1KSDA

The structure of endoglucanase from termite, nasutitermes takasagoensis, at ph 6.5.
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
433
structure length
433
Chain Sequence
MAYDYKQVLRDSLLFYEAQRSGRLPADQKVTWRKDSALNDQGDQGQDLTGGYFDAGDFVKFGFPMAYTATVLAWGLIDFEAGYSSAGALDDGRKAVKWATDYFIKAHTSQNEFYGQVGQGDADHAFWGRPEDMTMARPAYKIDTSRPGSDLAGETAAALAAASIVFRNVDGTYSNNLLTHARQLFDFANNYRGKYSDSITDARNFYASADYRDELVWAAAWLYRATNDNTYLNTAESLYDEFGLQNWGGGLNWDSKVSGVQVLLAKLTNKQAYKDTVQSYVNYLINNQQKTPKGLLYIDMWGTLRHAANAAFIMLEAAELGLSASSYRQFAQTQIDYALGDGGRSFVCGFGSNPPTRPHHRSSSCPPAPATCDWNTFNSPDPNYHVLSGALVGGPDQNDNYVDDRSDYVHNEVATDYNAGFQSALAALVALGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-b-1,4-glucanase
publication title Structure of an endoglucanase from termite, Nasutitermes takasagoensis.
pubmed doi rcsb
source organism Nasutitermes takasagoensis
molecule tags Hydrolase
total genus 174
structure length 433
sequence length 433
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2002-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00759 Glyco_hydro_9 Glycosyl hydrolase family 9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1ksdA00
3H2WA 3QFYA 2RI8A 2OKXA 1CEMA 1FBWA 1H54A 2DROA 3RX5A 1KSCA 1H12A 5M7YA 3X17A 1JS4A 2ZZRA 1K72A 2EACA 4CJ0A 1L1YA 1LF6A 5KKBA 4ZH5A 3WKFA 2DRSA 2EABA 3QXFA 3WIRA 3QFZA 3K11A 5CZLA 3QT3A 4TF4A 4ZG8A 3W7UA 3EQAA 1DL2A 1WU5A 3RRSA 3QSPA 4XUVA 5DGQA 4DOEA 3QG0A 1V7WA 5MEHA 3ACTA 1KRFA 1NC5A 2P0VA 1IA6A 3ON6A 4FUSA 1XWQA 2A8ZA 2JJBA 2EADA 1LF9A 4Q88A 3T33A 4L0GA 3S4DA 1KFGA 3QPFA 1F9OA 2VN4A 2FUZA 1KREA 4WU0A 1V5DA 2JF4A 2WYNA 1GAHA 3P2CA 3QT9A 1GAIA 1V7XA 3WIWA 4Q2BA 1V7VA 4WVAA 1F9DA 1WU6A 3H7LA 3WKGA 1WU4A 1TF4A 2B4FA 3GLYA 3WC3A 3ANIA 3W5MA 1FP3A 2EAEA 4WVBA 1KKTA 3H3KA 2RI9A 2JG0A 4EL8A 3E73A 3WUXA 1IA7A 1FCEA 1RQ5A 1G9JA 1GLMA 3QRYA 2FBAA 1G87A 3S4CA 3D3IA 3RENA 2GZ6A 3QDEA 2NVPA 3A3VA 2D8LA 1H14A 5CD2A 1KS8A 1V5CA 4WVCA 1G6IA 2D5JA 4KTPA 4JJJA 5M7IA 3WIQA 1UG9A 1FAEA 5CA3A 4TXTA 1VD5A 1XW2A 2Z07A 2XFGA 1KWFA 5GY3A 1FO2A 1KSDA 3W5NA 1H13A 1NXCA 3W7WA 2CQTA 3PMMA 1L2AA 4AYOA 4DODA 5DGRA 3VXDA 3TF4A 3AFJA 4L6XA 4AYQA 3S4BA 3CIHA 2AHFA 1AYXA 2F6DA 2YIKA 3QWTA 2ZBLA 3ANJA 4CJ1A 4J5TA 2DRRA 5E2JA 3S4AA 2AHGA 1X9DA 2DRQA 2RGKA 2FV0A 3WKHA 2CQSA 3QXQA 3W7XA 4Z4JA 3W7SA 3W7TA 3RX7A 1FO3A 3WKIA 3RSYA 4Z4LA 1AGMA 2GH4A 4AYPA 1G9GA 3RX8A 1UT9A 1CLCA 3VW5A 1FBOA 1FMIA 1IS9A 2VN7A 3GT5A 4KTRA 1GA2A 1ULVA 3ACSA 1DOGA 1HCUA 1XWTA 2FV1A 3EZ8A 2QNOA 1WZZA 3E6UA 3ANKA 5GW7A 3GZKA 4CE7A 4AYRA 2AFAA
chains in the Genus database with same CATH superfamily
5ILHA 2OKXA 1RWAA 1FBWA 5IKAA 1H12A 1LXMA 1JS4A 2EACA 4CJ0A 2V8JA 2V8KA 2DRSA 3QXFA 5JPMB 4E1YA 3EUVB 4XUVA 5DGQA 1SA4B 4DOEA 3QG0A 1DCEB 5MEHA 3ACTA 1MZCB 1XWQA 3DPYB 4MBGB 4FNVA 3SDTA 4L0GA 1W6KA 4OK4A 1F9OA 2VN4A 3P2CA 1H3AA 2BRWA 2WDAA 3PZ2B 1GAIA 1HN0A 5JPNB 4D4AA 3GLYA 2FUQA 1TNOB 3G6JB 2BBCA 4WVBA 1X1JA 2PN5A 1OJNA 3KSQB 3HXDB 4EL8A 4D4DA 1FCEA 1RQ5A 1S64B 3SDUA 3KSLB 2FBAA 3M78A 3RENA 1LXKA 1OJPA 1O1TB 3A3VA 5CD2A 1KS8A 1V5CA 4WVCA 1G6IA 2WINB 4KTPA 4JJJA 3RJ3A 5M7IA 3WIQA 1FAEA 5AGDA 1VD5A 2Z07A 1HMUA 1H13A 2G0DA 3PMMA 1L2AA 3VXDA 4AYQA 1TN7B 1W3YA 3Q7FB 2E24A 3SDRA 1RWFA 4OK2A 1AYXA 1TN6B 3DSUB 2ZBLA 1JCQB 3PZ3B 4L9PB 3SAEA 4OZVA 2R2LB 3S4AA 2IEJB 1HM3A 3W7SA 3DSSB 3DSWB 3WKIA 4C1SA 4GTVB 2A73B 1N22A 3Q78B 4GTRB 1CLCA 1J0NA 2VN7A 1KZOB 2WIIB 5IM1A 2BRPA 3PZ1B 2XQWA 3G4FA 1ULVA 4KTRA 5JMDA 3DSTB 1XWTA 2WCOA 3EZ8A 1WZZA 3ANKA 2Q1FA 3GZKA 3SFXB 4MMIA 1TNUB 2AFAA 1TNZB 1N21A 5IL8A 1CEMA 4LIXA 2E22A 1N23A 5IL3A 3HXFB 3KQ4A 1N95B 4GTMB 1K72A 1QAZA 1N7OA 3Q73B 1LF6A 5KKBA 4M76A 4LNVA 2ZIRB 1LOHA 2EABA 3WIRA 3G4DA 3QFZA 5ILZA 4ZG8A 3W7UA 3QT3A 3KLSA 3SFYB 1WU5A 3EU5B 1HM2A 1V7WA 3E32B 1NC5A 5GZKA 4GTQB 1IA6A 3ON6A 4BOKA 3HXCB 4EHMB 1KFGA 3QPFA 1C3DA 1RWHA 4RNQA 4WVAA 1WU6A 3K7XA 1WU4A 1D8DB 2V3NA 3W5MA 1KKTA 3H3KA 2RI9A 1S63B 2NOJA 1N7PA 4OJZA 1GXNA 1H37A 3QRYA 3D5RA 1G87A 1N4SB 1JCRB 1NI1B 1GHQA 2BEDB 1TNYB 1H14A 4V1RA 3M00A 2H6GB 4BOJA 2I07B 3N0GA 1O1SB 4TXTA 2XFGA 1FO2A 1KSDA 3NFVA 2CQTA 2J5CA 3D5SA 3TF4A 5FOBB 4GTTB 4V1SA 3S4BA 1H3BA 2AHFA 1KZPB 3EU8A 3QWTA 5ILKA 4CJ1A 2DRQA 2CQSA 3W7XA 1O79A 4Z4JA 4ONTA 3RX7A 1FO3A 4GL3A 3S9VA 1AGMA 1O6HA 4AYPA 1FPPB 1N7NA 4DI5A 5ILIA 1O6RA 3E80A 1FBOA 3VW5A 1FMIA 1IS9A 5ILDA 1LTXB 2FV1A 5FO7B 2QNOA 1CB8A 3E6UA 1N4RB 5GW7A 1N1BA 3QFYA 2RI8A 4MMHA 2BRVX 1O5MB 2DROA 4NEIA 1KSCA 1FT2B 4GAXA 2ONHA 3PYBA 1L1YA 1GXMA 1LD8B 2WY8A 4ZH5A 2WY7A 3DSVB 5CZLA 3AFLA 4TF4A 5EASA 1DL2A 3QSPA 1HMWA 1R76A 1KRFA 3SDQA 2A8ZA 2JJBA 3M7CA 4Q88A 5ILYA 3T33A 3S4DA 1EGUA 4ZRQA 1N1ZA 1KREA 4WU0A 3VSMA 1GAHA 1O6QA 3QT9A 4CE7A 3M7EA 3WIWA 4D94A 1V7VA 1HXGA 1TF4A 1N4QB 3PYAA 1FP3A 1FT1B 2EAEA 2B39A 1GSZA 1H36A 2JG0A 3E73A 3DSXB 4ZRPA 3PZ4B 1N9AB 1H3CA 1H39A 1IA7A 1JCSB 1GLMA 3E33B 1OJOA 2H6HB 2GZ6A 1N94B 4MU9A 1NL4B 2D8LA 4GTSB 4KKJA 3HXEB 2XWBB 2D5JA 3Q75B 1N20A 4ZH1A 5C05A 5CA3A 1I8QA 1XW2A 3E37B 3CU7A 1KWFA 5GY3A 3DRAB 3N0FA 3NNBA 3M74A 3W5NA 1HZFA 1X1IA 3W7WA 4AYOA 4LNGB 3AFJA 1X81B 3CIHA 1J0MA 2G02A 1UMPA 4YDOB 2FUTA 2F6DA 2YIKA 2BB6A 4FXKB 5FO9B 2DRRA 2AHGA 4KKIA 4YCRA 3QXQA 1N7RA 3W7TA 1C82A 5DHKA 4GTOB 2GH4A 5ILJA 1UT9A 2GOXA 3M7BA 1SA5B 3GT5A 1TN8B 1GA2A 4FJQA 1DOGA 1HCUA 1QBQB 1N7QA 3M71A 4OZWA 2ZZRA 3H2WA 2F0YB 3SQCA 1HX9A 3M76A 4D4CA 1LD7B 1N24A 3VSNA 1H54A 1HXAA 1QQFA 3RX5A 3M73A 1X1HA 5M7YA 3X17A 2X03A 3A0OA 2ONGA 3LZ9A 4D4BA 3E34B 2H6IB 2ZISB 3WKFA 3Q7AB 1TNBB 3K11A 3EQAA 3P5RA 3RRSA 5DHIA 2P0VA 1F9GA 3HXBB 4FUSA 5EAUA 2EADA 1LF9A 3M72A 3E7JA 2FUZA 1H35A 1V5DA 2JF4A 1SQCA 2WYNA 3M02A 4F13A 1RWCA 1V7XA 5IK6A 3E30B 4Q2BA 1F9DA 3H7LA 3M77A 3P5PA 3WKGA 1QSJA 5JMFA 2B4FA 4YDEB 3ANIA 3WC3A 1W6JA 1RWGA 1GXOA 3SDVA 3WUXA 1G9JA 5IK0A 3S4CA 3D3IA 2NVPA 3C72B 3QDEA 2V8IA 2SQCA 3OXUA 1UG9A 4FXGB 2H6FB 1N4PB 3Q79B 1NXCA 4DODA 1OJMA 2V3PA 3M75A 5DGRA 4L6XA 5IK9A 3M7LA 1HV6A 3ANJA 4F10A 4J5TA 5IKHA 5E2JA 1RW9A 1X9DA 1F1SA 2FV0A 2RGKA 3WKHA 2BB5A 5EATA 4QT9A 2PMVA 4LNBB 3OEDA 3RSYA 4Z4LA 5FO8B 1O1RB 1G9GA 3RX8A 1HXCA 4GTPB 3ACSA 3M01A 1D8EB 2XWJB 4AYRA
chains in the Genus database with same CATH topology
2OKXA 1FBWA 1H12A 1JS4A 2EACA 4CJ0A 2V8JA 2V8KA 2DRSA 3QXFA 5JPMB 3EUVB 4XUVA 5DGQA 1SA4B 4DOEA 3QG0A 1DCEB 5MEHA 3ACTA 1MZCB 1XWQA 3DPYB 4MBGB 3SDTA 4L0GA 1W6KA 1F9OA 2VN4A 3P2CA 1H3AA 3PZ2B 1GAIA 5JPNB 4D4AA 3GLYA 1TNOB 3G6JB 2BBCA 4WVBA 2PN5A 3KSQB 3HXDB 4EL8A 4D4DA 1FCEA 1RQ5A 1S64B 3SDUA 3KSLB 2FBAA 3M78A 3RENA 1O1TB 3A3VA 5CD2A 1KS8A 1V5CA 4WVCA 1G6IA 2WINB 4KTPA 4JJJA 3RJ3A 5M7IA 3WIQA 1FAEA 5AGDA 1VD5A 2Z07A 1H13A 2G0DA 3PMMA 1L2AA 3VXDA 4AYQA 1TN7B 3Q7FB 3SDRA 1AYXA 1TN6B 3DSUB 2ZBLA 1JCQB 3PZ3B 4L9PB 3SAEA 2R2LB 3S4AA 2IEJB 3W7SA 3DSSB 3DSWB 3WKIA 4C1SA 4GTVB 2A73B 3Q78B 4GTRB 1CLCA 2VN7A 1KZOB 2WIIB 3PZ1B 4KTRA 2XQWA 1ULVA 3DSTB 1XWTA 3EZ8A 1WZZA 3ANKA 3GZKA 3SFXB 1TNUB 2AFAA 1TNZB 1CEMA 4LIXA 3HXFB 3KQ4A 1N95B 4GTMB 1K72A 3Q73B 1LF6A 5KKBA 4M76A 4LNVA 2ZIRB 2EABA 3WIRA 3QFZA 4ZG8A 3W7UA 3QT3A 3KLSA 3SFYB 1WU5A 3EU5B 1V7WA 3E32B 1NC5A 5GZKA 4GTQB 1IA6A 3ON6A 4BOKA 3HXCB 4EHMB 1KFGA 3QPFA 1C3DA 4WVAA 1WU6A 3K7XA 1WU4A 1D8DB 2V3NA 3W5MA 1KKTA 3H3KA 2RI9A 1S63B 2NOJA 1GXNA 1H37A 3QRYA 3D5RA 1G87A 1N4SB 1JCRB 1NI1B 1GHQA 2BEDB 1TNYB 1H14A 4V1RA 2H6GB 4BOJA 2I07B 1O1SB 4TXTA 2XFGA 1FO2A 1KSDA 2CQTA 3D5SA 3TF4A 5FOBB 4GTTB 4V1SA 3S4BA 1H3BA 2AHFA 1KZPB 3EU8A 3QWTA 4CJ1A 2DRQA 2CQSA 3W7XA 1O79A 4Z4JA 4ONTA 3RX7A 1FO3A 4GL3A 3S9VA 1AGMA 1O6HA 4AYPA 1FPPB 1O6RA 3VW5A 1FBOA 1FMIA 1IS9A 1LTXB 2FV1A 5FO7B 2QNOA 3E6UA 1N4RB 5GW7A 3QFYA 2RI8A 1O5MB 2DROA 1KSCA 1FT2B 3PYBA 1L1YA 1GXMA 1LD8B 2WY8A 4ZH5A 2WY7A 3DSVB 5CZLA 4TF4A 1DL2A 3QSPA 1R76A 1KRFA 3SDQA 2A8ZA 2JJBA 3M7CA 4Q88A 3T33A 3S4DA 4ZRQA 1KREA 4WU0A 1GAHA 1O6QA 3QT9A 4CE7A 3M7EA 3WIWA 4D94A 1V7VA 1TF4A 1N4QB 3PYAA 1FP3A 1FT1B 2EAEA 2B39A 1GSZA 1H36A 2JG0A 3E73A 3DSXB 4ZRPA 3PZ4B 1N9AB 1H3CA 1H39A 1IA7A 1JCSB 1GLMA 3E33B 2H6HB 2GZ6A 1N94B 4MU9A 1NL4B 2D8LA 4GTSB 4KKJA 3HXEB 2XWBB 2D5JA 3Q75B 4ZH1A 5CA3A 1XW2A 3E37B 3CU7A 1KWFA 5GY3A 3DRAB 3W5NA 3M74A 1HZFA 3W7WA 4AYOA 4LNGB 3AFJA 1X81B 3CIHA 2G02A 1UMPA 4YDOB 2F6DA 2YIKA 2BB6A 4FXKB 5FO9B 2DRRA 2AHGA 4KKIA 4YCRA 3QXQA 3W7TA 4GTOB 2GH4A 1UT9A 2GOXA 3M7BA 1SA5B 3GT5A 1TN8B 1GA2A 1DOGA 1HCUA 1QBQB 3M71A 2ZZRA 3H2WA 2F0YB 3SQCA 3M76A 4D4CA 1LD7B 1H54A 1QQFA 3RX5A 3M73A 5M7YA 3X17A 4D4BA 3E34B 2H6IB 2ZISB 3WKFA 3Q7AB 1TNBB 3K11A 3EQAA 3P5RA 3RRSA 2P0VA 3HXBB 4FUSA 2EADA 1LF9A 3M72A 2FUZA 1H35A 1V5DA 2JF4A 1SQCA 2WYNA 1V7XA 3E30B 4Q2BA 1F9DA 3H7LA 3M77A 3P5PA 3WKGA 1QSJA 2B4FA 4YDEB 3ANIA 3WC3A 1W6JA 1GXOA 3SDVA 3WUXA 1G9JA 3S4CA 3D3IA 2NVPA 3C72B 3QDEA 2V8IA 2SQCA 3OXUA 1UG9A 4FXGB 2H6FB 1N4PB 3Q79B 1NXCA 4DODA 2V3PA 3M75A 5DGRA 4L6XA 3M7LA 3ANJA 4J5TA 5E2JA 1X9DA 2RGKA 2FV0A 3WKHA 2BB5A 4QT9A 2PMVA 4LNBB 3OEDA 3RSYA 4Z4LA 5FO8B 1O1RB 1G9GA 3RX8A 4GTPB 3ACSA 1D8EB 2XWJB 4AYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H2W A;  3QFY A;  2RI8 A;  2OKX A;  1CEM A;  1FBW A;  1H54 A;  2DRO A;  3RX5 A;  1KSC A;  1H12 A;  5M7Y A;  3X17 A;  1JS4 A;  2ZZR A;  1K72 A;  2EAC A;  4CJ0 A;  1L1Y A;  1LF6 A;  5KKB A;  4ZH5 A;  3WKF A;  2DRS A;  2EAB A;  3QXF A;  3WIR A;  3QFZ A;  3K11 A;  5CZL A;  3QT3 A;  4TF4 A;  4ZG8 A;  3W7U A;  3EQA A;  1DL2 A;  1WU5 A;  3RRS A;  3QSP A;  4XUV A;  5DGQ A;  4DOE A;  3QG0 A;  1V7W A;  5MEH A;  3ACT A;  1KRF A;  1NC5 A;  2P0V A;  1IA6 A;  3ON6 A;  4FUS A;  1XWQ A;  2A8Z A;  2JJB A;  2EAD A;  1LF9 A;  4Q88 A;  3T33 A;  4L0G A;  3S4D A;  1KFG A;  3QPF A;  1F9O A;  2VN4 A;  2FUZ A;  1KRE A;  4WU0 A;  1V5D A;  2JF4 A;  2WYN A;  1GAH A;  3P2C A;  3QT9 A;  1GAI A;  1V7X A;  3WIW A;  4Q2B A;  1V7V A;  4WVA A;  1F9D A;  1WU6 A;  3H7L A;  3WKG A;  1WU4 A;  1TF4 A;  2B4F A;  3GLY A;  3WC3 A;  3ANI A;  3W5M A;  1FP3 A;  2EAE A;  4WVB A;  1KKT A;  3H3K A;  2RI9 A;  2JG0 A;  4EL8 A;  3E73 A;  3WUX A;  1IA7 A;  1FCE A;  1RQ5 A;  1G9J A;  1GLM A;  3QRY A;  2FBA A;  1G87 A;  3S4C A;  3D3I A;  3REN A;  2GZ6 A;  3QDE A;  2NVP A;  3A3V A;  2D8L A;  1H14 A;  5CD2 A;  1KS8 A;  1V5C A;  4WVC A;  1G6I A;  2D5J A;  4KTP A;  4JJJ A;  5M7I A;  3WIQ A;  1UG9 A;  1FAE A;  5CA3 A;  4TXT A;  1VD5 A;  1XW2 A;  2Z07 A;  2XFG A;  1KWF A;  5GY3 A;  1FO2 A;  1KSD A;  3W5N A;  1H13 A;  1NXC A;  3W7W A;  2CQT A;  3PMM A;  1L2A A;  4AYO A;  4DOD A;  5DGR A;  3VXD A;  3TF4 A;  3AFJ A;  4L6X A;  4AYQ A;  3S4B A;  3CIH A;  2AHF A;  1AYX A;  2F6D A;  2YIK A;  3QWT A;  2ZBL A;  3ANJ A;  4CJ1 A;  4J5T A;  2DRR A;  5E2J A;  3S4A A;  2AHG A;  1X9D A;  2DRQ A;  2RGK A;  2FV0 A;  3WKH A;  2CQS A;  3QXQ A;  3W7X A;  4Z4J A;  3W7S A;  3W7T A;  3RX7 A;  1FO3 A;  3WKI A;  3RSY A;  4Z4L A;  1AGM A;  2GH4 A;  4AYP A;  1G9G A;  3RX8 A;  1UT9 A;  1CLC A;  3VW5 A;  1FBO A;  1FMI A;  1IS9 A;  2VN7 A;  3GT5 A;  4KTR A;  1GA2 A;  1ULV A;  3ACS A;  1DOG A;  1HCU A;  1XWT A;  2FV1 A;  3EZ8 A;  2QNO A;  1WZZ A;  3E6U A;  3ANK A;  5GW7 A;  3GZK A;  4CE7 A;  4AYR A;  2AFA A; 
#chains in the Genus database with same CATH topology
 5ILH A;  2OKX A;  1RWA A;  1FBW A;  5IKA A;  1H12 A;  1LXM A;  1JS4 A;  2EAC A;  4CJ0 A;  2V8J A;  2V8K A;  2DRS A;  3QXF A;  5JPM B;  4E1Y A;  3EUV B;  4XUV A;  5DGQ A;  1SA4 B;  4DOE A;  3QG0 A;  1DCE B;  5MEH A;  3ACT A;  1MZC B;  1XWQ A;  3DPY B;  4MBG B;  4FNV A;  3SDT A;  4L0G A;  1W6K A;  4OK4 A;  1F9O A;  2VN4 A;  3P2C A;  1H3A A;  2BRW A;  2WDA A;  3PZ2 B;  1GAI A;  1HN0 A;  5JPN B;  4D4A A;  3GLY A;  2FUQ A;  1TNO B;  3G6J B;  2BBC A;  4WVB A;  1X1J A;  2PN5 A;  1OJN A;  3KSQ B;  3HXD B;  4EL8 A;  4D4D A;  1FCE A;  1RQ5 A;  1S64 B;  3SDU A;  3KSL B;  2FBA A;  3M78 A;  3REN A;  1LXK A;  1OJP A;  1O1T B;  3A3V A;  5CD2 A;  1KS8 A;  1V5C A;  4WVC A;  1G6I A;  2WIN B;  4KTP A;  4JJJ A;  3RJ3 A;  5M7I A;  3WIQ A;  1FAE A;  5AGD A;  1VD5 A;  2Z07 A;  1HMU A;  1H13 A;  2G0D A;  3PMM A;  1L2A A;  3VXD A;  4AYQ A;  1TN7 B;  1W3Y A;  3Q7F B;  2E24 A;  3SDR A;  1RWF A;  4OK2 A;  1AYX A;  1TN6 B;  3DSU B;  2ZBL A;  1JCQ B;  3PZ3 B;  4L9P B;  3SAE A;  4OZV A;  2R2L B;  3S4A A;  2IEJ B;  1HM3 A;  3W7S A;  3DSS B;  3DSW B;  3WKI A;  4C1S A;  4GTV B;  2A73 B;  1N22 A;  3Q78 B;  4GTR B;  1CLC A;  1J0N A;  2VN7 A;  1KZO B;  2WII B;  5IM1 A;  2BRP A;  3PZ1 B;  2XQW A;  3G4F A;  1ULV A;  4KTR A;  5JMD A;  3DST B;  1XWT A;  2WCO A;  3EZ8 A;  1WZZ A;  3ANK A;  2Q1F A;  3GZK A;  3SFX B;  4MMI A;  1TNU B;  2AFA A;  1TNZ B;  1N21 A;  5IL8 A;  1CEM A;  4LIX A;  2E22 A;  1N23 A;  5IL3 A;  3HXF B;  3KQ4 A;  1N95 B;  4GTM B;  1K72 A;  1QAZ A;  1N7O A;  3Q73 B;  1LF6 A;  5KKB A;  4M76 A;  4LNV A;  2ZIR B;  1LOH A;  2EAB A;  3WIR A;  3G4D A;  3QFZ A;  5ILZ A;  4ZG8 A;  3W7U A;  3QT3 A;  3KLS A;  3SFY B;  1WU5 A;  3EU5 B;  1HM2 A;  1V7W A;  3E32 B;  1NC5 A;  5GZK A;  4GTQ B;  1IA6 A;  3ON6 A;  4BOK A;  3HXC B;  4EHM B;  1KFG A;  3QPF A;  1C3D A;  1RWH A;  4RNQ A;  4WVA A;  1WU6 A;  3K7X A;  1WU4 A;  1D8D B;  2V3N A;  3W5M A;  1KKT A;  3H3K A;  2RI9 A;  1S63 B;  2NOJ A;  1N7P A;  4OJZ A;  1GXN A;  1H37 A;  3QRY A;  3D5R A;  1G87 A;  1N4S B;  1JCR B;  1NI1 B;  1GHQ A;  2BED B;  1TNY B;  1H14 A;  4V1R A;  3M00 A;  2H6G B;  4BOJ A;  2I07 B;  3N0G A;  1O1S B;  4TXT A;  2XFG A;  1FO2 A;  1KSD A;  3NFV A;  2CQT A;  2J5C A;  3D5S A;  3TF4 A;  5FOB B;  4GTT B;  4V1S A;  3S4B A;  1H3B A;  2AHF A;  1KZP B;  3EU8 A;  3QWT A;  5ILK A;  4CJ1 A;  2DRQ A;  2CQS A;  3W7X A;  1O79 A;  4Z4J A;  4ONT A;  3RX7 A;  1FO3 A;  4GL3 A;  3S9V A;  1AGM A;  1O6H A;  4AYP A;  1FPP B;  1N7N A;  4DI5 A;  5ILI A;  1O6R A;  3E80 A;  1FBO A;  3VW5 A;  1FMI A;  1IS9 A;  5ILD A;  1LTX B;  2FV1 A;  5FO7 B;  2QNO A;  1CB8 A;  3E6U A;  1N4R B;  5GW7 A;  1N1B A;  3QFY A;  2RI8 A;  4MMH A;  2BRV X;  1O5M B;  2DRO A;  4NEI A;  1KSC A;  1FT2 B;  4GAX A;  2ONH A;  3PYB A;  1L1Y A;  1GXM A;  1LD8 B;  2WY8 A;  4ZH5 A;  2WY7 A;  3DSV B;  5CZL A;  3AFL A;  4TF4 A;  5EAS A;  1DL2 A;  3QSP A;  1HMW A;  1R76 A;  1KRF A;  3SDQ A;  2A8Z A;  2JJB A;  3M7C A;  4Q88 A;  5ILY A;  3T33 A;  3S4D A;  1EGU A;  4ZRQ A;  1N1Z A;  1KRE A;  4WU0 A;  3VSM A;  1GAH A;  1O6Q A;  3QT9 A;  4CE7 A;  3M7E A;  3WIW A;  4D94 A;  1V7V A;  1HXG A;  1TF4 A;  1N4Q B;  3PYA A;  1FP3 A;  1FT1 B;  2EAE A;  2B39 A;  1GSZ A;  1H36 A;  2JG0 A;  3E73 A;  3DSX B;  4ZRP A;  3PZ4 B;  1N9A B;  1H3C A;  1H39 A;  1IA7 A;  1JCS B;  1GLM A;  3E33 B;  1OJO A;  2H6H B;  2GZ6 A;  1N94 B;  4MU9 A;  1NL4 B;  2D8L A;  4GTS B;  4KKJ A;  3HXE B;  2XWB B;  2D5J A;  3Q75 B;  1N20 A;  4ZH1 A;  5C05 A;  5CA3 A;  1I8Q A;  1XW2 A;  3E37 B;  3CU7 A;  1KWF A;  5GY3 A;  3DRA B;  3N0F A;  3NNB A;  3M74 A;  3W5N A;  1HZF A;  1X1I A;  3W7W A;  4AYO A;  4LNG B;  3AFJ A;  1X81 B;  3CIH A;  1J0M A;  2G02 A;  1UMP A;  4YDO B;  2FUT A;  2F6D A;  2YIK A;  2BB6 A;  4FXK B;  5FO9 B;  2DRR A;  2AHG A;  4KKI A;  4YCR A;  3QXQ A;  1N7R A;  3W7T A;  1C82 A;  5DHK A;  4GTO B;  2GH4 A;  5ILJ A;  1UT9 A;  2GOX A;  3M7B A;  1SA5 B;  3GT5 A;  1TN8 B;  1GA2 A;  4FJQ A;  1DOG A;  1HCU A;  1QBQ B;  1N7Q A;  3M71 A;  4OZW A;  2ZZR A;  3H2W A;  2F0Y B;  3SQC A;  1HX9 A;  3M76 A;  4D4C A;  1LD7 B;  1N24 A;  3VSN A;  1H54 A;  1HXA A;  1QQF A;  3RX5 A;  3M73 A;  1X1H A;  5M7Y A;  3X17 A;  2X03 A;  3A0O A;  2ONG A;  3LZ9 A;  4D4B A;  3E34 B;  2H6I B;  2ZIS B;  3WKF A;  3Q7A B;  1TNB B;  3K11 A;  3EQA A;  3P5R A;  3RRS A;  5DHI A;  2P0V A;  1F9G A;  3HXB B;  4FUS A;  5EAU A;  2EAD A;  1LF9 A;  3M72 A;  3E7J A;  2FUZ A;  1H35 A;  1V5D A;  2JF4 A;  1SQC A;  2WYN A;  3M02 A;  4F13 A;  1RWC A;  1V7X A;  5IK6 A;  3E30 B;  4Q2B A;  1F9D A;  3H7L A;  3M77 A;  3P5P A;  3WKG A;  1QSJ A;  5JMF A;  2B4F A;  4YDE B;  3ANI A;  3WC3 A;  1W6J A;  1RWG A;  1GXO A;  3SDV A;  3WUX A;  1G9J A;  5IK0 A;  3S4C A;  3D3I A;  2NVP A;  3C72 B;  3QDE A;  2V8I A;  2SQC A;  3OXU A;  1UG9 A;  4FXG B;  2H6F B;  1N4P B;  3Q79 B;  1NXC A;  4DOD A;  1OJM A;  2V3P A;  3M75 A;  5DGR A;  4L6X A;  5IK9 A;  3M7L A;  1HV6 A;  3ANJ A;  4F10 A;  4J5T A;  5IKH A;  5E2J A;  1RW9 A;  1X9D A;  1F1S A;  2FV0 A;  2RGK A;  3WKH A;  2BB5 A;  5EAT A;  4QT9 A;  2PMV A;  4LNB B;  3OED A;  3RSY A;  4Z4L A;  5FO8 B;  1O1R B;  1G9G A;  3RX8 A;  1HXC A;  4GTP B;  3ACS A;  3M01 A;  1D8E B;  2XWJ B;  4AYR A; 
#chains in the Genus database with same CATH homology
 2OKX A;  1FBW A;  1H12 A;  1JS4 A;  2EAC A;  4CJ0 A;  2V8J A;  2V8K A;  2DRS A;  3QXF A;  5JPM B;  3EUV B;  4XUV A;  5DGQ A;  1SA4 B;  4DOE A;  3QG0 A;  1DCE B;  5MEH A;  3ACT A;  1MZC B;  1XWQ A;  3DPY B;  4MBG B;  3SDT A;  4L0G A;  1W6K A;  1F9O A;  2VN4 A;  3P2C A;  1H3A A;  3PZ2 B;  1GAI A;  5JPN B;  4D4A A;  3GLY A;  1TNO B;  3G6J B;  2BBC A;  4WVB A;  2PN5 A;  3KSQ B;  3HXD B;  4EL8 A;  4D4D A;  1FCE A;  1RQ5 A;  1S64 B;  3SDU A;  3KSL B;  2FBA A;  3M78 A;  3REN A;  1O1T B;  3A3V A;  5CD2 A;  1KS8 A;  1V5C A;  4WVC A;  1G6I A;  2WIN B;  4KTP A;  4JJJ A;  3RJ3 A;  5M7I A;  3WIQ A;  1FAE A;  5AGD A;  1VD5 A;  2Z07 A;  1H13 A;  2G0D A;  3PMM A;  1L2A A;  3VXD A;  4AYQ A;  1TN7 B;  3Q7F B;  3SDR A;  1AYX A;  1TN6 B;  3DSU B;  2ZBL A;  1JCQ B;  3PZ3 B;  4L9P B;  3SAE A;  2R2L B;  3S4A A;  2IEJ B;  3W7S A;  3DSS B;  3DSW B;  3WKI A;  4C1S A;  4GTV B;  2A73 B;  3Q78 B;  4GTR B;  1CLC A;  2VN7 A;  1KZO B;  2WII B;  3PZ1 B;  4KTR A;  2XQW A;  1ULV A;  3DST B;  1XWT A;  3EZ8 A;  1WZZ A;  3ANK A;  3GZK A;  3SFX B;  1TNU B;  2AFA A;  1TNZ B;  1CEM A;  4LIX A;  3HXF B;  3KQ4 A;  1N95 B;  4GTM B;  1K72 A;  3Q73 B;  1LF6 A;  5KKB A;  4M76 A;  4LNV A;  2ZIR B;  2EAB A;  3WIR A;  3QFZ A;  4ZG8 A;  3W7U A;  3QT3 A;  3KLS A;  3SFY B;  1WU5 A;  3EU5 B;  1V7W A;  3E32 B;  1NC5 A;  5GZK A;  4GTQ B;  1IA6 A;  3ON6 A;  4BOK A;  3HXC B;  4EHM B;  1KFG A;  3QPF A;  1C3D A;  4WVA A;  1WU6 A;  3K7X A;  1WU4 A;  1D8D B;  2V3N A;  3W5M A;  1KKT A;  3H3K A;  2RI9 A;  1S63 B;  2NOJ A;  1GXN A;  1H37 A;  3QRY A;  3D5R A;  1G87 A;  1N4S B;  1JCR B;  1NI1 B;  1GHQ A;  2BED B;  1TNY B;  1H14 A;  4V1R A;  2H6G B;  4BOJ A;  2I07 B;  1O1S B;  4TXT A;  2XFG A;  1FO2 A;  1KSD A;  2CQT A;  3D5S A;  3TF4 A;  5FOB B;  4GTT B;  4V1S A;  3S4B A;  1H3B A;  2AHF A;  1KZP B;  3EU8 A;  3QWT A;  4CJ1 A;  2DRQ A;  2CQS A;  3W7X A;  1O79 A;  4Z4J A;  4ONT A;  3RX7 A;  1FO3 A;  4GL3 A;  3S9V A;  1AGM A;  1O6H A;  4AYP A;  1FPP B;  1O6R A;  3VW5 A;  1FBO A;  1FMI A;  1IS9 A;  1LTX B;  2FV1 A;  5FO7 B;  2QNO A;  3E6U A;  1N4R B;  5GW7 A;  3QFY A;  2RI8 A;  1O5M B;  2DRO A;  1KSC A;  1FT2 B;  3PYB A;  1L1Y A;  1GXM A;  1LD8 B;  2WY8 A;  4ZH5 A;  2WY7 A;  3DSV B;  5CZL A;  4TF4 A;  1DL2 A;  3QSP A;  1R76 A;  1KRF A;  3SDQ A;  2A8Z A;  2JJB A;  3M7C A;  4Q88 A;  3T33 A;  3S4D A;  4ZRQ A;  1KRE A;  4WU0 A;  1GAH A;  1O6Q A;  3QT9 A;  4CE7 A;  3M7E A;  3WIW A;  4D94 A;  1V7V A;  1TF4 A;  1N4Q B;  3PYA A;  1FP3 A;  1FT1 B;  2EAE A;  2B39 A;  1GSZ A;  1H36 A;  2JG0 A;  3E73 A;  3DSX B;  4ZRP A;  3PZ4 B;  1N9A B;  1H3C A;  1H39 A;  1IA7 A;  1JCS B;  1GLM A;  3E33 B;  2H6H B;  2GZ6 A;  1N94 B;  4MU9 A;  1NL4 B;  2D8L A;  4GTS B;  4KKJ A;  3HXE B;  2XWB B;  2D5J A;  3Q75 B;  4ZH1 A;  5CA3 A;  1XW2 A;  3E37 B;  3CU7 A;  1KWF A;  5GY3 A;  3DRA B;  3W5N A;  3M74 A;  1HZF A;  3W7W A;  4AYO A;  4LNG B;  3AFJ A;  1X81 B;  3CIH A;  2G02 A;  1UMP A;  4YDO B;  2F6D A;  2YIK A;  2BB6 A;  4FXK B;  5FO9 B;  2DRR A;  2AHG A;  4KKI A;  4YCR A;  3QXQ A;  3W7T A;  4GTO B;  2GH4 A;  1UT9 A;  2GOX A;  3M7B A;  1SA5 B;  3GT5 A;  1TN8 B;  1GA2 A;  1DOG A;  1HCU A;  1QBQ B;  3M71 A;  2ZZR A;  3H2W A;  2F0Y B;  3SQC A;  3M76 A;  4D4C A;  1LD7 B;  1H54 A;  1QQF A;  3RX5 A;  3M73 A;  5M7Y A;  3X17 A;  4D4B A;  3E34 B;  2H6I B;  2ZIS B;  3WKF A;  3Q7A B;  1TNB B;  3K11 A;  3EQA A;  3P5R A;  3RRS A;  2P0V A;  3HXB B;  4FUS A;  2EAD A;  1LF9 A;  3M72 A;  2FUZ A;  1H35 A;  1V5D A;  2JF4 A;  1SQC A;  2WYN A;  1V7X A;  3E30 B;  4Q2B A;  1F9D A;  3H7L A;  3M77 A;  3P5P A;  3WKG A;  1QSJ A;  2B4F A;  4YDE B;  3ANI A;  3WC3 A;  1W6J A;  1GXO A;  3SDV A;  3WUX A;  1G9J A;  3S4C A;  3D3I A;  2NVP A;  3C72 B;  3QDE A;  2V8I A;  2SQC A;  3OXU A;  1UG9 A;  4FXG B;  2H6F B;  1N4P B;  3Q79 B;  1NXC A;  4DOD A;  2V3P A;  3M75 A;  5DGR A;  4L6X A;  3M7L A;  3ANJ A;  4J5T A;  5E2J A;  1X9D A;  2RGK A;  2FV0 A;  3WKH A;  2BB5 A;  4QT9 A;  2PMV A;  4LNB B;  3OED A;  3RSY A;  4Z4L A;  5FO8 B;  1O1R B;  1G9G A;  3RX8 A;  4GTP B;  3ACS A;  1D8E B;  2XWJ B;  4AYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...