1KS8A

The structure of endoglucanase from termite, nasutitermes takasagoensis, at ph 2.5.
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
433
structure length
433
Chain Sequence
b'MAYDYKQVLRDSLLFYEAQRSGRLPADQKVTWRKDSALNDQGDQGQDLTGGYFDAGDFVKFGFPMAYTATVLAWGLIDFEAGYSSAGALDDGRKAVKWATDYFIKAHTSQNEFYGQVGQGDADHAFWGRPEDMTMARPAYKIDTSRPGSDLAGETAAALAAASIVFRNVDGTYSNNLLTHARQLFDFANNYRGKYSDSITDARNFYASADYRDELVWAAAWLYRATNDNTYLNTAESLYDEFGLQNWGGGLNWDSKVSGVQVLLAKLTNKQAYKDTVQSYVNYLINNQQKTPKGLLYIDMWGTLRHAANAAFIMLEAAELGLSASSYRQFAQTQIDYALGDGGRSFVCGFGSNPPTRPHHRSSSCPPAPATCDWNTFNSPDPNYHVLSGALVGGPDQNDNYVDDRSDYVHNEVATDYNAGFQSALAALVALGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-b-1,4-glucanase
publication title Structure of an endoglucanase from termite, Nasutitermes takasagoensis.
pubmed doi rcsb
source organism Nasutitermes takasagoensis
molecule tags Hydrolase
total genus 169
structure length 433
sequence length 433
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2002-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00759 Glyco_hydro_9 Glycosyl hydrolase family 9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1ks8A00
2DRQA 3PMMA 2A8ZA 3GZKA 1LF9A 1KSDA 1H13A 1V7XA 4J5TA 4L0GA 4JJJA 3S4CA 2EABA 3X17A 4AYRA 1L2AA 5GY3A 4ZG8A 3QRYA 3S4DA 3QFYA 1V5CA 3AFJA 1GAHA 1FP3A 4AYQA 1ULVA 1UT9A 1FCEA 1G6IA 4WU0A 1L1YA 5CD2A 3H2WA 3WKIA 1XW2A 2YIKA 3W7WA 1KSCA 4WVAA 1XWQA 3WKGA 4AYPA 3W5NA 4FUSA 3ACTA 1CEMA 4TF4A 4AYOA 1VD5A 1KWFA 1GLMA 1K72A 3GLYA 3EZ8A 1KREA 4Z4JA 1F9DA 2B4FA 4L6XA 2EADA 1DOGA 2FUZA 1IA7A 3ANKA 3CIHA 2FBAA 1V5DA 4EL8A 1G87A 2FV1A 2GH4A 3QG0A 1F9OA 2F6DA 3ON6A 4TXTA 4Z4LA 1DL2A 5CZLA 5GW7A 1IA6A 1NXCA 4DOEA 1GAIA 2VN7A 3ACSA 3RX7A 2FV0A 1XWTA 4KTRA 3T33A 4Q2BA 4ZH5A 2CQTA 2D5JA 3EQAA 2AFAA 4CJ1A 3W7UA 1KRFA 3WIRA 5KKBA 3WIWA 2JF4A 1KKTA 1V7WA 2DRRA 3VXDA 1LF6A 1CLCA 3ANIA 3P2CA 3W7SA 2XFGA 1FO3A 1IS9A 1JS4A 4KTPA 5M7YA 3W7TA 2D8LA 3K11A 3QXFA 1FBWA 3E6UA 1H12A 2DRSA 2JG0A 3WKFA 3RSYA 5DGQA 3WUXA 1NC5A 1KS8A 1WU4A 2OKXA 1WU5A 2AHGA 4DODA 1X9DA 5MEHA 2AHFA 1UG9A 2RI9A 1AYXA 1TF4A 1WU6A 4WVBA 3QSPA 1AGMA 2EAEA 5CA3A 3WC3A 3QDEA 4WVCA 3RX8A 1FO2A 3QFZA 3A3VA 5DGRA 4CJ0A 3H3KA 3ANJA 5E2JA 2ZZRA 1FAEA 3VW5A 2QNOA 3QT9A 3RENA 4CE7A 3H7LA 2RI8A 3S4AA 3GT5A 3WIQA 1FBOA 4Q88A 2RGKA 2EACA 2CQSA 1H54A 2WYNA 1WZZA 1FMIA 2GZ6A 2P0VA 3D3IA 4XUVA 3QPFA 3E73A 3RX5A 1KFGA 3W5MA 2DROA 3QWTA 1V7VA 1GA2A 2Z07A 2NVPA 5M7IA 3W7XA 3QT3A 3S4BA 3WKHA 1G9GA 1H14A 1RQ5A 2JJBA 3QXQA 2VN4A 1G9JA 3TF4A 1HCUA 3RRSA 2ZBLA
chains in the Genus database with same CATH superfamily
2DRQA 2V8IA 2H6IB 4M76A 1OJOA 3QRYA 4YDOB 2ONHA 1N9AB 4QT9A 5EASA 1FP3A 3HXFB 4D94A 3PYBA 1D8DB 1ULVA 3E33B 3LZ9A 4WU0A 1N7RA 3SQCA 2WDAA 1KSCA 4AYPA 3WKGA 4TF4A 4GTTB 5AGDA 1HMWA 3GLYA 1SQCA 1N4PB 4LIXA 2B4FA 3M7BA 3M77A 3CIHA 1TN7B 3QG0A 1GXNA 5CZLA 1O6RA 5JPNB 3EUVB 1N22A 3RX7A 1LXKA 1FT2B 2CQTA 4MBGB 5FOBB 2AFAA 1HN0A 1KRFA 3WIRA 3WIWA 1CLCA 5FO9B 1N4RB 1RWGA 2FUQA 3QXFA 2IEJB 1FBWA 1H12A 2BRPA 2DRSA 1TNBB 4FXGB 2V8JA 3SFYB 2B39A 3G4FA 2XQWA 1KS8A 2PN5A 5ILIA 1LD8B 1WU4A 2OKXA 1WU5A 2AHGA 1FPPB 1DCEB 4DODA 1C3DA 1GHQA 1CB8A 3QSPA 5CA3A 3QDEA 4WVCA 3QFZA 1S64B 3ANJA 1H35A 1O1TB 2QNOA 3QT9A 3M7CA 1N21A 1J0MA 3DPYB 5FO7B 3WIQA 1RWFA 1HZFA 3DSVB 2CQSA 3SDVA 1O1SB 2GZ6A 4MMIA 1F9GA 4XUVA 3QPFA 3EU5B 3W5MA 1V7VA 1HXCA 1JCRB 4GTVB 3WKHA 3DSUB 2JJBA 4NEIA 1LD7B 3PMMA 3GZKA 3M01A 1KSDA 1H13A 4L0GA 2V8KA 1EGUA 5GY3A 1TN8B 3N0FA 2E22A 2H6HB 3AFJA 5DHIA 2Q1FA 4GTPB 2R2LB 1UT9A 1HXAA 4D4BA 1L1YA 3WKIA 1H3CA 3H2WA 1XW2A 2YIKA 2WCOA 3W5NA 4D4DA 3ACTA 4FXKB 1OJPA 1VD5A 2G0DA 1QSJA 3EU8A 3Q75B 3EZ8A 2E24A 3Q7FB 1X81B 3KLSA 4EL8A 1G87A 2FV1A 2GH4A 4BOKA 5ILYA 1NXCA 2VN7A 2J5CA 3PZ4B 3PYAA 1RWCA 1XWTA 1N1BA 3T33A 2D5JA 1N94B 3P5RA 2H6GB 2V3PA 1KKTA 4V1RA 3VXDA 4OK2A 3ANIA 2WINB 5FO8B 3W7SA 1N7QA 1FO3A 1IS9A 3M74A 5IK0A 2XWJB 2JG0A 2ZIRB 1N4SB 4LNBB 4ZRQA 2WY8A 2ONGA 1MZCB 1R76A 3PZ3B 3S9VA 2F0YB 2RI9A 5IK9A 1AYXA 1TF4A 1WU6A 3DSWB 4WVBA 2BRVX 3VSMA 3WC3A 3E7JA 3P5PA 5IM1A 3A3VA 4OJZA 3M78A 4CJ0A 5EAUA 3NFVA 2WIIB 3H3KA 2PMVA 5E2JA 3VW5A 4EHMB 3RENA 5IKAA 5JMDA 1JCSB 3H7LA 2RI8A 3C72B 1N7OA 1QBQB 1X1JA 2RGKA 2BB6A 2WYNA 3SAEA 4GTRB 3E73A 5ILKA 1F1SA 1O6QA 3HXCB 3Q7AB 4KKIA 3QWTA 2Z07A 1O5MB 1H14A 1RQ5A 3QXQA 1H3BA 1G9JA 1HCUA 3RRSA 3A0OA 2A8ZA 1LF9A 4J5TA 4JJJA 5C05A 3S4CA 2EABA 1L2AA 1HM2A 1QQFA 4MMHA 2BRWA 3S4DA 3SFXB 3SDRA 3M76A 3D5SA 4ZRPA 3PZ2B 4AYQA 4YDEB 3KSQB 1G6IA 3DSXB 5CD2A 3W7WA 1W6KA 2WY7A 4WVAA 1JCQB 1XWQA 1CEMA 4V1SA 4AYOA 1W3YA 3DSSB 1K72A 4YCRA 1SA5B 4D4AA 4Z4JA 1LTXB 3SDQA 1TNOB 4L6XA 1TN6B 1GXMA 3ANKA 2FBAA 1QAZA 3PZ1B 4Z4LA 1F9OA 1N7NA 2F6DA 3G6JB 3ON6A 4TXTA 1DL2A 3M73A 3M00A 4DOEA 3ACSA 5ILDA 2FV0A 4GAXA 3SDUA 1H39A 4MU9A 3EQAA 4ZH1A 3HXEB 1V7WA 1N24A 5IK6A 1GXOA 1KZPB 3M02A 1LF6A 2XFGA 1X1IA 1JS4A 2NOJA 2D8LA 3OXUA 3E6UA 1HV6A 3M7EA 3M72A 5JPMB 1J0NA 1FT1B 3RSYA 5DGQA 3WUXA 1HMUA 1NC5A 4F10A 4FNVA 3AFLA 5JMFA 3DRAB 4DI5A 3SDTA 1X9DA 5MEHA 2AHFA 2ZBLA 3KQ4A 1UG9A 1AGMA 3Q78B 4FJQA 1RWAA 3RX8A 1FO2A 5DGRA 2XWBB 4OZWA 1W6JA 2A73B 2BB5A 3N0GA 5ILJA 2I07B 4OZVA 3E37B 1NL4B 3Q79B 1X1HA 3S4AA 1RWHA 3GT5A 1FBOA 4Q88A 1LOHA 2EACA 1O1RB 1UMPA 3HXDB 1HM3A 2P0VA 3D3IA 3RJ3A 1LXMA 3E80A 2BBCA 2DROA 1HX9A 1N95B 3VSNA 3S4BA 4LNVA 3HXBB 2SQCA 2H6FB 1H37A 2G02A 3TF4A 2FUTA 2X03A 1V7XA 4LNGB 3X17A 4AYRA 4ZG8A 4D4CA 1OJMA 3QFYA 5ILZA 1V5CA 1GAHA 2ZISB 5IL8A 1FCEA 4FUSA 4BOJA 1NI1B 1S63B 1TNYB 4GTOB 1KWFA 1GLMA 4L9PB 3NNBA 1KREA 3OEDA 1F9DA 1N7PA 2EADA 1DOGA 2FUZA 1IA7A 4GTSB 1N4QB 5EATA 1V5DA 3E32B 4E1YA 5GW7A 5IL3A 1IA6A 5ILHA 4GTMB 1GAIA 4KTRA 4Q2BA 4ZH5A 1KZOB 4RNQA 4CJ1A 3W7UA 5KKBA 1C82A 2JF4A 4F13A 2DRRA 3P2CA 1N23A 3D5RA 1GSZA 4KTPA 5M7YA 3W7TA 3K11A 4GTQB 1H3AA 3WKFA 4KKJA 3E34B 2GOXA 1HXGA 3G4DA 2EAEA 4OK4A 3K7XA 4ONTA 1TNZB 3M75A 2ZZRA 1FAEA 1SA4B 1TNUB 4GL3A 4CE7A 5GZKA 1D8EB 1H36A 1N1ZA 3Q73B 1RW9A 2V3NA 3DSTB 1H54A 1WZZA 1FMIA 1O79A 3E30B 3RX5A 1KFGA 4C1SA 1N20A 2BEDB 1GA2A 3M71A 1I8QA 2NVPA 5M7IA 5DHKA 3W7XA 3QT3A 3KSLB 5IKHA 1G9GA 3M7LA 1OJNA 2VN4A 1O6HA 3CU7A
chains in the Genus database with same CATH topology
2DRQA 2V8IA 2H6IB 4M76A 3QRYA 4YDOB 1N9AB 4QT9A 1FP3A 3HXFB 4D94A 3PYBA 1D8DB 1ULVA 3E33B 4WU0A 3SQCA 1KSCA 4AYPA 3WKGA 4TF4A 4GTTB 5AGDA 3GLYA 1SQCA 1N4PB 4LIXA 2B4FA 3M7BA 3M77A 3CIHA 1TN7B 3QG0A 1GXNA 5CZLA 1O6RA 5JPNB 3EUVB 3RX7A 1FT2B 2CQTA 4MBGB 5FOBB 2AFAA 1KRFA 3WIRA 3WIWA 1CLCA 5FO9B 1N4RB 3QXFA 2IEJB 1FBWA 1H12A 2DRSA 1TNBB 4FXGB 2V8JA 3SFYB 2B39A 2XQWA 1KS8A 2PN5A 1LD8B 1WU4A 2OKXA 1WU5A 2AHGA 1FPPB 1DCEB 4DODA 1C3DA 1GHQA 3QSPA 5CA3A 3QDEA 4WVCA 3QFZA 1S64B 3ANJA 1H35A 1O1TB 2QNOA 3QT9A 3M7CA 3DPYB 5FO7B 3WIQA 1HZFA 3DSVB 2CQSA 3SDVA 1O1SB 2GZ6A 4XUVA 3QPFA 3EU5B 3W5MA 1V7VA 1JCRB 4GTVB 3WKHA 3DSUB 2JJBA 1LD7B 3PMMA 3GZKA 1KSDA 1H13A 4L0GA 2V8KA 5GY3A 1TN8B 2H6HB 3AFJA 4GTPB 2R2LB 1UT9A 4D4BA 1L1YA 3WKIA 1H3CA 3H2WA 1XW2A 2YIKA 3W5NA 4D4DA 3ACTA 4FXKB 1VD5A 2G0DA 1QSJA 3EU8A 3Q75B 3EZ8A 3Q7FB 1X81B 3KLSA 4EL8A 1G87A 2FV1A 2GH4A 4BOKA 1NXCA 2VN7A 3PZ4B 3PYAA 1XWTA 3T33A 2D5JA 1N94B 3P5RA 2H6GB 2V3PA 1KKTA 4V1RA 3VXDA 3ANIA 2WINB 5FO8B 3W7SA 1FO3A 1IS9A 3M74A 2XWJB 2JG0A 2ZIRB 1N4SB 4LNBB 4ZRQA 2WY8A 3PZ3B 1MZCB 1R76A 3S9VA 2F0YB 2RI9A 1AYXA 1TF4A 1WU6A 3DSWB 4WVBA 3WC3A 3P5PA 3A3VA 3M78A 4CJ0A 2WIIB 3H3KA 2PMVA 5E2JA 3VW5A 4EHMB 3RENA 1JCSB 3H7LA 2RI8A 3C72B 1QBQB 2RGKA 2BB6A 2WYNA 3SAEA 4GTRB 3E73A 1O6QA 3HXCB 3Q7AB 4KKIA 3QWTA 2Z07A 1O5MB 1H14A 1RQ5A 3QXQA 1H3BA 1G9JA 1HCUA 3RRSA 2A8ZA 1LF9A 4J5TA 4JJJA 3S4CA 2EABA 1L2AA 1QQFA 3S4DA 3SFXB 3SDRA 3M76A 3D5SA 4ZRPA 3PZ2B 4AYQA 4YDEB 3KSQB 1G6IA 3DSXB 5CD2A 3W7WA 1W6KA 2WY7A 4WVAA 1JCQB 1XWQA 1CEMA 4V1SA 4AYOA 3DSSB 1K72A 4YCRA 1SA5B 4D4AA 4Z4JA 1LTXB 3SDQA 1TNOB 4L6XA 1TN6B 1GXMA 3ANKA 2FBAA 3PZ1B 4Z4LA 1F9OA 2F6DA 3G6JB 3ON6A 4TXTA 1DL2A 3M73A 4DOEA 3ACSA 2FV0A 3SDUA 1H39A 4MU9A 3EQAA 4ZH1A 3HXEB 1V7WA 1GXOA 1KZPB 1LF6A 2XFGA 1JS4A 2NOJA 2D8LA 3OXUA 3E6UA 3M7EA 3M72A 5JPMB 1FT1B 3RSYA 5DGQA 3WUXA 1NC5A 3DRAB 3SDTA 1X9DA 5MEHA 2AHFA 2ZBLA 3KQ4A 1UG9A 1AGMA 3Q78B 3RX8A 1FO2A 5DGRA 2XWBB 1W6JA 2A73B 2BB5A 2I07B 3E37B 1NL4B 3Q79B 3S4AA 3GT5A 1FBOA 4Q88A 2EACA 1O1RB 1UMPA 3HXDB 2P0VA 3D3IA 3RJ3A 2BBCA 2DROA 1N95B 3S4BA 4LNVA 3HXBB 2SQCA 2H6FB 1H37A 2G02A 3TF4A 1V7XA 4LNGB 3X17A 4AYRA 4ZG8A 4D4CA 3QFYA 1V5CA 1GAHA 2ZISB 1FCEA 4FUSA 4BOJA 1NI1B 1S63B 1TNYB 4GTOB 1KWFA 1GLMA 4L9PB 3OEDA 1KREA 1F9DA 2EADA 1DOGA 2FUZA 1IA7A 4GTSB 1N4QB 1V5DA 3E32B 5GW7A 1IA6A 4GTMB 1GAIA 4KTRA 4Q2BA 4ZH5A 1KZOB 4CJ1A 3W7UA 5KKBA 2JF4A 2DRRA 3P2CA 3D5RA 1GSZA 4KTPA 5M7YA 3W7TA 3K11A 4GTQB 1H3AA 3WKFA 4KKJA 3E34B 2GOXA 2EAEA 3K7XA 4ONTA 1TNZB 3M75A 2ZZRA 1FAEA 1SA4B 1TNUB 4GL3A 4CE7A 5GZKA 1D8EB 1H36A 3Q73B 2V3NA 3DSTB 1H54A 1WZZA 1FMIA 1O79A 3E30B 3RX5A 1KFGA 4C1SA 2BEDB 1GA2A 3M71A 2NVPA 5M7IA 3W7XA 3QT3A 3KSLB 1G9GA 3M7LA 2VN4A 1O6HA 3CU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DRQ A;  3PMM A;  2A8Z A;  3GZK A;  1LF9 A;  1KSD A;  1H13 A;  1V7X A;  4J5T A;  4L0G A;  4JJJ A;  3S4C A;  2EAB A;  3X17 A;  4AYR A;  1L2A A;  5GY3 A;  4ZG8 A;  3QRY A;  3S4D A;  3QFY A;  1V5C A;  3AFJ A;  1GAH A;  1FP3 A;  4AYQ A;  1ULV A;  1UT9 A;  1FCE A;  1G6I A;  4WU0 A;  1L1Y A;  5CD2 A;  3H2W A;  3WKI A;  1XW2 A;  2YIK A;  3W7W A;  1KSC A;  4WVA A;  1XWQ A;  3WKG A;  4AYP A;  3W5N A;  4FUS A;  3ACT A;  1CEM A;  4TF4 A;  4AYO A;  1VD5 A;  1KWF A;  1GLM A;  1K72 A;  3GLY A;  3EZ8 A;  1KRE A;  4Z4J A;  1F9D A;  2B4F A;  4L6X A;  2EAD A;  1DOG A;  2FUZ A;  1IA7 A;  3ANK A;  3CIH A;  2FBA A;  1V5D A;  4EL8 A;  1G87 A;  2FV1 A;  2GH4 A;  3QG0 A;  1F9O A;  2F6D A;  3ON6 A;  4TXT A;  4Z4L A;  1DL2 A;  5CZL A;  5GW7 A;  1IA6 A;  1NXC A;  4DOE A;  1GAI A;  2VN7 A;  3ACS A;  3RX7 A;  2FV0 A;  1XWT A;  4KTR A;  3T33 A;  4Q2B A;  4ZH5 A;  2CQT A;  2D5J A;  3EQA A;  2AFA A;  4CJ1 A;  3W7U A;  1KRF A;  3WIR A;  5KKB A;  3WIW A;  2JF4 A;  1KKT A;  1V7W A;  2DRR A;  3VXD A;  1LF6 A;  1CLC A;  3ANI A;  3P2C A;  3W7S A;  2XFG A;  1FO3 A;  1IS9 A;  1JS4 A;  4KTP A;  5M7Y A;  3W7T A;  2D8L A;  3K11 A;  3QXF A;  1FBW A;  3E6U A;  1H12 A;  2DRS A;  2JG0 A;  3WKF A;  3RSY A;  5DGQ A;  3WUX A;  1NC5 A;  1KS8 A;  1WU4 A;  2OKX A;  1WU5 A;  2AHG A;  4DOD A;  1X9D A;  5MEH A;  2AHF A;  1UG9 A;  2RI9 A;  1AYX A;  1TF4 A;  1WU6 A;  4WVB A;  3QSP A;  1AGM A;  2EAE A;  5CA3 A;  3WC3 A;  3QDE A;  4WVC A;  3RX8 A;  1FO2 A;  3QFZ A;  3A3V A;  5DGR A;  4CJ0 A;  3H3K A;  3ANJ A;  5E2J A;  2ZZR A;  1FAE A;  3VW5 A;  2QNO A;  3QT9 A;  3REN A;  4CE7 A;  3H7L A;  2RI8 A;  3S4A A;  3GT5 A;  3WIQ A;  1FBO A;  4Q88 A;  2RGK A;  2EAC A;  2CQS A;  1H54 A;  2WYN A;  1WZZ A;  1FMI A;  2GZ6 A;  2P0V A;  3D3I A;  4XUV A;  3QPF A;  3E73 A;  3RX5 A;  1KFG A;  3W5M A;  2DRO A;  3QWT A;  1V7V A;  1GA2 A;  2Z07 A;  2NVP A;  5M7I A;  3W7X A;  3QT3 A;  3S4B A;  3WKH A;  1G9G A;  1H14 A;  1RQ5 A;  2JJB A;  3QXQ A;  2VN4 A;  1G9J A;  3TF4 A;  1HCU A;  3RRS A;  2ZBL A; 
#chains in the Genus database with same CATH topology
 2DRQ A;  2V8I A;  2H6I B;  4M76 A;  1OJO A;  3QRY A;  4YDO B;  2ONH A;  1N9A B;  4QT9 A;  5EAS A;  1FP3 A;  3HXF B;  4D94 A;  3PYB A;  1D8D B;  1ULV A;  3E33 B;  3LZ9 A;  4WU0 A;  1N7R A;  3SQC A;  2WDA A;  1KSC A;  4AYP A;  3WKG A;  4TF4 A;  4GTT B;  5AGD A;  1HMW A;  3GLY A;  1SQC A;  1N4P B;  4LIX A;  2B4F A;  3M7B A;  3M77 A;  3CIH A;  1TN7 B;  3QG0 A;  1GXN A;  5CZL A;  1O6R A;  5JPN B;  3EUV B;  1N22 A;  3RX7 A;  1LXK A;  1FT2 B;  2CQT A;  4MBG B;  5FOB B;  2AFA A;  1HN0 A;  1KRF A;  3WIR A;  3WIW A;  1CLC A;  5FO9 B;  1N4R B;  1RWG A;  2FUQ A;  3QXF A;  2IEJ B;  1FBW A;  1H12 A;  2BRP A;  2DRS A;  1TNB B;  4FXG B;  2V8J A;  3SFY B;  2B39 A;  3G4F A;  2XQW A;  1KS8 A;  2PN5 A;  5ILI A;  1LD8 B;  1WU4 A;  2OKX A;  1WU5 A;  2AHG A;  1FPP B;  1DCE B;  4DOD A;  1C3D A;  1GHQ A;  1CB8 A;  3QSP A;  5CA3 A;  3QDE A;  4WVC A;  3QFZ A;  1S64 B;  3ANJ A;  1H35 A;  1O1T B;  2QNO A;  3QT9 A;  3M7C A;  1N21 A;  1J0M A;  3DPY B;  5FO7 B;  3WIQ A;  1RWF A;  1HZF A;  3DSV B;  2CQS A;  3SDV A;  1O1S B;  2GZ6 A;  4MMI A;  1F9G A;  4XUV A;  3QPF A;  3EU5 B;  3W5M A;  1V7V A;  1HXC A;  1JCR B;  4GTV B;  3WKH A;  3DSU B;  2JJB A;  4NEI A;  1LD7 B;  3PMM A;  3GZK A;  3M01 A;  1KSD A;  1H13 A;  4L0G A;  2V8K A;  1EGU A;  5GY3 A;  1TN8 B;  3N0F A;  2E22 A;  2H6H B;  3AFJ A;  5DHI A;  2Q1F A;  4GTP B;  2R2L B;  1UT9 A;  1HXA A;  4D4B A;  1L1Y A;  3WKI A;  1H3C A;  3H2W A;  1XW2 A;  2YIK A;  2WCO A;  3W5N A;  4D4D A;  3ACT A;  4FXK B;  1OJP A;  1VD5 A;  2G0D A;  1QSJ A;  3EU8 A;  3Q75 B;  3EZ8 A;  2E24 A;  3Q7F B;  1X81 B;  3KLS A;  4EL8 A;  1G87 A;  2FV1 A;  2GH4 A;  4BOK A;  5ILY A;  1NXC A;  2VN7 A;  2J5C A;  3PZ4 B;  3PYA A;  1RWC A;  1XWT A;  1N1B A;  3T33 A;  2D5J A;  1N94 B;  3P5R A;  2H6G B;  2V3P A;  1KKT A;  4V1R A;  3VXD A;  4OK2 A;  3ANI A;  2WIN B;  5FO8 B;  3W7S A;  1N7Q A;  1FO3 A;  1IS9 A;  3M74 A;  5IK0 A;  2XWJ B;  2JG0 A;  2ZIR B;  1N4S B;  4LNB B;  4ZRQ A;  2WY8 A;  2ONG A;  1MZC B;  1R76 A;  3PZ3 B;  3S9V A;  2F0Y B;  2RI9 A;  5IK9 A;  1AYX A;  1TF4 A;  1WU6 A;  3DSW B;  4WVB A;  2BRV X;  3VSM A;  3WC3 A;  3E7J A;  3P5P A;  5IM1 A;  3A3V A;  4OJZ A;  3M78 A;  4CJ0 A;  5EAU A;  3NFV A;  2WII B;  3H3K A;  2PMV A;  5E2J A;  3VW5 A;  4EHM B;  3REN A;  5IKA A;  5JMD A;  1JCS B;  3H7L A;  2RI8 A;  3C72 B;  1N7O A;  1QBQ B;  1X1J A;  2RGK A;  2BB6 A;  2WYN A;  3SAE A;  4GTR B;  3E73 A;  5ILK A;  1F1S A;  1O6Q A;  3HXC B;  3Q7A B;  4KKI A;  3QWT A;  2Z07 A;  1O5M B;  1H14 A;  1RQ5 A;  3QXQ A;  1H3B A;  1G9J A;  1HCU A;  3RRS A;  3A0O A;  2A8Z A;  1LF9 A;  4J5T A;  4JJJ A;  5C05 A;  3S4C A;  2EAB A;  1L2A A;  1HM2 A;  1QQF A;  4MMH A;  2BRW A;  3S4D A;  3SFX B;  3SDR A;  3M76 A;  3D5S A;  4ZRP A;  3PZ2 B;  4AYQ A;  4YDE B;  3KSQ B;  1G6I A;  3DSX B;  5CD2 A;  3W7W A;  1W6K A;  2WY7 A;  4WVA A;  1JCQ B;  1XWQ A;  1CEM A;  4V1S A;  4AYO A;  1W3Y A;  3DSS B;  1K72 A;  4YCR A;  1SA5 B;  4D4A A;  4Z4J A;  1LTX B;  3SDQ A;  1TNO B;  4L6X A;  1TN6 B;  1GXM A;  3ANK A;  2FBA A;  1QAZ A;  3PZ1 B;  4Z4L A;  1F9O A;  1N7N A;  2F6D A;  3G6J B;  3ON6 A;  4TXT A;  1DL2 A;  3M73 A;  3M00 A;  4DOE A;  3ACS A;  5ILD A;  2FV0 A;  4GAX A;  3SDU A;  1H39 A;  4MU9 A;  3EQA A;  4ZH1 A;  3HXE B;  1V7W A;  1N24 A;  5IK6 A;  1GXO A;  1KZP B;  3M02 A;  1LF6 A;  2XFG A;  1X1I A;  1JS4 A;  2NOJ A;  2D8L A;  3OXU A;  3E6U A;  1HV6 A;  3M7E A;  3M72 A;  5JPM B;  1J0N A;  1FT1 B;  3RSY A;  5DGQ A;  3WUX A;  1HMU A;  1NC5 A;  4F10 A;  4FNV A;  3AFL A;  5JMF A;  3DRA B;  4DI5 A;  3SDT A;  1X9D A;  5MEH A;  2AHF A;  2ZBL A;  3KQ4 A;  1UG9 A;  1AGM A;  3Q78 B;  4FJQ A;  1RWA A;  3RX8 A;  1FO2 A;  5DGR A;  2XWB B;  4OZW A;  1W6J A;  2A73 B;  2BB5 A;  3N0G A;  5ILJ A;  2I07 B;  4OZV A;  3E37 B;  1NL4 B;  3Q79 B;  1X1H A;  3S4A A;  1RWH A;  3GT5 A;  1FBO A;  4Q88 A;  1LOH A;  2EAC A;  1O1R B;  1UMP A;  3HXD B;  1HM3 A;  2P0V A;  3D3I A;  3RJ3 A;  1LXM A;  3E80 A;  2BBC A;  2DRO A;  1HX9 A;  1N95 B;  3VSN A;  3S4B A;  4LNV A;  3HXB B;  2SQC A;  2H6F B;  1H37 A;  2G02 A;  3TF4 A;  2FUT A;  2X03 A;  1V7X A;  4LNG B;  3X17 A;  4AYR A;  4ZG8 A;  4D4C A;  1OJM A;  3QFY A;  5ILZ A;  1V5C A;  1GAH A;  2ZIS B;  5IL8 A;  1FCE A;  4FUS A;  4BOJ A;  1NI1 B;  1S63 B;  1TNY B;  4GTO B;  1KWF A;  1GLM A;  4L9P B;  3NNB A;  1KRE A;  3OED A;  1F9D A;  1N7P A;  2EAD A;  1DOG A;  2FUZ A;  1IA7 A;  4GTS B;  1N4Q B;  5EAT A;  1V5D A;  3E32 B;  4E1Y A;  5GW7 A;  5IL3 A;  1IA6 A;  5ILH A;  4GTM B;  1GAI A;  4KTR A;  4Q2B A;  4ZH5 A;  1KZO B;  4RNQ A;  4CJ1 A;  3W7U A;  5KKB A;  1C82 A;  2JF4 A;  4F13 A;  2DRR A;  3P2C A;  1N23 A;  3D5R A;  1GSZ A;  4KTP A;  5M7Y A;  3W7T A;  3K11 A;  4GTQ B;  1H3A A;  3WKF A;  4KKJ A;  3E34 B;  2GOX A;  1HXG A;  3G4D A;  2EAE A;  4OK4 A;  3K7X A;  4ONT A;  1TNZ B;  3M75 A;  2ZZR A;  1FAE A;  1SA4 B;  1TNU B;  4GL3 A;  4CE7 A;  5GZK A;  1D8E B;  1H36 A;  1N1Z A;  3Q73 B;  1RW9 A;  2V3N A;  3DST B;  1H54 A;  1WZZ A;  1FMI A;  1O79 A;  3E30 B;  3RX5 A;  1KFG A;  4C1S A;  1N20 A;  2BED B;  1GA2 A;  3M71 A;  1I8Q A;  2NVP A;  5M7I A;  5DHK A;  3W7X A;  3QT3 A;  3KSL B;  5IKH A;  1G9G A;  3M7L A;  1OJN A;  2VN4 A;  1O6H A;  3CU7 A; 
#chains in the Genus database with same CATH homology
 2DRQ A;  2V8I A;  2H6I B;  4M76 A;  3QRY A;  4YDO B;  1N9A B;  4QT9 A;  1FP3 A;  3HXF B;  4D94 A;  3PYB A;  1D8D B;  1ULV A;  3E33 B;  4WU0 A;  3SQC A;  1KSC A;  4AYP A;  3WKG A;  4TF4 A;  4GTT B;  5AGD A;  3GLY A;  1SQC A;  1N4P B;  4LIX A;  2B4F A;  3M7B A;  3M77 A;  3CIH A;  1TN7 B;  3QG0 A;  1GXN A;  5CZL A;  1O6R A;  5JPN B;  3EUV B;  3RX7 A;  1FT2 B;  2CQT A;  4MBG B;  5FOB B;  2AFA A;  1KRF A;  3WIR A;  3WIW A;  1CLC A;  5FO9 B;  1N4R B;  3QXF A;  2IEJ B;  1FBW A;  1H12 A;  2DRS A;  1TNB B;  4FXG B;  2V8J A;  3SFY B;  2B39 A;  2XQW A;  1KS8 A;  2PN5 A;  1LD8 B;  1WU4 A;  2OKX A;  1WU5 A;  2AHG A;  1FPP B;  1DCE B;  4DOD A;  1C3D A;  1GHQ A;  3QSP A;  5CA3 A;  3QDE A;  4WVC A;  3QFZ A;  1S64 B;  3ANJ A;  1H35 A;  1O1T B;  2QNO A;  3QT9 A;  3M7C A;  3DPY B;  5FO7 B;  3WIQ A;  1HZF A;  3DSV B;  2CQS A;  3SDV A;  1O1S B;  2GZ6 A;  4XUV A;  3QPF A;  3EU5 B;  3W5M A;  1V7V A;  1JCR B;  4GTV B;  3WKH A;  3DSU B;  2JJB A;  1LD7 B;  3PMM A;  3GZK A;  1KSD A;  1H13 A;  4L0G A;  2V8K A;  5GY3 A;  1TN8 B;  2H6H B;  3AFJ A;  4GTP B;  2R2L B;  1UT9 A;  4D4B A;  1L1Y A;  3WKI A;  1H3C A;  3H2W A;  1XW2 A;  2YIK A;  3W5N A;  4D4D A;  3ACT A;  4FXK B;  1VD5 A;  2G0D A;  1QSJ A;  3EU8 A;  3Q75 B;  3EZ8 A;  3Q7F B;  1X81 B;  3KLS A;  4EL8 A;  1G87 A;  2FV1 A;  2GH4 A;  4BOK A;  1NXC A;  2VN7 A;  3PZ4 B;  3PYA A;  1XWT A;  3T33 A;  2D5J A;  1N94 B;  3P5R A;  2H6G B;  2V3P A;  1KKT A;  4V1R A;  3VXD A;  3ANI A;  2WIN B;  5FO8 B;  3W7S A;  1FO3 A;  1IS9 A;  3M74 A;  2XWJ B;  2JG0 A;  2ZIR B;  1N4S B;  4LNB B;  4ZRQ A;  2WY8 A;  3PZ3 B;  1MZC B;  1R76 A;  3S9V A;  2F0Y B;  2RI9 A;  1AYX A;  1TF4 A;  1WU6 A;  3DSW B;  4WVB A;  3WC3 A;  3P5P A;  3A3V A;  3M78 A;  4CJ0 A;  2WII B;  3H3K A;  2PMV A;  5E2J A;  3VW5 A;  4EHM B;  3REN A;  1JCS B;  3H7L A;  2RI8 A;  3C72 B;  1QBQ B;  2RGK A;  2BB6 A;  2WYN A;  3SAE A;  4GTR B;  3E73 A;  1O6Q A;  3HXC B;  3Q7A B;  4KKI A;  3QWT A;  2Z07 A;  1O5M B;  1H14 A;  1RQ5 A;  3QXQ A;  1H3B A;  1G9J A;  1HCU A;  3RRS A;  2A8Z A;  1LF9 A;  4J5T A;  4JJJ A;  3S4C A;  2EAB A;  1L2A A;  1QQF A;  3S4D A;  3SFX B;  3SDR A;  3M76 A;  3D5S A;  4ZRP A;  3PZ2 B;  4AYQ A;  4YDE B;  3KSQ B;  1G6I A;  3DSX B;  5CD2 A;  3W7W A;  1W6K A;  2WY7 A;  4WVA A;  1JCQ B;  1XWQ A;  1CEM A;  4V1S A;  4AYO A;  3DSS B;  1K72 A;  4YCR A;  1SA5 B;  4D4A A;  4Z4J A;  1LTX B;  3SDQ A;  1TNO B;  4L6X A;  1TN6 B;  1GXM A;  3ANK A;  2FBA A;  3PZ1 B;  4Z4L A;  1F9O A;  2F6D A;  3G6J B;  3ON6 A;  4TXT A;  1DL2 A;  3M73 A;  4DOE A;  3ACS A;  2FV0 A;  3SDU A;  1H39 A;  4MU9 A;  3EQA A;  4ZH1 A;  3HXE B;  1V7W A;  1GXO A;  1KZP B;  1LF6 A;  2XFG A;  1JS4 A;  2NOJ A;  2D8L A;  3OXU A;  3E6U A;  3M7E A;  3M72 A;  5JPM B;  1FT1 B;  3RSY A;  5DGQ A;  3WUX A;  1NC5 A;  3DRA B;  3SDT A;  1X9D A;  5MEH A;  2AHF A;  2ZBL A;  3KQ4 A;  1UG9 A;  1AGM A;  3Q78 B;  3RX8 A;  1FO2 A;  5DGR A;  2XWB B;  1W6J A;  2A73 B;  2BB5 A;  2I07 B;  3E37 B;  1NL4 B;  3Q79 B;  3S4A A;  3GT5 A;  1FBO A;  4Q88 A;  2EAC A;  1O1R B;  1UMP A;  3HXD B;  2P0V A;  3D3I A;  3RJ3 A;  2BBC A;  2DRO A;  1N95 B;  3S4B A;  4LNV A;  3HXB B;  2SQC A;  2H6F B;  1H37 A;  2G02 A;  3TF4 A;  1V7X A;  4LNG B;  3X17 A;  4AYR A;  4ZG8 A;  4D4C A;  3QFY A;  1V5C A;  1GAH A;  2ZIS B;  1FCE A;  4FUS A;  4BOJ A;  1NI1 B;  1S63 B;  1TNY B;  4GTO B;  1KWF A;  1GLM A;  4L9P B;  3OED A;  1KRE A;  1F9D A;  2EAD A;  1DOG A;  2FUZ A;  1IA7 A;  4GTS B;  1N4Q B;  1V5D A;  3E32 B;  5GW7 A;  1IA6 A;  4GTM B;  1GAI A;  4KTR A;  4Q2B A;  4ZH5 A;  1KZO B;  4CJ1 A;  3W7U A;  5KKB A;  2JF4 A;  2DRR A;  3P2C A;  3D5R A;  1GSZ A;  4KTP A;  5M7Y A;  3W7T A;  3K11 A;  4GTQ B;  1H3A A;  3WKF A;  4KKJ A;  3E34 B;  2GOX A;  2EAE A;  3K7X A;  4ONT A;  1TNZ B;  3M75 A;  2ZZR A;  1FAE A;  1SA4 B;  1TNU B;  4GL3 A;  4CE7 A;  5GZK A;  1D8E B;  1H36 A;  3Q73 B;  2V3N A;  3DST B;  1H54 A;  1WZZ A;  1FMI A;  1O79 A;  3E30 B;  3RX5 A;  1KFG A;  4C1S A;  2BED B;  1GA2 A;  3M71 A;  2NVP A;  5M7I A;  3W7X A;  3QT3 A;  3KSL B;  1G9G A;  3M7L A;  2VN4 A;  1O6H A;  3CU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...