1KSCA

The structure of endoglucanase from termite, nasutitermes takasagoensis, at ph 5.6.
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
433
structure length
433
Chain Sequence
b'MAYDYKQVLRDSLLFYEAQRSGRLPADQKVTWRKDSALNDQGDQGQDLTGGYFDAGDFVKFGFPMAYTATVLAWGLIDFEAGYSSAGALDDGRKAVKWATDYFIKAHTSQNEFYGQVGQGDADHAFWGRPEDMTMARPAYKIDTSRPGSDLAGETAAALAAASIVFRNVDGTYSNNLLTHARQLFDFANNYRGKYSDSITDARNFYASADYRDELVWAAAWLYRATNDNTYLNTAESLYDEFGLQNWGGGLNWDSKVSGVQVLLAKLTNKQAYKDTVQSYVNYLINNQQKTPKGLLYIDMWGTLRHAANAAFIMLEAAELGLSASSYRQFAQTQIDYALGDGGRSFVCGFGSNPPTRPHHRSSSCPPAPATCDWNTFNSPDPNYHVLSGALVGGPDQNDNYVDDRSDYVHNEVATDYNAGFQSALAALVALGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-b-1,4-glucanase
publication title Structure of an endoglucanase from termite, Nasutitermes takasagoensis.
pubmed doi rcsb
source organism Nasutitermes takasagoensis
molecule tags Hydrolase
total genus 175
structure length 433
sequence length 433
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2002-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00759 Glyco_hydro_9 Glycosyl hydrolase family 9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1kscA00
2JJBA 1V7WA 3VXDA 2ZBLA 1FO2A 3QDEA 3S4AA 2FV1A 2XFGA 2WYNA 4CJ1A 2CQSA 3WIRA 3W5MA 2RI8A 1FBOA 1H54A 1G87A 1KSCA 4WVBA 3QFZA 3WIQA 1ULVA 2DRRA 2VN4A 2FUZA 1H14A 2EAEA 1CEMA 1G9GA 3GT5A 3ACTA 4TXTA 3RX7A 3S4CA 3S4BA 1NC5A 1G6IA 5DGRA 3ON6A 1KWFA 3RRSA 1WZZA 2NVPA 2A8ZA 3WUXA 4Z4LA 4CJ0A 3AFJA 2VN7A 5M7YA 3TF4A 5CA3A 2OKXA 4Z4JA 3H3KA 3H2WA 1XWQA 3RX5A 1AGMA 2EADA 2FV0A 3EZ8A 3WKHA 3GLYA 1FAEA 1V5DA 3QFYA 1JS4A 4J5TA 3WKFA 3QSPA 2QNOA 1IS9A 1KSDA 2Z07A 3H7LA 3T33A 5M7IA 3W7WA 1WU5A 2DROA 2GH4A 3RSYA 1KFGA 3WC3A 1K72A 1LF6A 3P2CA 4JJJA 1GLMA 2AFAA 4KTPA 1DL2A 3E73A 5CZLA 3QT9A 1FBWA 3QRYA 3VW5A 4Q2BA 3S4DA 3W7TA 2JF4A 1IA6A 4L0GA 4Q88A 1DOGA 2DRSA 3WKIA 2ZZRA 2RI9A 4KTRA 3QPFA 3WIWA 3X17A 1H12A 4AYOA 4CE7A 2P0VA 4WU0A 5E2JA 1X9DA 1FMIA 3ANKA 2AHFA 3QXQA 2CQTA 1GAHA 1KREA 1L2AA 1V7XA 1F9OA 1VD5A 3D3IA 3EQAA 3QWTA 1FP3A 2F6DA 3A3VA 2AHGA 3ANJA 5GY3A 2YIKA 3E6UA 1XWTA 2D5JA 1V7VA 3W7SA 1FCEA 1G9JA 3ACSA 1H13A 1TF4A 3QG0A 1UG9A 4XUVA 1RQ5A 4DODA 3W5NA 1IA7A 4WVCA 3CIHA 3W7UA 2EABA 4FUSA 3GZKA 1KKTA 2JG0A 2RGKA 1AYXA 1V5CA 2B4FA 3QT3A 1LF9A 4ZH5A 2EACA 3RX8A 4AYRA 5KKBA 1WU4A 3QXFA 1UT9A 5MEHA 1F9DA 5DGQA 1KS8A 1L1YA 3PMMA 3ANIA 1FO3A 1HCUA 5GW7A 4EL8A 3RENA 1GAIA 2D8LA 1NXCA 1KRFA 5CD2A 4AYQA 2DRQA 4ZG8A 2GZ6A 3WKGA 4AYPA 3W7XA 3K11A 4WVAA 4TF4A 4L6XA 1GA2A 4DOEA 2FBAA 1WU6A 1CLCA 1XW2A
chains in the Genus database with same CATH superfamily
1V7WA 2ZBLA 1HMUA 3QDEA 1HMWA 2H6IB 3C72B 3KSLB 5ILJA 1X1JA 3G4FA 3VSMA 1KSCA 1W6JA 1O1SB 4V1RA 1H14A 2ONGA 3GT5A 4TXTA 3S4CA 1NC5A 2WY8A 3CU7A 5IK0A 2NVPA 4Z4LA 4KKIA 4Z4JA 3Q75B 3RX5A 1N1ZA 2FV0A 4BOJA 5IK6A 1RWGA 2WDAA 1O6HA 4MMIA 2WY7A 3QFYA 1GXMA 3WKFA 2XQWA 1H37A 1KSDA 3W7WA 3RSYA 1O1RB 1LF6A 3P2CA 2BRWA 2AFAA 5CZLA 4MMHA 3QT9A 2BRVX 3EU5B 3VW5A 1N95B 3KSQB 3S4DA 2JF4A 3G6JB 3Q79B 4L0GA 1EGUA 5EASA 1DOGA 3KLSA 4KTRA 3QPFA 2BBCA 4AYOA 1C3DA 1X81B 5E2JA 5ILZA 1SA4B 4D4BA 1GAHA 1N4QB 1V7XA 1HV6A 2G0DA 2WIIB 3DPYB 1QQFA 5ILKA 1HXAA 1RWAA 3ANJA 4YDOB 2NOJA 1G9JA 4D4DA 4MU9A 2WCOA 1OJOA 4DODA 3SFYB 1IA7A 4QT9A 3CIHA 4ONTA 1TN8B 1AYXA 1S64B 3QT3A 2H6HB 4GTTB 5ILYA 3QXFA 3DSWB 3PMMA 1HCUA 1HX9A 1O5MB 4EL8A 3HXDB 2D8LA 5JPMB 5IL8A 1RW9A 4WVAA 4V1SA 1RWFA 3PZ2B 1CLCA 2JJBA 3VXDA 3HXCB 3S4AA 2FV1A 5DHIA 2E22A 4OZWA 3VSNA 1H36A 1H54A 1OJMA 2DRRA 2EAEA 3ACTA 1N1BA 4EHMB 1TNOB 5DGRA 1KWFA 2A8ZA 4KKJA 3E37B 5FOBB 1AGMA 3M7LA 1C82A 3EZ8A 3WKHA 5FO9B 4MBGB 1N4SB 1JS4A 3T33A 4LNGB 1HXGA 1WU5A 3M76A 3DSVB 1GHQA 2SQCA 3OXUA 1K72A 2V3NA 3M75A 4KTPA 4LNVA 1DL2A 3E73A 1H3BA 3PYBA 1FBWA 3QRYA 3W7TA 1FPPB 3SDVA 4GTRB 1LD7B 2ZZRA 1HXCA 2G02A 4D4AA 4CE7A 2P0VA 3AFLA 1X9DA 3SDQA 3E7JA 3QXQA 1F9OA 1TNUB 1W6KA 3P5PA 5IL3A 1D8DB 1N23A 1O6RA 2AHGA 5GY3A 1XWTA 5JMFA 4DI5A 1GXNA 3M7CA 1JCQB 2B39A 3W5NA 1H3AA 1LXKA 4GTOB 2X03A 3W7UA 2EABA 2JG0A 3NNBA 2RGKA 5EAUA 1LOHA 1SA5B 3SDUA 1N20A 1JCRB 3HXEB 5DGQA 3N0FA 3KQ4A 1L1YA 3Q73B 4GTVB 4OJZA 3SDRA 1NXCA 2DRQA 1N4PB 2GZ6A 2IEJB 3D5SA 2H6GB 3M73A 1UMPA 1O1TB 4TF4A 4L6XA 1GSZA 1GXOA 1FO2A 1TNYB 4OK4A 1N7QA 2V8IA 3PZ1B 2E24A 4CJ1A 1NL4B 2Q1FA 3W5MA 2RI8A 1FBOA 1MZCB 1LD8B 1G87A 3PZ4B 4WVBA 1HN0A 1ULVA 2VN4A 2FUZA 4NEIA 3E33B 1G9GA 3DSSB 3RX7A 1LTXB 2XWBB 4D94A 3S4BA 2V3PA 5JPNB 3ON6A 2BEDB 3RRSA 1TN6B 3WUXA 5ILDA 2VN7A 5M7YA 5FO7B 5CA3A 2BRPA 1O79A 3DSTB 3A0OA 3OEDA 3SQCA 3GLYA 1FAEA 1H3CA 1V5DA 4J5TA 1J0NA 3QSPA 1IS9A 5M7IA 2DROA 1KFGA 4OZVA 1GLMA 1N24A 4GAXA 4ZH1A 1N7RA 3E32B 2DRSA 3G4DA 1H35A 1R76A 2RI9A 3WIWA 3X17A 1FT2B 1H12A 3Q7FB 3SDTA 3PZ3B 1FMIA 3ANKA 5JMDA 2AHFA 1CB8A 3QWTA 3HXBB 2WINB 1FP3A 1N7OA 2F6DA 4GTQB 3A3VA 1X1IA 4RNQA 2BB5A 4GTPB 3HXFB 1N94B 1QAZA 1S63B 1TF4A 3QG0A 4GTMB 1OJNA 4XUVA 3Q7AB 4FJQA 4OK2A 4WVCA 4L9PB 3M7BA 4FUSA 2PN5A 3GZKA 3Q78B 4FNVA 4M76A 1V5CA 4YDEB 5AGDA 1LF9A 4ZH5A 3RX8A 4AYRA 1N21A 1X1HA 1WU4A 2ZIRB 1KS8A 1HM2A 3E30B 3ANIA 1FO3A 1J0MA 1KRFA 4AYQA 2V8JA 3EU8A 4ZG8A 1KZOB 3W7XA 1N9AB 2J5CA 1SQCA 3DSXB 1GA2A 5IK9A 1N22A 1FT1B 2FBAA 3LZ9A 3D5RA 5ILIA 3M7EA 2XFGA 1KZPB 2WYNA 2CQSA 3PYAA 3WIRA 2GOXA 3QFZA 3WIQA 1CEMA 1HZFA 1QBQB 2FUQA 3N0GA 1G6IA 1RWHA 1WZZA 1F9GA 2ONHA 3DSUB 4CJ0A 3AFJA 3TF4A 2OKXA 4FXKB 3H3KA 3H2WA 1XWQA 1F1SA 2EADA 3EUVB 3M02A 1RWCA 1D8EB 1TN7B 1W3YA 1JCSB 1O6QA 2QNOA 3P5RA 2Z07A 1I8QA 3H7LA 5DHKA 4BOKA 2GH4A 2BB6A 3WC3A 4LIXA 3M78A 4JJJA 4ZRQA 3S9VA 2XWJB 5FO8B 3M77A 4Q2BA 5ILHA 1IA6A 1TNZB 4Q88A 3WKIA 3M71A 2FUTA 1QSJA 5GZKA 4WU0A 3SAEA 5EATA 4GTSB 2V8KA 3NFVA 3M72A 2CQTA 1KREA 1L2AA 4ZRPA 4E1YA 1VD5A 3D3IA 3EQAA 5IKHA 1H39A 2F0YB 4C1SA 1NI1B 3M01A 1N7PA 2YIKA 3E6UA 3K7XA 4LNBB 2D5JA 1N7NA 2R2LB 1V7VA 3W7SA 1FCEA 3ACSA 4FXGB 1H13A 1N4RB 1HM3A 4F10A 1UG9A 1LXMA 1RQ5A 3DRAB 4YCRA 1KKTA 2PMVA 5IKAA 3SFXB 2B4FA 2ZISB 2EACA 5IM1A 5KKBA 1UT9A 5MEHA 1F9DA 5C05A 3M74A 3RJ3A 5GW7A 4F13A 3RENA 2A73B 1GAIA 5CD2A 2I07B 1OJPA 4AYPA 3WKGA 4D4CA 3E80A 2H6FB 3K11A 1DCEB 1TNBB 4GL3A 4DOEA 3M00A 3E34B 1WU6A 1XW2A
chains in the Genus database with same CATH topology
1V7WA 2ZBLA 3QDEA 2H6IB 3C72B 3KSLB 1KSCA 1W6JA 1O1SB 4V1RA 1H14A 3GT5A 4TXTA 3S4CA 1NC5A 2WY8A 3CU7A 2NVPA 4Z4LA 4KKIA 4Z4JA 3Q75B 3RX5A 2FV0A 4BOJA 1O6HA 2WY7A 3QFYA 1GXMA 3WKFA 2XQWA 1H37A 1KSDA 3W7WA 3RSYA 1O1RB 1LF6A 3P2CA 2AFAA 5CZLA 3QT9A 3EU5B 3VW5A 1N95B 3KSQB 3S4DA 2JF4A 3G6JB 3Q79B 4L0GA 1DOGA 3KLSA 4KTRA 3QPFA 2BBCA 4AYOA 1C3DA 1X81B 5E2JA 1SA4B 4D4BA 1GAHA 1N4QB 1V7XA 2G0DA 3DPYB 2WIIB 1QQFA 3ANJA 4YDOB 2NOJA 1G9JA 4D4DA 4MU9A 4DODA 3SFYB 1IA7A 4QT9A 3CIHA 4ONTA 1TN8B 1AYXA 1S64B 3QT3A 2H6HB 4GTTB 3QXFA 3DSWB 3PMMA 1HCUA 1O5MB 4EL8A 3HXDB 2D8LA 5JPMB 4WVAA 4V1SA 3PZ2B 1CLCA 2JJBA 3VXDA 3HXCB 3S4AA 2FV1A 1H36A 1H54A 2DRRA 2EAEA 3ACTA 4EHMB 1TNOB 5DGRA 1KWFA 2A8ZA 4KKJA 3E37B 5FOBB 1AGMA 3M7LA 3EZ8A 3WKHA 5FO9B 4MBGB 1N4SB 1JS4A 3T33A 4LNGB 1WU5A 3M76A 3DSVB 1GHQA 3OXUA 2SQCA 1K72A 2V3NA 3M75A 4KTPA 4LNVA 1DL2A 3E73A 1H3BA 3PYBA 1FBWA 3QRYA 3W7TA 1FPPB 3SDVA 4GTRB 1LD7B 2ZZRA 2G02A 4D4AA 4CE7A 2P0VA 1X9DA 3SDQA 3QXQA 1F9OA 1TNUB 1W6KA 3P5PA 1D8DB 1O6RA 2AHGA 5GY3A 1XWTA 1GXNA 3M7CA 1JCQB 2B39A 3W5NA 1H3AA 4GTOB 3W7UA 2EABA 2JG0A 2RGKA 1SA5B 3SDUA 1JCRB 3HXEB 5DGQA 3KQ4A 1L1YA 3Q73B 4GTVB 3SDRA 1NXCA 2DRQA 1N4PB 2GZ6A 2IEJB 3D5SA 2H6GB 3M73A 1UMPA 1O1TB 4TF4A 4L6XA 1GSZA 1GXOA 1FO2A 1TNYB 2V8IA 3PZ1B 4CJ1A 1NL4B 3W5MA 2RI8A 1FBOA 1MZCB 1LD8B 1G87A 3PZ4B 4WVBA 1ULVA 2VN4A 2FUZA 3E33B 1G9GA 3DSSB 3RX7A 1LTXB 2XWBB 4D94A 3S4BA 2V3PA 5JPNB 3ON6A 2BEDB 3RRSA 1TN6B 3WUXA 2VN7A 5M7YA 5FO7B 5CA3A 1O79A 3DSTB 3OEDA 3SQCA 3GLYA 1FAEA 1H3CA 1V5DA 4J5TA 3QSPA 1IS9A 5M7IA 2DROA 1KFGA 1GLMA 4ZH1A 3E32B 2DRSA 1H35A 1R76A 2RI9A 3WIWA 3X17A 1FT2B 1H12A 3Q7FB 3SDTA 3PZ3B 1FMIA 3ANKA 2AHFA 3QWTA 3HXBB 1FP3A 2WINB 2F6DA 4GTQB 3A3VA 2BB5A 4GTPB 3HXFB 1N94B 1S63B 1TF4A 3QG0A 4GTMB 4XUVA 3Q7AB 4WVCA 4L9PB 3M7BA 4FUSA 2PN5A 3GZKA 3Q78B 4M76A 1V5CA 4YDEB 5AGDA 1LF9A 4ZH5A 3RX8A 4AYRA 1WU4A 2ZIRB 1KS8A 3E30B 3ANIA 1FO3A 1KRFA 4AYQA 2V8JA 3EU8A 4ZG8A 1KZOB 3W7XA 1N9AB 1SQCA 3DSXB 1GA2A 1FT1B 2FBAA 3D5RA 3M7EA 2XFGA 1KZPB 2WYNA 2CQSA 3PYAA 3WIRA 2GOXA 3QFZA 3WIQA 1CEMA 1HZFA 1QBQB 1G6IA 1WZZA 3DSUB 4CJ0A 3AFJA 3TF4A 2OKXA 4FXKB 3H3KA 3H2WA 1XWQA 2EADA 3EUVB 1D8EB 1TN7B 1JCSB 1O6QA 2QNOA 3P5RA 2Z07A 3H7LA 4BOKA 2GH4A 2BB6A 3WC3A 4LIXA 3M78A 4JJJA 4ZRQA 3S9VA 2XWJB 5FO8B 3M77A 4Q2BA 1IA6A 1TNZB 4Q88A 3WKIA 3M71A 1QSJA 5GZKA 4WU0A 3SAEA 4GTSB 2V8KA 3M72A 2CQTA 1KREA 1L2AA 4ZRPA 1VD5A 3D3IA 3EQAA 1H39A 2F0YB 4C1SA 1NI1B 2YIKA 3E6UA 3K7XA 4LNBB 2D5JA 2R2LB 1V7VA 3W7SA 1FCEA 3ACSA 4FXGB 1H13A 1N4RB 1UG9A 1RQ5A 3DRAB 4YCRA 1KKTA 2PMVA 3SFXB 2B4FA 2ZISB 2EACA 5KKBA 1UT9A 5MEHA 1F9DA 3M74A 3RJ3A 5GW7A 3RENA 2A73B 1GAIA 5CD2A 2I07B 4AYPA 3WKGA 4D4CA 2H6FB 3K11A 1DCEB 1TNBB 4GL3A 4DOEA 3E34B 1WU6A 1XW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JJB A;  1V7W A;  3VXD A;  2ZBL A;  1FO2 A;  3QDE A;  3S4A A;  2FV1 A;  2XFG A;  2WYN A;  4CJ1 A;  2CQS A;  3WIR A;  3W5M A;  2RI8 A;  1FBO A;  1H54 A;  1G87 A;  1KSC A;  4WVB A;  3QFZ A;  3WIQ A;  1ULV A;  2DRR A;  2VN4 A;  2FUZ A;  1H14 A;  2EAE A;  1CEM A;  1G9G A;  3GT5 A;  3ACT A;  4TXT A;  3RX7 A;  3S4C A;  3S4B A;  1NC5 A;  1G6I A;  5DGR A;  3ON6 A;  1KWF A;  3RRS A;  1WZZ A;  2NVP A;  2A8Z A;  3WUX A;  4Z4L A;  4CJ0 A;  3AFJ A;  2VN7 A;  5M7Y A;  3TF4 A;  5CA3 A;  2OKX A;  4Z4J A;  3H3K A;  3H2W A;  1XWQ A;  3RX5 A;  1AGM A;  2EAD A;  2FV0 A;  3EZ8 A;  3WKH A;  3GLY A;  1FAE A;  1V5D A;  3QFY A;  1JS4 A;  4J5T A;  3WKF A;  3QSP A;  2QNO A;  1IS9 A;  1KSD A;  2Z07 A;  3H7L A;  3T33 A;  5M7I A;  3W7W A;  1WU5 A;  2DRO A;  2GH4 A;  3RSY A;  1KFG A;  3WC3 A;  1K72 A;  1LF6 A;  3P2C A;  4JJJ A;  1GLM A;  2AFA A;  4KTP A;  1DL2 A;  3E73 A;  5CZL A;  3QT9 A;  1FBW A;  3QRY A;  3VW5 A;  4Q2B A;  3S4D A;  3W7T A;  2JF4 A;  1IA6 A;  4L0G A;  4Q88 A;  1DOG A;  2DRS A;  3WKI A;  2ZZR A;  2RI9 A;  4KTR A;  3QPF A;  3WIW A;  3X17 A;  1H12 A;  4AYO A;  4CE7 A;  2P0V A;  4WU0 A;  5E2J A;  1X9D A;  1FMI A;  3ANK A;  2AHF A;  3QXQ A;  2CQT A;  1GAH A;  1KRE A;  1L2A A;  1V7X A;  1F9O A;  1VD5 A;  3D3I A;  3EQA A;  3QWT A;  1FP3 A;  2F6D A;  3A3V A;  2AHG A;  3ANJ A;  5GY3 A;  2YIK A;  3E6U A;  1XWT A;  2D5J A;  1V7V A;  3W7S A;  1FCE A;  1G9J A;  3ACS A;  1H13 A;  1TF4 A;  3QG0 A;  1UG9 A;  4XUV A;  1RQ5 A;  4DOD A;  3W5N A;  1IA7 A;  4WVC A;  3CIH A;  3W7U A;  2EAB A;  4FUS A;  3GZK A;  1KKT A;  2JG0 A;  2RGK A;  1AYX A;  1V5C A;  2B4F A;  3QT3 A;  1LF9 A;  4ZH5 A;  2EAC A;  3RX8 A;  4AYR A;  5KKB A;  1WU4 A;  3QXF A;  1UT9 A;  5MEH A;  1F9D A;  5DGQ A;  1KS8 A;  1L1Y A;  3PMM A;  3ANI A;  1FO3 A;  1HCU A;  5GW7 A;  4EL8 A;  3REN A;  1GAI A;  2D8L A;  1NXC A;  1KRF A;  5CD2 A;  4AYQ A;  2DRQ A;  4ZG8 A;  2GZ6 A;  3WKG A;  4AYP A;  3W7X A;  3K11 A;  4WVA A;  4TF4 A;  4L6X A;  1GA2 A;  4DOE A;  2FBA A;  1WU6 A;  1CLC A;  1XW2 A; 
#chains in the Genus database with same CATH topology
 1V7W A;  2ZBL A;  1HMU A;  3QDE A;  1HMW A;  2H6I B;  3C72 B;  3KSL B;  5ILJ A;  1X1J A;  3G4F A;  3VSM A;  1KSC A;  1W6J A;  1O1S B;  4V1R A;  1H14 A;  2ONG A;  3GT5 A;  4TXT A;  3S4C A;  1NC5 A;  2WY8 A;  3CU7 A;  5IK0 A;  2NVP A;  4Z4L A;  4KKI A;  4Z4J A;  3Q75 B;  3RX5 A;  1N1Z A;  2FV0 A;  4BOJ A;  5IK6 A;  1RWG A;  2WDA A;  1O6H A;  4MMI A;  2WY7 A;  3QFY A;  1GXM A;  3WKF A;  2XQW A;  1H37 A;  1KSD A;  3W7W A;  3RSY A;  1O1R B;  1LF6 A;  3P2C A;  2BRW A;  2AFA A;  5CZL A;  4MMH A;  3QT9 A;  2BRV X;  3EU5 B;  3VW5 A;  1N95 B;  3KSQ B;  3S4D A;  2JF4 A;  3G6J B;  3Q79 B;  4L0G A;  1EGU A;  5EAS A;  1DOG A;  3KLS A;  4KTR A;  3QPF A;  2BBC A;  4AYO A;  1C3D A;  1X81 B;  5E2J A;  5ILZ A;  1SA4 B;  4D4B A;  1GAH A;  1N4Q B;  1V7X A;  1HV6 A;  2G0D A;  2WII B;  3DPY B;  1QQF A;  5ILK A;  1HXA A;  1RWA A;  3ANJ A;  4YDO B;  2NOJ A;  1G9J A;  4D4D A;  4MU9 A;  2WCO A;  1OJO A;  4DOD A;  3SFY B;  1IA7 A;  4QT9 A;  3CIH A;  4ONT A;  1TN8 B;  1AYX A;  1S64 B;  3QT3 A;  2H6H B;  4GTT B;  5ILY A;  3QXF A;  3DSW B;  3PMM A;  1HCU A;  1HX9 A;  1O5M B;  4EL8 A;  3HXD B;  2D8L A;  5JPM B;  5IL8 A;  1RW9 A;  4WVA A;  4V1S A;  1RWF A;  3PZ2 B;  1CLC A;  2JJB A;  3VXD A;  3HXC B;  3S4A A;  2FV1 A;  5DHI A;  2E22 A;  4OZW A;  3VSN A;  1H36 A;  1H54 A;  1OJM A;  2DRR A;  2EAE A;  3ACT A;  1N1B A;  4EHM B;  1TNO B;  5DGR A;  1KWF A;  2A8Z A;  4KKJ A;  3E37 B;  5FOB B;  1AGM A;  3M7L A;  1C82 A;  3EZ8 A;  3WKH A;  5FO9 B;  4MBG B;  1N4S B;  1JS4 A;  3T33 A;  4LNG B;  1HXG A;  1WU5 A;  3M76 A;  3DSV B;  1GHQ A;  2SQC A;  3OXU A;  1K72 A;  2V3N A;  3M75 A;  4KTP A;  4LNV A;  1DL2 A;  3E73 A;  1H3B A;  3PYB A;  1FBW A;  3QRY A;  3W7T A;  1FPP B;  3SDV A;  4GTR B;  1LD7 B;  2ZZR A;  1HXC A;  2G02 A;  4D4A A;  4CE7 A;  2P0V A;  3AFL A;  1X9D A;  3SDQ A;  3E7J A;  3QXQ A;  1F9O A;  1TNU B;  1W6K A;  3P5P A;  5IL3 A;  1D8D B;  1N23 A;  1O6R A;  2AHG A;  5GY3 A;  1XWT A;  5JMF A;  4DI5 A;  1GXN A;  3M7C A;  1JCQ B;  2B39 A;  3W5N A;  1H3A A;  1LXK A;  4GTO B;  2X03 A;  3W7U A;  2EAB A;  2JG0 A;  3NNB A;  2RGK A;  5EAU A;  1LOH A;  1SA5 B;  3SDU A;  1N20 A;  1JCR B;  3HXE B;  5DGQ A;  3N0F A;  3KQ4 A;  1L1Y A;  3Q73 B;  4GTV B;  4OJZ A;  3SDR A;  1NXC A;  2DRQ A;  1N4P B;  2GZ6 A;  2IEJ B;  3D5S A;  2H6G B;  3M73 A;  1UMP A;  1O1T B;  4TF4 A;  4L6X A;  1GSZ A;  1GXO A;  1FO2 A;  1TNY B;  4OK4 A;  1N7Q A;  2V8I A;  3PZ1 B;  2E24 A;  4CJ1 A;  1NL4 B;  2Q1F A;  3W5M A;  2RI8 A;  1FBO A;  1MZC B;  1LD8 B;  1G87 A;  3PZ4 B;  4WVB A;  1HN0 A;  1ULV A;  2VN4 A;  2FUZ A;  4NEI A;  3E33 B;  1G9G A;  3DSS B;  3RX7 A;  1LTX B;  2XWB B;  4D94 A;  3S4B A;  2V3P A;  5JPN B;  3ON6 A;  2BED B;  3RRS A;  1TN6 B;  3WUX A;  5ILD A;  2VN7 A;  5M7Y A;  5FO7 B;  5CA3 A;  2BRP A;  1O79 A;  3DST B;  3A0O A;  3OED A;  3SQC A;  3GLY A;  1FAE A;  1H3C A;  1V5D A;  4J5T A;  1J0N A;  3QSP A;  1IS9 A;  5M7I A;  2DRO A;  1KFG A;  4OZV A;  1GLM A;  1N24 A;  4GAX A;  4ZH1 A;  1N7R A;  3E32 B;  2DRS A;  3G4D A;  1H35 A;  1R76 A;  2RI9 A;  3WIW A;  3X17 A;  1FT2 B;  1H12 A;  3Q7F B;  3SDT A;  3PZ3 B;  1FMI A;  3ANK A;  5JMD A;  2AHF A;  1CB8 A;  3QWT A;  3HXB B;  2WIN B;  1FP3 A;  1N7O A;  2F6D A;  4GTQ B;  3A3V A;  1X1I A;  4RNQ A;  2BB5 A;  4GTP B;  3HXF B;  1N94 B;  1QAZ A;  1S63 B;  1TF4 A;  3QG0 A;  4GTM B;  1OJN A;  4XUV A;  3Q7A B;  4FJQ A;  4OK2 A;  4WVC A;  4L9P B;  3M7B A;  4FUS A;  2PN5 A;  3GZK A;  3Q78 B;  4FNV A;  4M76 A;  1V5C A;  4YDE B;  5AGD A;  1LF9 A;  4ZH5 A;  3RX8 A;  4AYR A;  1N21 A;  1X1H A;  1WU4 A;  2ZIR B;  1KS8 A;  1HM2 A;  3E30 B;  3ANI A;  1FO3 A;  1J0M A;  1KRF A;  4AYQ A;  2V8J A;  3EU8 A;  4ZG8 A;  1KZO B;  3W7X A;  1N9A B;  2J5C A;  1SQC A;  3DSX B;  1GA2 A;  5IK9 A;  1N22 A;  1FT1 B;  2FBA A;  3LZ9 A;  3D5R A;  5ILI A;  3M7E A;  2XFG A;  1KZP B;  2WYN A;  2CQS A;  3PYA A;  3WIR A;  2GOX A;  3QFZ A;  3WIQ A;  1CEM A;  1HZF A;  1QBQ B;  2FUQ A;  3N0G A;  1G6I A;  1RWH A;  1WZZ A;  1F9G A;  2ONH A;  3DSU B;  4CJ0 A;  3AFJ A;  3TF4 A;  2OKX A;  4FXK B;  3H3K A;  3H2W A;  1XWQ A;  1F1S A;  2EAD A;  3EUV B;  3M02 A;  1RWC A;  1D8E B;  1TN7 B;  1W3Y A;  1JCS B;  1O6Q A;  2QNO A;  3P5R A;  2Z07 A;  1I8Q A;  3H7L A;  5DHK A;  4BOK A;  2GH4 A;  2BB6 A;  3WC3 A;  4LIX A;  3M78 A;  4JJJ A;  4ZRQ A;  3S9V A;  2XWJ B;  5FO8 B;  3M77 A;  4Q2B A;  5ILH A;  1IA6 A;  1TNZ B;  4Q88 A;  3WKI A;  3M71 A;  2FUT A;  1QSJ A;  5GZK A;  4WU0 A;  3SAE A;  5EAT A;  4GTS B;  2V8K A;  3NFV A;  3M72 A;  2CQT A;  1KRE A;  1L2A A;  4ZRP A;  4E1Y A;  1VD5 A;  3D3I A;  3EQA A;  5IKH A;  1H39 A;  2F0Y B;  4C1S A;  1NI1 B;  3M01 A;  1N7P A;  2YIK A;  3E6U A;  3K7X A;  4LNB B;  2D5J A;  1N7N A;  2R2L B;  1V7V A;  3W7S A;  1FCE A;  3ACS A;  4FXG B;  1H13 A;  1N4R B;  1HM3 A;  4F10 A;  1UG9 A;  1LXM A;  1RQ5 A;  3DRA B;  4YCR A;  1KKT A;  2PMV A;  5IKA A;  3SFX B;  2B4F A;  2ZIS B;  2EAC A;  5IM1 A;  5KKB A;  1UT9 A;  5MEH A;  1F9D A;  5C05 A;  3M74 A;  3RJ3 A;  5GW7 A;  4F13 A;  3REN A;  2A73 B;  1GAI A;  5CD2 A;  2I07 B;  1OJP A;  4AYP A;  3WKG A;  4D4C A;  3E80 A;  2H6F B;  3K11 A;  1DCE B;  1TNB B;  4GL3 A;  4DOE A;  3M00 A;  3E34 B;  1WU6 A;  1XW2 A; 
#chains in the Genus database with same CATH homology
 1V7W A;  2ZBL A;  3QDE A;  2H6I B;  3C72 B;  3KSL B;  1KSC A;  1W6J A;  1O1S B;  4V1R A;  1H14 A;  3GT5 A;  4TXT A;  3S4C A;  1NC5 A;  2WY8 A;  3CU7 A;  2NVP A;  4Z4L A;  4KKI A;  4Z4J A;  3Q75 B;  3RX5 A;  2FV0 A;  4BOJ A;  1O6H A;  2WY7 A;  3QFY A;  1GXM A;  3WKF A;  2XQW A;  1H37 A;  1KSD A;  3W7W A;  3RSY A;  1O1R B;  1LF6 A;  3P2C A;  2AFA A;  5CZL A;  3QT9 A;  3EU5 B;  3VW5 A;  1N95 B;  3KSQ B;  3S4D A;  2JF4 A;  3G6J B;  3Q79 B;  4L0G A;  1DOG A;  3KLS A;  4KTR A;  3QPF A;  2BBC A;  4AYO A;  1C3D A;  1X81 B;  5E2J A;  1SA4 B;  4D4B A;  1GAH A;  1N4Q B;  1V7X A;  2G0D A;  3DPY B;  2WII B;  1QQF A;  3ANJ A;  4YDO B;  2NOJ A;  1G9J A;  4D4D A;  4MU9 A;  4DOD A;  3SFY B;  1IA7 A;  4QT9 A;  3CIH A;  4ONT A;  1TN8 B;  1AYX A;  1S64 B;  3QT3 A;  2H6H B;  4GTT B;  3QXF A;  3DSW B;  3PMM A;  1HCU A;  1O5M B;  4EL8 A;  3HXD B;  2D8L A;  5JPM B;  4WVA A;  4V1S A;  3PZ2 B;  1CLC A;  2JJB A;  3VXD A;  3HXC B;  3S4A A;  2FV1 A;  1H36 A;  1H54 A;  2DRR A;  2EAE A;  3ACT A;  4EHM B;  1TNO B;  5DGR A;  1KWF A;  2A8Z A;  4KKJ A;  3E37 B;  5FOB B;  1AGM A;  3M7L A;  3EZ8 A;  3WKH A;  5FO9 B;  4MBG B;  1N4S B;  1JS4 A;  3T33 A;  4LNG B;  1WU5 A;  3M76 A;  3DSV B;  1GHQ A;  3OXU A;  2SQC A;  1K72 A;  2V3N A;  3M75 A;  4KTP A;  4LNV A;  1DL2 A;  3E73 A;  1H3B A;  3PYB A;  1FBW A;  3QRY A;  3W7T A;  1FPP B;  3SDV A;  4GTR B;  1LD7 B;  2ZZR A;  2G02 A;  4D4A A;  4CE7 A;  2P0V A;  1X9D A;  3SDQ A;  3QXQ A;  1F9O A;  1TNU B;  1W6K A;  3P5P A;  1D8D B;  1O6R A;  2AHG A;  5GY3 A;  1XWT A;  1GXN A;  3M7C A;  1JCQ B;  2B39 A;  3W5N A;  1H3A A;  4GTO B;  3W7U A;  2EAB A;  2JG0 A;  2RGK A;  1SA5 B;  3SDU A;  1JCR B;  3HXE B;  5DGQ A;  3KQ4 A;  1L1Y A;  3Q73 B;  4GTV B;  3SDR A;  1NXC A;  2DRQ A;  1N4P B;  2GZ6 A;  2IEJ B;  3D5S A;  2H6G B;  3M73 A;  1UMP A;  1O1T B;  4TF4 A;  4L6X A;  1GSZ A;  1GXO A;  1FO2 A;  1TNY B;  2V8I A;  3PZ1 B;  4CJ1 A;  1NL4 B;  3W5M A;  2RI8 A;  1FBO A;  1MZC B;  1LD8 B;  1G87 A;  3PZ4 B;  4WVB A;  1ULV A;  2VN4 A;  2FUZ A;  3E33 B;  1G9G A;  3DSS B;  3RX7 A;  1LTX B;  2XWB B;  4D94 A;  3S4B A;  2V3P A;  5JPN B;  3ON6 A;  2BED B;  3RRS A;  1TN6 B;  3WUX A;  2VN7 A;  5M7Y A;  5FO7 B;  5CA3 A;  1O79 A;  3DST B;  3OED A;  3SQC A;  3GLY A;  1FAE A;  1H3C A;  1V5D A;  4J5T A;  3QSP A;  1IS9 A;  5M7I A;  2DRO A;  1KFG A;  1GLM A;  4ZH1 A;  3E32 B;  2DRS A;  1H35 A;  1R76 A;  2RI9 A;  3WIW A;  3X17 A;  1FT2 B;  1H12 A;  3Q7F B;  3SDT A;  3PZ3 B;  1FMI A;  3ANK A;  2AHF A;  3QWT A;  3HXB B;  1FP3 A;  2WIN B;  2F6D A;  4GTQ B;  3A3V A;  2BB5 A;  4GTP B;  3HXF B;  1N94 B;  1S63 B;  1TF4 A;  3QG0 A;  4GTM B;  4XUV A;  3Q7A B;  4WVC A;  4L9P B;  3M7B A;  4FUS A;  2PN5 A;  3GZK A;  3Q78 B;  4M76 A;  1V5C A;  4YDE B;  5AGD A;  1LF9 A;  4ZH5 A;  3RX8 A;  4AYR A;  1WU4 A;  2ZIR B;  1KS8 A;  3E30 B;  3ANI A;  1FO3 A;  1KRF A;  4AYQ A;  2V8J A;  3EU8 A;  4ZG8 A;  1KZO B;  3W7X A;  1N9A B;  1SQC A;  3DSX B;  1GA2 A;  1FT1 B;  2FBA A;  3D5R A;  3M7E A;  2XFG A;  1KZP B;  2WYN A;  2CQS A;  3PYA A;  3WIR A;  2GOX A;  3QFZ A;  3WIQ A;  1CEM A;  1HZF A;  1QBQ B;  1G6I A;  1WZZ A;  3DSU B;  4CJ0 A;  3AFJ A;  3TF4 A;  2OKX A;  4FXK B;  3H3K A;  3H2W A;  1XWQ A;  2EAD A;  3EUV B;  1D8E B;  1TN7 B;  1JCS B;  1O6Q A;  2QNO A;  3P5R A;  2Z07 A;  3H7L A;  4BOK A;  2GH4 A;  2BB6 A;  3WC3 A;  4LIX A;  3M78 A;  4JJJ A;  4ZRQ A;  3S9V A;  2XWJ B;  5FO8 B;  3M77 A;  4Q2B A;  1IA6 A;  1TNZ B;  4Q88 A;  3WKI A;  3M71 A;  1QSJ A;  5GZK A;  4WU0 A;  3SAE A;  4GTS B;  2V8K A;  3M72 A;  2CQT A;  1KRE A;  1L2A A;  4ZRP A;  1VD5 A;  3D3I A;  3EQA A;  1H39 A;  2F0Y B;  4C1S A;  1NI1 B;  2YIK A;  3E6U A;  3K7X A;  4LNB B;  2D5J A;  2R2L B;  1V7V A;  3W7S A;  1FCE A;  3ACS A;  4FXG B;  1H13 A;  1N4R B;  1UG9 A;  1RQ5 A;  3DRA B;  4YCR A;  1KKT A;  2PMV A;  3SFX B;  2B4F A;  2ZIS B;  2EAC A;  5KKB A;  1UT9 A;  5MEH A;  1F9D A;  3M74 A;  3RJ3 A;  5GW7 A;  3REN A;  2A73 B;  1GAI A;  5CD2 A;  2I07 B;  4AYP A;  3WKG A;  4D4C A;  2H6F B;  3K11 A;  1DCE B;  1TNB B;  4GL3 A;  4DOE A;  3E34 B;  1WU6 A;  1XW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...