1KT1A

Structure of the large fkbp-like protein, fkbp51, involved in steroid receptor complexes
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
394
structure length
374
Chain Sequence
KKDRGVLKIVHGEETPMIGDRVYVHYNGKLANPFVFSIGKGQVIKAWDIGVATMKKGEICHLLCAYGATGSLPKIPSNATLFFEVELLDFKGEDLLEDGGIIRRTKRRGEGYSNPNEGARVQIHLEGRCGGRVFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILHLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYVQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQIFMCQKKAKEHNERDRRTYANMFKKFAEQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title STRUCTURE OF THE LARGE FK506-BINDING PROTEIN FKBP51, AN HSP90-BINDING PROTEIN AND A COMPONENT OF STEROID RECEPTOR COMPLEXES
pubmed doi rcsb
source organism Saimiri boliviensis
molecule tags Isomerase
molecule keywords FK506-binding protein FKBP51
total genus 108
structure length 374
sequence length 394
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2002-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF00515 TPR_1 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1kt1A03
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1kt1A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1kt1A02
2YHCA 1ELWA 3CVLA 3VTXA 3S7DA 4FN2A 3UI5A 5DIUA 5BXJA 1B6CA 4LAWA 1TCOC 3UQIA 3UI4A 1ZK6A 3E4BA 4W9RA 2ZQVA 2DBAA 1HZ4A 3KS2A 5HW8A 2KCKA 3O5PA 3JYSA 4GCNA 2PPOA 4G50A 3LUOA 1KT1A 5HW6A 4DIPA 3QDNA 3ZN3A 1FCHA 4GIVA 2Y4UA 3B7XA 2ONDA 2DG3A 5HUAA 4U85A 1BKFA 3BEEA 5HT1A 2ZQUA 1PC2A 3VTYA 2MLYA 1BL4A 4TYOA 4TNSA 1FKIA 2ZR4A 3KZ7A 3CK9A 4J8DA 3KD7A 2LGOA 5D0OD 3ESKA 5LCWC 2ZR5A 3UF8A 4N3CA 1W26A 1Q1CA 1ELRA 3ASDA 3GPKA 3O5KA 3FFLA 4DRIA 1NA0A 4UI9K 4JA9A 4ABNA 2FI7A 3Q15A 2WQHA 4Y6WA 4UQXA 4BF8A 4DRMA 4U0ZA 2AWGA 4ODRA 4B94A 3O5MA 3MA5A 1NZNA 1NA3A 1B89A 3KCEA 3PDNA 4J8FA 4DROA 4TW8A 3FWVA 1FKHA 5A6CA 4N3BA 2VSNA 3UQ3A 3O5QA 3ODKA 4G23A 4I9CA 4AY6A 5DIVA 1JNTA 2RUQA 3ZHEA 1JNSA 1FKBA 4IQCA 4JFKA 4NNRA 2D9FA 1FKSA 4U0SA 3UUXA 4QIBA 2KC7A 2XGSA 4HOTA 3LPZA 3MKRA 2LPVA 3O5DA 5BW8C 4I9EA 1Y8MA 2PV1A 1F40A 4KXKB 4HORA 1NMVA 3IHZA 3SF4A 4U84A 4GCOA 3RO2A 2MNTA 5I98A 4HOSA 5DBKA 3FP3A 2VCDA 4IN3B 4CGWA 1D6OA 2XGOA 4UI9J 2XP8A 4MGVA 1R9HA 4WNEA 1EQ3A 2VGXA 2PL2A 1E96B 3CK7A 5B8IC 3KAHA 3CGMA 3I6CA 1KT0A 1FKFA 5CCMA 4JHRA 4N39A 2R5SA 4BT9A 2LJ4A 4N19A 1IHGA 1L1PA 1P5QA 2M08A 2RUDA 4GGQA 4G24A 1YATA 4DZ2A 4ODOA 4ODKA 2XP3A 3CVNA 3NF1A 3ULQA 1T11A 4N5CA 3KAFA 3PA7A 4DRQA 3ZGQA 3O5EA 4TX0A 4N2QA 4XI0A 5G04J 5M72A 3O5LA 2C0LA 4BWRA 2ITKA 5LCWJ 2FKEA 1FKKA 2PQRA 1ZU2A 1U79A 4I2ZA 2P58C 3TG4A 1QZ2A 4G1TA 4H7YA 2FF4A 2XCCA 5KJMA 1ZBPA 4A1SA 4WNDA 3OXGA 4DRPA 2JLBA 4N2SA 5HTGA 1N1AA 3PE3A 4DT4A 4NQ0A 1Q6IA 3JYJA 4UI9C 1D7IA 3O5OA 2RURA 2PPNA 3KAIA 4ODMA 2M1IA 4APOA 2PV3A 1FKRA 1HH8A 5D0QD 2PBCA 4G2VA 1HXIA 4AM9A 2Y78A 3Q47B 4BT8A 5J6EA 4ODQA 4CDRA 2DG9A 1QPFA 3CV0A 4KBQA 2MLXA 2MLZA 2KFWA 3PRBA 2RQSA 2Y4TA 2PQNA 2JZVA 4C02B 4R0XA 5FJYA 4GPKA 3IK8A 1FKGA 1HXVA 2FBNA 3MEKA 3QWWA 2HR2A 1FD9A 2HO1A 2VGXB 5FZRA 2KE0A 4GZ6A 1WAO1 1D7JA 1M5YA 4GA2A 2XP5A 2LKNA 1FKLA 4G25A 1TJCA 3EDTB 1XNFA 2XPAA 5KJKA 3CVQA 4LEUA 3PE4A 4J4NA 5C1DA 4BTBA 3Q49B 5FZQA 4RG6A 4YVOA 4O6FA 3KACA 3IKGA 3N71A 2V5FA 3TGOA 1Q6HA 3Q4AB 1PINA 1FJDA 2Q5AA 2MHKA 5FTPA 3PRDA 4LAXA 4G26A 4JFIA 4GA0A 2PV2A 3O5IA 3RGCA 3HYMB 2IFUA 2UY1B 2LNIA 3LY8A 3H9RB 1ROUA 4QT2A 3TCZA 5ARGA 1ZCNA 1C9HA 4U07A 2PPPA 1FKTA 5ARFA 4JA7A 2F21A 3S7FA 3GZ2A 1YW5A 1Y0OA 3ZPJA 3KAEA 2FAPA 2K8IA 5G05C 1A17A 2F2DA 1W3BA 4JL0A 4FAPA 4HOUA 3QWVA 3NI6A 4XI9A 2N87A 2L6JA 3SZ7A 3AS4A 3IKDA 1KLXA 3QWPA 4ITZA 4KYOB 2XGMA 4GZ3A 5DIZA 3TDBA 4IPXA 1IYGA 5A7DB 2KGJA 3CVPA 5FZSA 3RFWA 1ROTA 3LY9A 2KO7A 5KJNA 3LCAA 3MV2B 3FAPA 4UQZA 2MF9A 4IQ2A 4GZ5A 5EKQD 2YQ8A 2XPIA 3RU0A 2KCLA 2VYIA 2OFNA 2QFCA 2F4EA 4I2WA 4LAVA 4G2PA 3S7BA 5JJ6A 1PBKA 2ZQSA 3ASHA 3U3WA 1WM5A 2LSVA 5EX3A 2KATA 2IF4A 4JFLA 3LY7A 2MPHA 4TW6A 2L2SA 5HWCA 1EYMA 3QKYA 4DRKA 4GYWA 3IEGA 3KADA 2XCBA 2AVPA 4H7XA 3S7JA 4J4OA 5DITA 3O5JA 2BUGA 3CK8A 4YNDA 3CKCA 3WH0A 3QOUA 3GW4A 2VQ2A 1QQEA 3UQBA 3OXLA 2C2LA 2RSEA 1J6YA 3OOBA 2VN1A 5HI7A 2XP6A 1A7XA 4JYSA 4WNFA 5KJLA 4N3AA 3RKVA 2PZIA 3JYMA 2GW1A 3K9IA 3UPVA 4DRHA 3GYZA 5JJTA 4DZ3A 3ZFWA 4QT3A 1NMWA 3TAXA 3O5RA 4AY5A 2Q7FA 3KABA 3OXFA 5G04C 1QPLA 4W9QA 2FO7A 3ZHEB 4AIFA 4EQFA 2UY1A 2XEVA 4WNGA 4J0UA 1J4RA 3UI6A 5CCLA 2XP7A 3MDYB 2I6HA 4HOQA 2E2EA 4DRNA 2ZR6A 5EX0A 1Q6UA 4UQYA 5FT9A 5JJ7A 3KAGA 1F8AB 1YA0A 4GYOA 5HW7A 2J9QA 4I17A 3TG5A 3WXXA 5AYWD 4F3VA 4JFMA 3VAWA 4YVQC 3O48A 4J8EA 3NRKA 4JFJA 5HKGA 2LSUA 1OUVA 3JXVA 4WUYA 4W9OA 3AS5A 4ODPA 3UQAA 2UWJG 5BNWA 2C0MA 3LKUA 5D75A 2WPVA 4GA1A 2KR7A 4DRJA 4RG9A 1J4IA 1FKJA 4U0UA 1JVWA 4MSPA 1D7HA 3CKBA 1FKDA 4LAYA 3ASGA 2KI3A 4NRHB 4I1AA 3AS8A 4DH0A 2M2AA 2RUCA 3RIBA 3EY6A 2VSYA 4U86A 3U4TA 2XPBA 1NSGA 2UZ5A 3TC5A 3O5GA 3CEQA 3GZ1A 3Q5MA 3O5FA 3CGNA 3URZA 4ODLA 3ASFA 4U04A 2HYZA 5HQ8A 5HWBA 4TW7A 2NC9A 2KCVA 3MV3B 4Y6CA 4W9PA 2XP4A 4ODNA 3R9AB 2XP9A 4BTAA 1FAPA 4XIFA 5CHEE 3RO3A 4GYYA 4CGVA 4O2TA 3RJVA 2VGYA 2DG4A 2FEZA 5GPGA 5G05J 5BT1A 2ZQTA 3LYAA 3NTPA 2OOEA 4ME2A 1J4HA
chains in the Genus database with same CATH superfamily
1E6RA 1ELWA 3CVLA 1B6CA 4UUCA 3UI4A 4W9RA 3W9GA 4Q7NA 2P9NG 3ARSA 2PPOA 5E75A 3LUOA 4WKAA 3QDNA 3WQVA 4WKHA 1TNUA 3PRAA 3QJZA 1SZAA 4AJWA 5HUAA 4E85A 3BEEA 3ARYA 2ZQUA 1PC2A 4XX5A 2YBTA 4FLHA 5D2MC 4TYOA 3KZ7A 4J8DA 4TXPA 2B5UB 2HM8A 2LGOA 4C0EA 3O4ZA 3UF8A 5IY5E 2RFAA 2IEJA 3R7RA 3UT4A 3O5KA 1HKKA 4GMJA 4JA9A 4X8QA 4Z2GA 4Q94A 2FI7A 1W9UA 4Y6WA 1E44A 3QC1A 3SD5A 1JWFA 2V8SE 4U0ZA 4AP2A 4ZFHA 4ODRA 3BQOA 4B94A 2H6IA 3ULEG 1KPSB 1EPUA 3NB2A 2EINE 3KCEA 2DCPA 4L23A 4PH4B 4TW8A 3D9MA 3TXMA 3ASNE 3UQ3A 4G23A 5CRUA 4I9CA 4FA6A 4XAKA 3ZHEA 2IQCA 3CSFA 1JNSA 4K5BA 2CG2A 3UUXA 2KC7A 4WKFA 1NWRA 4HOTA 2IONA 3IBEA 3BU8A 1LL7A 5BW8C 4I9EA 1Y8MA 5B3SE 5EILA 4A3TA 2WM9A 4HORA 3B8SA 3MZLB 3SF4A 4U84A 5T3RA 2XEHA 4HOSA 5KBAA 1KZPA 5FQ4A 2VCDA 1D6OA 4FHKA 1R9HA 2A3AA 5B8IC 1N4PA 1JCSA 4AVXA 3EUVA 4JHRA 1JWGA 5CEAA 4N39A 3E30A 2IJGX 1BI7B 3RSEG 1IHGA 1L1PA 1P5QA 5CERB 4HRLA 4G24A 1YATA 1L5JA 2RUDA 4ODKA 3B9DA 3CVNA 3LJ3A 1T11A 1JPLA 4DRQA 4GTTA 3ZGQA 4N2QA 3CQCB 4P8XA 1ZBVA 2ITKA 5LCWJ 3L82A 3DSXA 2AJAA 5JA4D 1GW6A 1Z3YA 4I2ZA 2ETCA 4G1TA 4B93B 2DT0A 4KQZA 5FWQA 4A1SA 3UT7A 5HBFA 2JLBA 4UWKA 3PNTB 4N2SA 2IU1A 5HTGA 2V0PA 4DT4A 4LG6A 4P8VA 1HE8A 1Q6IA 3T8KA 1FT1A 3KAIA 1FKRA 2GGFA 2PBCA 2Y78A 5J6EA 4I1MA 1LL6A 4V3IA 3ASOE 2QZAA 4WWNA 3PRBA 2OEWA 2Y4TA 2PQNA 5FJYA 1FT2A 3CSTA 1HXVA 2FBNA 1TJFA 1X6NA 1FD9A 5CMWA 2HO1A 2VGXB 3FY4A 2EIJE 5JH8A 4Q96A 2DYSE 4RSYA 3Q79A 3TWVA 4AOFA 3DSSA 4B89A 5FZQA 4O6FA 1EHNA 3WKZA 3FTSA 3N71A 3L54A 2V5FA 3TGOA 3TWXA 1OCOE 1FJDA 2JEKA 3KEZA 2Q5AA 3ZEFA 5AENA 1MJ0A 4YDWA 4ATZD 4JW1A 4G26A 3G2SA 1JCQA 2PV2A 4PUCA 3RGCA 1K1AA 3LY8A 5DF0A 3VLFA 4ANXA 1C9HA 4U07A 1IQRA 1ZB5A 3FUKA 1Y0OA 3ZPJA 1KFWA 3ARTA 2FDMA 2WM0A 1TNZA 1A17A 1YMPA 3JUEA 4XI9A 1RW2A 2V5QC 4UWHA 4G8KA 4TV3A 4HXIA 2H6FA 2XGMA 5LOZA 1H19A 2ESCA 5A7DB 3RFWA 1ROTA 3LY9A 4ZPWR 2WMNA 2CHWA 5KJNA 3ZIMA 4GTMA 4FC8A 2MF9A 1VF8A 4IQ2A 4GZ5A 2P2CP 1Z3XA 3DXKG 4JEHA 4OYSA 3HIZA 2AXZA 4J8SA 2NXPA 3HHMA 3S7BA 1RD6A 5JJ6A 3JQ1A 3U3WA 5EX3A 2LSVA 4RLYA 2LO6A 3ZXPA 4UWLA 4XKBA 4HI8A 2L2SA 4BX8A 4D10C 3IEGA 2RG8A 2XCBA 2BUGA 1N11A 3CKCA 4YNDA 4L1BA 2ZGDA 4URKA 2DSZA 5B1AE 3UINC 3AAAC 4JPSA 2C2LA 2XP6A 3WD3A 2WLZA 3DSTA 3JYMA 2BKGA 2GW1A 3FTUA 4JB8P 3CHOA 4CDMA 3ZUVB 3GYZA 2P4VA 5AJDA 2PNNA 2R59A 1JNEA 3TJPA 4AY5A 2Q7FA 1UG3A 2J8SD 4W9QA 3GU0A 5T4YA 3LJNA 3UI2A 1HU3A 3DEPA 2XEVA 4WNGA 1FPPA 5CCLA 3ABLE 2XP7A 5FQ8A 3WD0A 2YBUA 1VDYA 5J08A 2E2EA 4GZCA 4HLEA 4DRNA 1IQUA 5EX0A 2P9UG 4UQYA 3UMVA 3V2XA 4CT0A 3LXUX 3L6AA 5CEDB 2FULA 3TG5A 2L0TB 4F3VA 4ILGA 4YVQC 4J8EA 3C3RA 4WUYA 4W9OA 2UWJG 2X6KA 3AS0A 4FU3A 4KZCA 4ANUA 5CMYA 3TWQA 3PEUB 1FKJA 1JVWA 2P9SG 5ENOD 4MSPA 2WXHA 1EDQA 3FTWA 1FKDA 3ASGA 2KI3A 4I1AA 5EN5D 2J49A 3D9PA 3JCKC 3EY6A 3SGHA 3FXYA 4BETA 2QC9A 3ALFA 3TC5A 4L7TA 3GZ1A 5EIDA 4ILHB 3URZA 3RRUA 5HQ8A 1TN6A 3E34A 2NC9A 3L16A 2KBXA 1E6PA 3MV3B 1HFAA 2DIWA 4ODNA 1S63A 3OA5A 1H6KA 1NFIE 4L3NA 3GTYX 4O2TA 3L9TA 4F7AA 2Y69E 2DG4A 2FEZA 4APFA 1O1TA 2ZQTA 1GRJA 3I6CA 4M3OA 2YHCA 1JCHB 3VTXA 3PUKA 1DVPA 1K3ZD 5A23A 1ZK6A 2XHEA 3E32A 5JHAA 4W5UA 5HW8A 3R7QA 1IKND 4F6RD 3O5PA 4PS7A 4FHJA 4DWSA 2Y4UA 2ONDA 2XS8A 2DG3A 3D3MA 1BKFA 1N0QA 5BPPA 5EYLA 1MX2A 2OVBA 4CT4A 3VTYA 2CG3A 5JMND 1BL4A 2X38A 2ZR4A 3CK9A 1YYHA 1Z5SC 4RVBA 3KD7A 2EQXA 2ZR5A 2H6GA 2I9CA 1Q1CA 3FUEA 3RK6A 4HI9A 2DVWA 2AW6A 3FFLA 4DRIA 3HG0D 4UI9K 4ABNA 2PI6A 4AY1A 1G3NB 5C2YA 2WQHA 4JD2G 1A5EA 4XEIG 5KWDA 2QY7A 3APFA 4LSZE 4I6JA 3L13A 2LUHA 2XZDG 1NZNA 4U8YD 1NA3A 1H2UA 1LF8A 5AARA 3ULYA 1SZ9A 4N3BA 1U3DA 3ODKA 2MYOA 4AY6A 5AIJA 2RUQA 4GMRA 3CHFA 3Q7AA 4IQCA 4JFKA 4NNRA 4JXTA 1FKSA 4U0SA 3WL1A 4QIBA 2XGSA 4OVVA 2BF0X 3LPZA 4GTVA 2AWIA 1OWLA 5DEZA 5ENRD 4QQIA 4DX5D 2XENA 5EIBE 4KXKB 1FFRA 1NMVA 4B0ZA 3IHZA 4GCOA 3J5PA 2MNTA 5I98A 3FUFA 3PVLA 5CRVA 1H0AA 2XPZA 4J6IA 2A5EA 3CVVA 4CGWA 1NWSA 3MJWA 3FDHA 1LG1A 2XP8A 1E7VA 2PM6A 4IYPA 2VGXA 1D8EA 2PL2A 2A5UA 4TXQA 3ZYKA 3BG1B 1ZBKA 1HX8A 1KT0A 3CHQA 1FKFA 3ZVVA 1MYOA 2R5SA 3IV0A 3V31A 2LJ4A 4S3JA 2M08A 4GGQA 4DZ2A 3JQ0A 4CYMD 4ODOA 5HS0A 3NF1A 4DX6D 4JHKA 3KAFA 4GTOA 1MZCA 2WB2A 4BWRA 3G2WA 1LD8A 2O92A 1FKKA 2PQRA 2ETBA 3E33A 4U7EB 1U79A 3U64A 4R7LA 3EU9A 3TG4A 4Z2KA 3PZ2A 4CRWA 4LRZA 4I43A 4OVUA 1ZBPA 1JNDA 3P1UA 3MKQB 1HS6A 3JYJA 3CR3A 1D7IA 1JCRA 3D9KA 1LG2A 1E9LA 4APOA 1HXIA 1Z6TA 4TRQA 4AM9A 3Q47B 3ARQA 2CHXA 3WL0A 2DG9A 1QPFA 4MS6A 3RM9A 2JZVA 4C02B 4LUNU 1WNOA 1W1VA 2J4DA 2VSXE 1WAO1 4C9BB 4ML4A 1TJCA 3EDTB 1K8KG 2JABA 4J4NA 4U96D 3ZXSA 5BUZA 4RG6A 3FU3A 5BXOA 4KVMA 1HJVA 2WXJA 1TN7A 3B7BA 3JXIA 5FTPA 4FULA 1UW4B 3U9WA 1D8DA 3FEXA 3DPYA 4GA0A 2X6JA 2GRRB 3AU4A 3O5IA 3FUHA 3DSVA 4FJZA 3HYMB 2LNIA 3B7RL 5ENTD 2DPEA 3PZ4A 1WB0A 4LCTA 5ARGA 2LAIA 4WAFA 4HB5A 2PPPA 4P8UA 1GUVA 2I1JA 2FAPA 3CIAA 5ENNA 2WQ6A 2KXPC 5G05C 4MBGA 1ELKA 3E37A 2O9OA 3FULA 4FAPA 2X6FA 1H2VC 4Z2IA 3SZ7A 4ITZA 4XZ4A 4DX7D 4GMLA 3TDBA 1BD8A 4XKCA 3NAWA 2KGJA 2MOWA 3ZW3A 5EDSA 3CVPA 2F37A 2KO7A 5CBNA 3LCAA 4BESA 3LVRE 3FAPA 3QOKA 5EKQD 1RZ4A 5FIOA 2XPIA 3OTNA 3RU0A 3UM2A 2QFCA 1OXJA 1TNYA 4GZDA 4LAVA 4G2PA 3ARPA 3CHPA 4A3VA 1IHBA 2VTBA 3FUJA 2IF4A 3SBTB 2A4ZA 1O6IA 3HXEA 2DYRE 5AQAA 5HWCA 1NWUA 4FJYA 4GYWA 2F23A 2AVPA 4J4OA 3O5JA 1PY1A 3CK8A 2DT2A 1E90A 4GTPA 4NACA 2WVIA 3GW4A 2VQ2A 3AROA 1QQEA 3T8MA 2WXNA 3HDXA 2RSEA 3PEVB 4HARA 5HI7A 1A7XA 1NP7A 3RRNB 3PZ1A 2AXVA 1LJYA 3P2BA 2IY0C 3UPVA 4DRHA 5JJTA 4MKTA 4DZ3A 5T8IA 4ZPVR 3ZFWA 4QT3A 5LX8A 3O5RA 4DWSD 3KABA 3OXFA 5G04C 1IX5A 3SFYA 4AIFA 4DWSB 2UY1A 3NOCD 2AOSA 5H7PA 4J0UA 3UI6A 2V4LA 2I6HA 3G6MA 3RMEA 1Q6UA 5FT9A 1U2VG 5HW7A 2J9QA 5AQBA 4I17A 4BY6A 5AYWD 4JFMA 3VAWA 1SW6A 3HVEB 4JFJA 5HKGA 3CVWA 4DUIA 2WXRA 4GU5A 3AS5A 3EHRA 1H0IA 3UQAA 5BNWA 3LVQE 2DSWA 1GOIA 3AS2A 5D75A 2KR7A 4GA1A 4DRJA 4RG9A 1MX4A 4U0UA 2M63A 1D7HA 3APDA 3Q73A 4DH0A 4J7WA 2IOSA 2VSYA 2KZTA 4U86A 3U4TA 3ALGA 4DLQA 2UZ5A 3NZUA 4BEPA 3O5FA 2DT3A 4ODLA 3ASFA 5HWBA 2OCCE 3AU5A 4W9PA 2XP4A 4BTAA 4F53A 1FAPA 1TYQG 4ZPTR 4OAVB 1H2TC 3W9FA 3RJVA 3D9IA 3PR9A 5LFAA 5G05J 3FU5A 4DWSC 2IO3C 3LYAA 3NTPA 2DWZA 4PDXA 4L2YA 4NIKA 4U8VD 5ENQD 4HVBA 3NOGD 4FN2A 3UI5A 3AG4E 4LAWA 2F8YA 5BV0A 1TCOC 3UQIA 3E4BA 2ZQVA 4L2LA 1HZ4A 3KS2A 1HG5A 1QBQA 1GPFA 2KCKA 4GCNA 1KT1A 5HW6A 4DIPA 1ZU8A 3ZYQA 2GRMA 4U95D 3ZN3A 4KMOA 3B7XA 4DRXE 3HXDA 1N94A 2Y3AA 1ZL1A 3T5VA 5HT1A 4F1SA 5B1BE 2MLYA 1UJJA 1FKIA 5JHBA 4UDMA 3ESKA 3ZYLA 4N3CA 1W26A 1ELRA 5FQ7A 1HKJA 4AXHA 2I2OA 3ASDA 2B31A 1BLXB 1NA0A 4QZVB 3Q15A 1X6LA 3ARXA 1OCZE 3UIPC 1UJKA 4BF8A 4E6HA 3FH5A 3HVEA 4EHMA 3O5MA 3CQGB 3MA5A 3UM0A 1NI1A 1B89A 2FO1E 4J8FA 1DC2A 1DCQA 3ABME 2J4BA 3C3QA 1FKHA 2ETAA 1AWCB 5DIVA 5AAOA 1JNTA 3G2UA 3V79K 1S64A 2D9FA 2XQ0A 3HXFA 3O5DA 3T5XA 1F40A 3V2OA 1TFVA 3HXCA 3RO2A 1TNOA 5AQ7A 5DBKA 2WXGA 3FP3A 5GQBA 1EQ3A 3FH7A 3ZU7B 3CK7A 1E15A 3CGMA 5CCMA 3SNXA 2J07A 2E0IA 3ARVA 5HRYA 4BT9A 5AQ9A 3AG1E 3QB2A 4ILIA 3ULQA 2F8XK 3PA7A 4LGXA 4F1PA 4TX0A 2P9LG 4XI0A 1NH6A 1HO8A 2C0LA 2WXPA 4B8AA 3UT8A 4P8WA 2RKKA 3SY2A 3FEYA 2P58C 2FF4A 1TNBA 5AN8A 1OT8A 5ANRA 1NL4A 1XHGA 3PE3A 4NQ0A 1Y6IA 2WK2A 3FUMA 4G11A 2YNQA 4UI9C 3O5OA 2RURA 2PPNA 1UN8A 2P9IG 5FINA 2M1IA 2PV3A 1HH8A 1EYHA 4MTVA 4M7CA 5CBOA 4BT8A 4ODQA 4O1PA 1LL4A 4HFGA 1EIBA 2ZXWE 3CV0A 4KBQA 2MLXA 3D9HA 2KFWA 4EBAG 4R0XA 1FKGA 4DPRA 3D9LA 3MEKA 4FP7A 3QWWA 3BUAA 1SA5A 3FTVA 2Y0BG 5FZRA 1M5YA 3B9AA 4LNGA 4GA2A 1N4QA 4G25A 1OWOA 1XNFA 5KJKA 3CVQA 3W4RA 3ML9A 3VLDA 4LEUA 2GRPB 3TL5A 5KNHD 5ANLA 3TWWA 3C5RA 2RFMA 1XRVA 4QFVA 3Q4AB 1PINA 2LAHA 4ACLA 2MHKA 3PREA 4JHJA 3PRDA 4GPMA 4LAXA 2GRNB 3FH8A 4JFIA 1HKIA 3PZDA 3NBNB 3MYVA 2IFUA 4WWPA 1ROUA 3TCZA 1HG2A 1KZOA 3UM1A 1ZCNA 4EZKA 5BV1A 1FKTA 1E8WA 5ARFA 1JUQA 2YHEA 4HBEA 4JA7A 3S7FA 3GZ2A 1HKMA 3FTYA 3KAEA 3T9KA 4DX2A 2B6CA 3NZSA 2K8IA 2XRYA 3EHNA 3CZ8A 3G6LA 2P9KG 2WXMA 1DCEA 4CEMA 2ZGGA 3PS6A 3UTMA 2F2DA 1W3BA 4JL0A 3PZ3A 4S3KA 4O1OA 4ZHBA 4DI4A 2DSVA 3QWVA 2XS1A 4I1OB 1OGBA 3AS3A 2EULA 4KYOB 1N54A 3FUNA 4U8HA 5DIZA 4IPXA 1IYGA 1OY3D 3RAUA 3C98A 1HF8A 5FZSA 1LQ0A 3SI5A 2HE0A 3EJNA 3MV2B 2X3MA 4KT6B 4C0MA 2QYJA 3DPDA 2RD0A 2ZISA 4DK5A 3DRAA 3TWSA 2VYIA 3RRMB 2F4EA 2PM7A 4I2WA 3ABKE 3CVYA 4B8CB 1O5MA 3OAWA 2L9BA 3FU6A 3FUIA 1V54E 1O1RA 3JXJA 1PBKA 2ZQSA 3ASHA 1E8XA 3ML8A 4Q22A 4GB9A 4JFLA 3LY7A 1SVXA 2MPHA 4WK9A 3B7TA 3QKYA 3FUDA 4H7XA 3S7JA 1UR9A 5DITA 4A55A 3WH0A 4LNUD 3QOUA 4BFRA 1DNPA 3OXLA 1N4SA 2R02A 2VN1A 4JYSA 2R03A 4WNFA 5KJLA 2PN0A 2PZIA 4MPKA 4NSBA 3WQWA 3ZKJA 2WXIA 1N52A 1S0PA 1NMWA 1QYMA 3CHDA 3BXWA 1SA4A 3G2TA 3TWRA 1QPLA 2FO7A 3X2QE 3ZHEB 4EQFA 4K0RA 4AEZC 4BERA 5D66A 4LNBA 3DXMG 1J4RA 3IHVA 3MDYB 3APCA 2L6BA 4PTMA 1MHQA 2ZR6A 1OCCE 3KAGA 1F8AB 1YA0A 3MKQA 4GYOA 4EZJA 2WQ7A 3WXXA 4URIA 3O48A 3NRKA 3RM4A 2LSUA 1OUVA 3JXVA 3RM8A 4U63A 4A1GA 2C0MA 1TR4A 2WPVA 1J4IA 1EF1C 3I4RB 3CKBA 3ARUA 1WY6A 3QAQA 3AS8A 3SBSA 4EZLA 3RIBA 3CHEA 2ILRA 3SO8A 3B95A 2Y1LE 4Z2LA 4UWFA 3KSLA 3F6QA 3O5GA 3Q5MA 1D2KA 5G2NA 2A3BA 4U04A 1E6ZA 2MRIA 2HYZA 3LEWA 4TW7A 3EIQC 2EILE 3CLJA 3J5QB 3CHSA 4K03A 4HBDA 4CDNA 3DSUA 5E76A 4ATGA 1IXVA 3R9AB 4XIFA 5CHEE 3RO3A 4GYYA 1SR0A 1ZBCA 2H6HA 4GAAA 3WD2A 1WAWA 3CH9A 2LXMA 3L22A 5BT1A 3ZRHA 4ME2A 4GTQA 3S7DA 4CCAA 5DIUA 4ANVA 5BXJA 2OVFA 4HNAD 4Q69A 4JC8A 1O1SA 2DBAA 4DLOA 1WDYA 3KEAA 4AV7A 3JYSA 3NQPA 4G50A 3C72A 1FCHA 4GIVA 4JEUA 3ZYMA 4U85A 4KZ0A 3V30A 2AXUA 3ISMC 3Q7FA 4MRUA 1OWPA 3TXNA 2XRZA 4TNSA 2QYUA 3KSQA 1SQMA 5D0OD 5LCWC 3Q9UC 4YDOA 5LP0A 2KM4A 3C3OA 3GPKA 2ZIRA 3DWLG 1QNFA 4UQXA 5AJLA 1N4RA 4DRMA 2WXKA 2AWGA 4MNJA 3FHEA 2CFZA 1HJWA 1E8ZA 4I6GA 3PDNA 4DROA 2NYJA 3FWVA 1N0RA 3WG7E 2ETNA 3MX3A 5A6CA 3PRZA 2VSNA 5KCMA 4DJAA 3O5QA 4NZCA 1V55E 4R5EA 1INZA 2WLYA 3UX4A 1FKBA 3JUIA 3VLEA 3CHMA 4PS3A 4C48B 3IKOB 4LERA 1S70B 3MKRA 4ANWA 2LPVA 1OCRE 2PV1A 3UKRG 2NSZA 5BXUA 1ITXA 1W1YA 3Q78A 4IN3B 1X5BA 2XGOA 4NURA 1BPOA 4UI9J 4MGVA 1BI8B 1UOHA 4WNEA 3CVXA 1E96B 3Q9NC 4L9PA 1Q2ZA 3KAHA 2EIKE 4FADA 3D9NA 3I4GA 1LTXA 3PUJA 3S2AA 3SFXA 1E8YA 3UKUG 4N19A 1FFQA 2WXLA 4HS2A 2XP3A 2WMOA 1ZBWA 5ITZF 2XPYA 4N5CA 2ZU6B 3LDZA 3ARRA 3O5EA 1OWMA 1H6PA 5G04J 5M72A 3O5LA 3ESLA 3FY1A 2R05A 2FKEA 1ZU2A 3DSWA 4K5AB 1QZ2A 4H7YA 3PH0C 1BU9A 3B7UX 1H0GA 2XCCA 5KJMA 4HBOA 4WNDA 3OXGA 4DRPA 1SYTA 1N1AA 2IOLA 4BX9A 4GTSA 5DO2A 3MCXA 4ODMA 5D0QD 2QF8A 4G2VA 5KNGA 2LXLA 4CDRA 2MLZA 2RQSA 3WD4A 3GZSA 3CGHA 4GPKA 3IK8A 1XGWA 1W9VA 3ARWA 1UN9A 1YCSB 1PAQA 2HR2A 3PNLB 3EIPA 2KE0A 4GZ6A 2OV8A 1D7JA 3D9JA 2XP5A 4WJXA 2LKNA 1FKLA 3R9MA 2XPAA 4I6EA 3B7SA 2YINA 3PE4A 5C1DA 3AG3E 4BTBA 2CFUA 3D9OA 3Q49B 2DZNA 3QNKA 4JVSA 3CHCA 4YVOA 3KACA 3IKGA 2DZOA 1OWNA 1H6OA 4Z68A 3B9EA 3UM3A 1TEZA 4DI3A 1Q6HA 2XZTG 2G41A 4RQIA 2R17C 2GRQB 3BMBA 1N95A 1EDUA 4A63B 4HRNA 1D9SA 2OEVA 4YDEA 4MNKA 2P9PG 2A3CA 2UY1B 5J90A 2DSUA 3H9RB 4IT4A 4N5QA 4GTRA 4QT2A 3ONLA 1U3CA 3I5PA 3LS8A 4UWGA 4CZ2D 1W9PA 1W1PA 2F21A 4BSXA 1YW5A 2EIME 3DBSA 4K5CA 1FVHA 2J08A 2KZTB 3ENEA 1CTNA 1W1TA 5GPRA 4MAVA 4J8YA 4KVOA 1FVFA 3FU0A 4HOUA 2A3EA 3NI6A 2N87A 5ENSD 2L6JA 3AS4A 2DT1A 2VSOE 3IKDA 1KLXA 3QWPA 5HKPA 1E7UA 3ARZA 4KR0B 4GZ3A 2BEDA 1X81A 4MNLA 4Z2JA 4MNMA 3DEOA 4EPZA 3SQVA 3SFZA 4UQZA 4YDYA 5G55A 2YQ8A 4WIWA 4DX1A 2KCLA 4TUMA 2OFNA 2F0YA 3HRAA 4IULA 3FTZA 4G8LA 4PS8A 2IUZA 3UXGA 1WM5A 1LD7A 2KATA 4ACKA 5EYPF 2I1KA 3EHQA 3CHRA 4TW6A 1EYMA 4DRKA 1N9AA 4EBAA 3L17A 3KADA 4WWOA 2BTDA 3AS1A 4JZYA 2WXFA 4P29A 3WIJA 2J09A 3QARA 3ZNGA 3G2VA 1E6NA 3UQBA 1K1BA 3OOBA 4IT6A 1J6YA 2G8ZA 3SHFA 1TN8A 3CVUA 4N3AA 3RKVA 3AQUA 3K9IA 1AP7A 3FTXA 3TAXA 2VTBB 3MGBA 2X6IA 1WG0A 2VGEA 4MLPA 3AJIA 4OAUC 3TWTA 4IRUA 4EECA 1MQSA 4HOQA 2OLHA 4Z2HA 5JJ7A 2CHZA 1OWQA 2L0IA 3IHYA 2IO2C 3U66A 4O60A 1ZB1A 5ENPD 3I3NA 4HLLA 2WXQA 4ODPA 3WD1A 3EHMA 3LKUA 3EU5A 3B13A 4XE0A 5CECB 4ZS6A 4LAYA 2GRLA 2R2LA 4NRHB 1K9TA 3ONKA 3TWUA 2V4HC 3QK0A 2XEEA 2M2AA 4BSZB 4TUUA 2RUCA 5FQ6A 2B0OE 3BG0B 2XPBA 1NSGA 4TXRA 4FLBA 3CEQA 3CGNA 4HQDA 3EIJA 4L72B 2BKKB 1NWTA 3AG2E 2KCVA 3UIOC 4Y6CA 2GROB 1MX6A 2X6HA 3L08A 2XP9A 4HRMB 1HJXA 4CGVA 1UR8A 1OGGA 2WXOA 2VGYA 3IXEA 5GPGA 3Q75A 3HXBA 2VJ8A 2OOEA 1J4HA
chains in the Genus database with same CATH topology
1E6RA 1ELWA 3CVLA 1B6CA 3UI4A 4W9RA 4Q7NA 3ARSA 2PPOA 5E75A 3LUOA 4WKAA 3QDNA 3WQVA 4WKHA 3PRAA 3QJZA 1SZAA 4AJWA 5HUAA 4E85A 3BEEA 3ARYA 2ZQUA 1PC2A 4XX5A 2YBTA 4FLHA 4TYOA 3KZ7A 4J8DA 2HM8A 2LGOA 4C0EA 3O4ZA 3UF8A 3R7RA 3UT4A 3O5KA 1HKKA 4GMJA 4JA9A 4Z2GA 4Q94A 2FI7A 1W9UA 4Y6WA 3QC1A 3SD5A 1JWFA 2V8SE 4U0ZA 4AP2A 4ODRA 4B94A 1EPUA 3KCEA 2DCPA 4L23A 4PH4B 4TW8A 3D9MA 3TXMA 3UQ3A 4G23A 4I9CA 4FA6A 4XAKA 3ZHEA 2IQCA 3CSFA 1JNSA 2CG2A 3UUXA 2KC7A 4WKFA 1NWRA 4HOTA 2IONA 3IBEA 1LL7A 5BW8C 4I9EA 1Y8MA 4A3TA 2WM9A 4HORA 3B8SA 3MZLB 3SF4A 4U84A 5T3RA 4HOSA 5FQ4A 2VCDA 1D6OA 4FHKA 1R9HA 2A3AA 5B8IC 4AVXA 4JHRA 1JWGA 4N39A 2IJGX 1IHGA 1L1PA 1P5QA 2RUDA 4G24A 1YATA 1L5JA 4ODKA 3B9DA 3CVNA 3LJ3A 1T11A 1JPLA 4DRQA 3ZGQA 4N2QA 3CQCB 4P8XA 1ZBVA 2ITKA 5LCWJ 1GW6A 1Z3YA 4I2ZA 4G1TA 2DT0A 4KQZA 5FWQA 4A1SA 3UT7A 5HBFA 2JLBA 4UWKA 3PNTB 4N2SA 2IU1A 5HTGA 2V0PA 4DT4A 4P8VA 1HE8A 1Q6IA 3KAIA 1FKRA 2GGFA 2PBCA 2Y78A 5J6EA 4I1MA 1LL6A 4V3IA 4WWNA 3PRBA 2Y4TA 2PQNA 5FJYA 3CSTA 1HXVA 2FBNA 1TJFA 1X6NA 1FD9A 5CMWA 2HO1A 2VGXB 3FY4A 5JH8A 4Q96A 4RSYA 4AOFA 4B89A 5FZQA 4O6FA 1EHNA 3WKZA 3FTSA 3N71A 3L54A 2V5FA 3TGOA 1FJDA 2JEKA 3KEZA 2Q5AA 3ZEFA 5AENA 4JW1A 4G26A 3G2SA 2PV2A 4PUCA 3RGCA 3LY8A 5DF0A 3VLFA 4ANXA 1C9HA 4U07A 1IQRA 1ZB5A 3FUKA 1Y0OA 3ZPJA 1KFWA 3ARTA 2FDMA 2WM0A 1A17A 4XI9A 4UWHA 4TV3A 4HXIA 2XGMA 5LOZA 1H19A 2ESCA 5A7DB 3RFWA 1ROTA 3LY9A 4ZPWR 2WMNA 2CHWA 5KJNA 3ZIMA 4FC8A 2MF9A 1VF8A 4IQ2A 4GZ5A 1Z3XA 4JEHA 4OYSA 3HIZA 2AXZA 4J8SA 2NXPA 3HHMA 3S7BA 1RD6A 5JJ6A 3JQ1A 3U3WA 5EX3A 2LSVA 2LO6A 4UWLA 4XKBA 2L2SA 4BX8A 4D10C 3IEGA 2RG8A 2XCBA 2BUGA 4YNDA 3CKCA 4L1BA 4URKA 2DSZA 4JPSA 2C2LA 2XP6A 3WD3A 2WLZA 3JYMA 2GW1A 3FTUA 3CHOA 4CDMA 3GYZA 5AJDA 2R59A 1JNEA 3TJPA 4AY5A 2Q7FA 1UG3A 4W9QA 5T4YA 1HU3A 2XEVA 4WNGA 5CCLA 2XP7A 5FQ8A 3WD0A 2YBUA 1VDYA 5J08A 2E2EA 4GZCA 4HLEA 4DRNA 1IQUA 5EX0A 4UQYA 3UMVA 4CT0A 3LXUX 3L6AA 2FULA 3TG5A 2L0TB 4F3VA 4ILGA 4YVQC 4J8EA 4WUYA 4W9OA 2UWJG 2X6KA 3AS0A 4FU3A 4KZCA 4ANUA 5CMYA 3PEUB 1FKJA 1JVWA 4MSPA 2WXHA 1EDQA 3FTWA 1FKDA 3ASGA 2KI3A 4I1AA 2J49A 3D9PA 3JCKC 3EY6A 3SGHA 3FXYA 3ALFA 3TC5A 4L7TA 3GZ1A 4ILHB 3URZA 3RRUA 5HQ8A 2NC9A 3L16A 1E6PA 3MV3B 1HFAA 2DIWA 4ODNA 3OA5A 1H6KA 4L3NA 4O2TA 4F7AA 2DG4A 2FEZA 4APFA 2ZQTA 3I6CA 4M3OA 2YHCA 3VTXA 3PUKA 1DVPA 5A23A 1ZK6A 2XHEA 5JHAA 4W5UA 5HW8A 3R7QA 3O5PA 4PS7A 4FHJA 4DWSA 2Y4UA 2ONDA 2DG3A 3D3MA 1BKFA 5BPPA 2OVBA 4CT4A 3VTYA 2CG3A 1BL4A 2X38A 2ZR4A 3CK9A 4RVBA 3KD7A 2EQXA 2ZR5A 2I9CA 1Q1CA 3FUEA 3RK6A 2AW6A 3FFLA 4DRIA 4UI9K 4ABNA 2PI6A 4AY1A 5C2YA 2WQHA 2QY7A 3APFA 4I6JA 3L13A 1NZNA 1NA3A 1H2UA 1LF8A 1SZ9A 4N3BA 1U3DA 3ODKA 4AY6A 5AIJA 2RUQA 3CHFA 4IQCA 4JFKA 4NNRA 4JXTA 1FKSA 4U0SA 3WL1A 4QIBA 2XGSA 4OVVA 2BF0X 3LPZA 2AWIA 1OWLA 5DEZA 4KXKB 1FFRA 1NMVA 4B0ZA 3IHZA 4GCOA 2MNTA 5I98A 3FUFA 3PVLA 1H0AA 2XPZA 4J6IA 3CVVA 4CGWA 1NWSA 3MJWA 3FDHA 1LG1A 2XP8A 1E7VA 2PM6A 4IYPA 2VGXA 2PL2A 2A5UA 3ZYKA 3BG1B 1ZBKA 1HX8A 1KT0A 3CHQA 1FKFA 3ZVVA 2R5SA 3IV0A 2LJ4A 4S3JA 2M08A 4GGQA 4DZ2A 3JQ0A 4ODOA 3NF1A 4JHKA 3KAFA 2WB2A 4BWRA 3G2WA 2O92A 1FKKA 2PQRA 1U79A 3U64A 4R7LA 3TG4A 4Z2KA 4CRWA 4LRZA 4I43A 4OVUA 1ZBPA 1JNDA 3P1UA 3MKQB 1HS6A 3JYJA 3CR3A 1D7IA 3D9KA 1LG2A 1E9LA 4APOA 1HXIA 1Z6TA 4TRQA 4AM9A 3Q47B 3ARQA 2CHXA 3WL0A 2DG9A 1QPFA 4MS6A 3RM9A 2JZVA 4C02B 4LUNU 1WNOA 1W1VA 2J4DA 2VSXE 1WAO1 4C9BB 4ML4A 1TJCA 3EDTB 4J4NA 3ZXSA 5BUZA 4RG6A 3FU3A 4KVMA 1HJVA 2WXJA 5FTPA 4FULA 1UW4B 3U9WA 3FEXA 4GA0A 2X6JA 3AU4A 3O5IA 3FUHA 4FJZA 3HYMB 2LNIA 3B7RL 2DPEA 1WB0A 4LCTA 5ARGA 2LAIA 4WAFA 2PPPA 4P8UA 1GUVA 2I1JA 2FAPA 3CIAA 5ENNA 2WQ6A 5G05C 1ELKA 2O9OA 3FULA 4FAPA 2X6FA 1H2VC 4Z2IA 3SZ7A 4ITZA 4XZ4A 4GMLA 3TDBA 4XKCA 2KGJA 2MOWA 3ZW3A 5EDSA 3CVPA 2KO7A 3LCAA 3LVRE 3FAPA 3QOKA 5EKQD 2XPIA 3OTNA 3RU0A 2QFCA 4GZDA 4LAVA 4G2PA 3ARPA 3CHPA 4A3VA 2VTBA 3FUJA 2IF4A 3SBTB 2A4ZA 1O6IA 5HWCA 1NWUA 4FJYA 4GYWA 2AVPA 4J4OA 3O5JA 1PY1A 3CK8A 2DT2A 1E90A 4NACA 2WVIA 3GW4A 2VQ2A 3AROA 1QQEA 3T8MA 2WXNA 3HDXA 2RSEA 3PEVB 4HARA 5HI7A 1A7XA 1NP7A 3RRNB 2AXVA 1LJYA 3P2BA 3UPVA 4DRHA 5JJTA 4MKTA 4DZ3A 5T8IA 4ZPVR 3ZFWA 4QT3A 5LX8A 3O5RA 4DWSD 3KABA 3OXFA 5G04C 1IX5A 4AIFA 4DWSB 2UY1A 2AOSA 4J0UA 3UI6A 2V4LA 2I6HA 3G6MA 3RMEA 1Q6UA 5FT9A 5HW7A 2J9QA 4I17A 4BY6A 5AYWD 4JFMA 3VAWA 3HVEB 4JFJA 5HKGA 3CVWA 2WXRA 4GU5A 3AS5A 1H0IA 3UQAA 5BNWA 3LVQE 2DSWA 1GOIA 3AS2A 5D75A 2KR7A 4GA1A 4DRJA 4RG9A 4U0UA 2M63A 1D7HA 3APDA 4DH0A 2IOSA 2VSYA 2KZTA 4U86A 3U4TA 3ALGA 4DLQA 2UZ5A 3NZUA 3O5FA 2DT3A 4ODLA 3ASFA 5HWBA 3AU5A 4W9PA 2XP4A 4BTAA 4F53A 1FAPA 4ZPTR 1H2TC 3RJVA 3D9IA 3PR9A 5LFAA 5G05J 3FU5A 4DWSC 3LYAA 3NTPA 4PDXA 4L2YA 4HVBA 4FN2A 3UI5A 4LAWA 5BV0A 1TCOC 3UQIA 3E4BA 2ZQVA 4L2LA 1HZ4A 3KS2A 1HG5A 1GPFA 2KCKA 4GCNA 1KT1A 5HW6A 4DIPA 1ZU8A 3ZYQA 2GRMA 3ZN3A 4KMOA 3B7XA 2Y3AA 1ZL1A 3T5VA 5HT1A 4F1SA 2MLYA 1UJJA 1FKIA 5JHBA 3ESKA 3ZYLA 4N3CA 1W26A 1ELRA 5FQ7A 1HKJA 4AXHA 2I2OA 3ASDA 2B31A 1NA0A 4QZVB 3Q15A 1X6LA 3ARXA 1UJKA 4BF8A 4E6HA 3FH5A 3HVEA 3O5MA 3CQGB 3MA5A 1B89A 4J8FA 2J4BA 1FKHA 5DIVA 1JNTA 3G2UA 2D9FA 2XQ0A 3O5DA 3T5XA 1F40A 1TFVA 3RO2A 5DBKA 2WXGA 3FP3A 5GQBA 1EQ3A 3FH7A 3CK7A 1E15A 3CGMA 5CCMA 3SNXA 2J07A 2E0IA 3ARVA 4BT9A 3QB2A 4ILIA 3ULQA 3PA7A 4LGXA 4TX0A 4XI0A 1NH6A 1HO8A 2C0LA 2WXPA 4B8AA 3UT8A 4P8WA 3FEYA 2P58C 2FF4A 5ANRA 1XHGA 3PE3A 4NQ0A 1Y6IA 2WK2A 3FUMA 4G11A 2YNQA 4UI9C 3O5OA 2RURA 2PPNA 1UN8A 2M1IA 2PV3A 1HH8A 1EYHA 4MTVA 4BT8A 4ODQA 1LL4A 4HFGA 1EIBA 3CV0A 4KBQA 2MLXA 2KFWA 4EBAG 4R0XA 1FKGA 4DPRA 3D9LA 3MEKA 4FP7A 3QWWA 3FTVA 5FZRA 1M5YA 3B9AA 4GA2A 4G25A 1OWOA 1XNFA 5KJKA 3CVQA 3W4RA 3ML9A 3VLDA 4LEUA 3TL5A 5ANLA 1XRVA 4QFVA 3Q4AB 1PINA 2LAHA 4ACLA 2MHKA 3PREA 4JHJA 3PRDA 4LAXA 3FH8A 4JFIA 1HKIA 3PZDA 3MYVA 2IFUA 4WWPA 1ROUA 3TCZA 1HG2A 1ZCNA 4EZKA 5BV1A 1FKTA 1E8WA 5ARFA 1JUQA 2YHEA 4HBEA 4JA7A 3S7FA 3GZ2A 1HKMA 3FTYA 3KAEA 3NZSA 2K8IA 2XRYA 3EHNA 3CZ8A 3G6LA 2WXMA 4CEMA 2F2DA 3PS6A 1W3BA 4JL0A 4S3KA 4DI4A 2DSVA 3QWVA 4I1OB 1OGBA 3AS3A 4KYOB 1N54A 3FUNA 4U8HA 5DIZA 4IPXA 1IYGA 3C98A 1HF8A 5FZSA 1LQ0A 3SI5A 3EJNA 3MV2B 2X3MA 4KT6B 4C0MA 3DPDA 2RD0A 4DK5A 2VYIA 3RRMB 2F4EA 2PM7A 4I2WA 3CVYA 4B8CB 3OAWA 2L9BA 3FU6A 3FUIA 1PBKA 2ZQSA 3ASHA 1E8XA 3ML8A 4Q22A 4GB9A 4JFLA 3LY7A 2MPHA 4WK9A 3B7TA 3QKYA 3FUDA 4H7XA 3S7JA 1UR9A 5DITA 4A55A 3WH0A 3QOUA 4BFRA 1DNPA 3OXLA 2VN1A 4JYSA 4WNFA 5KJLA 2PZIA 4MPKA 4NSBA 3WQWA 2WXIA 1N52A 1S0PA 1NMWA 3CHDA 3BXWA 3G2TA 1QPLA 2FO7A 3ZHEB 4K0RA 4AEZC 4EQFA 1J4RA 3IHVA 3MDYB 3APCA 4PTMA 1MHQA 2ZR6A 3KAGA 1F8AB 1YA0A 3MKQA 4GYOA 4EZJA 2WQ7A 3WXXA 4URIA 3O48A 3NRKA 3RM4A 2LSUA 1OUVA 3JXVA 3RM8A 4U63A 4A1GA 2C0MA 2WPVA 1J4IA 1EF1C 3I4RB 3CKBA 3ARUA 1WY6A 3QAQA 3AS8A 3SBSA 4EZLA 3RIBA 3CHEA 2ILRA 4Z2LA 4UWFA 3O5GA 3Q5MA 1D2KA 5G2NA 2A3BA 4U04A 1E6ZA 2MRIA 2HYZA 3LEWA 4TW7A 3EIQC 3CLJA 3CHSA 4K03A 5E76A 4CDNA 4ATGA 3R9AB 4XIFA 5CHEE 3RO3A 4GYYA 1SR0A 1ZBCA 4GAAA 3WD2A 1WAWA 3CH9A 3L22A 5BT1A 3ZRHA 4ME2A 3S7DA 4CCAA 5DIUA 4ANVA 5BXJA 2OVFA 4Q69A 4JC8A 2DBAA 4DLOA 4AV7A 3JYSA 3NQPA 4G50A 1FCHA 4GIVA 4JEUA 3ZYMA 4U85A 4KZ0A 2AXUA 4MRUA 1OWPA 3TXNA 2XRZA 4TNSA 1SQMA 5D0OD 5LCWC 5LP0A 2KM4A 3GPKA 1QNFA 4UQXA 5AJLA 4DRMA 2WXKA 2AWGA 4MNJA 3FHEA 2CFZA 1HJWA 1E8ZA 4I6GA 3PDNA 4DROA 3FWVA 3MX3A 5A6CA 3PRZA 2VSNA 5KCMA 4DJAA 3O5QA 4NZCA 4R5EA 1INZA 2WLYA 3UX4A 1FKBA 3JUIA 3VLEA 3CHMA 4PS3A 3IKOB 4LERA 3MKRA 4ANWA 2LPVA 2PV1A 2NSZA 1ITXA 1W1YA 4IN3B 1X5BA 2XGOA 4NURA 1BPOA 4UI9J 4MGVA 4WNEA 3CVXA 1E96B 3KAHA 4FADA 3D9NA 3I4GA 3PUJA 3S2AA 1E8YA 4N19A 1FFQA 2WXLA 4HS2A 2XP3A 2WMOA 1ZBWA 2XPYA 4N5CA 2ZU6B 3LDZA 3ARRA 3O5EA 1OWMA 5G04J 5M72A 3O5LA 3ESLA 3FY1A 2FKEA 1ZU2A 1QZ2A 4H7YA 3PH0C 3B7UX 1H0GA 2XCCA 4HBOA 5KJMA 4WNDA 3OXGA 4DRPA 1SYTA 1N1AA 2IOLA 4BX9A 5DO2A 3MCXA 4ODMA 5D0QD 2QF8A 4G2VA 4CDRA 2MLZA 2RQSA 3WD4A 3GZSA 3CGHA 4GPKA 3IK8A 1XGWA 3ARWA 1W9VA 1UN9A 1PAQA 2HR2A 3PNLB 2KE0A 4GZ6A 2OV8A 1D7JA 3D9JA 2XP5A 4WJXA 2LKNA 1FKLA 2XPAA 4I6EA 3B7SA 2YINA 3PE4A 5C1DA 4JVSA 4BTBA 2CFUA 3D9OA 3Q49B 3QNKA 3CHCA 4YVOA 3KACA 3IKGA 1OWNA 3B9EA 1TEZA 4DI3A 1Q6HA 2G41A 2R17C 1EDUA 4MNKA 2A3CA 2UY1B 5J90A 2DSUA 3H9RB 4IT4A 4QT2A 3ONLA 1U3CA 3I5PA 3LS8A 4UWGA 1W9PA 1W1PA 2F21A 4BSXA 1YW5A 3DBSA 1FVHA 2J08A 2KZTB 3ENEA 1CTNA 1W1TA 5GPRA 4MAVA 4KVOA 1FVFA 3FU0A 4HOUA 2A3EA 3NI6A 2N87A 2L6JA 3AS4A 2DT1A 2VSOE 3IKDA 1KLXA 3QWPA 1E7UA 3ARZA 4KR0B 4GZ3A 4MNLA 4Z2JA 4MNMA 4EPZA 3SFZA 4UQZA 5G55A 2YQ8A 4WIWA 2KCLA 2OFNA 4IULA 3FTZA 4PS8A 2IUZA 1WM5A 2KATA 4ACKA 2I1KA 3CHRA 4TW6A 1EYMA 4DRKA 3L17A 4EBAA 3KADA 4WWOA 2BTDA 3AS1A 4JZYA 2WXFA 4P29A 3WIJA 2J09A 3QARA 3G2VA 1E6NA 3UQBA 1J6YA 3OOBA 4IT6A 2G8ZA 3SHFA 3CVUA 4N3AA 3RKVA 3AQUA 3K9IA 3FTXA 3TAXA 2VTBB 3MGBA 2X6IA 4MLPA 4IRUA 4EECA 1MQSA 4HOQA 2OLHA 4Z2HA 5JJ7A 2CHZA 1OWQA 2L0IA 3IHYA 3U66A 3I3NA 2WXQA 4ODPA 3WD1A 3EHMA 3LKUA 3B13A 4XE0A 4ZS6A 4LAYA 2GRLA 4NRHB 1K9TA 3ONKA 3QK0A 2M2AA 4TUUA 2RUCA 5FQ6A 3BG0B 2XPBA 1NSGA 4FLBA 3CEQA 3CGNA 3EIJA 4L72B 1NWTA 2KCVA 4Y6CA 2X6HA 3L08A 2XP9A 1HJXA 4CGVA 1UR8A 1OGGA 2WXOA 2VGYA 5GPGA 2VJ8A 2OOEA 1J4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YHC A;  1ELW A;  3CVL A;  3VTX A;  3S7D A;  4FN2 A;  3UI5 A;  5DIU A;  5BXJ A;  1B6C A;  4LAW A;  1TCO C;  3UQI A;  3UI4 A;  1ZK6 A;  3E4B A;  4W9R A;  2ZQV A;  2DBA A;  1HZ4 A;  3KS2 A;  5HW8 A;  2KCK A;  3O5P A;  3JYS A;  4GCN A;  2PPO A;  4G50 A;  3LUO A;  1KT1 A;  5HW6 A;  4DIP A;  3QDN A;  3ZN3 A;  1FCH A;  4GIV A;  2Y4U A;  3B7X A;  2OND A;  2DG3 A;  5HUA A;  4U85 A;  1BKF A;  3BEE A;  5HT1 A;  2ZQU A;  1PC2 A;  3VTY A;  2MLY A;  1BL4 A;  4TYO A;  4TNS A;  1FKI A;  2ZR4 A;  3KZ7 A;  3CK9 A;  4J8D A;  3KD7 A;  2LGO A;  5D0O D;  3ESK A;  5LCW C;  2ZR5 A;  3UF8 A;  4N3C A;  1W26 A;  1Q1C A;  1ELR A;  3ASD A;  3GPK A;  3O5K A;  3FFL A;  4DRI A;  1NA0 A;  4UI9 K;  4JA9 A;  4ABN A;  2FI7 A;  3Q15 A;  2WQH A;  4Y6W A;  4UQX A;  4BF8 A;  4DRM A;  4U0Z A;  2AWG A;  4ODR A;  4B94 A;  3O5M A;  3MA5 A;  1NZN A;  1NA3 A;  1B89 A;  3KCE A;  3PDN A;  4J8F A;  4DRO A;  4TW8 A;  3FWV A;  1FKH A;  5A6C A;  4N3B A;  2VSN A;  3UQ3 A;  3O5Q A;  3ODK A;  4G23 A;  4I9C A;  4AY6 A;  5DIV A;  1JNT A;  2RUQ A;  3ZHE A;  1JNS A;  1FKB A;  4IQC A;  4JFK A;  4NNR A;  2D9F A;  1FKS A;  4U0S A;  3UUX A;  4QIB A;  2KC7 A;  2XGS A;  4HOT A;  3LPZ A;  3MKR A;  2LPV A;  3O5D A;  5BW8 C;  4I9E A;  1Y8M A;  2PV1 A;  1F40 A;  4KXK B;  4HOR A;  1NMV A;  3IHZ A;  3SF4 A;  4U84 A;  4GCO A;  3RO2 A;  2MNT A;  5I98 A;  4HOS A;  5DBK A;  3FP3 A;  2VCD A;  4IN3 B;  4CGW A;  1D6O A;  2XGO A;  4UI9 J;  2XP8 A;  4MGV A;  1R9H A;  4WNE A;  1EQ3 A;  2VGX A;  2PL2 A;  1E96 B;  3CK7 A;  5B8I C;  3KAH A;  3CGM A;  3I6C A;  1KT0 A;  1FKF A;  5CCM A;  4JHR A;  4N39 A;  2R5S A;  4BT9 A;  2LJ4 A;  4N19 A;  1IHG A;  1L1P A;  1P5Q A;  2M08 A;  2RUD A;  4GGQ A;  4G24 A;  1YAT A;  4DZ2 A;  4ODO A;  4ODK A;  2XP3 A;  3CVN A;  3NF1 A;  3ULQ A;  1T11 A;  4N5C A;  3KAF A;  3PA7 A;  4DRQ A;  3ZGQ A;  3O5E A;  4TX0 A;  4N2Q A;  4XI0 A;  5G04 J;  5M72 A;  3O5L A;  2C0L A;  4BWR A;  2ITK A;  5LCW J;  2FKE A;  1FKK A;  2PQR A;  1ZU2 A;  1U79 A;  4I2Z A;  2P58 C;  3TG4 A;  1QZ2 A;  4G1T A;  4H7Y A;  2FF4 A;  2XCC A;  5KJM A;  1ZBP A;  4A1S A;  4WND A;  3OXG A;  4DRP A;  2JLB A;  4N2S A;  5HTG A;  1N1A A;  3PE3 A;  4DT4 A;  4NQ0 A;  1Q6I A;  3JYJ A;  4UI9 C;  1D7I A;  3O5O A;  2RUR A;  2PPN A;  3KAI A;  4ODM A;  2M1I A;  4APO A;  2PV3 A;  1FKR A;  1HH8 A;  5D0Q D;  2PBC A;  4G2V A;  1HXI A;  4AM9 A;  2Y78 A;  3Q47 B;  4BT8 A;  5J6E A;  4ODQ A;  4CDR A;  2DG9 A;  1QPF A;  3CV0 A;  4KBQ A;  2MLX A;  2MLZ A;  2KFW A;  3PRB A;  2RQS A;  2Y4T A;  2PQN A;  2JZV A;  4C02 B;  4R0X A;  5FJY A;  4GPK A;  3IK8 A;  1FKG A;  1HXV A;  2FBN A;  3MEK A;  3QWW A;  2HR2 A;  1FD9 A;  2HO1 A;  2VGX B;  5FZR A;  2KE0 A;  4GZ6 A;  1WAO 1;  1D7J A;  1M5Y A;  4GA2 A;  2XP5 A;  2LKN A;  1FKL A;  4G25 A;  1TJC A;  3EDT B;  1XNF A;  2XPA A;  5KJK A;  3CVQ A;  4LEU A;  3PE4 A;  4J4N A;  5C1D A;  4BTB A;  3Q49 B;  5FZQ A;  4RG6 A;  4YVO A;  4O6F A;  3KAC A;  3IKG A;  3N71 A;  2V5F A;  3TGO A;  1Q6H A;  3Q4A B;  1PIN A;  1FJD A;  2Q5A A;  2MHK A;  5FTP A;  3PRD A;  4LAX A;  4G26 A;  4JFI A;  4GA0 A;  2PV2 A;  3O5I A;  3RGC A;  3HYM B;  2IFU A;  2UY1 B;  2LNI A;  3LY8 A;  3H9R B;  1ROU A;  4QT2 A;  3TCZ A;  5ARG A;  1ZCN A;  1C9H A;  4U07 A;  2PPP A;  1FKT A;  5ARF A;  4JA7 A;  2F21 A;  3S7F A;  3GZ2 A;  1YW5 A;  1Y0O A;  3ZPJ A;  3KAE A;  2FAP A;  2K8I A;  5G05 C;  1A17 A;  2F2D A;  1W3B A;  4JL0 A;  4FAP A;  4HOU A;  3QWV A;  3NI6 A;  4XI9 A;  2N87 A;  2L6J A;  3SZ7 A;  3AS4 A;  3IKD A;  1KLX A;  3QWP A;  4ITZ A;  4KYO B;  2XGM A;  4GZ3 A;  5DIZ A;  3TDB A;  4IPX A;  1IYG A;  5A7D B;  2KGJ A;  3CVP A;  5FZS A;  3RFW A;  1ROT A;  3LY9 A;  2KO7 A;  5KJN A;  3LCA A;  3MV2 B;  3FAP A;  4UQZ A;  2MF9 A;  4IQ2 A;  4GZ5 A;  5EKQ D;  2YQ8 A;  2XPI A;  3RU0 A;  2KCL A;  2VYI A;  2OFN A;  2QFC A;  2F4E A;  4I2W A;  4LAV A;  4G2P A;  3S7B A;  5JJ6 A;  1PBK A;  2ZQS A;  3ASH A;  3U3W A;  1WM5 A;  2LSV A;  5EX3 A;  2KAT A;  2IF4 A;  4JFL A;  3LY7 A;  2MPH A;  4TW6 A;  2L2S A;  5HWC A;  1EYM A;  3QKY A;  4DRK A;  4GYW A;  3IEG A;  3KAD A;  2XCB A;  2AVP A;  4H7X A;  3S7J A;  4J4O A;  5DIT A;  3O5J A;  2BUG A;  3CK8 A;  4YND A;  3CKC A;  3WH0 A;  3QOU A;  3GW4 A;  2VQ2 A;  1QQE A;  3UQB A;  3OXL A;  2C2L A;  2RSE A;  1J6Y A;  3OOB A;  2VN1 A;  5HI7 A;  2XP6 A;  1A7X A;  4JYS A;  4WNF A;  5KJL A;  4N3A A;  3RKV A;  2PZI A;  3JYM A;  2GW1 A;  3K9I A;  3UPV A;  4DRH A;  3GYZ A;  5JJT A;  4DZ3 A;  3ZFW A;  4QT3 A;  1NMW A;  3TAX A;  3O5R A;  4AY5 A;  2Q7F A;  3KAB A;  3OXF A;  5G04 C;  1QPL A;  4W9Q A;  2FO7 A;  3ZHE B;  4AIF A;  4EQF A;  2UY1 A;  2XEV A;  4WNG A;  4J0U A;  1J4R A;  3UI6 A;  5CCL A;  2XP7 A;  3MDY B;  2I6H A;  4HOQ A;  2E2E A;  4DRN A;  2ZR6 A;  5EX0 A;  1Q6U A;  4UQY A;  5FT9 A;  5JJ7 A;  3KAG A;  1F8A B;  1YA0 A;  4GYO A;  5HW7 A;  2J9Q A;  4I17 A;  3TG5 A;  3WXX A;  5AYW D;  4F3V A;  4JFM A;  3VAW A;  4YVQ C;  3O48 A;  4J8E A;  3NRK A;  4JFJ A;  5HKG A;  2LSU A;  1OUV A;  3JXV A;  4WUY A;  4W9O A;  3AS5 A;  4ODP A;  3UQA A;  2UWJ G;  5BNW A;  2C0M A;  3LKU A;  5D75 A;  2WPV A;  4GA1 A;  2KR7 A;  4DRJ A;  4RG9 A;  1J4I A;  1FKJ A;  4U0U A;  1JVW A;  4MSP A;  1D7H A;  3CKB A;  1FKD A;  4LAY A;  3ASG A;  2KI3 A;  4NRH B;  4I1A A;  3AS8 A;  4DH0 A;  2M2A A;  2RUC A;  3RIB A;  3EY6 A;  2VSY A;  4U86 A;  3U4T A;  2XPB A;  1NSG A;  2UZ5 A;  3TC5 A;  3O5G A;  3CEQ A;  3GZ1 A;  3Q5M A;  3O5F A;  3CGN A;  3URZ A;  4ODL A;  3ASF A;  4U04 A;  2HYZ A;  5HQ8 A;  5HWB A;  4TW7 A;  2NC9 A;  2KCV A;  3MV3 B;  4Y6C A;  4W9P A;  2XP4 A;  4ODN A;  3R9A B;  2XP9 A;  4BTA A;  1FAP A;  4XIF A;  5CHE E;  3RO3 A;  4GYY A;  4CGV A;  4O2T A;  3RJV A;  2VGY A;  2DG4 A;  2FEZ A;  5GPG A;  5G05 J;  5BT1 A;  2ZQT A;  3LYA A;  3NTP A;  2OOE A;  4ME2 A;  1J4H A; 
#chains in the Genus database with same CATH topology
 1E6R A;  1ELW A;  3CVL A;  1B6C A;  4UUC A;  3UI4 A;  4W9R A;  3W9G A;  4Q7N A;  2P9N G;  3ARS A;  2PPO A;  5E75 A;  3LUO A;  4WKA A;  3QDN A;  3WQV A;  4WKH A;  1TNU A;  3PRA A;  3QJZ A;  1SZA A;  4AJW A;  5HUA A;  4E85 A;  3BEE A;  3ARY A;  2ZQU A;  1PC2 A;  4XX5 A;  2YBT A;  4FLH A;  5D2M C;  4TYO A;  3KZ7 A;  4J8D A;  4TXP A;  2B5U B;  2HM8 A;  2LGO A;  4C0E A;  3O4Z A;  3UF8 A;  5IY5 E;  2RFA A;  2IEJ A;  3R7R A;  3UT4 A;  3O5K A;  1HKK A;  4GMJ A;  4JA9 A;  4X8Q A;  4Z2G A;  4Q94 A;  2FI7 A;  1W9U A;  4Y6W A;  1E44 A;  3QC1 A;  3SD5 A;  1JWF A;  2V8S E;  4U0Z A;  4AP2 A;  4ZFH A;  4ODR A;  3BQO A;  4B94 A;  2H6I A;  3ULE G;  1KPS B;  1EPU A;  3NB2 A;  2EIN E;  3KCE A;  2DCP A;  4L23 A;  4PH4 B;  4TW8 A;  3D9M A;  3TXM A;  3ASN E;  3UQ3 A;  4G23 A;  5CRU A;  4I9C A;  4FA6 A;  4XAK A;  3ZHE A;  2IQC A;  3CSF A;  1JNS A;  4K5B A;  2CG2 A;  3UUX A;  2KC7 A;  4WKF A;  1NWR A;  4HOT A;  2ION A;  3IBE A;  3BU8 A;  1LL7 A;  5BW8 C;  4I9E A;  1Y8M A;  5B3S E;  5EIL A;  4A3T A;  2WM9 A;  4HOR A;  3B8S A;  3MZL B;  3SF4 A;  4U84 A;  5T3R A;  2XEH A;  4HOS A;  5KBA A;  1KZP A;  5FQ4 A;  2VCD A;  1D6O A;  4FHK A;  1R9H A;  2A3A A;  5B8I C;  1N4P A;  1JCS A;  4AVX A;  3EUV A;  4JHR A;  1JWG A;  5CEA A;  4N39 A;  3E30 A;  2IJG X;  1BI7 B;  3RSE G;  1IHG A;  1L1P A;  1P5Q A;  5CER B;  4HRL A;  4G24 A;  1YAT A;  1L5J A;  2RUD A;  4ODK A;  3B9D A;  3CVN A;  3LJ3 A;  1T11 A;  1JPL A;  4DRQ A;  4GTT A;  3ZGQ A;  4N2Q A;  3CQC B;  4P8X A;  1ZBV A;  2ITK A;  5LCW J;  3L82 A;  3DSX A;  2AJA A;  5JA4 D;  1GW6 A;  1Z3Y A;  4I2Z A;  2ETC A;  4G1T A;  4B93 B;  2DT0 A;  4KQZ A;  5FWQ A;  4A1S A;  3UT7 A;  5HBF A;  2JLB A;  4UWK A;  3PNT B;  4N2S A;  2IU1 A;  5HTG A;  2V0P A;  4DT4 A;  4LG6 A;  4P8V A;  1HE8 A;  1Q6I A;  3T8K A;  1FT1 A;  3KAI A;  1FKR A;  2GGF A;  2PBC A;  2Y78 A;  5J6E A;  4I1M A;  1LL6 A;  4V3I A;  3ASO E;  2QZA A;  4WWN A;  3PRB A;  2OEW A;  2Y4T A;  2PQN A;  5FJY A;  1FT2 A;  3CST A;  1HXV A;  2FBN A;  1TJF A;  1X6N A;  1FD9 A;  5CMW A;  2HO1 A;  2VGX B;  3FY4 A;  2EIJ E;  5JH8 A;  4Q96 A;  2DYS E;  4RSY A;  3Q79 A;  3TWV A;  4AOF A;  3DSS A;  4B89 A;  5FZQ A;  4O6F A;  1EHN A;  3WKZ A;  3FTS A;  3N71 A;  3L54 A;  2V5F A;  3TGO A;  3TWX A;  1OCO E;  1FJD A;  2JEK A;  3KEZ A;  2Q5A A;  3ZEF A;  5AEN A;  1MJ0 A;  4YDW A;  4ATZ D;  4JW1 A;  4G26 A;  3G2S A;  1JCQ A;  2PV2 A;  4PUC A;  3RGC A;  1K1A A;  3LY8 A;  5DF0 A;  3VLF A;  4ANX A;  1C9H A;  4U07 A;  1IQR A;  1ZB5 A;  3FUK A;  1Y0O A;  3ZPJ A;  1KFW A;  3ART A;  2FDM A;  2WM0 A;  1TNZ A;  1A17 A;  1YMP A;  3JUE A;  4XI9 A;  1RW2 A;  2V5Q C;  4UWH A;  4G8K A;  4TV3 A;  4HXI A;  2H6F A;  2XGM A;  5LOZ A;  1H19 A;  2ESC A;  5A7D B;  3RFW A;  1ROT A;  3LY9 A;  4ZPW R;  2WMN A;  2CHW A;  5KJN A;  3ZIM A;  4GTM A;  4FC8 A;  2MF9 A;  1VF8 A;  4IQ2 A;  4GZ5 A;  2P2C P;  1Z3X A;  3DXK G;  4JEH A;  4OYS A;  3HIZ A;  2AXZ A;  4J8S A;  2NXP A;  3HHM A;  3S7B A;  1RD6 A;  5JJ6 A;  3JQ1 A;  3U3W A;  5EX3 A;  2LSV A;  4RLY A;  2LO6 A;  3ZXP A;  4UWL A;  4XKB A;  4HI8 A;  2L2S A;  4BX8 A;  4D10 C;  3IEG A;  2RG8 A;  2XCB A;  2BUG A;  1N11 A;  3CKC A;  4YND A;  4L1B A;  2ZGD A;  4URK A;  2DSZ A;  5B1A E;  3UIN C;  3AAA C;  4JPS A;  2C2L A;  2XP6 A;  3WD3 A;  2WLZ A;  3DST A;  3JYM A;  2BKG A;  2GW1 A;  3FTU A;  4JB8 P;  3CHO A;  4CDM A;  3ZUV B;  3GYZ A;  2P4V A;  5AJD A;  2PNN A;  2R59 A;  1JNE A;  3TJP A;  4AY5 A;  2Q7F A;  1UG3 A;  2J8S D;  4W9Q A;  3GU0 A;  5T4Y A;  3LJN A;  3UI2 A;  1HU3 A;  3DEP A;  2XEV A;  4WNG A;  1FPP A;  5CCL A;  3ABL E;  2XP7 A;  5FQ8 A;  3WD0 A;  2YBU A;  1VDY A;  5J08 A;  2E2E A;  4GZC A;  4HLE A;  4DRN A;  1IQU A;  5EX0 A;  2P9U G;  4UQY A;  3UMV A;  3V2X A;  4CT0 A;  3LXU X;  3L6A A;  5CED B;  2FUL A;  3TG5 A;  2L0T B;  4F3V A;  4ILG A;  4YVQ C;  4J8E A;  3C3R A;  4WUY A;  4W9O A;  2UWJ G;  2X6K A;  3AS0 A;  4FU3 A;  4KZC A;  4ANU A;  5CMY A;  3TWQ A;  3PEU B;  1FKJ A;  1JVW A;  2P9S G;  5ENO D;  4MSP A;  2WXH A;  1EDQ A;  3FTW A;  1FKD A;  3ASG A;  2KI3 A;  4I1A A;  5EN5 D;  2J49 A;  3D9P A;  3JCK C;  3EY6 A;  3SGH A;  3FXY A;  4BET A;  2QC9 A;  3ALF A;  3TC5 A;  4L7T A;  3GZ1 A;  5EID A;  4ILH B;  3URZ A;  3RRU A;  5HQ8 A;  1TN6 A;  3E34 A;  2NC9 A;  3L16 A;  2KBX A;  1E6P A;  3MV3 B;  1HFA A;  2DIW A;  4ODN A;  1S63 A;  3OA5 A;  1H6K A;  1NFI E;  4L3N A;  3GTY X;  4O2T A;  3L9T A;  4F7A A;  2Y69 E;  2DG4 A;  2FEZ A;  4APF A;  1O1T A;  2ZQT A;  1GRJ A;  3I6C A;  4M3O A;  2YHC A;  1JCH B;  3VTX A;  3PUK A;  1DVP A;  1K3Z D;  5A23 A;  1ZK6 A;  2XHE A;  3E32 A;  5JHA A;  4W5U A;  5HW8 A;  3R7Q A;  1IKN D;  4F6R D;  3O5P A;  4PS7 A;  4FHJ A;  4DWS A;  2Y4U A;  2OND A;  2XS8 A;  2DG3 A;  3D3M A;  1BKF A;  1N0Q A;  5BPP A;  5EYL A;  1MX2 A;  2OVB A;  4CT4 A;  3VTY A;  2CG3 A;  5JMN D;  1BL4 A;  2X38 A;  2ZR4 A;  3CK9 A;  1YYH A;  1Z5S C;  4RVB A;  3KD7 A;  2EQX A;  2ZR5 A;  2H6G A;  2I9C A;  1Q1C A;  3FUE A;  3RK6 A;  4HI9 A;  2DVW A;  2AW6 A;  3FFL A;  4DRI A;  3HG0 D;  4UI9 K;  4ABN A;  2PI6 A;  4AY1 A;  1G3N B;  5C2Y A;  2WQH A;  4JD2 G;  1A5E A;  4XEI G;  5KWD A;  2QY7 A;  3APF A;  4LSZ E;  4I6J A;  3L13 A;  2LUH A;  2XZD G;  1NZN A;  4U8Y D;  1NA3 A;  1H2U A;  1LF8 A;  5AAR A;  3ULY A;  1SZ9 A;  4N3B A;  1U3D A;  3ODK A;  2MYO A;  4AY6 A;  5AIJ A;  2RUQ A;  4GMR A;  3CHF A;  3Q7A A;  4IQC A;  4JFK A;  4NNR A;  4JXT A;  1FKS A;  4U0S A;  3WL1 A;  4QIB A;  2XGS A;  4OVV A;  2BF0 X;  3LPZ A;  4GTV A;  2AWI A;  1OWL A;  5DEZ A;  5ENR D;  4QQI A;  4DX5 D;  2XEN A;  5EIB E;  4KXK B;  1FFR A;  1NMV A;  4B0Z A;  3IHZ A;  4GCO A;  3J5P A;  2MNT A;  5I98 A;  3FUF A;  3PVL A;  5CRV A;  1H0A A;  2XPZ A;  4J6I A;  2A5E A;  3CVV A;  4CGW A;  1NWS A;  3MJW A;  3FDH A;  1LG1 A;  2XP8 A;  1E7V A;  2PM6 A;  4IYP A;  2VGX A;  1D8E A;  2PL2 A;  2A5U A;  4TXQ A;  3ZYK A;  3BG1 B;  1ZBK A;  1HX8 A;  1KT0 A;  3CHQ A;  1FKF A;  3ZVV A;  1MYO A;  2R5S A;  3IV0 A;  3V31 A;  2LJ4 A;  4S3J A;  2M08 A;  4GGQ A;  4DZ2 A;  3JQ0 A;  4CYM D;  4ODO A;  5HS0 A;  3NF1 A;  4DX6 D;  4JHK A;  3KAF A;  4GTO A;  1MZC A;  2WB2 A;  4BWR A;  3G2W A;  1LD8 A;  2O92 A;  1FKK A;  2PQR A;  2ETB A;  3E33 A;  4U7E B;  1U79 A;  3U64 A;  4R7L A;  3EU9 A;  3TG4 A;  4Z2K A;  3PZ2 A;  4CRW A;  4LRZ A;  4I43 A;  4OVU A;  1ZBP A;  1JND A;  3P1U A;  3MKQ B;  1HS6 A;  3JYJ A;  3CR3 A;  1D7I A;  1JCR A;  3D9K A;  1LG2 A;  1E9L A;  4APO A;  1HXI A;  1Z6T A;  4TRQ A;  4AM9 A;  3Q47 B;  3ARQ A;  2CHX A;  3WL0 A;  2DG9 A;  1QPF A;  4MS6 A;  3RM9 A;  2JZV A;  4C02 B;  4LUN U;  1WNO A;  1W1V A;  2J4D A;  2VSX E;  1WAO 1;  4C9B B;  4ML4 A;  1TJC A;  3EDT B;  1K8K G;  2JAB A;  4J4N A;  4U96 D;  3ZXS A;  5BUZ A;  4RG6 A;  3FU3 A;  5BXO A;  4KVM A;  1HJV A;  2WXJ A;  1TN7 A;  3B7B A;  3JXI A;  5FTP A;  4FUL A;  1UW4 B;  3U9W A;  1D8D A;  3FEX A;  3DPY A;  4GA0 A;  2X6J A;  2GRR B;  3AU4 A;  3O5I A;  3FUH A;  3DSV A;  4FJZ A;  3HYM B;  2LNI A;  3B7R L;  5ENT D;  2DPE A;  3PZ4 A;  1WB0 A;  4LCT A;  5ARG A;  2LAI A;  4WAF A;  4HB5 A;  2PPP A;  4P8U A;  1GUV A;  2I1J A;  2FAP A;  3CIA A;  5ENN A;  2WQ6 A;  2KXP C;  5G05 C;  4MBG A;  1ELK A;  3E37 A;  2O9O A;  3FUL A;  4FAP A;  2X6F A;  1H2V C;  4Z2I A;  3SZ7 A;  4ITZ A;  4XZ4 A;  4DX7 D;  4GML A;  3TDB A;  1BD8 A;  4XKC A;  3NAW A;  2KGJ A;  2MOW A;  3ZW3 A;  5EDS A;  3CVP A;  2F37 A;  2KO7 A;  5CBN A;  3LCA A;  4BES A;  3LVR E;  3FAP A;  3QOK A;  5EKQ D;  1RZ4 A;  5FIO A;  2XPI A;  3OTN A;  3RU0 A;  3UM2 A;  2QFC A;  1OXJ A;  1TNY A;  4GZD A;  4LAV A;  4G2P A;  3ARP A;  3CHP A;  4A3V A;  1IHB A;  2VTB A;  3FUJ A;  2IF4 A;  3SBT B;  2A4Z A;  1O6I A;  3HXE A;  2DYR E;  5AQA A;  5HWC A;  1NWU A;  4FJY A;  4GYW A;  2F23 A;  2AVP A;  4J4O A;  3O5J A;  1PY1 A;  3CK8 A;  2DT2 A;  1E90 A;  4GTP A;  4NAC A;  2WVI A;  3GW4 A;  2VQ2 A;  3ARO A;  1QQE A;  3T8M A;  2WXN A;  3HDX A;  2RSE A;  3PEV B;  4HAR A;  5HI7 A;  1A7X A;  1NP7 A;  3RRN B;  3PZ1 A;  2AXV A;  1LJY A;  3P2B A;  2IY0 C;  3UPV A;  4DRH A;  5JJT A;  4MKT A;  4DZ3 A;  5T8I A;  4ZPV R;  3ZFW A;  4QT3 A;  5LX8 A;  3O5R A;  4DWS D;  3KAB A;  3OXF A;  5G04 C;  1IX5 A;  3SFY A;  4AIF A;  4DWS B;  2UY1 A;  3NOC D;  2AOS A;  5H7P A;  4J0U A;  3UI6 A;  2V4L A;  2I6H A;  3G6M A;  3RME A;  1Q6U A;  5FT9 A;  1U2V G;  5HW7 A;  2J9Q A;  5AQB A;  4I17 A;  4BY6 A;  5AYW D;  4JFM A;  3VAW A;  1SW6 A;  3HVE B;  4JFJ A;  5HKG A;  3CVW A;  4DUI A;  2WXR A;  4GU5 A;  3AS5 A;  3EHR A;  1H0I A;  3UQA A;  5BNW A;  3LVQ E;  2DSW A;  1GOI A;  3AS2 A;  5D75 A;  2KR7 A;  4GA1 A;  4DRJ A;  4RG9 A;  1MX4 A;  4U0U A;  2M63 A;  1D7H A;  3APD A;  3Q73 A;  4DH0 A;  4J7W A;  2IOS A;  2VSY A;  2KZT A;  4U86 A;  3U4T A;  3ALG A;  4DLQ A;  2UZ5 A;  3NZU A;  4BEP A;  3O5F A;  2DT3 A;  4ODL A;  3ASF A;  5HWB A;  2OCC E;  3AU5 A;  4W9P A;  2XP4 A;  4BTA A;  4F53 A;  1FAP A;  1TYQ G;  4ZPT R;  4OAV B;  1H2T C;  3W9F A;  3RJV A;  3D9I A;  3PR9 A;  5LFA A;  5G05 J;  3FU5 A;  4DWS C;  2IO3 C;  3LYA A;  3NTP A;  2DWZ A;  4PDX A;  4L2Y A;  4NIK A;  4U8V D;  5ENQ D;  4HVB A;  3NOG D;  4FN2 A;  3UI5 A;  3AG4 E;  4LAW A;  2F8Y A;  5BV0 A;  1TCO C;  3UQI A;  3E4B A;  2ZQV A;  4L2L A;  1HZ4 A;  3KS2 A;  1HG5 A;  1QBQ A;  1GPF A;  2KCK A;  4GCN A;  1KT1 A;  5HW6 A;  4DIP A;  1ZU8 A;  3ZYQ A;  2GRM A;  4U95 D;  3ZN3 A;  4KMO A;  3B7X A;  4DRX E;  3HXD A;  1N94 A;  2Y3A A;  1ZL1 A;  3T5V A;  5HT1 A;  4F1S A;  5B1B E;  2MLY A;  1UJJ A;  1FKI A;  5JHB A;  4UDM A;  3ESK A;  3ZYL A;  4N3C A;  1W26 A;  1ELR A;  5FQ7 A;  1HKJ A;  4AXH A;  2I2O A;  3ASD A;  2B31 A;  1BLX B;  1NA0 A;  4QZV B;  3Q15 A;  1X6L A;  3ARX A;  1OCZ E;  3UIP C;  1UJK A;  4BF8 A;  4E6H A;  3FH5 A;  3HVE A;  4EHM A;  3O5M A;  3CQG B;  3MA5 A;  3UM0 A;  1NI1 A;  1B89 A;  2FO1 E;  4J8F A;  1DC2 A;  1DCQ A;  3ABM E;  2J4B A;  3C3Q A;  1FKH A;  2ETA A;  1AWC B;  5DIV A;  5AAO A;  1JNT A;  3G2U A;  3V79 K;  1S64 A;  2D9F A;  2XQ0 A;  3HXF A;  3O5D A;  3T5X A;  1F40 A;  3V2O A;  1TFV A;  3HXC A;  3RO2 A;  1TNO A;  5AQ7 A;  5DBK A;  2WXG A;  3FP3 A;  5GQB A;  1EQ3 A;  3FH7 A;  3ZU7 B;  3CK7 A;  1E15 A;  3CGM A;  5CCM A;  3SNX A;  2J07 A;  2E0I A;  3ARV A;  5HRY A;  4BT9 A;  5AQ9 A;  3AG1 E;  3QB2 A;  4ILI A;  3ULQ A;  2F8X K;  3PA7 A;  4LGX A;  4F1P A;  4TX0 A;  2P9L G;  4XI0 A;  1NH6 A;  1HO8 A;  2C0L A;  2WXP A;  4B8A A;  3UT8 A;  4P8W A;  2RKK A;  3SY2 A;  3FEY A;  2P58 C;  2FF4 A;  1TNB A;  5AN8 A;  1OT8 A;  5ANR A;  1NL4 A;  1XHG A;  3PE3 A;  4NQ0 A;  1Y6I A;  2WK2 A;  3FUM A;  4G11 A;  2YNQ A;  4UI9 C;  3O5O A;  2RUR A;  2PPN A;  1UN8 A;  2P9I G;  5FIN A;  2M1I A;  2PV3 A;  1HH8 A;  1EYH A;  4MTV A;  4M7C A;  5CBO A;  4BT8 A;  4ODQ A;  4O1P A;  1LL4 A;  4HFG A;  1EIB A;  2ZXW E;  3CV0 A;  4KBQ A;  2MLX A;  3D9H A;  2KFW A;  4EBA G;  4R0X A;  1FKG A;  4DPR A;  3D9L A;  3MEK A;  4FP7 A;  3QWW A;  3BUA A;  1SA5 A;  3FTV A;  2Y0B G;  5FZR A;  1M5Y A;  3B9A A;  4LNG A;  4GA2 A;  1N4Q A;  4G25 A;  1OWO A;  1XNF A;  5KJK A;  3CVQ A;  3W4R A;  3ML9 A;  3VLD A;  4LEU A;  2GRP B;  3TL5 A;  5KNH D;  5ANL A;  3TWW A;  3C5R A;  2RFM A;  1XRV A;  4QFV A;  3Q4A B;  1PIN A;  2LAH A;  4ACL A;  2MHK A;  3PRE A;  4JHJ A;  3PRD A;  4GPM A;  4LAX A;  2GRN B;  3FH8 A;  4JFI A;  1HKI A;  3PZD A;  3NBN B;  3MYV A;  2IFU A;  4WWP A;  1ROU A;  3TCZ A;  1HG2 A;  1KZO A;  3UM1 A;  1ZCN A;  4EZK A;  5BV1 A;  1FKT A;  1E8W A;  5ARF A;  1JUQ A;  2YHE A;  4HBE A;  4JA7 A;  3S7F A;  3GZ2 A;  1HKM A;  3FTY A;  3KAE A;  3T9K A;  4DX2 A;  2B6C A;  3NZS A;  2K8I A;  2XRY A;  3EHN A;  3CZ8 A;  3G6L A;  2P9K G;  2WXM A;  1DCE A;  4CEM A;  2ZGG A;  3PS6 A;  3UTM A;  2F2D A;  1W3B A;  4JL0 A;  3PZ3 A;  4S3K A;  4O1O A;  4ZHB A;  4DI4 A;  2DSV A;  3QWV A;  2XS1 A;  4I1O B;  1OGB A;  3AS3 A;  2EUL A;  4KYO B;  1N54 A;  3FUN A;  4U8H A;  5DIZ A;  4IPX A;  1IYG A;  1OY3 D;  3RAU A;  3C98 A;  1HF8 A;  5FZS A;  1LQ0 A;  3SI5 A;  2HE0 A;  3EJN A;  3MV2 B;  2X3M A;  4KT6 B;  4C0M A;  2QYJ A;  3DPD A;  2RD0 A;  2ZIS A;  4DK5 A;  3DRA A;  3TWS A;  2VYI A;  3RRM B;  2F4E A;  2PM7 A;  4I2W A;  3ABK E;  3CVY A;  4B8C B;  1O5M A;  3OAW A;  2L9B A;  3FU6 A;  3FUI A;  1V54 E;  1O1R A;  3JXJ A;  1PBK A;  2ZQS A;  3ASH A;  1E8X A;  3ML8 A;  4Q22 A;  4GB9 A;  4JFL A;  3LY7 A;  1SVX A;  2MPH A;  4WK9 A;  3B7T A;  3QKY A;  3FUD A;  4H7X A;  3S7J A;  1UR9 A;  5DIT A;  4A55 A;  3WH0 A;  4LNU D;  3QOU A;  4BFR A;  1DNP A;  3OXL A;  1N4S A;  2R02 A;  2VN1 A;  4JYS A;  2R03 A;  4WNF A;  5KJL A;  2PN0 A;  2PZI A;  4MPK A;  4NSB A;  3WQW A;  3ZKJ A;  2WXI A;  1N52 A;  1S0P A;  1NMW A;  1QYM A;  3CHD A;  3BXW A;  1SA4 A;  3G2T A;  3TWR A;  1QPL A;  2FO7 A;  3X2Q E;  3ZHE B;  4EQF A;  4K0R A;  4AEZ C;  4BER A;  5D66 A;  4LNB A;  3DXM G;  1J4R A;  3IHV A;  3MDY B;  3APC A;  2L6B A;  4PTM A;  1MHQ A;  2ZR6 A;  1OCC E;  3KAG A;  1F8A B;  1YA0 A;  3MKQ A;  4GYO A;  4EZJ A;  2WQ7 A;  3WXX A;  4URI A;  3O48 A;  3NRK A;  3RM4 A;  2LSU A;  1OUV A;  3JXV A;  3RM8 A;  4U63 A;  4A1G A;  2C0M A;  1TR4 A;  2WPV A;  1J4I A;  1EF1 C;  3I4R B;  3CKB A;  3ARU A;  1WY6 A;  3QAQ A;  3AS8 A;  3SBS A;  4EZL A;  3RIB A;  3CHE A;  2ILR A;  3SO8 A;  3B95 A;  2Y1L E;  4Z2L A;  4UWF A;  3KSL A;  3F6Q A;  3O5G A;  3Q5M A;  1D2K A;  5G2N A;  2A3B A;  4U04 A;  1E6Z A;  2MRI A;  2HYZ A;  3LEW A;  4TW7 A;  3EIQ C;  2EIL E;  3CLJ A;  3J5Q B;  3CHS A;  4K03 A;  4HBD A;  4CDN A;  3DSU A;  5E76 A;  4ATG A;  1IXV A;  3R9A B;  4XIF A;  5CHE E;  3RO3 A;  4GYY A;  1SR0 A;  1ZBC A;  2H6H A;  4GAA A;  3WD2 A;  1WAW A;  3CH9 A;  2LXM A;  3L22 A;  5BT1 A;  3ZRH A;  4ME2 A;  4GTQ A;  3S7D A;  4CCA A;  5DIU A;  4ANV A;  5BXJ A;  2OVF A;  4HNA D;  4Q69 A;  4JC8 A;  1O1S A;  2DBA A;  4DLO A;  1WDY A;  3KEA A;  4AV7 A;  3JYS A;  3NQP A;  4G50 A;  3C72 A;  1FCH A;  4GIV A;  4JEU A;  3ZYM A;  4U85 A;  4KZ0 A;  3V30 A;  2AXU A;  3ISM C;  3Q7F A;  4MRU A;  1OWP A;  3TXN A;  2XRZ A;  4TNS A;  2QYU A;  3KSQ A;  1SQM A;  5D0O D;  5LCW C;  3Q9U C;  4YDO A;  5LP0 A;  2KM4 A;  3C3O A;  3GPK A;  2ZIR A;  3DWL G;  1QNF A;  4UQX A;  5AJL A;  1N4R A;  4DRM A;  2WXK A;  2AWG A;  4MNJ A;  3FHE A;  2CFZ A;  1HJW A;  1E8Z A;  4I6G A;  3PDN A;  4DRO A;  2NYJ A;  3FWV A;  1N0R A;  3WG7 E;  2ETN A;  3MX3 A;  5A6C A;  3PRZ A;  2VSN A;  5KCM A;  4DJA A;  3O5Q A;  4NZC A;  1V55 E;  4R5E A;  1INZ A;  2WLY A;  3UX4 A;  1FKB A;  3JUI A;  3VLE A;  3CHM A;  4PS3 A;  4C48 B;  3IKO B;  4LER A;  1S70 B;  3MKR A;  4ANW A;  2LPV A;  1OCR E;  2PV1 A;  3UKR G;  2NSZ A;  5BXU A;  1ITX A;  1W1Y A;  3Q78 A;  4IN3 B;  1X5B A;  2XGO A;  4NUR A;  1BPO A;  4UI9 J;  4MGV A;  1BI8 B;  1UOH A;  4WNE A;  3CVX A;  1E96 B;  3Q9N C;  4L9P A;  1Q2Z A;  3KAH A;  2EIK E;  4FAD A;  3D9N A;  3I4G A;  1LTX A;  3PUJ A;  3S2A A;  3SFX A;  1E8Y A;  3UKU G;  4N19 A;  1FFQ A;  2WXL A;  4HS2 A;  2XP3 A;  2WMO A;  1ZBW A;  5ITZ F;  2XPY A;  4N5C A;  2ZU6 B;  3LDZ A;  3ARR A;  3O5E A;  1OWM A;  1H6P A;  5G04 J;  5M72 A;  3O5L A;  3ESL A;  3FY1 A;  2R05 A;  2FKE A;  1ZU2 A;  3DSW A;  4K5A B;  1QZ2 A;  4H7Y A;  3PH0 C;  1BU9 A;  3B7U X;  1H0G A;  2XCC A;  5KJM A;  4HBO A;  4WND A;  3OXG A;  4DRP A;  1SYT A;  1N1A A;  2IOL A;  4BX9 A;  4GTS A;  5DO2 A;  3MCX A;  4ODM A;  5D0Q D;  2QF8 A;  4G2V A;  5KNG A;  2LXL A;  4CDR A;  2MLZ A;  2RQS A;  3WD4 A;  3GZS A;  3CGH A;  4GPK A;  3IK8 A;  1XGW A;  1W9V A;  3ARW A;  1UN9 A;  1YCS B;  1PAQ A;  2HR2 A;  3PNL B;  3EIP A;  2KE0 A;  4GZ6 A;  2OV8 A;  1D7J A;  3D9J A;  2XP5 A;  4WJX A;  2LKN A;  1FKL A;  3R9M A;  2XPA A;  4I6E A;  3B7S A;  2YIN A;  3PE4 A;  5C1D A;  3AG3 E;  4BTB A;  2CFU A;  3D9O A;  3Q49 B;  2DZN A;  3QNK A;  4JVS A;  3CHC A;  4YVO A;  3KAC A;  3IKG A;  2DZO A;  1OWN A;  1H6O A;  4Z68 A;  3B9E A;  3UM3 A;  1TEZ A;  4DI3 A;  1Q6H A;  2XZT G;  2G41 A;  4RQI A;  2R17 C;  2GRQ B;  3BMB A;  1N95 A;  1EDU A;  4A63 B;  4HRN A;  1D9S A;  2OEV A;  4YDE A;  4MNK A;  2P9P G;  2A3C A;  2UY1 B;  5J90 A;  2DSU A;  3H9R B;  4IT4 A;  4N5Q A;  4GTR A;  4QT2 A;  3ONL A;  1U3C A;  3I5P A;  3LS8 A;  4UWG A;  4CZ2 D;  1W9P A;  1W1P A;  2F21 A;  4BSX A;  1YW5 A;  2EIM E;  3DBS A;  4K5C A;  1FVH A;  2J08 A;  2KZT B;  3ENE A;  1CTN A;  1W1T A;  5GPR A;  4MAV A;  4J8Y A;  4KVO A;  1FVF A;  3FU0 A;  4HOU A;  2A3E A;  3NI6 A;  2N87 A;  5ENS D;  2L6J A;  3AS4 A;  2DT1 A;  2VSO E;  3IKD A;  1KLX A;  3QWP A;  5HKP A;  1E7U A;  3ARZ A;  4KR0 B;  4GZ3 A;  2BED A;  1X81 A;  4MNL A;  4Z2J A;  4MNM A;  3DEO A;  4EPZ A;  3SQV A;  3SFZ A;  4UQZ A;  4YDY A;  5G55 A;  2YQ8 A;  4WIW A;  4DX1 A;  2KCL A;  4TUM A;  2OFN A;  2F0Y A;  3HRA A;  4IUL A;  3FTZ A;  4G8L A;  4PS8 A;  2IUZ A;  3UXG A;  1WM5 A;  1LD7 A;  2KAT A;  4ACK A;  5EYP F;  2I1K A;  3EHQ A;  3CHR A;  4TW6 A;  1EYM A;  4DRK A;  1N9A A;  4EBA A;  3L17 A;  3KAD A;  4WWO A;  2BTD A;  3AS1 A;  4JZY A;  2WXF A;  4P29 A;  3WIJ A;  2J09 A;  3QAR A;  3ZNG A;  3G2V A;  1E6N A;  3UQB A;  1K1B A;  3OOB A;  4IT6 A;  1J6Y A;  2G8Z A;  3SHF A;  1TN8 A;  3CVU A;  4N3A A;  3RKV A;  3AQU A;  3K9I A;  1AP7 A;  3FTX A;  3TAX A;  2VTB B;  3MGB A;  2X6I A;  1WG0 A;  2VGE A;  4MLP A;  3AJI A;  4OAU C;  3TWT A;  4IRU A;  4EEC A;  1MQS A;  4HOQ A;  2OLH A;  4Z2H A;  5JJ7 A;  2CHZ A;  1OWQ A;  2L0I A;  3IHY A;  2IO2 C;  3U66 A;  4O60 A;  1ZB1 A;  5ENP D;  3I3N A;  4HLL A;  2WXQ A;  4ODP A;  3WD1 A;  3EHM A;  3LKU A;  3EU5 A;  3B13 A;  4XE0 A;  5CEC B;  4ZS6 A;  4LAY A;  2GRL A;  2R2L A;  4NRH B;  1K9T A;  3ONK A;  3TWU A;  2V4H C;  3QK0 A;  2XEE A;  2M2A A;  4BSZ B;  4TUU A;  2RUC A;  5FQ6 A;  2B0O E;  3BG0 B;  2XPB A;  1NSG A;  4TXR A;  4FLB A;  3CEQ A;  3CGN A;  4HQD A;  3EIJ A;  4L72 B;  2BKK B;  1NWT A;  3AG2 E;  2KCV A;  3UIO C;  4Y6C A;  2GRO B;  1MX6 A;  2X6H A;  3L08 A;  2XP9 A;  4HRM B;  1HJX A;  4CGV A;  1UR8 A;  1OGG A;  2WXO A;  2VGY A;  3IXE A;  5GPG A;  3Q75 A;  3HXB A;  2VJ8 A;  2OOE A;  1J4H A; 
#chains in the Genus database with same CATH homology
 1E6R A;  1ELW A;  3CVL A;  1B6C A;  3UI4 A;  4W9R A;  4Q7N A;  3ARS A;  2PPO A;  5E75 A;  3LUO A;  4WKA A;  3QDN A;  3WQV A;  4WKH A;  3PRA A;  3QJZ A;  1SZA A;  4AJW A;  5HUA A;  4E85 A;  3BEE A;  3ARY A;  2ZQU A;  1PC2 A;  4XX5 A;  2YBT A;  4FLH A;  4TYO A;  3KZ7 A;  4J8D A;  2HM8 A;  2LGO A;  4C0E A;  3O4Z A;  3UF8 A;  3R7R A;  3UT4 A;  3O5K A;  1HKK A;  4GMJ A;  4JA9 A;  4Z2G A;  4Q94 A;  2FI7 A;  1W9U A;  4Y6W A;  3QC1 A;  3SD5 A;  1JWF A;  2V8S E;  4U0Z A;  4AP2 A;  4ODR A;  4B94 A;  1EPU A;  3KCE A;  2DCP A;  4L23 A;  4PH4 B;  4TW8 A;  3D9M A;  3TXM A;  3UQ3 A;  4G23 A;  4I9C A;  4FA6 A;  4XAK A;  3ZHE A;  2IQC A;  3CSF A;  1JNS A;  2CG2 A;  3UUX A;  2KC7 A;  4WKF A;  1NWR A;  4HOT A;  2ION A;  3IBE A;  1LL7 A;  5BW8 C;  4I9E A;  1Y8M A;  4A3T A;  2WM9 A;  4HOR A;  3B8S A;  3MZL B;  3SF4 A;  4U84 A;  5T3R A;  4HOS A;  5FQ4 A;  2VCD A;  1D6O A;  4FHK A;  1R9H A;  2A3A A;  5B8I C;  4AVX A;  4JHR A;  1JWG A;  4N39 A;  2IJG X;  1IHG A;  1L1P A;  1P5Q A;  2RUD A;  4G24 A;  1YAT A;  1L5J A;  4ODK A;  3B9D A;  3CVN A;  3LJ3 A;  1T11 A;  1JPL A;  4DRQ A;  3ZGQ A;  4N2Q A;  3CQC B;  4P8X A;  1ZBV A;  2ITK A;  5LCW J;  1GW6 A;  1Z3Y A;  4I2Z A;  4G1T A;  2DT0 A;  4KQZ A;  5FWQ A;  4A1S A;  3UT7 A;  5HBF A;  2JLB A;  4UWK A;  3PNT B;  4N2S A;  2IU1 A;  5HTG A;  2V0P A;  4DT4 A;  4P8V A;  1HE8 A;  1Q6I A;  3KAI A;  1FKR A;  2GGF A;  2PBC A;  2Y78 A;  5J6E A;  4I1M A;  1LL6 A;  4V3I A;  4WWN A;  3PRB A;  2Y4T A;  2PQN A;  5FJY A;  3CST A;  1HXV A;  2FBN A;  1TJF A;  1X6N A;  1FD9 A;  5CMW A;  2HO1 A;  2VGX B;  3FY4 A;  5JH8 A;  4Q96 A;  4RSY A;  4AOF A;  4B89 A;  5FZQ A;  4O6F A;  1EHN A;  3WKZ A;  3FTS A;  3N71 A;  3L54 A;  2V5F A;  3TGO A;  1FJD A;  2JEK A;  3KEZ A;  2Q5A A;  3ZEF A;  5AEN A;  4JW1 A;  4G26 A;  3G2S A;  2PV2 A;  4PUC A;  3RGC A;  3LY8 A;  5DF0 A;  3VLF A;  4ANX A;  1C9H A;  4U07 A;  1IQR A;  1ZB5 A;  3FUK A;  1Y0O A;  3ZPJ A;  1KFW A;  3ART A;  2FDM A;  2WM0 A;  1A17 A;  4XI9 A;  4UWH A;  4TV3 A;  4HXI A;  2XGM A;  5LOZ A;  1H19 A;  2ESC A;  5A7D B;  3RFW A;  1ROT A;  3LY9 A;  4ZPW R;  2WMN A;  2CHW A;  5KJN A;  3ZIM A;  4FC8 A;  2MF9 A;  1VF8 A;  4IQ2 A;  4GZ5 A;  1Z3X A;  4JEH A;  4OYS A;  3HIZ A;  2AXZ A;  4J8S A;  2NXP A;  3HHM A;  3S7B A;  1RD6 A;  5JJ6 A;  3JQ1 A;  3U3W A;  5EX3 A;  2LSV A;  2LO6 A;  4UWL A;  4XKB A;  2L2S A;  4BX8 A;  4D10 C;  3IEG A;  2RG8 A;  2XCB A;  2BUG A;  4YND A;  3CKC A;  4L1B A;  4URK A;  2DSZ A;  4JPS A;  2C2L A;  2XP6 A;  3WD3 A;  2WLZ A;  3JYM A;  2GW1 A;  3FTU A;  3CHO A;  4CDM A;  3GYZ A;  5AJD A;  2R59 A;  1JNE A;  3TJP A;  4AY5 A;  2Q7F A;  1UG3 A;  4W9Q A;  5T4Y A;  1HU3 A;  2XEV A;  4WNG A;  5CCL A;  2XP7 A;  5FQ8 A;  3WD0 A;  2YBU A;  1VDY A;  5J08 A;  2E2E A;  4GZC A;  4HLE A;  4DRN A;  1IQU A;  5EX0 A;  4UQY A;  3UMV A;  4CT0 A;  3LXU X;  3L6A A;  2FUL A;  3TG5 A;  2L0T B;  4F3V A;  4ILG A;  4YVQ C;  4J8E A;  4WUY A;  4W9O A;  2UWJ G;  2X6K A;  3AS0 A;  4FU3 A;  4KZC A;  4ANU A;  5CMY A;  3PEU B;  1FKJ A;  1JVW A;  4MSP A;  2WXH A;  1EDQ A;  3FTW A;  1FKD A;  3ASG A;  2KI3 A;  4I1A A;  2J49 A;  3D9P A;  3JCK C;  3EY6 A;  3SGH A;  3FXY A;  3ALF A;  3TC5 A;  4L7T A;  3GZ1 A;  4ILH B;  3URZ A;  3RRU A;  5HQ8 A;  2NC9 A;  3L16 A;  1E6P A;  3MV3 B;  1HFA A;  2DIW A;  4ODN A;  3OA5 A;  1H6K A;  4L3N A;  4O2T A;  4F7A A;  2DG4 A;  2FEZ A;  4APF A;  2ZQT A;  3I6C A;  4M3O A;  2YHC A;  3VTX A;  3PUK A;  1DVP A;  5A23 A;  1ZK6 A;  2XHE A;  5JHA A;  4W5U A;  5HW8 A;  3R7Q A;  3O5P A;  4PS7 A;  4FHJ A;  4DWS A;  2Y4U A;  2OND A;  2DG3 A;  3D3M A;  1BKF A;  5BPP A;  2OVB A;  4CT4 A;  3VTY A;  2CG3 A;  1BL4 A;  2X38 A;  2ZR4 A;  3CK9 A;  4RVB A;  3KD7 A;  2EQX A;  2ZR5 A;  2I9C A;  1Q1C A;  3FUE A;  3RK6 A;  2AW6 A;  3FFL A;  4DRI A;  4UI9 K;  4ABN A;  2PI6 A;  4AY1 A;  5C2Y A;  2WQH A;  2QY7 A;  3APF A;  4I6J A;  3L13 A;  1NZN A;  1NA3 A;  1H2U A;  1LF8 A;  1SZ9 A;  4N3B A;  1U3D A;  3ODK A;  4AY6 A;  5AIJ A;  2RUQ A;  3CHF A;  4IQC A;  4JFK A;  4NNR A;  4JXT A;  1FKS A;  4U0S A;  3WL1 A;  4QIB A;  2XGS A;  4OVV A;  2BF0 X;  3LPZ A;  2AWI A;  1OWL A;  5DEZ A;  4KXK B;  1FFR A;  1NMV A;  4B0Z A;  3IHZ A;  4GCO A;  2MNT A;  5I98 A;  3FUF A;  3PVL A;  1H0A A;  2XPZ A;  4J6I A;  3CVV A;  4CGW A;  1NWS A;  3MJW A;  3FDH A;  1LG1 A;  2XP8 A;  1E7V A;  2PM6 A;  4IYP A;  2VGX A;  2PL2 A;  2A5U A;  3ZYK A;  3BG1 B;  1ZBK A;  1HX8 A;  1KT0 A;  3CHQ A;  1FKF A;  3ZVV A;  2R5S A;  3IV0 A;  2LJ4 A;  4S3J A;  2M08 A;  4GGQ A;  4DZ2 A;  3JQ0 A;  4ODO A;  3NF1 A;  4JHK A;  3KAF A;  2WB2 A;  4BWR A;  3G2W A;  2O92 A;  1FKK A;  2PQR A;  1U79 A;  3U64 A;  4R7L A;  3TG4 A;  4Z2K A;  4CRW A;  4LRZ A;  4I43 A;  4OVU A;  1ZBP A;  1JND A;  3P1U A;  3MKQ B;  1HS6 A;  3JYJ A;  3CR3 A;  1D7I A;  3D9K A;  1LG2 A;  1E9L A;  4APO A;  1HXI A;  1Z6T A;  4TRQ A;  4AM9 A;  3Q47 B;  3ARQ A;  2CHX A;  3WL0 A;  2DG9 A;  1QPF A;  4MS6 A;  3RM9 A;  2JZV A;  4C02 B;  4LUN U;  1WNO A;  1W1V A;  2J4D A;  2VSX E;  1WAO 1;  4C9B B;  4ML4 A;  1TJC A;  3EDT B;  4J4N A;  3ZXS A;  5BUZ A;  4RG6 A;  3FU3 A;  4KVM A;  1HJV A;  2WXJ A;  5FTP A;  4FUL A;  1UW4 B;  3U9W A;  3FEX A;  4GA0 A;  2X6J A;  3AU4 A;  3O5I A;  3FUH A;  4FJZ A;  3HYM B;  2LNI A;  3B7R L;  2DPE A;  1WB0 A;  4LCT A;  5ARG A;  2LAI A;  4WAF A;  2PPP A;  4P8U A;  1GUV A;  2I1J A;  2FAP A;  3CIA A;  5ENN A;  2WQ6 A;  5G05 C;  1ELK A;  2O9O A;  3FUL A;  4FAP A;  2X6F A;  1H2V C;  4Z2I A;  3SZ7 A;  4ITZ A;  4XZ4 A;  4GML A;  3TDB A;  4XKC A;  2KGJ A;  2MOW A;  3ZW3 A;  5EDS A;  3CVP A;  2KO7 A;  3LCA A;  3LVR E;  3FAP A;  3QOK A;  5EKQ D;  2XPI A;  3OTN A;  3RU0 A;  2QFC A;  4GZD A;  4LAV A;  4G2P A;  3ARP A;  3CHP A;  4A3V A;  2VTB A;  3FUJ A;  2IF4 A;  3SBT B;  2A4Z A;  1O6I A;  5HWC A;  1NWU A;  4FJY A;  4GYW A;  2AVP A;  4J4O A;  3O5J A;  1PY1 A;  3CK8 A;  2DT2 A;  1E90 A;  4NAC A;  2WVI A;  3GW4 A;  2VQ2 A;  3ARO A;  1QQE A;  3T8M A;  2WXN A;  3HDX A;  2RSE A;  3PEV B;  4HAR A;  5HI7 A;  1A7X A;  1NP7 A;  3RRN B;  2AXV A;  1LJY A;  3P2B A;  3UPV A;  4DRH A;  5JJT A;  4MKT A;  4DZ3 A;  5T8I A;  4ZPV R;  3ZFW A;  4QT3 A;  5LX8 A;  3O5R A;  4DWS D;  3KAB A;  3OXF A;  5G04 C;  1IX5 A;  4AIF A;  4DWS B;  2UY1 A;  2AOS A;  4J0U A;  3UI6 A;  2V4L A;  2I6H A;  3G6M A;  3RME A;  1Q6U A;  5FT9 A;  5HW7 A;  2J9Q A;  4I17 A;  4BY6 A;  5AYW D;  4JFM A;  3VAW A;  3HVE B;  4JFJ A;  5HKG A;  3CVW A;  2WXR A;  4GU5 A;  3AS5 A;  1H0I A;  3UQA A;  5BNW A;  3LVQ E;  2DSW A;  1GOI A;  3AS2 A;  5D75 A;  2KR7 A;  4GA1 A;  4DRJ A;  4RG9 A;  4U0U A;  2M63 A;  1D7H A;  3APD A;  4DH0 A;  2IOS A;  2VSY A;  2KZT A;  4U86 A;  3U4T A;  3ALG A;  4DLQ A;  2UZ5 A;  3NZU A;  3O5F A;  2DT3 A;  4ODL A;  3ASF A;  5HWB A;  3AU5 A;  4W9P A;  2XP4 A;  4BTA A;  4F53 A;  1FAP A;  4ZPT R;  1H2T C;  3RJV A;  3D9I A;  3PR9 A;  5LFA A;  5G05 J;  3FU5 A;  4DWS C;  3LYA A;  3NTP A;  4PDX A;  4L2Y A;  4HVB A;  4FN2 A;  3UI5 A;  4LAW A;  5BV0 A;  1TCO C;  3UQI A;  3E4B A;  2ZQV A;  4L2L A;  1HZ4 A;  3KS2 A;  1HG5 A;  1GPF A;  2KCK A;  4GCN A;  1KT1 A;  5HW6 A;  4DIP A;  1ZU8 A;  3ZYQ A;  2GRM A;  3ZN3 A;  4KMO A;  3B7X A;  2Y3A A;  1ZL1 A;  3T5V A;  5HT1 A;  4F1S A;  2MLY A;  1UJJ A;  1FKI A;  5JHB A;  3ESK A;  3ZYL A;  4N3C A;  1W26 A;  1ELR A;  5FQ7 A;  1HKJ A;  4AXH A;  2I2O A;  3ASD A;  2B31 A;  1NA0 A;  4QZV B;  3Q15 A;  1X6L A;  3ARX A;  1UJK A;  4BF8 A;  4E6H A;  3FH5 A;  3HVE A;  3O5M A;  3CQG B;  3MA5 A;  1B89 A;  4J8F A;  2J4B A;  1FKH A;  5DIV A;  1JNT A;  3G2U A;  2D9F A;  2XQ0 A;  3O5D A;  3T5X A;  1F40 A;  1TFV A;  3RO2 A;  5DBK A;  2WXG A;  3FP3 A;  5GQB A;  1EQ3 A;  3FH7 A;  3CK7 A;  1E15 A;  3CGM A;  5CCM A;  3SNX A;  2J07 A;  2E0I A;  3ARV A;  4BT9 A;  3QB2 A;  4ILI A;  3ULQ A;  3PA7 A;  4LGX A;  4TX0 A;  4XI0 A;  1NH6 A;  1HO8 A;  2C0L A;  2WXP A;  4B8A A;  3UT8 A;  4P8W A;  3FEY A;  2P58 C;  2FF4 A;  5ANR A;  1XHG A;  3PE3 A;  4NQ0 A;  1Y6I A;  2WK2 A;  3FUM A;  4G11 A;  2YNQ A;  4UI9 C;  3O5O A;  2RUR A;  2PPN A;  1UN8 A;  2M1I A;  2PV3 A;  1HH8 A;  1EYH A;  4MTV A;  4BT8 A;  4ODQ A;  1LL4 A;  4HFG A;  1EIB A;  3CV0 A;  4KBQ A;  2MLX A;  2KFW A;  4EBA G;  4R0X A;  1FKG A;  4DPR A;  3D9L A;  3MEK A;  4FP7 A;  3QWW A;  3FTV A;  5FZR A;  1M5Y A;  3B9A A;  4GA2 A;  4G25 A;  1OWO A;  1XNF A;  5KJK A;  3CVQ A;  3W4R A;  3ML9 A;  3VLD A;  4LEU A;  3TL5 A;  5ANL A;  1XRV A;  4QFV A;  3Q4A B;  1PIN A;  2LAH A;  4ACL A;  2MHK A;  3PRE A;  4JHJ A;  3PRD A;  4LAX A;  3FH8 A;  4JFI A;  1HKI A;  3PZD A;  3MYV A;  2IFU A;  4WWP A;  1ROU A;  3TCZ A;  1HG2 A;  1ZCN A;  4EZK A;  5BV1 A;  1FKT A;  1E8W A;  5ARF A;  1JUQ A;  2YHE A;  4HBE A;  4JA7 A;  3S7F A;  3GZ2 A;  1HKM A;  3FTY A;  3KAE A;  3NZS A;  2K8I A;  2XRY A;  3EHN A;  3CZ8 A;  3G6L A;  2WXM A;  4CEM A;  2F2D A;  3PS6 A;  1W3B A;  4JL0 A;  4S3K A;  4DI4 A;  2DSV A;  3QWV A;  4I1O B;  1OGB A;  3AS3 A;  4KYO B;  1N54 A;  3FUN A;  4U8H A;  5DIZ A;  4IPX A;  1IYG A;  3C98 A;  1HF8 A;  5FZS A;  1LQ0 A;  3SI5 A;  3EJN A;  3MV2 B;  2X3M A;  4KT6 B;  4C0M A;  3DPD A;  2RD0 A;  4DK5 A;  2VYI A;  3RRM B;  2F4E A;  2PM7 A;  4I2W A;  3CVY A;  4B8C B;  3OAW A;  2L9B A;  3FU6 A;  3FUI A;  1PBK A;  2ZQS A;  3ASH A;  1E8X A;  3ML8 A;  4Q22 A;  4GB9 A;  4JFL A;  3LY7 A;  2MPH A;  4WK9 A;  3B7T A;  3QKY A;  3FUD A;  4H7X A;  3S7J A;  1UR9 A;  5DIT A;  4A55 A;  3WH0 A;  3QOU A;  4BFR A;  1DNP A;  3OXL A;  2VN1 A;  4JYS A;  4WNF A;  5KJL A;  2PZI A;  4MPK A;  4NSB A;  3WQW A;  2WXI A;  1N52 A;  1S0P A;  1NMW A;  3CHD A;  3BXW A;  3G2T A;  1QPL A;  2FO7 A;  3ZHE B;  4K0R A;  4AEZ C;  4EQF A;  1J4R A;  3IHV A;  3MDY B;  3APC A;  4PTM A;  1MHQ A;  2ZR6 A;  3KAG A;  1F8A B;  1YA0 A;  3MKQ A;  4GYO A;  4EZJ A;  2WQ7 A;  3WXX A;  4URI A;  3O48 A;  3NRK A;  3RM4 A;  2LSU A;  1OUV A;  3JXV A;  3RM8 A;  4U63 A;  4A1G A;  2C0M A;  2WPV A;  1J4I A;  1EF1 C;  3I4R B;  3CKB A;  3ARU A;  1WY6 A;  3QAQ A;  3AS8 A;  3SBS A;  4EZL A;  3RIB A;  3CHE A;  2ILR A;  4Z2L A;  4UWF A;  3O5G A;  3Q5M A;  1D2K A;  5G2N A;  2A3B A;  4U04 A;  1E6Z A;  2MRI A;  2HYZ A;  3LEW A;  4TW7 A;  3EIQ C;  3CLJ A;  3CHS A;  4K03 A;  5E76 A;  4CDN A;  4ATG A;  3R9A B;  4XIF A;  5CHE E;  3RO3 A;  4GYY A;  1SR0 A;  1ZBC A;  4GAA A;  3WD2 A;  1WAW A;  3CH9 A;  3L22 A;  5BT1 A;  3ZRH A;  4ME2 A;  3S7D A;  4CCA A;  5DIU A;  4ANV A;  5BXJ A;  2OVF A;  4Q69 A;  4JC8 A;  2DBA A;  4DLO A;  4AV7 A;  3JYS A;  3NQP A;  4G50 A;  1FCH A;  4GIV A;  4JEU A;  3ZYM A;  4U85 A;  4KZ0 A;  2AXU A;  4MRU A;  1OWP A;  3TXN A;  2XRZ A;  4TNS A;  1SQM A;  5D0O D;  5LCW C;  5LP0 A;  2KM4 A;  3GPK A;  1QNF A;  4UQX A;  5AJL A;  4DRM A;  2WXK A;  2AWG A;  4MNJ A;  3FHE A;  2CFZ A;  1HJW A;  1E8Z A;  4I6G A;  3PDN A;  4DRO A;  3FWV A;  3MX3 A;  5A6C A;  3PRZ A;  2VSN A;  5KCM A;  4DJA A;  3O5Q A;  4NZC A;  4R5E A;  1INZ A;  2WLY A;  3UX4 A;  1FKB A;  3JUI A;  3VLE A;  3CHM A;  4PS3 A;  3IKO B;  4LER A;  3MKR A;  4ANW A;  2LPV A;  2PV1 A;  2NSZ A;  1ITX A;  1W1Y A;  4IN3 B;  1X5B A;  2XGO A;  4NUR A;  1BPO A;  4UI9 J;  4MGV A;  4WNE A;  3CVX A;  1E96 B;  3KAH A;  4FAD A;  3D9N A;  3I4G A;  3PUJ A;  3S2A A;  1E8Y A;  4N19 A;  1FFQ A;  2WXL A;  4HS2 A;  2XP3 A;  2WMO A;  1ZBW A;  2XPY A;  4N5C A;  2ZU6 B;  3LDZ A;  3ARR A;  3O5E A;  1OWM A;  5G04 J;  5M72 A;  3O5L A;  3ESL A;  3FY1 A;  2FKE A;  1ZU2 A;  1QZ2 A;  4H7Y A;  3PH0 C;  3B7U X;  1H0G A;  2XCC A;  4HBO A;  5KJM A;  4WND A;  3OXG A;  4DRP A;  1SYT A;  1N1A A;  2IOL A;  4BX9 A;  5DO2 A;  3MCX A;  4ODM A;  5D0Q D;  2QF8 A;  4G2V A;  4CDR A;  2MLZ A;  2RQS A;  3WD4 A;  3GZS A;  3CGH A;  4GPK A;  3IK8 A;  1XGW A;  3ARW A;  1W9V A;  1UN9 A;  1PAQ A;  2HR2 A;  3PNL B;  2KE0 A;  4GZ6 A;  2OV8 A;  1D7J A;  3D9J A;  2XP5 A;  4WJX A;  2LKN A;  1FKL A;  2XPA A;  4I6E A;  3B7S A;  2YIN A;  3PE4 A;  5C1D A;  4JVS A;  4BTB A;  2CFU A;  3D9O A;  3Q49 B;  3QNK A;  3CHC A;  4YVO A;  3KAC A;  3IKG A;  1OWN A;  3B9E A;  1TEZ A;  4DI3 A;  1Q6H A;  2G41 A;  2R17 C;  1EDU A;  4MNK A;  2A3C A;  2UY1 B;  5J90 A;  2DSU A;  3H9R B;  4IT4 A;  4QT2 A;  3ONL A;  1U3C A;  3I5P A;  3LS8 A;  4UWG A;  1W9P A;  1W1P A;  2F21 A;  4BSX A;  1YW5 A;  3DBS A;  1FVH A;  2J08 A;  2KZT B;  3ENE A;  1CTN A;  1W1T A;  5GPR A;  4MAV A;  4KVO A;  1FVF A;  3FU0 A;  4HOU A;  2A3E A;  3NI6 A;  2N87 A;  2L6J A;  3AS4 A;  2DT1 A;  2VSO E;  3IKD A;  1KLX A;  3QWP A;  1E7U A;  3ARZ A;  4KR0 B;  4GZ3 A;  4MNL A;  4Z2J A;  4MNM A;  4EPZ A;  3SFZ A;  4UQZ A;  5G55 A;  2YQ8 A;  4WIW A;  2KCL A;  2OFN A;  4IUL A;  3FTZ A;  4PS8 A;  2IUZ A;  1WM5 A;  2KAT A;  4ACK A;  2I1K A;  3CHR A;  4TW6 A;  1EYM A;  4DRK A;  3L17 A;  4EBA A;  3KAD A;  4WWO A;  2BTD A;  3AS1 A;  4JZY A;  2WXF A;  4P29 A;  3WIJ A;  2J09 A;  3QAR A;  3G2V A;  1E6N A;  3UQB A;  1J6Y A;  3OOB A;  4IT6 A;  2G8Z A;  3SHF A;  3CVU A;  4N3A A;  3RKV A;  3AQU A;  3K9I A;  3FTX A;  3TAX A;  2VTB B;  3MGB A;  2X6I A;  4MLP A;  4IRU A;  4EEC A;  1MQS A;  4HOQ A;  2OLH A;  4Z2H A;  5JJ7 A;  2CHZ A;  1OWQ A;  2L0I A;  3IHY A;  3U66 A;  3I3N A;  2WXQ A;  4ODP A;  3WD1 A;  3EHM A;  3LKU A;  3B13 A;  4XE0 A;  4ZS6 A;  4LAY A;  2GRL A;  4NRH B;  1K9T A;  3ONK A;  3QK0 A;  2M2A A;  4TUU A;  2RUC A;  5FQ6 A;  3BG0 B;  2XPB A;  1NSG A;  4FLB A;  3CEQ A;  3CGN A;  3EIJ A;  4L72 B;  1NWT A;  2KCV A;  4Y6C A;  2X6H A;  3L08 A;  2XP9 A;  1HJX A;  4CGV A;  1UR8 A;  1OGG A;  2WXO A;  2VGY A;  5GPG A;  2VJ8 A;  2OOE A;  1J4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...