1KSCA

The structure of endoglucanase from termite, nasutitermes takasagoensis, at ph 5.6.
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
433
structure length
433
Chain Sequence
MAYDYKQVLRDSLLFYEAQRSGRLPADQKVTWRKDSALNDQGDQGQDLTGGYFDAGDFVKFGFPMAYTATVLAWGLIDFEAGYSSAGALDDGRKAVKWATDYFIKAHTSQNEFYGQVGQGDADHAFWGRPEDMTMARPAYKIDTSRPGSDLAGETAAALAAASIVFRNVDGTYSNNLLTHARQLFDFANNYRGKYSDSITDARNFYASADYRDELVWAAAWLYRATNDNTYLNTAESLYDEFGLQNWGGGLNWDSKVSGVQVLLAKLTNKQAYKDTVQSYVNYLINNQQKTPKGLLYIDMWGTLRHAANAAFIMLEAAELGLSASSYRQFAQTQIDYALGDGGRSFVCGFGSNPPTRPHHRSSSCPPAPATCDWNTFNSPDPNYHVLSGALVGGPDQNDNYVDDRSDYVHNEVATDYNAGFQSALAALVALGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-b-1,4-glucanase
publication title Structure of an endoglucanase from termite, Nasutitermes takasagoensis.
pubmed doi rcsb
source organism Nasutitermes takasagoensis
molecule tags Hydrolase
total genus 175
structure length 433
sequence length 433
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2002-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00759 Glyco_hydro_9 Glycosyl hydrolase family 9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1kscA00
2JF4A 3GLYA 3K11A 4WVCA 4DODA 1GLMA 1L2AA 1XWTA 4Q2BA 3E73A 5E2JA 3WIWA 3D3IA 3X17A 2NVPA 1FCEA 2DRSA 2QNOA 1G6IA 2JJBA 2D5JA 2EADA 2OKXA 4Q88A 3WKHA 1KRFA 3WIQA 1CLCA 1G9JA 3E6UA 3QWTA 2DRRA 1VD5A 4FUSA 5GY3A 1L1YA 2JG0A 2FV1A 5CD2A 4AYPA 4KTPA 3T33A 1IS9A 2F6DA 4CJ1A 2A8ZA 2RI8A 3W7TA 5GW7A 3QG0A 4CE7A 3RX5A 3ANJA 1WZZA 3QPFA 3PMMA 1KFGA 3EQAA 3QT3A 1XWQA 4DOEA 1IA7A 1UG9A 2B4FA 2FV0A 2FUZA 3AFJA 2AFAA 2ZBLA 3RX8A 3S4DA 3WUXA 1G87A 1KWFA 3TF4A 2EABA 5KKBA 5M7YA 3QSPA 1XW2A 4EL8A 2VN4A 3RENA 2DROA 1X9DA 1CEMA 1GAHA 1KREA 5CZLA 3S4BA 4AYOA 3WKIA 4AYQA 4WVAA 1FO2A 1V5CA 4ZH5A 3WKFA 1ULVA 4J5TA 1NXCA 1G9GA 1FBWA 4CJ0A 1V7XA 3H7LA 3H2WA 1AGMA 1KSCA 3GZKA 3WC3A 3A3VA 3W7SA 2AHFA 2CQTA 1TF4A 3VXDA 2AHGA 2CQSA 1RQ5A 1FO3A 1GAIA 1KS8A 1JS4A 1V7WA 1WU4A 3S4AA 3W7UA 3CIHA 3ACSA 1DOGA 3ON6A 1V5DA 3QXFA 4WVBA 3RX7A 4Z4LA 2YIKA 1DL2A 1H54A 4JJJA 3ACTA 1KSDA 3W7WA 2P0VA 5M7IA 3GT5A 3QRYA 2Z07A 2VN7A 3RSYA 4AYRA 1H13A 4ZG8A 1FP3A 2RI9A 3QDEA 1KKTA 2EAEA 1WU6A 1F9DA 2DRQA 1FBOA 3WIRA 1F9OA 1FAEA 3P2CA 1HCUA 1H14A 1IA6A 2D8LA 4Z4JA 3ANKA 2WYNA 3EZ8A 5DGRA 4TXTA 3RRSA 5CA3A 4L6XA 3QFZA 1LF6A 2GZ6A 3QXQA 4KTRA 3W5NA 3W7XA 1K72A 1LF9A 2EACA 4L0GA 2GH4A 1WU5A 2XFGA 3QFYA 3ANIA 3QT9A 1AYXA 1UT9A 4TF4A 1H12A 3VW5A 4XUVA 3H3KA 4WU0A 2RGKA 1NC5A 3W5MA 2ZZRA 1FMIA 1V7VA 3WKGA 5MEHA 2FBAA 5DGQA 3S4CA 1GA2A
chains in the Genus database with same CATH superfamily
4NEIA 4WVCA 3GLYA 3K11A 3M7BA 3M00A 1GLMA 1EGUA 1H36A 3WIWA 1FT1B 1F9GA 4KKJA 2BBCA 2DRSA 1N21A 2SQCA 2H6GB 1OJMA 2JJBA 5IL8A 4D4DA 5DHIA 5ILZA 1CLCA 1N7NA 3E6UA 4FNVA 3M77A 4FUSA 1L1YA 5IK6A 2F6DA 1H3BA 2WIIB 3M78A 4V1RA 5GW7A 3M75A 3RX5A 5IL3A 2XWBB 1X1IA 3D5SA 3M01A 3W7TA 1IA7A 3WUXA 4KKIA 2FUZA 2AFAA 5DHKA 2EABA 5M7YA 2BRVX 1HMWA 2GOXA 3RENA 1O1SB 2DROA 1CEMA 2V3NA 5CZLA 4AYOA 1TNBB 3WKIA 3VSMA 3WKFA 1FBWA 4CJ0A 1N9AB 3WC3A 2AHFA 4OK2A 3VXDA 3HXCB 1GXOA 2ONGA 1KS8A 1W6JA 1JS4A 1V7WA 3G4FA 3W7UA 3ON6A 1NL4B 1JCRB 2YIKA 4BOKA 1DL2A 4JJJA 1N23A 1KSDA 3ACTA 1N7OA 3KQ4A 4LNVA 5FO9B 3SQCA 2VN7A 1FP3A 2RI9A 1LTXB 1RW9A 3PZ4B 2ZIRB 1WU6A 5EASA 2XWJB 1CB8A 1HCUA 3DRAB 2D8LA 3AFLA 1N7RA 3ANKA 4TXTA 2V8KA 4GTRB 2Q1FA 3W7XA 5ILIA 5ILJA 1WU5A 4DI5A 3VW5A 1N20A 1TN6B 1N22A 3H3KA 3W5MA 3KSLB 2ONHA 3M7LA 1V7VA 4L9PB 4GTPB 1N24A 3S4CA 3A0OA 5ILYA 5GZKA 4DODA 1QSJA 3C72B 1XWTA 1OJOA 5E2JA 3E73A 4GL3A 1TN7B 2NVPA 4BOJA 1LOHA 1LXMA 1N1ZA 3P5PA 2EADA 3WIQA 1H39A 3QWTA 3RJ3A 4C1SA 2F0YB 2JG0A 1OJNA 1IS9A 4CJ1A 4GTMB 1HMUA 1RWFA 3DSWB 1QQFA 5ILDA 1TNUB 2E24A 3E7JA 3PYAA 5JPMB 1H3CA 1HX9A 1TNZB 1N4SB 1QAZA 3QT3A 2B4FA 4AYQA 4OZVA 4LIXA 3DSTB 3QSPA 1NI1B 3G6JB 3S4BA 3S9VA 4YDOB 1FO2A 4J5TA 1G9GA 1O6RA 4M76A 1HM3A 1W6KA 2WCOA 1S64B 1AGMA 1KSCA 4MMHA 3M74A 3E34B 1FO3A 1SA5B 1WU4A 1H37A 2FUTA 3CIHA 3ACSA 3PZ3B 1W3YA 3SFYB 3DSVB 1N94B 3Q75B 5IM1A 2IEJB 3M7CA 1HXAA 1FBOA 1N7PA 2PMVA 1KZPB 1H35A 3VSNA 4GTVB 1IA6A 3NFVA 4Z4JA 1D8DB 1N4PB 4RNQA 3EZ8A 5DGRA 3RRSA 4D94A 4L6XA 4FXGB 1R76A 2GZ6A 2EACA 4D4AA 1TN8B 5FO7B 4TF4A 1AYXA 1N4RB 2BB5A 1H12A 1O5MB 1C3DA 4OZWA 1FT2B 2BRPA 4WU0A 2PN5A 1NC5A 2ZZRA 3E80A 3HXDB 3N0GA 2WY8A 5AGDA 2FBAA 1TNOB 2H6HB 2V8JA 1GA2A 1LXKA 1DCEB 1RWHA 3DSSB 3D3IA 3PYBA 3X17A 3EUVB 3PZ1B 2QNOA 3N0FA 1G6IA 3DPYB 2D5JA 2H6FB 4Q88A 3WKHA 1G9JA 1HXGA 4F10A 1FPPB 4F13A 4AYPA 3SDTA 4KTPA 3T33A 2V8IA 1I8QA 2A8ZA 4MMIA 2G0DA 5ILHA 3QG0A 3DSXB 1HXCA 1WZZA 3PZ2B 3Q7AB 3K7XA 1O79A 4MU9A 1GXMA 1QBQB 3EQAA 4DOEA 1XWQA 3HXEB 1UG9A 2H6IB 2ZBLA 1G87A 3TF4A 1UMPA 4V1SA 2VN4A 1D8EB 1X9DA 1JCQB 1KREA 1SQCA 3Q73B 5FOBB 4WVAA 4E1YA 3EU8A 4ZH5A 1ULVA 1X1HA 1N1BA 1V7XA 5FO8B 3H7LA 3KSQB 1O1RB 1LD7B 3GZKA 1J0NA 3A3VA 1GSZA 3W7SA 2ZISB 3E32B 2CQSA 1GAIA 3HXFB 1X1JA 3S4AA 5C05A 1DOGA 1V5DA 1HZFA 1H54A 4D4BA 3E30B 3D5RA 3W7WA 5M7IA 3GT5A 2Z07A 1LD8B 2BEDB 3RSYA 1H13A 4ZG8A 1HV6A 1SA4B 5ILKA 3SDUA 3M72A 1KKTA 3HXBB 1F9DA 3WIRA 1O6HA 1FAEA 1H14A 3EU5B 4MBGB 2WYNA 5CA3A 3M7EA 3QFZA 1TNYB 1LF6A 3KLSA 3W5NA 1GXNA 1LF9A 2GH4A 1J0MA 3M71A 3QT9A 1UT9A 2BRWA 3SDVA 1GHQA 5JPNB 2RGKA 3Q79B 1FMIA 3WKGA 2XQWA 5IKHA 2P0VA 2BB6A 5EAUA 2JF4A 3SAEA 5IK0A 1L2AA 4Q2BA 4YDEB 4OJZA 2A73B 4GTTB 2E22A 3E33B 4LNBB 1OJPA 1FCEA 2NOJA 1S63B 2OKXA 1KRFA 2WINB 3OEDA 1RWCA 2WDAA 2DRRA 1VD5A 5GY3A 5EATA 2FV1A 3Q78B 5CD2A 2RI8A 1F1SA 4YCRA 4CE7A 4GAXA 4QT9A 3ANJA 4GTSB 3QPFA 3PMMA 1RWGA 1KFGA 3S4DA 3AFJA 2FV0A 3G4DA 1N4QB 3RX8A 1MZCB 1KWFA 5IK9A 5KKBA 3DSUB 1N7QA 4LNGB 2J5CA 1XW2A 4GTOB 2I07B 4EL8A 4ONTA 1C82A 1GAHA 2G02A 4FJQA 1V5CA 3M73A 1NXCA 2X03A 4EHMB 5JMFA 3H2WA 1HM2A 4ZRQA 2CQTA 1TF4A 1X81B 2AHGA 1N95B 3Q7FB 5JMDA 1RQ5A 5IKAA 2V3PA 3M02A 3M76A 4GTQB 3LZ9A 3SDRA 3QXFA 4Z4LA 4WVBA 3RX7A 3P5RA 3E37B 3QRYA 4AYRA 3QDEA 4FXKB 2WY7A 1O1TB 2EAEA 4ZH1A 2DRQA 1F9OA 3P2CA 2FUQA 1JCSB 1H3AA 2R2LB 1KZOB 3SFXB 3QXQA 4KTRA 1K72A 4L0GA 3CU7A 4OK4A 3QFYA 2XFGA 1RWAA 2B39A 3ANIA 4ZRPA 3OXUA 3NNBA 3SDQA 4XUVA 1HN0A 4D4CA 5MEHA 5DGQA 1O6QA
chains in the Genus database with same CATH topology
4WVCA 3GLYA 3K11A 3M7BA 1GLMA 1H36A 3WIWA 1FT1B 4KKJA 2BBCA 2DRSA 2H6GB 2SQCA 2JJBA 4D4DA 1CLCA 3E6UA 3M77A 4FUSA 1L1YA 2F6DA 1H3BA 2WIIB 3M78A 4V1RA 5GW7A 3M75A 3RX5A 2XWBB 3D5SA 3W7TA 1IA7A 3WUXA 4KKIA 2FUZA 2AFAA 2EABA 5M7YA 2GOXA 3RENA 1O1SB 2DROA 1CEMA 2V3NA 5CZLA 4AYOA 1TNBB 3WKIA 3WKFA 1FBWA 4CJ0A 1N9AB 3WC3A 2AHFA 3VXDA 3HXCB 1GXOA 1KS8A 1W6JA 1JS4A 1V7WA 3W7UA 3ON6A 1NL4B 1JCRB 2YIKA 4BOKA 1DL2A 4JJJA 3ACTA 1KSDA 3KQ4A 4LNVA 5FO9B 3SQCA 2VN7A 1FP3A 2RI9A 1LTXB 3PZ4B 2ZIRB 1WU6A 2XWJB 1HCUA 3DRAB 2D8LA 3ANKA 4TXTA 2V8KA 4GTRB 3W7XA 1WU5A 3VW5A 1TN6B 3H3KA 3W5MA 3KSLB 3M7LA 1V7VA 4L9PB 4GTPB 3S4CA 5GZKA 4DODA 1QSJA 3C72B 1XWTA 5E2JA 3E73A 4GL3A 1TN7B 2NVPA 4BOJA 3P5PA 2EADA 3WIQA 1H39A 3QWTA 3RJ3A 4C1SA 2F0YB 2JG0A 1IS9A 4CJ1A 4GTMB 3DSWB 1QQFA 1TNUB 5JPMB 3PYAA 1H3CA 1TNZB 1N4SB 3QT3A 2B4FA 4AYQA 4LIXA 3DSTB 3QSPA 1NI1B 3G6JB 3S4BA 3S9VA 4YDOB 1FO2A 4J5TA 1G9GA 1O6RA 4M76A 1W6KA 1S64B 1AGMA 1KSCA 3M74A 3E34B 1FO3A 1SA5B 1WU4A 1H37A 3CIHA 3ACSA 3PZ3B 3SFYB 3DSVB 1N94B 3Q75B 2IEJB 3M7CA 1FBOA 2PMVA 1KZPB 1H35A 4GTVB 1IA6A 4Z4JA 1D8DB 1N4PB 3EZ8A 5DGRA 3RRSA 4D94A 4L6XA 4FXGB 1R76A 2GZ6A 2EACA 4D4AA 1TN8B 5FO7B 4TF4A 1AYXA 1N4RB 2BB5A 1H12A 1O5MB 1C3DA 1FT2B 4WU0A 2PN5A 1NC5A 2ZZRA 3HXDB 2WY8A 5AGDA 2FBAA 1TNOB 2H6HB 2V8JA 1GA2A 1DCEB 3DSSB 3D3IA 3PYBA 3X17A 3EUVB 3PZ1B 2QNOA 1G6IA 3DPYB 2D5JA 2H6FB 4Q88A 3WKHA 1G9JA 1FPPB 4AYPA 3SDTA 4KTPA 3T33A 2V8IA 2A8ZA 2G0DA 3QG0A 3DSXB 1WZZA 3PZ2B 3Q7AB 3K7XA 1O79A 4MU9A 1GXMA 1QBQB 3EQAA 4DOEA 1XWQA 3HXEB 1UG9A 2H6IB 2ZBLA 1G87A 3TF4A 1UMPA 4V1SA 2VN4A 1D8EB 1X9DA 1JCQB 1KREA 1SQCA 3Q73B 5FOBB 4WVAA 3EU8A 4ZH5A 1ULVA 1V7XA 5FO8B 3H7LA 3KSQB 1O1RB 1LD7B 3GZKA 3A3VA 1GSZA 3W7SA 2ZISB 3E32B 2CQSA 1GAIA 3HXFB 3S4AA 1DOGA 1V5DA 1HZFA 1H54A 4D4BA 3E30B 3D5RA 3W7WA 5M7IA 3GT5A 2Z07A 1LD8B 2BEDB 3RSYA 1H13A 4ZG8A 1SA4B 3SDUA 3M72A 1KKTA 3HXBB 1F9DA 3WIRA 1O6HA 1FAEA 1H14A 3EU5B 4MBGB 2WYNA 5CA3A 3M7EA 3QFZA 1TNYB 1LF6A 3KLSA 3W5NA 1GXNA 1LF9A 2GH4A 3QT9A 3M71A 1UT9A 3SDVA 1GHQA 5JPNB 2RGKA 3Q79B 1FMIA 3WKGA 2XQWA 2P0VA 2BB6A 2JF4A 3SAEA 1L2AA 4Q2BA 4YDEB 2A73B 4GTTB 3E33B 4LNBB 1FCEA 2NOJA 1S63B 2OKXA 1KRFA 2WINB 3OEDA 2DRRA 1VD5A 5GY3A 2FV1A 3Q78B 5CD2A 2RI8A 4YCRA 4CE7A 4QT9A 3ANJA 4GTSB 3QPFA 3PMMA 1KFGA 3S4DA 3AFJA 2FV0A 1N4QB 3RX8A 1MZCB 1KWFA 5KKBA 3DSUB 4LNGB 1XW2A 4GTOB 2I07B 4EL8A 4ONTA 1GAHA 2G02A 1V5CA 3M73A 1NXCA 4EHMB 3H2WA 4ZRQA 2CQTA 1TF4A 1X81B 2AHGA 1N95B 3Q7FB 1RQ5A 2V3PA 3M76A 4GTQB 3SDRA 3QXFA 4Z4LA 4WVBA 3RX7A 3P5RA 3E37B 3QRYA 4AYRA 3QDEA 4FXKB 2WY7A 1O1TB 2EAEA 4ZH1A 2DRQA 1F9OA 3P2CA 1JCSB 1H3AA 2R2LB 1KZOB 3SFXB 3QXQA 4KTRA 1K72A 4L0GA 3CU7A 3QFYA 2XFGA 2B39A 3ANIA 4ZRPA 3OXUA 3SDQA 4XUVA 4D4CA 5MEHA 5DGQA 1O6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JF4 A;  3GLY A;  3K11 A;  4WVC A;  4DOD A;  1GLM A;  1L2A A;  1XWT A;  4Q2B A;  3E73 A;  5E2J A;  3WIW A;  3D3I A;  3X17 A;  2NVP A;  1FCE A;  2DRS A;  2QNO A;  1G6I A;  2JJB A;  2D5J A;  2EAD A;  2OKX A;  4Q88 A;  3WKH A;  1KRF A;  3WIQ A;  1CLC A;  1G9J A;  3E6U A;  3QWT A;  2DRR A;  1VD5 A;  4FUS A;  5GY3 A;  1L1Y A;  2JG0 A;  2FV1 A;  5CD2 A;  4AYP A;  4KTP A;  3T33 A;  1IS9 A;  2F6D A;  4CJ1 A;  2A8Z A;  2RI8 A;  3W7T A;  5GW7 A;  3QG0 A;  4CE7 A;  3RX5 A;  3ANJ A;  1WZZ A;  3QPF A;  3PMM A;  1KFG A;  3EQA A;  3QT3 A;  1XWQ A;  4DOE A;  1IA7 A;  1UG9 A;  2B4F A;  2FV0 A;  2FUZ A;  3AFJ A;  2AFA A;  2ZBL A;  3RX8 A;  3S4D A;  3WUX A;  1G87 A;  1KWF A;  3TF4 A;  2EAB A;  5KKB A;  5M7Y A;  3QSP A;  1XW2 A;  4EL8 A;  2VN4 A;  3REN A;  2DRO A;  1X9D A;  1CEM A;  1GAH A;  1KRE A;  5CZL A;  3S4B A;  4AYO A;  3WKI A;  4AYQ A;  4WVA A;  1FO2 A;  1V5C A;  4ZH5 A;  3WKF A;  1ULV A;  4J5T A;  1NXC A;  1G9G A;  1FBW A;  4CJ0 A;  1V7X A;  3H7L A;  3H2W A;  1AGM A;  1KSC A;  3GZK A;  3WC3 A;  3A3V A;  3W7S A;  2AHF A;  2CQT A;  1TF4 A;  3VXD A;  2AHG A;  2CQS A;  1RQ5 A;  1FO3 A;  1GAI A;  1KS8 A;  1JS4 A;  1V7W A;  1WU4 A;  3S4A A;  3W7U A;  3CIH A;  3ACS A;  1DOG A;  3ON6 A;  1V5D A;  3QXF A;  4WVB A;  3RX7 A;  4Z4L A;  2YIK A;  1DL2 A;  1H54 A;  4JJJ A;  3ACT A;  1KSD A;  3W7W A;  2P0V A;  5M7I A;  3GT5 A;  3QRY A;  2Z07 A;  2VN7 A;  3RSY A;  4AYR A;  1H13 A;  4ZG8 A;  1FP3 A;  2RI9 A;  3QDE A;  1KKT A;  2EAE A;  1WU6 A;  1F9D A;  2DRQ A;  1FBO A;  3WIR A;  1F9O A;  1FAE A;  3P2C A;  1HCU A;  1H14 A;  1IA6 A;  2D8L A;  4Z4J A;  3ANK A;  2WYN A;  3EZ8 A;  5DGR A;  4TXT A;  3RRS A;  5CA3 A;  4L6X A;  3QFZ A;  1LF6 A;  2GZ6 A;  3QXQ A;  4KTR A;  3W5N A;  3W7X A;  1K72 A;  1LF9 A;  2EAC A;  4L0G A;  2GH4 A;  1WU5 A;  2XFG A;  3QFY A;  3ANI A;  3QT9 A;  1AYX A;  1UT9 A;  4TF4 A;  1H12 A;  3VW5 A;  4XUV A;  3H3K A;  4WU0 A;  2RGK A;  1NC5 A;  3W5M A;  2ZZR A;  1FMI A;  1V7V A;  3WKG A;  5MEH A;  2FBA A;  5DGQ A;  3S4C A;  1GA2 A; 
#chains in the Genus database with same CATH topology
 4NEI A;  4WVC A;  3GLY A;  3K11 A;  3M7B A;  3M00 A;  1GLM A;  1EGU A;  1H36 A;  3WIW A;  1FT1 B;  1F9G A;  4KKJ A;  2BBC A;  2DRS A;  1N21 A;  2SQC A;  2H6G B;  1OJM A;  2JJB A;  5IL8 A;  4D4D A;  5DHI A;  5ILZ A;  1CLC A;  1N7N A;  3E6U A;  4FNV A;  3M77 A;  4FUS A;  1L1Y A;  5IK6 A;  2F6D A;  1H3B A;  2WII B;  3M78 A;  4V1R A;  5GW7 A;  3M75 A;  3RX5 A;  5IL3 A;  2XWB B;  1X1I A;  3D5S A;  3M01 A;  3W7T A;  1IA7 A;  3WUX A;  4KKI A;  2FUZ A;  2AFA A;  5DHK A;  2EAB A;  5M7Y A;  2BRV X;  1HMW A;  2GOX A;  3REN A;  1O1S B;  2DRO A;  1CEM A;  2V3N A;  5CZL A;  4AYO A;  1TNB B;  3WKI A;  3VSM A;  3WKF A;  1FBW A;  4CJ0 A;  1N9A B;  3WC3 A;  2AHF A;  4OK2 A;  3VXD A;  3HXC B;  1GXO A;  2ONG A;  1KS8 A;  1W6J A;  1JS4 A;  1V7W A;  3G4F A;  3W7U A;  3ON6 A;  1NL4 B;  1JCR B;  2YIK A;  4BOK A;  1DL2 A;  4JJJ A;  1N23 A;  1KSD A;  3ACT A;  1N7O A;  3KQ4 A;  4LNV A;  5FO9 B;  3SQC A;  2VN7 A;  1FP3 A;  2RI9 A;  1LTX B;  1RW9 A;  3PZ4 B;  2ZIR B;  1WU6 A;  5EAS A;  2XWJ B;  1CB8 A;  1HCU A;  3DRA B;  2D8L A;  3AFL A;  1N7R A;  3ANK A;  4TXT A;  2V8K A;  4GTR B;  2Q1F A;  3W7X A;  5ILI A;  5ILJ A;  1WU5 A;  4DI5 A;  3VW5 A;  1N20 A;  1TN6 B;  1N22 A;  3H3K A;  3W5M A;  3KSL B;  2ONH A;  3M7L A;  1V7V A;  4L9P B;  4GTP B;  1N24 A;  3S4C A;  3A0O A;  5ILY A;  5GZK A;  4DOD A;  1QSJ A;  3C72 B;  1XWT A;  1OJO A;  5E2J A;  3E73 A;  4GL3 A;  1TN7 B;  2NVP A;  4BOJ A;  1LOH A;  1LXM A;  1N1Z A;  3P5P A;  2EAD A;  3WIQ A;  1H39 A;  3QWT A;  3RJ3 A;  4C1S A;  2F0Y B;  2JG0 A;  1OJN A;  1IS9 A;  4CJ1 A;  4GTM B;  1HMU A;  1RWF A;  3DSW B;  1QQF A;  5ILD A;  1TNU B;  2E24 A;  3E7J A;  3PYA A;  5JPM B;  1H3C A;  1HX9 A;  1TNZ B;  1N4S B;  1QAZ A;  3QT3 A;  2B4F A;  4AYQ A;  4OZV A;  4LIX A;  3DST B;  3QSP A;  1NI1 B;  3G6J B;  3S4B A;  3S9V A;  4YDO B;  1FO2 A;  4J5T A;  1G9G A;  1O6R A;  4M76 A;  1HM3 A;  1W6K A;  2WCO A;  1S64 B;  1AGM A;  1KSC A;  4MMH A;  3M74 A;  3E34 B;  1FO3 A;  1SA5 B;  1WU4 A;  1H37 A;  2FUT A;  3CIH A;  3ACS A;  3PZ3 B;  1W3Y A;  3SFY B;  3DSV B;  1N94 B;  3Q75 B;  5IM1 A;  2IEJ B;  3M7C A;  1HXA A;  1FBO A;  1N7P A;  2PMV A;  1KZP B;  1H35 A;  3VSN A;  4GTV B;  1IA6 A;  3NFV A;  4Z4J A;  1D8D B;  1N4P B;  4RNQ A;  3EZ8 A;  5DGR A;  3RRS A;  4D94 A;  4L6X A;  4FXG B;  1R76 A;  2GZ6 A;  2EAC A;  4D4A A;  1TN8 B;  5FO7 B;  4TF4 A;  1AYX A;  1N4R B;  2BB5 A;  1H12 A;  1O5M B;  1C3D A;  4OZW A;  1FT2 B;  2BRP A;  4WU0 A;  2PN5 A;  1NC5 A;  2ZZR A;  3E80 A;  3HXD B;  3N0G A;  2WY8 A;  5AGD A;  2FBA A;  1TNO B;  2H6H B;  2V8J A;  1GA2 A;  1LXK A;  1DCE B;  1RWH A;  3DSS B;  3D3I A;  3PYB A;  3X17 A;  3EUV B;  3PZ1 B;  2QNO A;  3N0F A;  1G6I A;  3DPY B;  2D5J A;  2H6F B;  4Q88 A;  3WKH A;  1G9J A;  1HXG A;  4F10 A;  1FPP B;  4F13 A;  4AYP A;  3SDT A;  4KTP A;  3T33 A;  2V8I A;  1I8Q A;  2A8Z A;  4MMI A;  2G0D A;  5ILH A;  3QG0 A;  3DSX B;  1HXC A;  1WZZ A;  3PZ2 B;  3Q7A B;  3K7X A;  1O79 A;  4MU9 A;  1GXM A;  1QBQ B;  3EQA A;  4DOE A;  1XWQ A;  3HXE B;  1UG9 A;  2H6I B;  2ZBL A;  1G87 A;  3TF4 A;  1UMP A;  4V1S A;  2VN4 A;  1D8E B;  1X9D A;  1JCQ B;  1KRE A;  1SQC A;  3Q73 B;  5FOB B;  4WVA A;  4E1Y A;  3EU8 A;  4ZH5 A;  1ULV A;  1X1H A;  1N1B A;  1V7X A;  5FO8 B;  3H7L A;  3KSQ B;  1O1R B;  1LD7 B;  3GZK A;  1J0N A;  3A3V A;  1GSZ A;  3W7S A;  2ZIS B;  3E32 B;  2CQS A;  1GAI A;  3HXF B;  1X1J A;  3S4A A;  5C05 A;  1DOG A;  1V5D A;  1HZF A;  1H54 A;  4D4B A;  3E30 B;  3D5R A;  3W7W A;  5M7I A;  3GT5 A;  2Z07 A;  1LD8 B;  2BED B;  3RSY A;  1H13 A;  4ZG8 A;  1HV6 A;  1SA4 B;  5ILK A;  3SDU A;  3M72 A;  1KKT A;  3HXB B;  1F9D A;  3WIR A;  1O6H A;  1FAE A;  1H14 A;  3EU5 B;  4MBG B;  2WYN A;  5CA3 A;  3M7E A;  3QFZ A;  1TNY B;  1LF6 A;  3KLS A;  3W5N A;  1GXN A;  1LF9 A;  2GH4 A;  1J0M A;  3M71 A;  3QT9 A;  1UT9 A;  2BRW A;  3SDV A;  1GHQ A;  5JPN B;  2RGK A;  3Q79 B;  1FMI A;  3WKG A;  2XQW A;  5IKH A;  2P0V A;  2BB6 A;  5EAU A;  2JF4 A;  3SAE A;  5IK0 A;  1L2A A;  4Q2B A;  4YDE B;  4OJZ A;  2A73 B;  4GTT B;  2E22 A;  3E33 B;  4LNB B;  1OJP A;  1FCE A;  2NOJ A;  1S63 B;  2OKX A;  1KRF A;  2WIN B;  3OED A;  1RWC A;  2WDA A;  2DRR A;  1VD5 A;  5GY3 A;  5EAT A;  2FV1 A;  3Q78 B;  5CD2 A;  2RI8 A;  1F1S A;  4YCR A;  4CE7 A;  4GAX A;  4QT9 A;  3ANJ A;  4GTS B;  3QPF A;  3PMM A;  1RWG A;  1KFG A;  3S4D A;  3AFJ A;  2FV0 A;  3G4D A;  1N4Q B;  3RX8 A;  1MZC B;  1KWF A;  5IK9 A;  5KKB A;  3DSU B;  1N7Q A;  4LNG B;  2J5C A;  1XW2 A;  4GTO B;  2I07 B;  4EL8 A;  4ONT A;  1C82 A;  1GAH A;  2G02 A;  4FJQ A;  1V5C A;  3M73 A;  1NXC A;  2X03 A;  4EHM B;  5JMF A;  3H2W A;  1HM2 A;  4ZRQ A;  2CQT A;  1TF4 A;  1X81 B;  2AHG A;  1N95 B;  3Q7F B;  5JMD A;  1RQ5 A;  5IKA A;  2V3P A;  3M02 A;  3M76 A;  4GTQ B;  3LZ9 A;  3SDR A;  3QXF A;  4Z4L A;  4WVB A;  3RX7 A;  3P5R A;  3E37 B;  3QRY A;  4AYR A;  3QDE A;  4FXK B;  2WY7 A;  1O1T B;  2EAE A;  4ZH1 A;  2DRQ A;  1F9O A;  3P2C A;  2FUQ A;  1JCS B;  1H3A A;  2R2L B;  1KZO B;  3SFX B;  3QXQ A;  4KTR A;  1K72 A;  4L0G A;  3CU7 A;  4OK4 A;  3QFY A;  2XFG A;  1RWA A;  2B39 A;  3ANI A;  4ZRP A;  3OXU A;  3NNB A;  3SDQ A;  4XUV A;  1HN0 A;  4D4C A;  5MEH A;  5DGQ A;  1O6Q A; 
#chains in the Genus database with same CATH homology
 4WVC A;  3GLY A;  3K11 A;  3M7B A;  1GLM A;  1H36 A;  3WIW A;  1FT1 B;  4KKJ A;  2BBC A;  2DRS A;  2H6G B;  2SQC A;  2JJB A;  4D4D A;  1CLC A;  3E6U A;  3M77 A;  4FUS A;  1L1Y A;  2F6D A;  1H3B A;  2WII B;  3M78 A;  4V1R A;  5GW7 A;  3M75 A;  3RX5 A;  2XWB B;  3D5S A;  3W7T A;  1IA7 A;  3WUX A;  4KKI A;  2FUZ A;  2AFA A;  2EAB A;  5M7Y A;  2GOX A;  3REN A;  1O1S B;  2DRO A;  1CEM A;  2V3N A;  5CZL A;  4AYO A;  1TNB B;  3WKI A;  3WKF A;  1FBW A;  4CJ0 A;  1N9A B;  3WC3 A;  2AHF A;  3VXD A;  3HXC B;  1GXO A;  1KS8 A;  1W6J A;  1JS4 A;  1V7W A;  3W7U A;  3ON6 A;  1NL4 B;  1JCR B;  2YIK A;  4BOK A;  1DL2 A;  4JJJ A;  3ACT A;  1KSD A;  3KQ4 A;  4LNV A;  5FO9 B;  3SQC A;  2VN7 A;  1FP3 A;  2RI9 A;  1LTX B;  3PZ4 B;  2ZIR B;  1WU6 A;  2XWJ B;  1HCU A;  3DRA B;  2D8L A;  3ANK A;  4TXT A;  2V8K A;  4GTR B;  3W7X A;  1WU5 A;  3VW5 A;  1TN6 B;  3H3K A;  3W5M A;  3KSL B;  3M7L A;  1V7V A;  4L9P B;  4GTP B;  3S4C A;  5GZK A;  4DOD A;  1QSJ A;  3C72 B;  1XWT A;  5E2J A;  3E73 A;  4GL3 A;  1TN7 B;  2NVP A;  4BOJ A;  3P5P A;  2EAD A;  3WIQ A;  1H39 A;  3QWT A;  3RJ3 A;  4C1S A;  2F0Y B;  2JG0 A;  1IS9 A;  4CJ1 A;  4GTM B;  3DSW B;  1QQF A;  1TNU B;  5JPM B;  3PYA A;  1H3C A;  1TNZ B;  1N4S B;  3QT3 A;  2B4F A;  4AYQ A;  4LIX A;  3DST B;  3QSP A;  1NI1 B;  3G6J B;  3S4B A;  3S9V A;  4YDO B;  1FO2 A;  4J5T A;  1G9G A;  1O6R A;  4M76 A;  1W6K A;  1S64 B;  1AGM A;  1KSC A;  3M74 A;  3E34 B;  1FO3 A;  1SA5 B;  1WU4 A;  1H37 A;  3CIH A;  3ACS A;  3PZ3 B;  3SFY B;  3DSV B;  1N94 B;  3Q75 B;  2IEJ B;  3M7C A;  1FBO A;  2PMV A;  1KZP B;  1H35 A;  4GTV B;  1IA6 A;  4Z4J A;  1D8D B;  1N4P B;  3EZ8 A;  5DGR A;  3RRS A;  4D94 A;  4L6X A;  4FXG B;  1R76 A;  2GZ6 A;  2EAC A;  4D4A A;  1TN8 B;  5FO7 B;  4TF4 A;  1AYX A;  1N4R B;  2BB5 A;  1H12 A;  1O5M B;  1C3D A;  1FT2 B;  4WU0 A;  2PN5 A;  1NC5 A;  2ZZR A;  3HXD B;  2WY8 A;  5AGD A;  2FBA A;  1TNO B;  2H6H B;  2V8J A;  1GA2 A;  1DCE B;  3DSS B;  3D3I A;  3PYB A;  3X17 A;  3EUV B;  3PZ1 B;  2QNO A;  1G6I A;  3DPY B;  2D5J A;  2H6F B;  4Q88 A;  3WKH A;  1G9J A;  1FPP B;  4AYP A;  3SDT A;  4KTP A;  3T33 A;  2V8I A;  2A8Z A;  2G0D A;  3QG0 A;  3DSX B;  1WZZ A;  3PZ2 B;  3Q7A B;  3K7X A;  1O79 A;  4MU9 A;  1GXM A;  1QBQ B;  3EQA A;  4DOE A;  1XWQ A;  3HXE B;  1UG9 A;  2H6I B;  2ZBL A;  1G87 A;  3TF4 A;  1UMP A;  4V1S A;  2VN4 A;  1D8E B;  1X9D A;  1JCQ B;  1KRE A;  1SQC A;  3Q73 B;  5FOB B;  4WVA A;  3EU8 A;  4ZH5 A;  1ULV A;  1V7X A;  5FO8 B;  3H7L A;  3KSQ B;  1O1R B;  1LD7 B;  3GZK A;  3A3V A;  1GSZ A;  3W7S A;  2ZIS B;  3E32 B;  2CQS A;  1GAI A;  3HXF B;  3S4A A;  1DOG A;  1V5D A;  1HZF A;  1H54 A;  4D4B A;  3E30 B;  3D5R A;  3W7W A;  5M7I A;  3GT5 A;  2Z07 A;  1LD8 B;  2BED B;  3RSY A;  1H13 A;  4ZG8 A;  1SA4 B;  3SDU A;  3M72 A;  1KKT A;  3HXB B;  1F9D A;  3WIR A;  1O6H A;  1FAE A;  1H14 A;  3EU5 B;  4MBG B;  2WYN A;  5CA3 A;  3M7E A;  3QFZ A;  1TNY B;  1LF6 A;  3KLS A;  3W5N A;  1GXN A;  1LF9 A;  2GH4 A;  3QT9 A;  3M71 A;  1UT9 A;  3SDV A;  1GHQ A;  5JPN B;  2RGK A;  3Q79 B;  1FMI A;  3WKG A;  2XQW A;  2P0V A;  2BB6 A;  2JF4 A;  3SAE A;  1L2A A;  4Q2B A;  4YDE B;  2A73 B;  4GTT B;  3E33 B;  4LNB B;  1FCE A;  2NOJ A;  1S63 B;  2OKX A;  1KRF A;  2WIN B;  3OED A;  2DRR A;  1VD5 A;  5GY3 A;  2FV1 A;  3Q78 B;  5CD2 A;  2RI8 A;  4YCR A;  4CE7 A;  4QT9 A;  3ANJ A;  4GTS B;  3QPF A;  3PMM A;  1KFG A;  3S4D A;  3AFJ A;  2FV0 A;  1N4Q B;  3RX8 A;  1MZC B;  1KWF A;  5KKB A;  3DSU B;  4LNG B;  1XW2 A;  4GTO B;  2I07 B;  4EL8 A;  4ONT A;  1GAH A;  2G02 A;  1V5C A;  3M73 A;  1NXC A;  4EHM B;  3H2W A;  4ZRQ A;  2CQT A;  1TF4 A;  1X81 B;  2AHG A;  1N95 B;  3Q7F B;  1RQ5 A;  2V3P A;  3M76 A;  4GTQ B;  3SDR A;  3QXF A;  4Z4L A;  4WVB A;  3RX7 A;  3P5R A;  3E37 B;  3QRY A;  4AYR A;  3QDE A;  4FXK B;  2WY7 A;  1O1T B;  2EAE A;  4ZH1 A;  2DRQ A;  1F9O A;  3P2C A;  1JCS B;  1H3A A;  2R2L B;  1KZO B;  3SFX B;  3QXQ A;  4KTR A;  1K72 A;  4L0G A;  3CU7 A;  3QFY A;  2XFG A;  2B39 A;  3ANI A;  4ZRP A;  3OXU A;  3SDQ A;  4XUV A;  4D4C A;  5MEH A;  5DGQ A;  1O6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...