZHQF 5J58A 5HXAA 2BTQA 5AUPB 1C9KA 4U9UA 3BERA 5ISMA 1J56A 4DDUA 3FOCA 1Z5VA 4K46A 1W88B 1ZMRA 2Q6LA 1U8UA 3Q9NA 3W3AA 3AY7A 4RDCA 2OM6A 1MB2A 1LF5A 1P62B 3PUIA 4J0HA 4EFDA 4RL6A 5IBPA 4YLYA 3CTMA 5HEKA 1ZHOA 3TLXA 3KUDA 3DWEX 3OEED 2WU8A 4MUJA 1FSZA 3DTNA 1G1AA 2CJPA 1XNRB 1YCFA 5I48A 3AY3A 5IEJA 3IAHA 1S4MA 3OTIA 3LBAA 3UC5A 4RPKA 3DAOA 3HUDA 3IE2A 5HSGA 3A1CA 4DV6B 3RFVA 1LH0A 2X0IA 4AJKA 3JQGB 1EXNA 2QLJA 1F5SA 4GGPA 4L5JA 1I1HA 3HFSA 3W5UA 4IH9A 1L5LA 2HM7A 1RJGA 1PSDA 2V7QA 2ZANA 4NI5A 3W6NA 1KK3A 2JI4A 3DZIA 1R7RA 1UINA 2VDKB 2CHUA 5KOHB 4UM5A 2AUMA 2B8TA 5EJIA 1FDRA 4GKVA 3SG0A 3L02A 4FFMA 2RAVA 1B6RA 4KV9A 3GO4A 1ZDMA 2XUAA 3CM0A 3HBAA 4NICA 1J07A 2VDWA 2F4VB 1H1DA 5ALMA 4KRYA 5A0FA 5LWHA 2DWQA 1VSUA 2HFJA 2X58A 2OB1A 3VR0A 3IPXA 2W2LD 1RRGA 2WTEA 1DP4A 3IQXA 2UUAB 2J87A 4HDSB 4JDUA 1S3FA 2CL0X 1IJEA 2ZRPA 3A9RA 1RR6A 3QEMA 5K0ZA 5MF6A 3ZD7A 3O74A 3GDOA 2R86A 4U3JA 1KRHA 2JAWA 5I7WA 2C4VA 1WDKA 2XOXA 4HPWA 3DMGA 5EE3A 4DEYA 2NZUG 1KJYA 3ASZA 3HGQA 2RAPA 4RLHA 5JOQA 1AS0A 2FSUA 3OCXA 5EZYA 4AJ4A 1EFAA 5FBKA 3QFSA 1HH4A 2Q3HA 2X5XA 4NE7A 4J0QA 4ZVSA 3USZA 5A4KA 2F43B 2WWTA 4QXMA 1WMDA 3KG2A 3QPBA 5KSZA 1U0GA 1VCNA 3V32A 4F3CA 4U6SA 1BGWA 3F3KA 3T5TA 3DR3A 1GZSA 1F2TB 4X7RA 2WJHA 3GG9A 2CNDA 6NULA 4G5GA 1UT5A 4RWZA 3KZMA 1XZJA 4AF7A 2O2CA 3MGKA 1JPUA 1IN8A 1MX5A 5DEOA 4F8YA 2JFQA 2I80A 4RAOA 4X1OA 1HQCA 4X84A 2F1HA 3DD5A 5EGNA 1DO8A 3COPA 2YXEA 5JISA 4P4NA 4IL5A 4UFOA 1LA2A 2HK7A 3T61A 5JD4A 2PQ2A 4PHFA 5KOYA 3PL1A 2P9GA 2ACKA 2RIRA 2IZZA 1A04A 5ABPA 3QVLA 5I9SA 3B1XA 2Q0SA 4HEHA 1CCWA 1J97A 1PKXA 2DYKA 2G6TA 4WL0A 5AKYA 4HDMB 2AZMA 3L4JA 2C8JA 2FMHA 2P4SA 4N8DA 3KAKA 4QU5A 1V1RA 4MWSA 2D1SA 2LKDA 1GG8A 4KLRA 3IV7A 3OM8A 1BE6A 1OTXA 5JS6A 4R0VA 1F20A 1Q0ZA 4HCJA 4PLYA 5KJFA 3KT8A 3N2IA 3R3ZA 4PS0A 5F4ZA 3NTLA 3H0CA 4YJKA 1TAUA 1I4LD 3ORHA 3T0GA 4AYTA 1CUSA 4FYXA 4OHBA 1ECCA 2AFHE 1YC5A 4DLRA 1V5GA 1HF3A 2P3LA 4JR2A 3NHLA 2I2AA 1XP5A 1SN7A 3THSA 4TV9B 2FJPA 2IXGA 4GP9A 4GW3A 3U26A 3EHEA 3UK7A 5CDYA 3I04M 4S1VA 3WOVA 5MN5A 3LUHA 4BNLA 2OBBA 4MVXA 1LDYA 3U48A 3H1GA 4RZXA 3RUCA 4AY6A 3AERB 1L5YA 3RBAA 4NBWA 4KQJA 1Q7CA 4LFBB 1ZH2A 4R2HA 4BO6A 2CJWB 1UEJA 4XQ9A 4Q3BA 4JLBA 4A0HA 4X3CA 2WWRA 4EPRA 3L5KA 3CCFA 3UUWA 4P0QB 1MG0A 3KV1A 4YCMA 4C7OB 1YRLA 2P3SA 3EA4A 1TZCA 2WPDA 4LAFA 1USGA 3ZW7A 5AJTA 2NSLA 3DMRA 2X2PA 5CG2A 3GLHE 2YW2A 2AEEA 1MVLA 4B76A 4COOA 1F2VA 1U9JA 3GUCA 2WVGA 4F0JA 4KXQA 5ALIA 1REQA 1BYUA 3DTVB 1ZI6A 1ETUA 1X8JA 821PA 3P9NA 3ZDAA 2H7XA 1HKHA 4HSEA 2XE6A 3ETJA 5DHPA 1VJTA 1VYHA 1XEXA 3VNSA 1EX7A 1SUSA 1GITA 2XDYA 1ID1A 1JDVA 1USVA 2IYZA 2LUOA 1AUOA 3O2SB 2CFCA 3HWRA 4MW9A 1E6KA 1GG9A 1MMFB 2Z8YA 4F4UA 2I91A 5CURA 1N2JA 1KP3A 2FHSA 2IXDA 4BZXA 2R6CA 4ZYVA 3EDOA 4B8WA 3LUKA 2AZ4A 4JCCA 5E3IA 5B58C 4NCNA 1PUIA 2PWAA 4ZO8A 1MVNA 3R0XA 3N2GB 4URUR 1TD9A 5J59A 4BJ5A 5A7FA 1DZIA 4JNKA 2GSWA 3IC5A 1ZBQA 2MMCA 2EZTA 4H3KB 4IS3A 4L9AA 4MYHA 1T36A 4M1ZA 5DCYA 4DY6A 4JI4B 1IUKA 4P33A 3TNJA 2WTMA 1TFRA 1HSZA 1TVCA 3TUZC 4RZIA 4OXIA 1W5SA 3SVZA 3AUUA 4IG9A 2QT0A 3SVLA 1BA3A 2CXRA 2LCFA 3AF4A 4JVOA 2Q0QA 5BSKA 5TS3A 4ILKA 3MUEA 2FRDC 2XB6A 3FBTA 3KTFA 3LX8A 4R05A 2P27A 3NJRA 2DWPA 2YV2A 4NL4H 3G6KA 1Q7EA 4GFDA 4J7CA 4CN9A 5HZMA 5JPDA 4Q1CA 4DFDA 3AHEA 1ZINA 1RIIA 3D3WB 3DCNA 2R7KA 4UU8A 4EATA 4F3KA 3HCFA 4IBOA 4J6EA 1QOZA 1ST2A 3W3AH 5JS7A 5DYIA 4BGVA 5DPMA 2Q5OA 4B47A 3LW7A 1N34B 1QLWA 1SG9A 4CV1A 1I3CA 1VG0B 1KBZA 1EBBA 1WUHS 4TLDA 3A58B 3QHPA 4G0QA 4WKOA 2ZSUA 4QT0A 2JI8A 4ZEMA 2HPHA 3W7AA 1QIKA 4US1R 1L5KA 3EIHA 1GIAA 2JHPA 5BUQA 2AN4A 1EFCA 4OF4A 5AI9A 2I29A 4ID3A 4F04A 4NQRA 4AUEA 1VLVA 1GGFA 3D8TA 1A9ZA 4GOJA 2WTBA 3GEIA 1YXMA 3PC2A 1TXGA 2HRRA 3GH3A 3TLGA 1U3VA 4WV3A 4HQ0A 1PJ8A 3TFOA 2JIMA 4BFCA 4BAUA 2HIHA 1B6TA 5K3AA 4D92A 4O4LA 1FYEA 1WVGA 2QDXA 2FPPA 3NTUA 4PZUA 4OK3A 3AYZB 2C9ZA 3ESDA 3ZYCA 5C46F 2TMKA 1GJRA 4DSTA 3V7UA 2GD1O 3PQ4A 2QQGA 5KVVA 4IF6A 3PF9A 4CLRA 2J0SA 1TVKB 3RUHA 1P9OA 3WMEA 3GEMA 3DZHA 1U8EA 4X20B 5M04A 4F3RA 1P81A 2NYRA 2VAWA 1W34A 5IPFA 5LQDA 5B57C 3GPCA 2C0PA 2GD6A 4N7MA 1PWEA 2B8EA 2ISQA 1VKZA 2WT8A 1VG1A 3ZLJA 1W29A 2WHPA 1R8JA 3MBKA 5BWCA 1OGJA 1A8HA 3QBDA 4G8CA 4GR9A 5CIWA 3DAYA 3DUFA 4BMVA 4IY1A 3JQAB 2PFSA 4XX0B 3AR4A 3SZGA 3TZCA 4PXYA 5JVDA 4WGGA 3V4ZA 5JTUA 1XMQB 4YI5A 4FM9A 4DC9A 4H9GA 4DG8A 2Z56A 1TM3E 4U39A 1SC6A 4P7FA 3OM9A 5D3ZA 1DOHA 3JAWB 4NBVA 4WKNA 5AOVA 5FUWA 1FMJA 5GJWC 4ZMRA 3KQSA 4DVGA 3HKBA 5EOVA 1FTGA 3VI3B 1XJCA 1EU1A 3AETB 3SHTA 3LUAA 5INTA 4KPYA 2J0UB 4AZ3A 1JFLA 2RJOA 3LY7A 4E08A 2XY4A 1UQUA 4JXKA 4CR7A 5B36A 3VNAA 4OA5A 4OM7A 1YB2A 2EJUA 5E9AA 4RETA 4CU5A 4IFEA 4MQFB 4BECA 1GUFA 2CLDX 2X4DA 2G40A 4HVLA 3H8WA 1XLVA 4CDGA 4LHXA 1EEXB 3INRA 2Q8NA 2ZPUA 4TLEA 5CW1A 4JVMA 3ZR4B 3A9UA 5GIPE 1PJ4A 2NIPA 4J0CA 3W5VA 1U0EA 4LNUA 4AO6A 1KOGA 1WCWA 2IEDA 4M8SA 5AH0A 2E4ZA 4I6JA 3OEEA 2NN3C 3KTAA 1KMMA 2V45A 4EI9A 4BRSA 3G68A 3KVNA 4P3PA 4CUKA 3GFVA 2M98A 3OQJA 5FNVF 4BRZA 1K6XA 3PS9A 1Y37A 4L1KA 3WQQA 3CT6A 1AU9A 4BP9A 3OQPA 3SPXA 5IJZA 5JS8A 5KYXA 2NUBA 2RSLA 3A05A 4JJ6A 1YU9A 3KZCA 1SKMA 3O8RA 2VJAA 1E6WA 3VO1A 1Z0IA 1JH9A 5JMPA 5B4TA 3G7NA 2O3UA 4PC6A 4BQIA 4ZALA 2A57A 3L8DA 3A06A 4HS4A 1DJQA 1DHRA 1Y42X 2OM2A 4H6XA 1H1LB 4JQYA 3RLIA 3LUJA 5BN4A 2J46A 4RY9A 3MCZA 1IHDA 5EUCA 3T0IA 1HEIA 3FB1A 2XUIA 1TM4E 1PU2A 2W2LA 3SSNA 2Q5FA 3EDQA 4R1LA 4PSDA 4WN9A 3OQ6A 5DYYA 5LZ4A 2V3CC 2HK8A 2YINC 2VF8A 1VPVA 1U7PA 4AZVA 1L4KA 2FZWA 3DO5A 3UJCA 4BNDA 4BDSA 3LYAA 4D4GA 2QHXA 4TVSA 4YIHA 1U0BB 1X94A 1MKYA 1BVUA 3TPFA 3CB4A 3FCYA 4XUEA 4X85A 3R75A 5C1PA 3RWBA 1VSVA 2I2XB 3S28A 1NU8A 4H35A 5GONF 3BICA 5DNWA 4AL4A 1Q2XA 2HKIA 1UBNA 4BO8A 1OLSB 3D6FA 5SYMA 1L2TA 1FMLA 2XSZD 2D0DA 1RXEA 4EA6A 4BV9A 5A4IS 4ZIRA 4IYJA 4C08A 1KH3A 4HWPA 3ECCA 3I8OA 4YCNA 2ERCA 2O2XA 4UKDA 3EQ9A 2IYFA 1MIOA 1R0LA 2B36A 3OLQA 4GEKA 2GYUA 2J4FA 4MUKA 2ZM5A 2ERXA 3JD4A 1FDUA 2J5RA 1ZW1A 1AKYA 3V42A 2QUIA 3FNBA 1OB2A 2MYPA 6CHYA 1M72A 3HV2A 3IJPA 1T9BA 1WLSA 4NAVA 3C5HA 3GLGE 3W34A 3L6CA 1Z7GA 2SNIE 1LLCA 4DXAA 5F21A 2Y6VA 1QGOA 3FNEA 4G8JA 2AI3A 4G01B 4A0RA 4G5FA 4NKRA 3HA5A 2A1TS 5CEFA 2QE6A 4R9RA 2WUFA 3TUIC 4LQ4A 4POOA 3E1KA 5KOJB 4UUBA 3B9BA 4NBSA 5FJIA 2ZB4A 2ENWA 1NF3A 3ROZA 1G8GA 1D2HA 1N75A 2BFEB 2OBYA 4UAGA 1RYNA 3LD9A 4MQUA 4W5JA 4HRYA 2QD1A 2JLRA 5CAEA 4ARVA 4QWWA 4KLZA 5E38A 1DG3A 1QRRA 5AUOB 1P4JA 3SEQA 3QSYA 4UTNA 4JFRA 3EGVA 1NF2A 1GUDA 2P6PA 1Y3IA 5FLEX 4FFPA 1A9QA 1IN6A 2VPIA 4EG5A 4DUYB 5CFRA 4LV8B 5SZJA 3TIXB 1AD2A 2GSDA 4DDVA 1PJCA 1XCOA 2PMDA 4PG4A 4M1TA 4PO9A 5LP6B 4DLPA 1HG0A 1W0KD 4J1TC 4NCHA 3GR6A 3RYIA 2ECFA 3UMCA 4X54A 5KQPA 2HRQA 1JEDA 5G4KB 2C2YA 4BNWA 1AB5A 3GG2A 3OF2A 4HV4A 4FZ3A 1X74A 3C5CA 1QQ5A 1RI1A 2GFHA 2UVQA 3SKXA 2GRJA 2FSSA 1URPA 1PVOA 3UAZA 1ECPA 2PGXA 1GV1A 1C2YA 3BIFA 4HH4A 2XNHA 4RVDA 4EKYA 4W99A 1FK8A 5B7GA 4NBLA 1P1BA 4BGUA 4E1AA 2BI7A 1PK8A 1THMA 1EFVA 3B8EA 1SOUA 1GNTA 3DEHA 1ISRA 3ZV3A 1VI6A 3WWPA 1YB7A 4DM3A 3PU6A 1OTHA 4IO0A 3CWQA 1MHPA 3GZNB 4DA8A 2AG1A 1M2OB 3MB5A 2FW9A 3R3WA 2JFGA 1EP3B 1PLJA 1QH8A 5AOCA 1OT5A 2SBTA 5FJJA 4NPCA 1KHHA 1Z29A 2CLMB 3UMRA 2BI4A 5FAKA 2I4IA 1ML4A 4DOMA 3FNQA 2FEAA 4LJSA 2QLTA 1DC6A 2ROQA 1MH1A 5I9MA 2PSJA 3ZXXA 2GX6A 3CUVA 3OO1A 4F56A 4ZAXA 2WE7A 2QUBA 5JAMA 3A6EA 2FRXA 4JMPA 3GLFB 2E87A 5AHWA 3WMFA 5K99A 4DLTA 4HO1X 1T0IA 1YFLA 3P20A 2H48A 4MW2A 2FXVA 2I33A 2HNBA 3OO0A 3BGIA 2YZMA 1Q1BA 5JCJD 3HA7A 1Z62A 2V65A 5CNJA 2CBZA 1SXGA 3ADKA 3FNFA 3G8DA 5L3VA 2A4MA 1IH8A 4MGYR 3TQIA 4BE9A 5BNWA 3H9UA 1U2PA 3IELA 3NVMB 2RHRA 3P1JA 1IQUA 3UPDA 4H16A 4PQGA 1NVTA 4RD2A 5IDQA 2B34A 3TLCA 2P9JA 4ALIA 3ZE9A 5GIOE 4AT1A 5FFFA 1O87A 1OTYA 1QG0A 3AJAA 4AP5A 4RA6B 3LG2A 5DM1A 1YJXA 5C51B 1GL6A 3F6PA 4TKUB 2IF0A 8OHMA 3DE7X 1XPUA 1LTQA 2LTAA 2X1HA 4J4TA 3PEYA 3JXEA 5JHGB 3GPLA 1JALA 2QB5A 3QBVA 1XMOB 4CKEB 4ZODA 3ZCRA 4BJ3A 4MS3B 4V2IA 2H2DA 1II9A 4OHCA 2V1UA 4AJNA 1SPBS 1SCBA 5B1DA 1R0XA 3JWJA 3E4DA 3Q0EA 4YFVA 5JCPA 1LI7A 1PR0A 4BMOB 4E13A 1UMCB 1ZUHA 1BQ3A 2BJWA 4PGGA 2HGSA 1IOVA 3ZV4A 5HFNA 4DSAA 2CE7A 3QITA 1SK8A 3K5PA 1Q0TA 2XZPA 4HEJA 3VNUA 1XTUA 4CZ2A 1TC1A 3RFFA 4EPVA 5FT9A 4M1WA 3UJ8A 4O2AB 2ORED 4BEBA 4BE7B 4M8KA 2ID4A 3S5JA 2IBSA 1OREA 1G3RA 4EAQA 3OWHA 1CBUA 1JSLA 2GASA 2A0XA 4FDUA 3ORQA 1Y7HA 4B7AA 2IYUA 2LRHA 5DRTA 5BVGA 4QD3A 2FMKA 2HPVA 4BU0A 2J59A 4ND2A 3WNCA 3SWWA 1XRJA 2NWQA 2FA9A 5AOBA 3GCGA 3NTRA 3DF9A 3KZNA 2HNKA 3FWHA 3PGA1 1FFCA 3UTDA 1S9HA 2ZRIA 1CHDA 1LB1B 3EEIA 4II2A 3T3IA 4CF5A 3THWA 2ZUEA 2I9KA 1TK9A 3P4UA 3UJAA 4D7AA 3N2LA 4N5HX 3WLNA 3DZFA 5JNSA 1D2NA 4PBTA 1DSSG 4Q9JA 5DT9A 2ZRJA 2SKDA 2R6HA 2P2ZA 2QU8A 4MUAA 4QHTA 4UD6A 2IV3A 5LP1A 2ZVQX 2A88A 4NCXA 4LF6B 1G2PA 2IUTA 3EIQA 2LDXA 3R0QA 4KVGA 5A3RA 3UMGA 2R6ZA 2IY9A 2BAGA 1P61B 1AK1A 4NFYA 4RV5A 2BSXA 3JQ7A 2QNRA 2QYTA 1S0UA 2QP9X 2WG2A 3IMCA 3VNRA 3W7BA 1XJ5A 4E5DA 5JYBA 3GQBB 3OZAA 3N6VA 4QO8A 4UHEA 3OF3A 1D1QA 1HLFA 2PUDA 1ACJA 4QBTA 1O4WA 4PYNA 2Z2ZA 2IFTA 2YZNA 1JX6A 2P3OA 1P9NA 2V6MA 5CT8A 5EHGA 5TQJA 3REGA 2FY8A 3TSAA 2C0QA 1X39A 4F1JA 2DGDA 4Q47A 1W6RA 4YAUA 3A0RB 4BAGA 1YGPA 3HSSA 4BDTA 3HCAA 3DLHA 2G07A 1IIBA 1Z38A 3I37X 1U2TA 3EQ8A 2H8GA 3GDHA 2BJVA 4GNKA 1ZRMA 2ID9A 1E3TA 1N2IA 3RFXA 2CL7X 1OD6A 4P83A 5EEGA 4MULA 4EY6A 2WOOA 3LUBA 5FI1B 5CFPA 2CXSA 1E2FA 1PJ2A 2Q6OA 3PC8A 3RCBA 5ELXA 4YASA 5K8IA 3LY9A 4BVAA 3JD2A 4AX4A 1ICIA 4G9GA 5ALWA 3V9PA 3FPSA 4FNAA 2I54A 4BQQA 4F1KA 3CFYA 3DOFA 1T5DX 4RGBA 4KIGA 5KU1A 3JVEA 3UHPA 5AW6A 4LJRA 1JXOA 4TMYA 2G04A 3ZWCA 5CYGA 3TOSA 2XYVA 3AL3A 4EY7A 5DX1A 1MJHA 4BNIA 4BWGA 1AN9A 2C3YA 4HLUA 3DNFA 4DM4A 2ZDGA 1ILEA 2E6KA 3ZNPA 4DA7A 1DAHA 3IB6A 4J7XA 1P2BA 4XB1A 4QVGA 3OH8A 3ZDCA 4AF8A 2AFHA 2H07A 4H7KA 4IKOA 4URWR 3QE3A 1E0JA 3DXYA 2H4FA 3Q1KA 4KWTA 2AS0A 1SK9A 1A9TA 3QPVA 3V8MA 2GEVA 4S24A 5P21A 2A0FA 5DWQA 3VDXA 4BPRA 4UBKA 4HGQA 4QJ5A 3CLUD 3KQLA 2AVNA 2QTCA 5AM4A 1F60A 1ZICA 3U9TA 4R31A 4D81A 1VLHA 2IYRA 1TYAE 2HHLA 5L95A 2P2SA 2M9MA 2OQVA 5EUMA 1UJ4A 1GPAA 1RLIA 1V8BA 2E37A 1FP2A 3INNA 2QK4A 3FPCA 2FV8A 1H5UA 3CZPA 3GLHA 1ORVA 3G2LA 5F77A 1E58A 3SMQA 4E32A 1RC8A 2JDID 3IX7A 3PNKA 1E64A 4Y6RA 1FLNA 2XNCA 3U3MA 4E11A 3ZJTA 4TYWA 3TDNA 1HA3A 3NEYA 5M29A 1JU4A 2XTZA 4QBIA 1JEOA 2B5WA 3SYNA 4CT4B 1KERA 1DPFA 2WSSD 3IKVA 1OXUA 1A5SB 1YFKA 2PSEA 2Q4DA 1QE0A 3AF3A 3EVFA 1JXMA 2DFVA 2IYWA 3AF2A 3VBCA 3L6BA 5IN5A 2R1ZA 4IJWA 5ENDA 2XSZA 1WW3A 3DOUA 4L8GA 4LN1A 4K0KB 1QH1B 1UKBA 3ZNOA 3EY9A 1V7CA 4YI3A 1QHIA 1Z22A 5DJ5A 4Z86A 3TAUA 3AX6A 1EGVB 1CEXA 3B2QA 4L8VA 5T41A 5KIAA 4L85A 4HZUB 1E2MA 3B70A 1F2UB 4MQBA 4H0CA 4ROSA 4HR7A 1N2CB 3EE6A 4RDXA 1JYSA 3NTQA 4YT8A 5C3MA 1KI2A 3ZHQA 2AJLI 1JLRA 2IP2A 2DUUA 4L8YA 1JDSA 2Q3EA 1SXJC 3DR5A 3I01M 1W94A 2AG5A 3K1AB 3CKYA 3NU1A 1RI2A 3IAM1 3DT8A 5DGCA 5TB5A 3Q11A 3H2BA 1USUA 5LZ8A 3M70A 3RSOA 1WO8A 1T2NA 2YBEA 3W8NA 1XA0A 3AO0B 3H6GA 4R8RA 3SIXA 1Y7TA 4W5QA 5F7OA 2JGEA 2VXOA 5FQOA 1Z0ZA 1J99A 2VKQA 3C3KA 2GEJA 2H65A 1G20B 5EZQA 5DLPA 2JA2A 3MMPA 2PX0A 5FOWA 3RBXA 2RIPA 1RRPA 2O23A 3RS5A 2WJ3A 2Y1OA 4I4IA 2GUWA 5FBVB 4HH0A 4GLOA 5DNDA 4YCLA 3LHKA 3U4MA 4POAA 4DQXA 4X00A 3MZ0A 4MUYA 4ZOEA 1T43A 4HWTA 4OQNA 3N86A 3B5IA 1NULA 2ONZA 3EULA 3K09A 4XCVA 2NSYA 3Q8WA 5A9RA 2D2VA 5C4GB 4TQAA 1D4ZA 2GK6A 3UBMA 5IS2A 1KMHA 2J5XA 2FLWA 5T4HA 2XAAA 2KSQA 3K9FC 2O20A 3GP3A 1XU4A 4LKOA 4GZ6A 5E4FA 1EIWA 1E99A 2G77B 3VX4A 4OLHA 1HZZA 1GZ4A 4WFJA 2P4EA 1SXJB 3ROTA 4EB8A 5AD1A 5AESA 1FP4B 4WNYA 1TIPA 4NEHB 3VPHA 1K6JA 2JI7A 4DIDA 4GMFA 3KOMA 3IDZA 5L3SB 3KV3O 4MDEA 4QYSA 5GAJA 3PVSA 1IXYA 1TPZA 1UMDA 2C2MA 3IXMA 1BMFD 2QZZA 4FVTA 5EWMA 3NVDA 3W9SA 1SCIA 2X8AA 4PO1A 4BV8A 3PUJA 4B7ZA 4DR7B 1ZD3A 5EPUA 1UC8A 2CZCA 2Q9UA 2NU7A 1VYTA 3I2KA 4L4SA 4ENUA 4I2NA 1E3WB 3ZC3A 1QCDA 1IM8A 2X23A 4NABA 4RD6A 1FJ2A 4UEWA 4M9RA 3VYWA 3TPZA 5BR1A 3TCKA 5BSRA 2UYGA 3K32A 5BR7A 1QBKC 1CZHA 5DLYA 4BMDA 2HJGA 1I01A 3WLPA 1V37A 3L8ZA 3H4IA 2EFHB 3FKQA 4ND1A 1IE3A 2GTPA 2WEKA 3NM6B 3O4HA 3VHRA 4FLEA 4KE9A 5BWOA 2QSZA 3V7YA 3MXTA 3SLGA 2FPXA 5SY9A 4OBBA 3VC3A 1CU1A 3HEMA 2C3OA 3CF6R 4HDNB 4GXTA 4G5RA 4RU1A 5ALOA 2FR8A 5LQKA 2B94A 1KI6B 1JKIA 3PYXA 2OKCA 4INJA 1YSCA 1FTYA 3I2YX 1G3QA 4N4AA 4WZBB 4KO2S 2AJTA 4QG7A 5ALHA 4F97A 1SXPA 1P1JA 3BGVA 5JCJA 2HXGA 5B30A 5UKDA 3S99A 2NTJA 4JDPA 2H4ZA 5G1OA 3BSFA 4D3YA 3VKHA 2XTAA 3MRXA 4OO3A 2XB9A 1K5DA 1ACMA 1ESDA 2YN4A 1Y5MA 4MV0A 4MI3A 4QSMA 5GJVC 5TY0A 2WR8A 4FS8A 3LP5A 4ALLA 2NMVA 3G8BA 2O8DA 2QROA 3H5IA 2BH2A 4DC1A 3WHIA 2AZDA 3RYFB 2R1UA 3UEOA 3VXKA 3D02A 3TX2A 2CF6A 1NRJB 3HBNA 3PEEA 4KB5A 5F78A 2XMQA 2A8YA 4R7ZA 4GI7A 1ZCAA 3AESB 3NHPA 3AHIA 1VB3A 4Y7CA 3PE6A 4RORA 2J5BA 4CL3A 3VOBA 3UYLA 2NV6A 4BKOA 2X0JA 5DE3A 1F48A 2CLCX 1UKCA 2DT5A 1AKVA 2X40A 1LZKA 2FQ1A 3A1TA 5K2OA 1V6CA 4X66B 1WF3A 2KE5A 4C4YA 1VBMA 3L7DA 3PJDA 1ZGBA 1ANKA 5E6SB 5IDWA 1B6GA 1U3UA 4ALNA 1Y48E 3GCDA 4DADA 3ZCUA 1KFKB 3INTA 1Y1KE 3CVUA 3VNVA 1IXKA 1S7CA 4WD3A 3GLRA 2Z5GA 3R3VA 1K08A 3AY6A 4G0YA 3TB6A 4BS9A 5KKNB 4FCWA 3KQYA 1HFKA 3UJHA 3MINB 4OHRA 2A1UA 4GR5A 5EY5B 9ABPA 2Q2OA 2J9RA 2WA2A 4RH0A 5BN5B 5FWXB 5GONA 3NHFA 1KZ1A 2O2ZA 4M0EA 4RBNA 3ODGA 4H77A 2X7JA 2GNOA 5FO0A 4QGSA 1TZMA 2IGTA 5AXDA 2WFLB 5BRJA 5AVVA 5K0BA 2QW1A 1U5BB 2ZVPX 3PHBE 5C31A 4HDKA 4EUFA 1UDAA 4WKGA 4UUAA 2RGRA 1K89A 2ID7A 3L4BA 4MO2A 5FUXA 1G2QA 2CT8A 1FP6A 7ABPA 2PKCA 4WZAB 1OFVA 3HKCA 4HGZA 3GMTA 3OCZA 3QVGB 4EF6A 4EO7A 1DAGA 3F2VA 1N7JA 3LA6A 3HMKA 1E4EA 1GILA 2ZJFA 3PDHA 4L95C 4LX8A 3RC9A 3F78A 1K0UA 1OX6A 4MGEA 1BWSA 2QLFA 5JMWA 1EP1B 5K6RA 2AMJA 1H85A 1F6WA 2ZU0C 3FUUA 3FPAA 4MCJA 3D6TB 2NVUB 3VR5D 4AWAA 2KPOA 3ELUA 2ZT5A 2HH9A 1EFLA 1II8A 4GXRA 3CGWA 1XTJA 1C1DA 4LA4A 1RYMA 4L74A 3BYZA 1DC7A 5K0LA 2C59A 2YYAA 1CJKC 2J3KA 3STYA 3ER9A 2ZYWX 2DFPA 5BN1A 1MPTA 3OM1A 5D1HA 3VTAA 3U6BA 1C7QA 1JJVA 4F5ZA 1NYRA 2PKEA 1B26A 1RW4A 5KYWA 3PNSA 4XASA 3QUAA 3E27A 1KEZA 4F21A 4RTQA 2IH2A 4BJHB 1LPPA 3NJ8A 1U65A 1NG1A 1KEEB 3AHHA 1SGWA 2UV8A 1FVOA 1RNLA 2ICAA 5CDTA 3LWNA 4MR8B 3AJEA 1C30B 3L8CA 4LF7B 2EFCB 4QPNA 4U63A 1KVRA 5U4XA 1E3JA 1ZCJA 3H19A 1FJGB 4U7HA 4OAQA 4Q4LA 4RPIA 1E3MA 4GI2A 1RU3A 5EIOA 1NI4A 1C9JA 1NNSA 1US8A 2XMRA 4IUCS 2J3IA 4WJKB 4Q4AA 5HZKA 1U7XA 3H2YA 3RVJA 3HO6A 4PW0A 5DIFA 4QBGB 3QTBA 3DV0B 3FYTA 2I4LA 2J3JA 3GRRA 1YBMA 3ROFA 1OXKB 1TECE 4ZXPA 4RTKA 4D4HA 2BDEA 2W2OA 4OQMA 2DKNA 3OZTA 3KKEA 3U80A 1JWBB 1EJ2A 3A70A 5FFMA 2XEXA 2W9XA 3AFNA 1ISMA 2JGDB 4L7QA 4JEUA 5CVJA 4ZEVA 2W83A 4ZXFA 3ADPA 2PMFA 3TF5A 1MT3A 1QGAA 2DAPA 1Q91A 3TNYA 2DFTA 1N36B 1W7AA 4KUGA 3KQQA 3IMKA 3IJ5A 3MT0A 4LEIA 3UWKA 4UHKA 4KO4S 4UREA 2ZQ5A 1TZ2A 2IYQA 2WRZA 5BYJA 3L04A 4Z1MD 1R0CA 4XVRA 4EKDA 1R8QA 1EWYA 1H69A 1TVEA 2VNSA 3DQQA 2FZCA 5FLXA 5H3LA 2CYCA 1Q0QA 1F0NA 4GKBA 2R60A 2ZUSA 2ZRMA 2B6NA 1D2RA 4QXQA 5BSFA 2PUFA 1FC0A 1BMDA 5DDIP 1ODKA 5K45A 1D0IA 1FUUA 4N3AA 3A6KA 3D2CA 2JDIA 2QAIA 1M8KA 3NASA 4BMPB 4BEJA 3ZZ1A 4QREA 4JHXA 1PTJA 4V1CI 2DWOA 1AB6A 2FB9A 2NQ8A 2A7XA 2HU5A 2WSSA 2Y0EA 3JQQA 2H4YA 4FFBB 4QOGA 1OROA 3O3OB 1COZA 4JQZA 3V3TA 3RTDA 4B80A 3OOEA 1TOAA 3WNQA 1G9TA 2J3HA 4D9BA 1X38A 5JECA 1LBTA 3DL7A 1B7GO 3WI7A 3WWDA 4C87A 5KNDD 1CEEA 3G0IA 5AKKA 2XRZA 3AGQA 3HADA 4U8GA 1W85A 2ADMA 2VF2A 3CINA 4XD2A 2NU8A 2H1FA 1OIVA 4V02A 1YZFA 4I1UA 1TCAA 4R41A 2YJGA 4I3HA 3VU1A 2FUNB 2D1TA 2Z6UA 1VXRA 2NTVA 3B85A 1FYVA 2X9VA 2VNJA 4JJGA 3MHTA 3E0XA 3G9TA 3P9CA 3DZGA 3PEVA 1P6XA 1FFEA 1NC3A 4G0WA 3C4JA 1Q0UA 4EUNA 2C2HA 3R5KA 4PLWA 3WBKA 3PSAA 4KWIA 2OGUA 1NQXA 4YX9A 4YJFB 1TJNA 5A06A 2K6GA 1RIFA 2NXNA 4RTPA 2AWOA 2LZ0A 2ZRAA 3KJFA 3L92A 3NFRA 3QXJA 3ZS9A 4LFCB 1KMNA 3H9BA 3U44B 1KIAA 4K6GA 1FX0B 4X65B 4QASA 1J0AA 4A82A 5F5XA 3NRBA 2CMDA 3WGQA 1G291 3TOCA 2ZBEA 4EMBA 3G3EA 4M88A 3VH2A 1BKSB 2BC9A 2X6QA 3N53A 3P9SA 3DLAA 4CI9A 1QIHA 5IUNC 1YL6A 3ZI0A 3R6GA 1JG1A 3WGNA 2J3MA 5JZBA 4LCBA 2G28A 3AH8A 4UEKA 1P7YA 2Q8QA 1YJAA 5HQ3A 1JQ3A 5B7PA 3I39X 2DJ5A 1GT91 2Q1SA 3EG5A 4MVJG 4OSOA 4QPJC 4ZCMA 3O4RA 1J2TA 2V3WA 1BN7A 3NOQA 1E98A 4JP1A 4N18A 2PO7A 4QICA 3GXOA 2YYYA 4CLHA 4N6OA 5HWSA 2BGGA 2YXBA 4IUYA 4K3UA 4Q3OA 3OZXA 2W6OA 1QIDA 1NVMB 4JR0A 2CFTA 2IS1A 5T5QA 3ZDRA 4N3CA 3IVXA 3L0CA 1ZVVA 4REMA 5DOZA 3TD2A 2PBRA 4LZOA 2AI2A 2HNAA 1I1NA 3GRVA 5BQOA 4A0FA 5BXYA 5HUJA 4WUTA 4ZC8A 4OMFG 1QV7A 4ZAVA 3JASA 2NSDA 3IEVA 1TUEA 3FSEA 5NULA 3HRHA 1NE7A 2HDOA 1G5TA 5A5EA 1BMFA 2LBPA 1Z4OA 2GYVA 3HY6A 2C99A 2JFFA 3O1IC 3O95A 5EWJB 4B5LA 3WGGA 2AV6A 4Q4JA 3FDIA 1Y9AA 3VM6A 5IU6A 3C1UA 1RCFA 2XNSA 3DE0X 4MV5A 1N4AA 4OQEA 1XV5A 5J2TB 1RADA 1FRZA 2OVBA 2VP4A 3I73A 3JYQA 5LDGA 3C4VA 1PJQA 2KBEA 3ZGXA 4CR8A 4ZI7B 5HS4A 1NVKA 4OYYA 1WXWA 3T5BA 2REOA 4FNMA 2WVJA 1TW3A 3PGKA 3AT1A 1U8FO 1B42A 4CL8A 3W5DA 2XWBF 1GR1A 2GVZC 3EDCA 3I76A 4ZRMA 3B78A 4MB0A 2VSNA 3OBBA 1DXYA 4OREX 1I0LA 2HCFA 1NM5A 3F4LA 2Z30A 2J0QA 1A27A 3E5MA 3REQB 1C7EA 3BDIA 1Y9EA 4YT5A 1J0CA 3O26A 4QNNA 3THRA 1GCUA 3N8KA 4C3OB 3ETNA 1IJFA 2JAHA 4D8UA 3GUYA 1JVSA 1GPMA 1KDTA 3IDQA 1JG2A 4GF5A 4P38A 1S2DA 2HA7A 2ZP1A 2XW6A 3FCCA 3G7SA 3PXGA 4OL9A 4ZEXA 3VO9A 4BCBA 3LDUA 2L2QA 1KXZA 2DH5A 2QPOA 1V8DA 3ZDDA 3ITKA 1PQYA 1TIBA 4QOIA 2PNJA 3CN7A 1ADJA 4WK2B 5FWYA 3C8MA 3HUUA 4AAYA 2IWHA 3A6HA 3COZA 1G0NA 3FHCB 4JASB 3DPSA 2AFVA 3MVEA 4PZAA 1GPBA 2O2JA 3PWZA 3OURA 4MW4A 3HBLA 4AICA 4PQEA 1LW6E 2AMVA 4JR1A 1N3LA 4C6RA 1JRLA 4KLCA 4UNIA 2OCAA 3VU3A 1DQSA 1MHTA 2P3QA 1I9GA 4U7WA 1UFRA 2ZJ1A 1VGRA 1BEUB 1XEAA 1SA0B 1MFPA 3D43A 3Q3JB 4MDYA 5HZGA 4TROA 1B1CA 5J2UF 2VSOA 2HA6A 4K40A 2OGWA 2QRPA 4RULA 2C7QA 3JRNA 4NX2A 3ADCA 4RF2A 3VPGA 4J43A 3L7YA 2ZJ0A 4L15A 4B85A 1W93A 3DWIA 3PYLA 2AUNA 2HJ9A 3AY0A 3RODA 3ZV6A 1KJIA 1QFXA 1XCGB 1X1QA 2YJ4A 2ZDHA 1G7CA 3OEHD 3P9YA 4INOA 4P4GA 3BXGA 5CHYA 4DG9A 3C3PA 5TQ0B 2Z3WA 5L45A 1LNQA 1QYDA 1L4UA 5CGZA 4HX9A 4CV3A 5ICMA 2IITA 3M5PA 2BGTA 4D9HA 3CLTD 3IE0A 3WL4A 1ECJA 4HPJB 4BGEA 2JGRA 3BDAA 4AS3A 1B74A 5MFPA 4DCVA 1YE3A 4IUDS 1YWGO 3O7WA 4MKXA 5E0KB 4GL2A 3E5HA 2VTVA 1L6RA 2VKTA 3TNLA 4OUKX 3KU1A 5DN9A 1N2BA 1G8YA 1UPFA 1CJSA 1RXUA 3BB4A 3BTSA 3SQDA 1Z6PA 4BKPA 5E1DA 1FRVA 5E7MA 4D8WA 1K4KA 1RZVA 4WMLA 1P1FA 3O90A 1XJ0A 3AVPA 3O93A 4A8PA 5FX2A 3Q0TA 4AS2A 2Z2KA 3T5PA 1LVHA 1DBWA 3FF4A 3TNFA 1WB4A 2VK1A 1JLKA 2WILA 3HFGA 1F8UA 4Q3AA 1LJUA 4TQGA 3VHQA 4EHKA 3LLSA 2XAUA 2I8LA 5D8DA 3SQMA 2GXQA 4XVCA 3LVRE 4XPIB 1PL8A 2L19A 4YN3A 4DCOA 3MILA 4EY3A 3PPWA 2OWDA 3MAJA 4HN2A 2G6BA 1RLOA 3WV5A 2FPMA 5A62A 3VH1A 2NZVG 5F12A 1JIJA 1GXSA 1ODJA 3NM4A 4HWSA 2TMYA 4M0FA 4DLLA 2PBZA 2OY0A 3KKOA 4Q9IA 5GZ3A 3I45A 5I4BA 5L6MB 1DJNA 5DYGA 3FUTA 1LLQA 1W96A 3K2EA 2E55A 3LXRA 2IZ1A 2LCIA 1L8LA 4J16C 4MR9A 5IVIA 4BO3A 2ZM6B 3K70C 2HWXA 1SC9A 1SCNE 4IHJF 4NQZA 1I3OA 1W36C 1N9GA 1RWBA 2YFHA 3PHLA 4M9XA 3D8NA 4N0QA 3AM1A 1U1DA 4HVAA 2PMKA 1U3FA 2VATA 5ALXA 2R9VA 4YAWA 3V1MA 1WPXA 4DN6A 5KOHA 2QJFA 3CZCA 3I6ZA 3QUBA 2JLCA 3GHHA 4TUYB 4FR5A 3CG4A 5DTJA 4FJ0A 5DASA 4EVQA 2CVFA 1HDYA 1OBHA 4FYIA 2C5EA 1BE0A 4OHKA 4D0GA 3EVNA 2H1IA 1ID8A 4HDSA 2R7NA 4TVKA 3Q9SA 2X4LA 1TM1E 1R0BA 1DOAA 2EQ5A 2CBXA 1A9XB 2F3RA 4QU9A 5LSAA 4V0OA 3EXHB 4W1RA 4OAOA 4F5WA 2WWHA 1P2DA 2DHEA 2WDPA 3WKEA 4E3ZA 1NYQA 1T2VA 4N41A 4O2AF 4EYKA 3OLYA 2GZHA 4Z1MA 4BYMA 2ZWVA 5F1PA 3FD8A 4PAWA 2OXIA 1FUEA 2R8YA 3OLXA 1TK2A 1FQKA 4G1BA 421PA 4MQ4A 1DS6A 1ELOA 1JYFA 4RHCA 3K72B 4LRTB 4L78A 4Y6SA 2XGMA 5IDXA 4QUEA 1D09A 4P7BA 3K70B 1SU8A 2ZSJA 1JFFA 4NS4A 2YHUA 4ZZ2A 3CY6A 4ABYA 1TJ3A 3T5AA 1RT9A 3D4PA 4DMRA 2NV0A 4PG5A 3K4PA 4RYDA 1GZ6A 3KE9A 1V11A 1SU6A 3AEKA 2IV7A 1JT2A 2W58A 2WQ7A 2PPLA 5DHAA 1CRQA 4ABTA 4KTVE 2M6LA 4FYHA 4IG4A 5KMGB 5C1BA 4XLZA 3ZVKA 4QYIB 3OTGA 3FGNA 3FJYA 3GP8A 3U7JA 2QTNA 3M82A 2ZTLA 4JGIA 4J4HA 1UOOA 2ZYAA 4NECA 5B6JA 3CX8A 3OCYA 1YAJA 4HB3A 3NR2A 4WBNB 2P0EA 5KNDA 1ADYA 1PL7A 1DINA 3SFVA 2RC6A 3ASYA 1I6LA 4CLXA 2ZS8A 5E9JA 4P84A 1YI0A 4XIFA 4URHA 1U0RA 3HACA 5AKEA 4A6PA 5IYZB 2PQ0A 1ZGZA 1NNUA 1JAZA 2O7SA 4HNGA 5KYUB 5KU7A 4EJ2A 1JYEA 1PVVA 3RRMA 1AF7A 1IUOA 4WEOA 4EPTA 4KSBA 1ORRA 3EZLA 3TI9A 1JNYA 5FLKA 1ZL2A 4HNQA 1CZNA 3I6MA 5EIHA 4LBWA 5I9BA 1JZQA 1MJGM 4QYWA 4X3OA 3R3HA 1CY1A 4MWGA 3ANXA 4LECA 1AGNA 4CM1A 2GA9A 4CUZA 1MEEA 3ZLUA 1RBQA 1V5FA 1FMCA 4P7GA 4IQ8A 2YDXA 3D6AA 4XGQA 1TU3A 3TIFA 4QDJA 3SHVA 3GC6A 3QBJA 3QEAZ 4AKTA 2QSYA 1Z5PA 3IQZA 2G8NA 4NATA 4BB9A 2W48A 3SS7X 3WLOA 2RCNA 2OZLA 1S2GA 4TXNA 3BWEA 1Z17A 3FFTA 1ENOA 1J1IA 2PZEA 3AYXB 3H2JA 3NDIA 4FEEA 2WKPA 3MYRA 4WINA 4YK7A 5B53A 3OZ7A 5AW3A 3KD3A 2VYCA 1EFUA 1Y4UA 3DPUA 4JKIA 3T4PA 1O6ZA 5C8VA 1GTJ1 4DQUA 2Q21A 3LY5A 4NONA 4UHJA 1DMSA 1KI9A 2WJ6A 1U1CA 4XEUA 4CRWB 3C15C 3GRYA 2AMFA 2B9VA 3NIGB 4FGWA 5THQA 5HRCA 2BFPA 3F98A 4GI5A 3BK7A 4QVIA 2YOHA 4QUJA 1G60A 1FFHA 2B9EA 4FDVA 1EGMB 2UUCB 4Q1FA 3I6QA 5F1OA 3AU9A 1V26A 4B8ZA 1IVYA 1ADFA 1XAHA 3PQ6A 1X7ZB 3FPGA 1R5BA 3F96A 1DAOA 3ZEAA 5JW6A 1N2CE 4LVNA 1EDBA 4P4SA 1I4EB 1V35A 3OT1B 3MGCA 3PVCA 1FUYB 1K06A 1G5QA 2ZUWA 3JALA 3VMMA 1P0QA 1D1SA 3ETGA 3MS4A 4FHCA 5H59A 4BXOB 3G1WA 2XXBA 3N5CA 4S1NA 3EF1A 2AOUB 2H18A 5C5CA 3PLNA 4F92B 5L51A 1FQJA 5DYTA 4Q6WA 2VT3A 4XIGS 1Y33E 1DDGA 4EUSA 3W2HA 4F2WA 1QE3A 1TQ8A 1Z3IX 3GLUA 4PPGA 5IKMA 3GLIB 4FQ8A 1HMPA 2LP4Y 4EF4A 3IGFA 4JWKA 1OA0A 2GM5A 2XKBA 3G2OA 1E5VA 1QPGA 2NXWA 1UBOS 3OIDA 1XZMA 4QGHA 1TT7A 4PLHA 4IJ5A 3WGTA 1P6UA 3EJWA 3GEEA 3AVWA 4UTXA 1CQIB 4KXNA 2GN9A 2E4AA 4DDWA 1ZQ1A 4JMLA 5IH7A 2OAEA 4X8LA 1L0BA 1XCMA 1J6UA 2GCPA 3A2NA 1PQ4A 4BO4A 2OD7A 4XDGA 1E7QA 4MKGA 3BMXA 1R9MA 2Q41A 2VL7A 3K2IA 4RVOA 3M4YA 4WGFA 5JMTA 3FMIA 5D5QA 4MRAA 5FPHA 3IXLA 2GQ0A 4NBTA 4TWJA 5IDYA 3GI1A 3SEZA 5LJIA 2D1FA 2YWDA 2QR3A 2XH8A 5GGYA 3MWLA 3MF4A 4LRYA 5JYCA 4IIDA 4PVCA 2ZTUA 4XX1A 3WADA 4DCNA 3HG7A 3PWSA 1E7RA 2HV8A 1JECA 1EMDA 2YJNA 3DBRB 3I2FA 3L7KA 2VZ9A 4JP8A 4C0BA 2OYSA 5K8LA 2X3YA 3BB1A 4GX5A 4IDGA 3U1VA 4E5MA 1Q83A 3ABSB 4W8HA 2HLNA 4QECA 5LQAA 2W4QA 4HAOA 2J07A 5JD3A 1A5BB 3KR1A 4ZO9A 1HSOA 3C3DA 4KL8S 4Q24A 4KMRA 2JATA 4JC5A 4UXJA 3F6BX 1GN8A 1K7EB 1U04A 3QMPA 1UBSB 4L07A 1UK9A 3REOA 1NW4A 1FDOA 3AHCA 4CTJA 1QZ3A 3D7SA 1R37A 4E5NA 4LG1A 1RAFA 1SD1A 5EYPB 5HW0A 3PIDA 3R09A 2CCKA 2XA2A 1WWKA 3V1NA 2GVDC 4BRUA 1BVHA 4GMHA 3CH5A 2WIKA 3RTEA 2P4HX 1W25A 4MXDA 4J91A 2FRDA 4NJEB 4NMHA 1K3FA 5C5EA 2BBWA 3E4CA 4UQPA 1M5RA 4R2MA 4H7FA 4QA9A 3HK2A 1EQ2A 3K8OE 1NQTA 3PQDA 3QX7A 3K16A 3BCRA 4ERNA 4IIEA 2PPVA 1VYVA 5IMBA 3GJ7A 2ZWAA 1OBFO 3OEHA 1N6OA 1KZYC 1II0A 4FJ1A 4B3IA 2OSVA 4YJ3F 2IOFA 2Y27A 1WXQA 4PFKA 4PSCA 1MC5A 2IOFK 3TFWA 1JILA 3KZXA 5SV2A 1LBEA 2LV8A 4XX0A 4YXFA 5K7SA 5EKUA 4M4SA 1YB6A 3L05A 1BIFA 4E94A 5A2QA 3HJNA 4XQGA 5DX8A 1XAJA 4ACBA 1J90A 2IIPA 2R87A 1QTRA 3ESZA 1H1TA 3EVDA 4N8EA 4CR6A 1NJGA 1X9GA 1U28C 3ZIAA 3ORFA 1TEVA 3S68A 1X7HA 5CT5A 1FFGA 3N8NA 5FF9A 1G19A 3SZ3A 3DCIA 2OB2A 2J0UA 4F6LA 1T1IA 2FZKA 2HSJA 1L3IA 1D2EA 1ZX1A 2O4UX 2VWPA 4MH0R 2FW8A 5EL0A 5B3LA 5CB4B 1TZBA 2VN8A 1GRRA 1ZUWA 2Q1XA 5E4YA 3BD7A 1I14A 4X0EA 1QU3A 2EU8A 3VR4D 5BSUA 1WMSA 1PNTA 1X77A 3KT0A 2GNAA 4DW8A 1JFRA 5B3KA 2FLVA 3SYKA 5IBQA 2W2XA 5C8XA 3RROA 1DCKA 2MU1A 2EEZA 1JL3A 1N6IA 3LK7A 3QM1A 4Q00A 4WAUA 4EX7A 4F9TA 5KNDH 2Q3LA 1AUXA 4BTEA 4EJ6A 2J33A 2YWRA 5C18A 5JSUA 2ACVA 1UWVA 2E89A 3NT5A 1YONA 3QVUA 2ZR0A 3R9IA 3L43A 3I53A 2BDTA 3PFBA 4CIXA 2FX3A 3UM9A 4AUMA 3SYRA 1IWBB 2BMDA 2YIVX 3EPPA 4R16A 3ST7A 1Z6AA 1GLNA 1OI2A 4KQIA 4PO8A 4PTYA 1JPVA 2IKSA 4N01A 1ZMTA 3TTXA 1SKQA 3UK1A 1YDEA 4DNFA 1J8YF 1MBZA 2DVMA 2PKQO 4FHDA 3E70C 4H15A 1Z08A 4RSGA 3AEYA 2CHQA 2JLAA 2MJLA 2PH7A 3TTUA 1U2GC 1UADA 3V4PB 2GK3A 3VI4B 3LC2O 1VJCA 2HO4A 4MRMB 4R8MA 5I3ZA 2AEJA 3AFGA 1M0EA 2HCRA 1CLEA 2C4TA 4ARAA 3ESAA 2RJNA 1E5LA 4CIBA 3L0PA 4C30A 1MDBA 4IJKA 3NKLA 1BKYA 3O0TA 1AQ6A 1Y81A 3TW8B 3U3DA 3N59A 4FYVA 2VBFA 2VPXA 5E4JA 1R66A 1EVYA 3HQ4O 4WZAE 4IOMA 1GD1O 1NMXA 5LVAA 4ZO7A 1RXCA 1RWVA 1RC1A 2ZIXA 3OE7D 1PGJA 4MPDA 4TXMA 5DW3A 3ZHYA 1RM4A 4UTOA 2OPBA 1E1LA 1D2GA 4AY4A 2J7PD 6ABPA 3U7FB 2WKSA 4HN4B 2CVHA 5FA6A 3RSFA 4H4DA 1AJEA 1DUVG 1G5HA 5JDCC 2FPOA 3IJEB 3MWYW 1Z0SA 3JQDA 2XQFA 3E03A 3VV2A 4B2PA 3OQ1A 1ZZGA 2EKPA 2OYCA 2I3ZA 1JGTA 2AW5A 4HRAA 4F60A 2RHLA 3F2IA 1VECA 1E8MA 2DG2A 2ZOSA 4EKIA 1E9VA 2EQBA 2Y2VA 2JEZA 1TNDA 4MVYA 1EG7A 4RACA 5LFAA 1ZLXA 4XFJA 4YDQA 2NTYC 4C4OA 3L6EA 2P2YA 1E6MA 1KY2A 1Y3BE 2PH1A 4F2HA 3Q8MA 2XR1A 5A7GA 3ZW9A 2EP5A 2ZUTA 3D8UA 2R1VB 3QOWA 1VBFA 4HG2A 2GR9A 4NU6A 2WD7A 4HFRA 5GM2A 3NHYA 3FOZA 4YNBA 2SKCA 3GJZA 4Q34A 2WDZA 3AUAA 1EI9A 4KVZA 5IDVA 3EGCA 1RKXA 3SBXA 1ZUNA 1FNSA 3M49A 2VEDA 4GZMA 4J1SA 4PLGA 1QHSA 1L5SA 2F4NA 4HTFB 4MCIA 4K6MA 3VPCA 2EDAA 5LOVF 4RTOA 1XLUA 1EVQA 2JPDA 3H1PA 3CUEF 4EYEA 1KH2A 3SFTA 4EW6A 2CFSA 1CJTC 1OZFA 4RLFA 1Y5LA 2PLAA 3JVUA 5JY6A 4Z4EA 4JJKA 1NVXQ 1Z4NA 2QXYA 3LGAA 2O8FA 1LRLA 1H6BA 1A7AA 3DBLB 3WAJA 4QX6A 1Z45A 2XUJA 1NE2A 3JYHA 2D13A 3R77A 4CKCA 1U9ZA 2QJWA 4IRXA 2O1EA 2WJAA 3UAVA 1VZ2A 3GT7A 2CV2A 4K6OA 3D3NA 1CNFA 4EYOA 5IULC 2CKDA 1KAHA 1H5NA 3WXMA 3KCNA 3IR7A 2HQSA 1U6JA 3QBTA 5B1HA 2OZKA 5AJYA 3UAOA 2QYOA 4IIXA 3UYKA 4EHJA 3OC6A 5J2UA 5JJIA 1T9GS 4PN7A 2RHJA 1OOEA 2WJZB 4L4XA 1XD2A 4MV8A 1D7AA 1SXIA 2ZR9A 4I9GA 3DFFA 4Q7JB 2WAYA 2OXTA 3SZOA 3V46A 4FSXA 1XTVA 3HWWA 1I30A 3G2MA 2QBYA 3MWGA 5DTRA 3GRUA 3TRFA 4RH1A 4IDHA 3QGMA 3GZTB 1HORA 2GPNA 2PX3A 2IJGX 1L5HB 1Q7GA 2GLXA 3C16C 3DM5A 4HDRB 1YUNA 3TKYA 2B2CA 3TPCA 4M87A 4C9BA 4CI0B 4CQLB 4RCZA 2HHHB 1B23P 1MB9A 1MZPA 1WNTA 2RHGB 4I9UA 3IVAA 5EI5A 1VRCA 2VBGA 4LJ7A 4BLWA 2O0LA 3IBCA 1J0BA 4G4IA 2P69A 4XKJA 2VI5A 4CU2A 3AIIA 2AG0A 1WSDA 2V8OA 3HJRA 3HSKA 3NHMA 3SLRA 1NMYA 4ZCPA 4BIMA 3RAGA 4DYVA 4ZYUA 5KTTA 2W6QA 2XRMA 1SEPA 3WTCA 3UUFA 4ER0A 3LBYA 4R9VA 3G02A 1KRXA 4XGKA 2KJQA 2DPXA 3CKLA 3EXFA 2C1ZA 3RW9A 2LR0A 4YQEA 4RZHA 1YVEI 4IJQA 2GM9A 3M3DA 1C7FA 1HYEA 1E5TA 3EZFA 4IKEA 4FDAA 4OYHA 5I7AA 1FYDA 2NU6A 3ZU6A 1PNVA 3ETEA 4ZICA 1IOWA 1WHSA 3H2SA 5AICA 2P5UA 3O8CA 4D4LA 4X94A 4E5YA 5COBA 1ODFA 3EH2A 4OQXA 4CLEA 2NXJA 3GBSA 3Q8XB 1YMUA 1Z4JA 2XB8A 1WPRA 3EBPA 1Y9JA 3FMPB 4UHBA 3AKCA 5I9TA 5JJ5A 4MQEB 2K2QB 2Q7DA 1LSOA 4HX5A 2R6AA 1X1AA 1RZUA 1M6YA 2L17A 3QRWA 3LTNC 1YZVA 4DCMA 5KBYA 3CSDA 3CSUA 2RGDA 1K27A 3K5HA 2YOFA 1ZGCA 4EB6A 3G2NA 3KYBA 2ZRBA 2DLNA 5A71A 1KSJA 2GILA 5I8PA 2I99A 3N7UA 4RPJA 1AQJA 4MW1A 1TM7E 3MCWA 3BHMA 5F5NA 3H8JA 2HLDD 4XE5A 3FZNA 3N70A 1RI3A 2PZAA 2QTHA 3QXHA 2QIPA 2DPYA 2EARA 5G1PA 1Z4LA 5FYDA 5YASA 2BJHA 4G89A 3DEZA 3MIIA 4GO1A 3OE4A 3VX3A 4QAQA 3MLBA 1SC1A 3GROA 2V6IA 2GEDA 4IHJA 1THZA 4UFNA 4W82A 3HDQA 5BV1A 4R68A 4X92A 2QM3A 2QN3A 2VTEA 3H8SA 2IPAB 2O2IA 2C84A 5K3BA 4MJLA 2IWRA 2YW9A 1EK1A 3A11A 4NXNB 4X44A 3GLTA 4TTJA 1UMKA 2QL9A 4MS3A 3ZV7A 4PC3A 4C6TB 1K8RA 1QIEA 1X42A 3UICA 2BCGY 4DLUA 2MINB 5AK6A 3AVYA 4R9UC 3ABRB 5CU7A 1W5FA 4MYCA 3VPSA 2GM4A 3H75A 2FCAA 1M10A 3BKWA 4PLTA 5ALUA 1KFJB 1E0AA 4O2AA 1N9ZA 4Q48A 4YDRA 4A8JC 4C06A 2H11A 4DJFC 5TXGA 3CRQA 3AI1A 2O14A 2VAXA 2W6IA 3P2OA 4HAUA 5CGQB 4CODB 3G1UA 1MA0A 2YOGA 3NETA 4I19A 4WXHA 1H9AA 4A5OA 1YK1A 4YROA 3VYTB 5C80A 3QENA 2AI1A 2OFPA 4WNAA 3WDMA 3LSYA 2Z0MA 4XQCA 4PLVA 4N03A 2RGCA 3ZU2A 1E94E 2XUPA 3WRWA 4NZZA 4PCVA 4D44A 4W1PA 4XJTA 3PXEA 3AVXA 1VHLA 2PFKA 1M1NA 1ESEA 4HNRA 3HJGA 4IRUB 4QYXA 4TVOA 4R71A 4G65A 2PMCA 1NBAA 2ZI3A 2CKMA 2H3HA 2P8SA 3SDSA 2E4VA 4OKSA 3T8YA 3WMXA 1OH6A 4G67A 5K51A 1B8VA 4RGVA 4CQJA 3H04A 2J0EA 2YV4A 5ALDA 5LA6F 1UDCA 1VP3A 1ZFNA 5CLGA 4LOIA 2FZEA 4KUHA 4OMUA 3ENNA 3HLKA 3RYHA 4F91B 4EMUA 4MGHA 1XBTA 2P91A 3HEAA 2OUIA 3NBUA 5LXTB 1M1YE 2NZ2A 5J2TF 1XQXA 2VXCA 4I46A 4BO5A 5K0SA 1YF3A 3U7IA 1LBSA 2FSVC 3JVDA 4LCJA 1MQSA 2IY7A 1C8LA 2IDKA 4A8JB 1G21B 6PFKA 2VYFA 3BXOA 4HAIA 1DE0A 4OFBA 3V1LA 5IKXA 3VR4A 1K0FA 2F8LA 2ANCA 2JANA 2GXUA 2P2GA 3GVCA 4JBYA 4C0SA 3VC2A 2ZREA 2QSUA 3OPMA 3D8RA 3QYFA 3U31A 5CVUA 4BO9A 9LDBA 2RB5A 3H11A 4CLOA 5CNMA 3VHXA 4NJMB 5ENZA 3S7TA 3B13B 3QQ5A 3Q40A 5FOQA 1AX9A 4PAGA 2I1VB 4NEGA 3QFTA 2M1ZA 4EG8A 3ZXYA 3N2EA 2FWBA 1H0RA 3O5AA 1V8PA 4ZA2A 2Q3FA 1TCVA 2DSTA 3L8YA 3NOXA 2BBTA 3TD9A 4ZN6A 1ZH4A 4FOTA 2ZYHA 5SZKB 4UNRA 1TUGA 1U1IA 1XX6A 1UJ6A 2E0IA 2O3RA 1L8AA 1HTTA 3KJXA 3ZCVA 2UZIR 2ZI4A 2YY6A 1A71A 1BC5A 1NBME 1AKMA 3CYFA 5IWCA 2B92A 2QEQA 3R5XA 4TWAA 5D84A 5FWDA 3IDSA 4ZKEA 1SBHA 4C1NA 3DL4A 2GHQA 4L22A 4ZYWA 1QU2A 4ISBA 3AJ8A 3LT0A 1NDUA 2HMSA 4RNDB 1DRJA 3TTTA 4CTKA 1RTTA 2GLTA 4WCFA 4A91A 1K8YB 4HWGA 1LGYA 2CC2A 1NXOA 3C8ZA 5B1SA 1YIDA 2ZJ2A 3DMTC 2Q29A 3BWXA 3DDCA 2HA5A 2GN4A 2OECA 3OE7A 4Y1EA 3AIOA 1OAOC 3AXSA 1NLUA 1RYDA 2FUEA 4MS4B 3EGDB 5LCXA 3QF4B 4C0KA 4CKZA 2J7PA 3U3XA 1PG2A 3G0CA 1DEXA 2BPOA 3W5IA 4DIOA 2WV9A 1PW5A 5HE9A 1Y6GA 2EX1A 3OM0A 3M4XA 5IX8A 5K6AC 4IDFA 1K98A 2P6RA 2NVWA 5FPSA 1ESNA 1MA3A 1FYXA 3HJBA 4DZRA 2HMTA 1GQOA 1X13A 3PE3A 4D45A 4AJ1A 1EP2B 1SR8A 1U31A 5E3HA 5CDSA 1F7UA 3GEPA 3JQRA 3ZD6A 1N5RA 2FLKA 2NTEA 3FTNA 1PFYA 4IZ6A 4TKLA 4MUXA 3HU3A 4E30A 1S01A 2WHEA 2BGNA 1QH1A 4IMPA 4JODA 4UM8B 1GQSA 1YNOA 3SJBA 4YRAA 2VNHA 3CO5A 3FZGA 4K9PA 2VJNA 1UCFA 2P77A 3EAGA 4EG0A 1FDWA 1SULA 2IPMA 1GRNA 2ZTHA 3PDIB 4MHSA 4DPKA 3R7WB 2O2DA 5I7FA 1TK3A 2REQB 2YUTA 3IIMA 1GFWA 2HA0A 1TT5A 3FNIA 1W5TA 2I3DA 1GRCA 2J3EA 1AA9A 2CVZA 2JK0A 2WHYA 3H99A 3NPMA 3WA6A 1ZIPA 4HFJA 1JQBA 1KP9A 2CYAA 2VH1A 3MQ2A 4QE3A 3B6IA 5ADUS 5DTQA 5CT4A 4ML3A 4R98A 4B3FX 1JDZA 1M2EA 4XW2A 4ENPA 2BEVB 1Y3CE 3H13A 2P9CA 3R0ZA 4O2BB 4JIGA 3BS4A 2XE4A 2XODA 1FSPA 1H9CA 2PVCA 1RPTA 2J31A 5HJEA 3QFCA 4DLBA 2X1MA 1LQTA 5AUQA 3WJ7A 4LMPA 1SHKA 1TM2A 1A9YA 4RO0A 3F1LA 2GBLC 4ZMBA 4QWMA 5EMKA 2D3WA 3DXZA 1TTPB 4RV4A 4I1RA 4LDAA 1B8PA 1OILA 2XMZA 3TQTA 3UK0A 2PUJA 5G41A 1EEHA 1K6EA 1QDLB 1YOVB 1BCSA 1CXZA 4KQXA 1IYZA 1S1MA 4ND8A 3HCPA 3C24A 3AL2A 4QU0A 1V3TA 1M8PA 3NYRA 5TT0A 2NPIA 3F47A 4PLFA 3V8BA 3W4KA 2V7GA 1NBIA 1GAJA 2WAXA 3NJ4A 4JSYA 4WK6A 5T4EA 3TVDA 3FNRA 3KLBA 1W5AA 1O9GA 3OLCX 3D31A 2G5TA 3QKRB 4OB8A 5IANA 3WGOA 3VKGA 1QWOA 4QDUA 2XITA 5JNWA 1LPOA 3PIIA 3VZRA 3QFFA 5H9VA 5FO1A 2C1XA 4ZOCA 3WYGA 2HDHA 1WCIB 3UAWA 4DJAA 1OWOA 3MB8A 4GL4A 2R48A 3NAMA 4N9QA 4Q19A 3QPDA 3RARA 3USES 4P0TA 3GJYA 2PWPA 4MUGA 5KS2A 4YJ3A 4YJHB 4NYJQ 4CMCA 1X87A 5L3SA 3AKEA 4MKZA 2PGOA 1LPMA 5CD9A 1DRUA 4H4CA 1CUCA 2O59A 3VV3A 4B6FA 4DC0A 2B1IA 2XWPA 3ZDQA 2RI6A 5ECGC 1U9IC 1QR6A 2VRCD 4OXQA 2QI9C 3W6UA 3ZUGA 4KQMA 1N77A 1FA9A 2A7QA 4GECA 4UULA 1VCIA 5HM6A 3I83A 1KKMA 5HIKA 3CEJA 4YMSA 1GNRA 3WRXA 2JLZA 3I9MA 2ETVA 3NKFA 1YCDA 2ZAYA 4KWEA 3PR3A 3UFXB 5AW8A 1PV4A 5IAAA 2ZI9A 1RWPA 3CRZA 3ELYA 1KZ6A 4MVCA 4JZYA 2XLCA 2WC1A 4TMVA 4E7OA 4FMBB 5ELLA 1NQ5A 5JYDA 3BL5A 4KFUA 3QK7A 4GP7A 1RPNA 1IY2A 2Z43A 3DW1X 4YTEA 1D7OA 4NYJR 2I9PA 5AKXA 1HQYE 3CLRD 3TLAA 3SQWA 3KEQA 5AVYA 4DUPA 3EMDA 5JQWA 2IX3A 4KMSA 5EP1A 1E1MA 2YXPX 2ETXA 3ZZMA 3G13A 3K71B 3WYCA 3AFHA 1G2IA 3JAKA 4YRDA 2VQSA 3PFGA 3EBOA 1KI6A 3IALA 4IIJB 1N5IA 2NZXA 3ZBPA 4EP1A 1XTKA 3OKPA 1QFMA 2DWCA 2LPMA 4QRIA 2WSIA 1KSGA 2A9VA 4GM0A 1BVYF 3ZHCA 5BNIA 1K5HA 2MR6A 1MO4A 2J3DA 2W43A 4QBKA 1RHKA 3CN9A 4LOKA 5FBRB 3ZWKA 4DMKA 4BU1A 3GRCA 2HLDA 4RKQA 4ASUD 1NXTA 3QW2A 2OXRA 2X14A 2X86A 3G2KA 3ZWNA 1IDN1 4FR2A 3M6UA 4HP8A 1JTEA 1FSFA 3VR4H 3RFTA 2FE1A 5AI4A 1JB9A 1SIUA 2XMCA 1ZIXA 3K9BA 1JR3E 2H52A 3RYFA 3WBJA 1EVIA 3NUQA 3TLMA 2YDYA 5H80A 4LMBA 3U9SA 5FBQB 2WU4A 1KKLA 1VJ0A 1IFXA 3DGEC 1AGXA 3B3GA 5FOSA 5L3QB 1Z63A 1GUAA 4WESA 2IYEA 1CEQA 3P9ZA 3TAXA 5A1JA 1E92A 2J8ZA 1DKRA 1EINA 2JVJA 4Q3CA 4AO8A 4BLVA 4CKBA 4MROA 4Z5XA 4XDYA 2J48A 2FJ0A 1NHGA 2FKNA 1ENZA 1TYBE 3C70A 1VE1A 4IIFA 4M76B 2YVLA 4MICA 4XJVA 5JPCA 3WWYA 1TZJA 4GX1A 4K9DA 2AEFA 1OXTA 1ZNQO 2ERYA 1DRWA 4N8SA 1I2MA 3UZUA 2HJWA 2FN8A 4QOEA 4UC0A 3RG2A 3E2MA 1BD3A 1L4FA 4H59A 4F4HA 4Z9YA 2QL6A 3TRDA 4MI9A 1WM1A 4ZWNA 1RAAA 3FUWA 4JFAA 4KQ9A 4UOQA 2ZIFA 3SS9X 3QMMA 3GAZA 4QXAA 1OFUA 2C4NA 5TMEA 5CA0F 2OCLA 2HAEA 2PQMA 2W8BA 6LDHA 5CEJA 1PT7A 1XTIA 1EXMA 2W2KB 4WFKA 4YMGA 3V1YA 5JWRA 3A1NA 4WK4B 3TWOA 4LK2A 1RJ9A 1Y6ZA 1NBMD 2VAMA 3QVTA 4JJ4A 4KX3A 5G3ZA 4EO9A 3AONB 4C43A 2QL5A 5AW1A 4I6GA 2XBMA 4D3ZA 3U1BA 4JC8A 3WFZA 3CBQA 2VPTA 3CW9A 5H7XA 1KYTA 2RH5A 2Y9MB 4AKHA 3BMCB 4B6QA 1G42A 3IFSA 1J00A 3KZ1E 1UP7A 4JU9A 3HSYA 4MVJI 5J3JA 1RRFA 5LZ2A 1U7HA 1Y80A 4RCYA 4WZAA 5FTWA 1WXXA 4R9SA 4LFAB 4F3NA 3WP1B 3B89A 1JKMA 2B0CA 2GMWA 4R7TA 1T1SA 2YMQA 4FFLA 1J2JA 4KQWA 3IRVA 4YREA 2VWHA 2FOLA 2LXNA 2VHCA 2YXDA 3Q7TA 4U8HA 2NU9B 4CKYA 1SD5A 3DE1X 1DXHA 2DWUA 3VDMA 4TTSA 2HSZA 1LKZA 2B69A 4HB0A 1G4AE 1RXWA 1EE1A 2A3NA 2PZBA 1OLUA 2YH2A 3P45A 1T5OA 3QPCA 4OGGA 4PR3A 4RVCA 3KTOA 4U2EA 5C5DA 4DA4A 3Q2KA 3W05A 3Q6MA 3T5DA 4UJ5A