1KSKA

Structure of rsua
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
234
structure length
234
Chain Sequence
GSHMRLDKFIAQQLGVSRAIAGREIRGNRVTVDGEIVRNAAFKLLPEHDVAYDGNPLAQQHGPRYFMLNKPQGYVCSTDDPDHPTVLYFLDEPVAWKLHAAGRLDIDTTGLVLMTDDGQWSHRITSPRHHCEKTYLVTLESPVADDTAEQFAKGVQLHNEKDLTKPAVLEVITPTQVRLTISEGRYHQVKRMFAAVGNHVVELHRERIGGITLDADLAPGEYRPLTEEEIASVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL SMALL SUBUNIT PSEUDOURIDINE SYNTHASE A
publication title Structure of the 16S rRNA pseudouridine synthase RsuA bound to uracil and UMP.
pubmed rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 56
structure length 234
sequence length 234
ec nomenclature ec 5.4.99.19: 16S rRNA pseudouridine(516) synthase.
pdb deposition date 2002-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00849 PseudoU_synth_2 RNA pseudouridylate synthase
A PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.290.10 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A RNA-binding S4 domain 1kskA01
3.30.2350.10 Alpha Beta 2-Layer Sandwich Pseudouridine synthase Pseudouridine synthase 1kskA02
4DR7D 3DH3A 3LWPA 4JI7D 1VIOA 5LMUD 1IBMD 2JANA 4DV0D 1HNWD 3HAXA 4DR4D 4LF8D 1QYUA 2AUSA 1J5ED 2UUBD 1I94D 4YHHD 4LGTA 4LFBD 1KSVA 4LABA 5LMND 2I82A 4JV5D 1XMQD 3MQKA 4X62D 4K0KD 1HR0D 1PRZA 4JI2D 1C06A 2E5LD 1XNRD 1JH3A 4OUDA 4DV7D 5BR8D 2UUAD 2F4VD 2EY4A 4GKJD 4DV3D 2KTLA 4JI3D 4DR6D 1XMOD 1ZE2A 4LF6D 1N36D 3HP7A 4YY3D 4X64D 1N32D 2UXCD 2APOA 4DR1D 1ZE1A 1HNXD 4JI6D 3LWVA 1N34D 4B3MD 3UAIA 4DV1D 1N33D 3KBGA 3T1YD 1H3EA 4LF7D 4X66D 4DV2D 1K8WA 3U28A 4DV6D 4DV4D 4X65D 2UUCD 4JI4D 1FKAD 2UXDD 2UU9D 2UXBD 4DUZD 4DV5D 2HHHD 1R3FA 1ZL3A 2HVYA 4LF9D 4JYAD 2ISTA 1V9KA 4JI8D 4DR5D 4LFCD 1KSLA 4LF5D 3HJWA 4JI0D 2VQFD 4JI1D 4B3SD 4JI5D 4GKKD 4DR2D 1C05A 1H3FA 3OTOD 1SGVA 3T1HD 1XNQD 1IBKD 4B3RD 5IWAD 4OX9D 3LWRA 1HNZD 1P9KA 3HJYA 4KHPD 1FJGD 4AQYD 3LWOA 2RFKA 4NXND 4DUYD 4LFAD 1KSKA 1DM9A 1R3EA 2VQED 1V9FA 2AB4A 4DR3D 4LF4D 2ZM6D 4NXMD 1XPIA 3LWQA 4B3TD 2K6PA 1IBLD
chains in the Genus database with same CATH superfamily
4DR7D 3DH3A 3LWPA 4JI7D 1VIOA 3KYCB 5LMUD 2LQ7A 1IBMD 2JANA 4DV0D 1HNWD 3HAXA 5IT9E 5KNLA 4DR4D 4LF8D 1QYUA 1SZWA 3ONGA 2AUSA 1J5ED 2UUBD 3ONHA 4NNJA 1I94D 4YHHD 4LGTA 4LFBD 1KSVA 4II2A 4LABA 5LMND 2I82A 4JV5D 1XMQD 3MQKA 4X62D 4K0KD 1HR0D 1PRZA 5FLXE 4JI2D 1Y8RB 1C06A 2E5LD 1XNRD 1JH3A 4OUDA 1Z2ZA 4DV7D 5BR8D 2UUAD 2F4VD 2EY4A 4GKJD 4DV3D 2KTLA 3KYDB 4JI3D 1XMOD 4DR6D 1ZE2A 4LF6D 1SB7A 1N36D 3HP7A 4YY3D 4X64D 1N32D 3J81E 5LL6S 2UXCD 2APOA 4DR1D 1ZE1A 1HNXD 4JI6D 3LWVA 1N34D 4B3MD 3UAIA 4DV1D 1N33D 3KBGA 3T1YD 1H3EA 4LF7D 4X66D 4DV2D 1K8WA 3FN1A 3U28A 4DV6D 4DV4D 4X65D 1IBLD 2UUCD 4JI4D 1Y8QB 1FKAD 2UXDD 2UU9D 2UXBD 4DUZD 4DV5D 2HHHD 1R3FA 3J80E 1ZL3A 2HVYA 4LF9D 2I1SA 4JYAD 2ISTA 1V9KA 4JI8D 4DR5D 4LFCD 1KSLA 3CMMA 5A2QE 4LF5D 3HJWA 4JI0D 2VQFD 4JI1D 4B3SD 4JI5D 4GKKD 4DR2D 1C05A 1H3FA 2NVUB 3OTOD 1SGVA 3T1HD 1XNQD 1IBKD 3J7AF 4B3RD 5IWAD 4OX9D 4W5VB 3LWRA 1HNZD 1P9KA 3HJYA 4II3A 4KHPD 1FJGD 4AQYD 3LWOA 2RFKA 4NXND 4DUYD 4LFAD 1KSKA 1DM9A 1R3EA 1Y8XB 3JAME 2ZTBA 2VQED 1V9FA 2AB4A 4DR3D 1SI7A 4LF4D 2ZM6D 4NXMD 1XPIA 3LWQA 4B3TD 2K6PA 5FQ2B
chains in the Genus database with same CATH topology
4DR7D 3DH3A 3LWPA 4JI7D 1VIOA 5LMUD 1IBMD 2JANA 4DV0D 1HNWD 3HAXA 4DR4D 4LF8D 1QYUA 1SZWA 2AUSA 1J5ED 2UUBD 1I94D 4YHHD 4LGTA 4LFBD 1KSVA 4LABA 5LMND 2I82A 4JV5D 1XMQD 3MQKA 4X62D 4K0KD 1HR0D 1PRZA 4JI2D 1C06A 2E5LD 1XNRD 1JH3A 4OUDA 1Z2ZA 4DV7D 5BR8D 2UUAD 2F4VD 2EY4A 4GKJD 4DV3D 2KTLA 4JI3D 4DR6D 1XMOD 1ZE2A 4LF6D 1SB7A 1N36D 3HP7A 4YY3D 4X64D 1N32D 2UXCD 2APOA 4DR1D 1ZE1A 1HNXD 4JI6D 3LWVA 1N34D 4B3MD 3UAIA 4DV1D 1N33D 3KBGA 3T1YD 1H3EA 4LF7D 4X66D 4DV2D 1K8WA 3U28A 4DV6D 4DV4D 4X65D 2UUCD 4JI4D 1FKAD 2UXDD 2UU9D 2UXBD 4DUZD 4DV5D 2HHHD 1R3FA 1ZL3A 2HVYA 4LF9D 4JYAD 2ISTA 1V9KA 4JI8D 4DR5D 4LFCD 1KSLA 4LF5D 3HJWA 4JI0D 2VQFD 4JI1D 4B3SD 4JI5D 4GKKD 4DR2D 1C05A 1H3FA 3OTOD 1SGVA 3T1HD 1XNQD 1IBKD 4B3RD 5IWAD 4OX9D 3LWRA 1HNZD 1P9KA 3HJYA 4KHPD 1FJGD 4AQYD 3LWOA 2RFKA 4NXND 4DUYD 4LFAD 1KSKA 1DM9A 1R3EA 2VQED 1V9FA 2AB4A 4DR3D 1SI7A 4LF4D 2ZM6D 4NXMD 1XPIA 3LWQA 4B3TD 2K6PA 1IBLD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR7 D;  3DH3 A;  3LWP A;  4JI7 D;  1VIO A;  5LMU D;  1IBM D;  2JAN A;  4DV0 D;  1HNW D;  3HAX A;  4DR4 D;  4LF8 D;  1QYU A;  2AUS A;  1J5E D;  2UUB D;  1I94 D;  4YHH D;  4LGT A;  4LFB D;  1KSV A;  4LAB A;  5LMN D;  2I82 A;  4JV5 D;  1XMQ D;  3MQK A;  4X62 D;  4K0K D;  1HR0 D;  1PRZ A;  4JI2 D;  1C06 A;  2E5L D;  1XNR D;  1JH3 A;  4OUD A;  4DV7 D;  5BR8 D;  2UUA D;  2F4V D;  2EY4 A;  4GKJ D;  4DV3 D;  2KTL A;  4JI3 D;  4DR6 D;  1XMO D;  1ZE2 A;  4LF6 D;  1N36 D;  3HP7 A;  4YY3 D;  4X64 D;  1N32 D;  2UXC D;  2APO A;  4DR1 D;  1ZE1 A;  1HNX D;  4JI6 D;  3LWV A;  1N34 D;  4B3M D;  3UAI A;  4DV1 D;  1N33 D;  3KBG A;  3T1Y D;  1H3E A;  4LF7 D;  4X66 D;  4DV2 D;  1K8W A;  3U28 A;  4DV6 D;  4DV4 D;  4X65 D;  2UUC D;  4JI4 D;  1FKA D;  2UXD D;  2UU9 D;  2UXB D;  4DUZ D;  4DV5 D;  2HHH D;  1R3F A;  1ZL3 A;  2HVY A;  4LF9 D;  4JYA D;  2IST A;  1V9K A;  4JI8 D;  4DR5 D;  4LFC D;  1KSL A;  4LF5 D;  3HJW A;  4JI0 D;  2VQF D;  4JI1 D;  4B3S D;  4JI5 D;  4GKK D;  4DR2 D;  1C05 A;  1H3F A;  3OTO D;  1SGV A;  3T1H D;  1XNQ D;  1IBK D;  4B3R D;  5IWA D;  4OX9 D;  3LWR A;  1HNZ D;  1P9K A;  3HJY A;  4KHP D;  1FJG D;  4AQY D;  3LWO A;  2RFK A;  4NXN D;  4DUY D;  4LFA D;  1KSK A;  1DM9 A;  1R3E A;  2VQE D;  1V9F A;  2AB4 A;  4DR3 D;  4LF4 D;  2ZM6 D;  4NXM D;  1XPI A;  3LWQ A;  4B3T D;  2K6P A;  1IBL D; 
#chains in the Genus database with same CATH topology
 4DR7 D;  3DH3 A;  3LWP A;  4JI7 D;  1VIO A;  3KYC B;  5LMU D;  2LQ7 A;  1IBM D;  2JAN A;  4DV0 D;  1HNW D;  3HAX A;  5IT9 E;  5KNL A;  4DR4 D;  4LF8 D;  1QYU A;  1SZW A;  3ONG A;  2AUS A;  1J5E D;  2UUB D;  3ONH A;  4NNJ A;  1I94 D;  4YHH D;  4LGT A;  4LFB D;  1KSV A;  4II2 A;  4LAB A;  5LMN D;  2I82 A;  4JV5 D;  1XMQ D;  3MQK A;  4X62 D;  4K0K D;  1HR0 D;  1PRZ A;  5FLX E;  4JI2 D;  1Y8R B;  1C06 A;  2E5L D;  1XNR D;  1JH3 A;  4OUD A;  1Z2Z A;  4DV7 D;  5BR8 D;  2UUA D;  2F4V D;  2EY4 A;  4GKJ D;  4DV3 D;  2KTL A;  3KYD B;  4JI3 D;  1XMO D;  4DR6 D;  1ZE2 A;  4LF6 D;  1SB7 A;  1N36 D;  3HP7 A;  4YY3 D;  4X64 D;  1N32 D;  3J81 E;  5LL6 S;  2UXC D;  2APO A;  4DR1 D;  1ZE1 A;  1HNX D;  4JI6 D;  3LWV A;  1N34 D;  4B3M D;  3UAI A;  4DV1 D;  1N33 D;  3KBG A;  3T1Y D;  1H3E A;  4LF7 D;  4X66 D;  4DV2 D;  1K8W A;  3FN1 A;  3U28 A;  4DV6 D;  4DV4 D;  4X65 D;  1IBL D;  2UUC D;  4JI4 D;  1Y8Q B;  1FKA D;  2UXD D;  2UU9 D;  2UXB D;  4DUZ D;  4DV5 D;  2HHH D;  1R3F A;  3J80 E;  1ZL3 A;  2HVY A;  4LF9 D;  2I1S A;  4JYA D;  2IST A;  1V9K A;  4JI8 D;  4DR5 D;  4LFC D;  1KSL A;  3CMM A;  5A2Q E;  4LF5 D;  3HJW A;  4JI0 D;  2VQF D;  4JI1 D;  4B3S D;  4JI5 D;  4GKK D;  4DR2 D;  1C05 A;  1H3F A;  2NVU B;  3OTO D;  1SGV A;  3T1H D;  1XNQ D;  1IBK D;  3J7A F;  4B3R D;  5IWA D;  4OX9 D;  4W5V B;  3LWR A;  1HNZ D;  1P9K A;  3HJY A;  4II3 A;  4KHP D;  1FJG D;  4AQY D;  3LWO A;  2RFK A;  4NXN D;  4DUY D;  4LFA D;  1KSK A;  1DM9 A;  1R3E A;  1Y8X B;  3JAM E;  2ZTB A;  2VQE D;  1V9F A;  2AB4 A;  4DR3 D;  1SI7 A;  4LF4 D;  2ZM6 D;  4NXM D;  1XPI A;  3LWQ A;  4B3T D;  2K6P A;  5FQ2 B; 
#chains in the Genus database with same CATH homology
 4DR7 D;  3DH3 A;  3LWP A;  4JI7 D;  1VIO A;  5LMU D;  1IBM D;  2JAN A;  4DV0 D;  1HNW D;  3HAX A;  4DR4 D;  4LF8 D;  1QYU A;  1SZW A;  2AUS A;  1J5E D;  2UUB D;  1I94 D;  4YHH D;  4LGT A;  4LFB D;  1KSV A;  4LAB A;  5LMN D;  2I82 A;  4JV5 D;  1XMQ D;  3MQK A;  4X62 D;  4K0K D;  1HR0 D;  1PRZ A;  4JI2 D;  1C06 A;  2E5L D;  1XNR D;  1JH3 A;  4OUD A;  1Z2Z A;  4DV7 D;  5BR8 D;  2UUA D;  2F4V D;  2EY4 A;  4GKJ D;  4DV3 D;  2KTL A;  4JI3 D;  4DR6 D;  1XMO D;  1ZE2 A;  4LF6 D;  1SB7 A;  1N36 D;  3HP7 A;  4YY3 D;  4X64 D;  1N32 D;  2UXC D;  2APO A;  4DR1 D;  1ZE1 A;  1HNX D;  4JI6 D;  3LWV A;  1N34 D;  4B3M D;  3UAI A;  4DV1 D;  1N33 D;  3KBG A;  3T1Y D;  1H3E A;  4LF7 D;  4X66 D;  4DV2 D;  1K8W A;  3U28 A;  4DV6 D;  4DV4 D;  4X65 D;  2UUC D;  4JI4 D;  1FKA D;  2UXD D;  2UU9 D;  2UXB D;  4DUZ D;  4DV5 D;  2HHH D;  1R3F A;  1ZL3 A;  2HVY A;  4LF9 D;  4JYA D;  2IST A;  1V9K A;  4JI8 D;  4DR5 D;  4LFC D;  1KSL A;  4LF5 D;  3HJW A;  4JI0 D;  2VQF D;  4JI1 D;  4B3S D;  4JI5 D;  4GKK D;  4DR2 D;  1C05 A;  1H3F A;  3OTO D;  1SGV A;  3T1H D;  1XNQ D;  1IBK D;  4B3R D;  5IWA D;  4OX9 D;  3LWR A;  1HNZ D;  1P9K A;  3HJY A;  4KHP D;  1FJG D;  4AQY D;  3LWO A;  2RFK A;  4NXN D;  4DUY D;  4LFA D;  1KSK A;  1DM9 A;  1R3E A;  2VQE D;  1V9F A;  2AB4 A;  4DR3 D;  1SI7 A;  4LF4 D;  2ZM6 D;  4NXM D;  1XPI A;  3LWQ A;  4B3T D;  2K6P A;  1IBL D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...