1KT1A

Structure of the large fkbp-like protein, fkbp51, involved in steroid receptor complexes
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
394
structure length
374
Chain Sequence
KKDRGVLKIVHGEETPMIGDRVYVHYNGKLANPFVFSIGKGQVIKAWDIGVATMKKGEICHLLCAYGATGSLPKIPSNATLFFEVELLDFKGEDLLEDGGIIRRTKRRGEGYSNPNEGARVQIHLEGRCGGRVFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILHLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYVQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQIFMCQKKAKEHNERDRRTYANMFKKFAEQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein FKBP51
publication title STRUCTURE OF THE LARGE FK506-BINDING PROTEIN FKBP51, AN HSP90-BINDING PROTEIN AND A COMPONENT OF STEROID RECEPTOR COMPLEXES
pubmed doi rcsb
source organism Saimiri boliviensis
molecule tags Isomerase
total genus 108
structure length 374
sequence length 394
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2002-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF00515 TPR_1 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1kt1A03
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1kt1A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1kt1A02
3IHZA 3S7BA 1D7HA 4JL0A 2XP8A 4UQXA 4TNSA 4ME2A 4KBQA 5AYWD 4U0SA 1QPFA 2XP9A 2UY1B 1Y8MA 3JYMA 2PL2A 5HWCA 2YQ8A 4U04A 2GW1A 4JA7A 2BUGA 3MV2B 2HYZA 2FBNA 4GA0A 3MKRA 1JNTA 3NTPA 4DIPA 1EQ3A 3PE3A 3Q15A 1WAO1 2XPAA 2KO7A 4QT3A 3MV3B 4YVOA 2M2AA 1J4RA 2HO1A 4J4OA 2ZQSA 2LGOA 2QFCA 4NQ0A 4GCNA 3TG5A 3O5QA 1ZK6A 3ASDA 2LNIA 3SZ7A 2K8IA 4GGQA 4J0UA 4AY5A 2FAPA 2ONDA 5I98A 3MA5A 4G25A 3PRBA 3TDBA 3IKDA 3ZFWA 3UI6A 1J6YA 3K9IA 2PPNA 2RURA 4UQYA 3RIBA 3LCAA 4IQ2A 3RGCA 3S7DA 1FKLA 2L2SA 2PQRA 3FP3A 4WUYA 3CK9A 2C0MA 2PV1A 5HUAA 3ZHEB 4HOTA 5BXJA 2UWJG 4XI9A 3WXXA 2LPVA 4G2PA 4U0ZA 3TAXA 3CGMA 2XPIA 3NRKA 4I1AA 4ODKA 1HZ4A 3ASHA 3LY7A 3LY9A 4ODPA 4N2SA 4G23A 4JFLA 4DRMA 3OXLA 2XP5A 3EDTB 5KJMA 4ITZA 1ELWA 3KZ7A 3QKYA 4LAWA 3TCZA 3UPVA 4KYOB 3Q5MA 1E96B 4O2TA 2MHKA 1J4HA 3KAGA 5CCMA 2PPPA 2ZR6A 3RO3A 5HW7A 3AS8A 3RJVA 1B6CA 5CHEE 2DG4A 2I6HA 4AY6A 1FKBA 3U3WA 2VGYA 2XP6A 2VSNA 4I17A 4XIFA 2F21A 1YA0A 2IF4A 3E4BA 4XI0A 3O5IA 2XGSA 4JFIA 2FI7A 3HYMB 4DRNA 1A7XA 5DIVA 2PBCA 2UY1A 4N39A 3KD7A 3KCEA 4IQCA 4TX0A 4DRPA 1XNFA 4GZ6A 3RKVA 4DRHA 2RUQA 5A6CA 4GZ3A 1ZCNA 2KE0A 4DRKA 2FF4A 5KJKA 1FKHA 2ZQTA 2M08A 1Q6HA 2ITKA 3MDYB 4A1SA 2KCKA 4DRJA 5ARFA 3KAEA 2XPBA 1FD9A 4AIFA 4TYOA 1QQEA 4U84A 3QOUA 2HR2A 5GPGA 2ZQUA 4G50A 4FN2A 4JFJA 3N71A 1BL4A 4U0UA 2IFUA 3QDNA 1D7IA 1NZNA 4DH0A 4GPKA 4UI9J 3UI4A 3CVPA 3GYZA 3CK7A 1FKFA 4UI9K 1WM5A 3UUXA 1JVWA 1NMVA 3O5OA 3UQAA 1FKTA 2JZVA 3O5RA 1P5QA 4TW6A 1JNSA 3O5JA 4C02B 3ASFA 5EX0A 4N3AA 3I6CA 4BTAA 3QWPA 4CDRA 1ZBPA 1YW5A 3VAWA 1FKSA 2J9QA 3ZHEA 3UQ3A 5FZSA 2XP3A 1KT1A 4GA2A 5G05J 5D75A 2XGMA 4BTBA 4HOSA 3URZA 3EY6A 3FFLA 4QT2A 1QZ2A 2PPOA 1HXVA 3FWVA 3MEKA 4DT4A 4CGVA 2LJ4A 3RO2A 1Q6IA 5JJ7A 3JXVA 4J8EA 4H7XA 2P58C 5BW8C 5DIZA 1KLXA 4U86A 2WQHA 4JFKA 4NNRA 4DRQA 1FKKA 3PE4A 2DG3A 3IEGA 2DG9A 3IKGA 4LAVA 4W9PA 5J6EA 2AVPA 5CCLA 4LAYA 5EX3A 3LYAA 2XEVA 3ESKA 2XP7A 3RU0A 1PC2A 1IHGA 1QPLA 1KT0A 4BT8A 3VTYA 3QWVA 5BNWA 2PQNA 1W3BA 1HH8A 3Q47B 4Y6CA 3WH0A 4IPXA 1Q1CA 5HWBA 2JLBA 4AM9A 3CVNA 1FCHA 1NMWA 3UQIA 3SF4A 1IYGA 4ABNA 1TJCA 2KCLA 3ULQA 3S7JA 3O5DA 1FKDA 2Y4TA 4J8FA 4N3CA 4TW7A 3NF1A 2MNTA 4ODQA 3UQBA 1FKIA 4JHRA 4G2VA 2Q7FA 4GYOA 4BWRA 3IK8A 2XGOA 1PBKA 2N87A 1B89A 5D0QD 1J4IA 1NSGA 4ODMA 5G04J 1C9HA 1FKGA 2LSUA 4Y6WA 4WNDA 4YVQC 3B7XA 2V5FA 1ELRA 3KADA 4H7YA 4UQZA 3BEEA 5FT9A 5KJNA 3TGOA 4I9CA 4N2QA 5DIUA 3KS2A 2M1IA 1ROTA 4R0XA 3CVQA 1FAPA 2F4EA 4ODNA 2PV3A 4QIBA 1F40A 4WNEA 5LCWJ 5EKQD 3GPKA 5FTPA 2WPVA 3O5LA 3UI5A 3ZN3A 5ARGA 1TCOC 3Q4AB 2FO7A 4U07A 5KJLA 3O5EA 4J8DA 4G26A 3KAIA 3LUOA 5M72A 3CGNA 5BT1A 3O48A 4O6FA 3KABA 3O5GA 3CVLA 1F8AB 1W26A 2DBAA 3JYSA 3PDNA 5G05C 3O5KA 1PINA 2UZ5A 3CKBA 2C0LA 3OXGA 4DZ2A 2ZR5A 5HKGA 4LAXA 3ZGQA 3VTXA 3ASGA 1Y0OA 2C2LA 4RG6A 5FZRA 1M5YA 4BF8A 4RG9A 4U85A 1OUVA 2F2DA 4W9QA 1T11A 5FZQA 2VGXB 4JA9A 3H9RB 4BT9A 3CK8A 4JFMA 1D7JA 2VQ2A 2Q5AA 4I2ZA 3O5FA 3TG4A 3AS5A 4MSPA 3TC5A 2KCVA 4HORA 3CKCA 3Q49B 4JYSA 4KXKB 2XCCA 3KACA 2KGJA 5HW8A 2KI3A 4N19A 4WNGA 1ZU2A 4GYYA 4HOQA 3O5PA 5JJTA 2LKNA 2KFWA 1D6OA 5DITA 5C1DA 4WNFA 3U4TA 3LKUA 2VYIA 4J4NA 3CEQA 3QWWA 1U79A 2MLXA 3RFWA 1L1PA 3PA7A 1FKJA 4GZ5A 4GA1A 1BKFA 4TW8A 5D0OD 2YHCA 2RQSA 4MGVA 4F3VA 2D9FA 2R5SA 2FEZA 4G1TA 5JJ6A 1HXIA 4ODLA 4HOUA 2MF9A 4ODOA 1R9HA 4W9OA 4I2WA 3S7FA 4N3BA 3GZ2A 4YNDA 3ZPJA 2VSYA 5HW6A 1FJDA 1YATA 2RSEA 1NA0A 5G04C 5A7DB 5HTGA 5DBKA 4GCOA 1ROUA 1N1AA 4G24A 2ZR4A 4I9EA 5HI7A 4GIVA 1FKRA 5HT1A 4DZ3A 4N5CA 3GW4A 2VN1A 2XP4A 4DRIA 4IN3B 2E2EA 4ODRA 5FJYA 5HQ8A 4B94A 2MPHA 2PZIA 2FKEA 5LCWC 3CV0A 2RUCA 3NI6A 4UI9C 2ZQVA 3FAPA 2LSVA 1EYMA 4DROA 4EQFA 2XCBA 3ODKA 2KR7A 2L6JA 3GZ1A 4W9RA 4CGWA 4FAPA 4GYWA 2OFNA 2OOEA 3R9AB 3LPZA 2AWGA 1NA3A 4NRHB 4APOA 2PV2A 2VGXA 1Q6UA 2RUDA 2MLYA 3JYJA 2Y78A 3KAFA 2NC9A 3OXFA 3AS4A 4LEUA 3OOBA 2Y4UA 2KATA 3UF8A 2MLZA 5B8IC 2KC7A 3LY8A 3KAHA 2VCDA 1A17A 3O5MA 3PRDA
chains in the Genus database with same CATH superfamily
3IHZA 3ENEA 2LAHA 1JWFA 4TNSA 4ME2A 4ATZD 4LNGA 4B8CB 4IT6A 2XP9A 2YINA 3PUJA 4NACA 5ENPD 3FY1A 3MKQB 1FVHA 3FH8A 3JUEA 3ARZA 3CVWA 4MNMA 5HWCA 3FTZA 3CVXA 1H0AA 4KZCA 3DEOA 1O1SA 2BUGA 4HBOA 4GA0A 5AN8A 5C2YA 2OLHA 1K1AA 3NTPA 2P9LG 3MV3B 4HRNA 3T8KA 2LGOA 5HRYA 4HFGA 4NQ0A 3J5QB 4HB5A 3AG3E 4JEHA 1ZK6A 2K8IA 4DUIA 1DVPA 4Q7NA 4J0UA 3NQPA 2ONDA 4ACLA 1Z5SC 3ZFWA 5EIDA 4A3TA 2PPNA 1K3ZD 2XHEA 3JQ1A 4IQ2A 4F53A 5ANRA 3RGCA 4FLHA 1D8EA 4DK5A 2C0MA 2PV1A 4PS8A 2V5QC 3ML9A 2AJAA 3TAXA 3CGMA 2XPIA 3NRKA 4ODKA 1HZ4A 3ASHA 3ARSA 3LY7A 4DRXE 3RSEG 4HRMB 3V2OA 2IJGX 4DRMA 3FY4A 2BF0X 5KJMA 3ISMC 4LAWA 4Z2KA 5AQ9A 1N0QA 1J4HA 3KAGA 3RO3A 4LCTA 3SBTB 1UJKA 4IULA 4OYSA 4AY6A 3CSTA 4HLLA 5CRUA 2XP6A 1YA0A 3E4BA 4EHMA 3O5IA 2FI7A 3HYMB 2FO1E 3CHDA 2PBCA 2YBUA 4N39A 3KCEA 4GZ3A 3C72A 3D9MA 3ARWA 4EBAG 4K5AB 2M08A 1Q6HA 3UT7A 5ARFA 3TWRA 3PREA 4MPKA 3D9PA 4U84A 1EF1C 1FT2A 2HR2A 2JEKA 1UR8A 4GTPA 3RRUA 2L0IA 1N94A 1MJ0A 4JFJA 1ZBCA 4WK9A 2OVFA 4Q94A 4U0UA 4DWSA 3CQGB 3E37A 5JA4D 3UUXA 1JVWA 1FKTA 2JZVA 3RMEA 3Q75A 1BD8A 1P5QA 4TW6A 4F7AA 5BXUA 1V54E 2DT3A 3ASFA 1FVFA 4BTAA 1S70B 1LG2A 4XKCA 3ZU7B 2RFAA 3WKZA 2F8YA 2XRYA 4U96D 2XP3A 3AROA 1GOIA 4PTMA 1TYQG 4HOSA 3URZA 3EY6A 4PH4B 3MZLB 3DXKG 4U8YD 3B95A 3MEKA 3HXDA 3UIOC 3NZSA 4KZ0A 1RD6A 5G2NA 4H7XA 5DIZA 1KLXA 3AG2E 5AARA 4JFKA 3FXYA 1NWTA 1S63A 2P2CP 2WQ6A 3PE4A 2QYJA 3IEGA 2DG3A 3IKGA 4LAVA 2J07A 2P9PG 5CCLA 3LYAA 2PM7A 3CVVA 3ESKA 1E7VA 4P29A 4ANXA 1XRVA 3VTYA 3QWVA 3PEVB 3DSVA 2WLZA 1W3BA 3UM0A 1TN8A 2I2OA 1H6KA 2BKKB 4G8LA 2B31A 3EIQC 4BY6A 2P9UG 4HXIA 1HG5A 2PM6A 3NAWA 3O5DA 3JCKC 3L9TA 4N3CA 4M7CA 3NF1A 4WAFA 4ODQA 3ONLA 2DPEA 2KZTA 2WXGA 1W1PA 3EHQA 1K8KG 1PY1A 4G2VA 5G55A 4R5EA 4GYOA 3ZEFA 3IK8A 2XGOA 2N87A 3ALFA 2V0PA 2B6CA 4ODMA 1SVXA 3R7RA 4JC8A 2IU1A 1FKGA 3FUHA 4YVQC 3B7XA 4UWKA 1JNEA 3RM9A 4Z2HA 1ZBVA 3APFA 3SQVA 2JABA 5KJNA 1H2TC 2QYUA 3AAAC 4I9CA 4BETA 2WXPA 3U64A 3AU5A 4AJWA 3BUAA 3ZYMA 1SR0A 5EKQD 5JHAA 4HI9A 3O5LA 3UI5A 1SA5A 5EYLA 5ARGA 5KJLA 4UWGA 2CHZA 2DCPA 1GW6A 5M72A 3O48A 3BG0B 4DX7D 1E8ZA 3D9IA 3JYSA 3ARVA 4UUCA 4F1PA 5G05C 4G8KA 3O5KA 4JXTA 3LVRE 3OXGA 4PUCA 4L3NA 3VTXA 3CHEA 4BF8A 1KPSB 3AG4E 3IKOB 2F2DA 4NSBA 3QAQA 4JA9A 4AOFA 2VQ2A 3ZYKA 4GMLA 4L7TA 3TG4A 1W9VA 2XS1A 2KCVA 4L2YA 1OXJA 3L22A 3AU4A 3FUDA 1Q2ZA 1GRJA 4O1PA 5LX8A 4TV3A 2R05A 1ZU2A 4GYYA 4UWLA 3O5PA 3ZYLA 5JJTA 1BU9A 2RG8A 2AOSA 2GRLA 2IQCA 5AQAA 1LJYA 2R59A 4F1SA 3IV0A 3LKUA 2MLXA 3FUJA 3RFWA 4LNBA 2R17C 1FKJA 1BKFA 5AIJA 2YHCA 1N52A 4FJZA 4QQIA 3W9GA 2J4DA 3DPYA 5JJ6A 4ODOA 4I2WA 4I6GA 3GZ2A 4YNDA 1OGBA 5ENSD 2LXLA 4X8QA 4ATGA 3WL0A 5ITZF 2J09A 1NA0A 4K03A 5DBKA 4GCOA 1N1AA 2ZR4A 4ANWA 2WVIA 4QZVB 2DVWA 3CGHA 5HT1A 1JUQA 3LDZA 2VN1A 4DRIA 4LUNU 4IN3B 2I1JA 3F6QA 2L6BA 2GRPB 3ABKE 2B0OE 1ELKA 2RUCA 4FHJA 3CQCB 4DROA 2EIJE 3ODKA 2L6JA 1X5BA 3E30A 1HO8A 1MX4A 1S64A 2WK2A 4GYWA 2OFNA 4OVUA 3R9AB 4NRHB 2PV2A 2RUDA 3JYJA 2AWIA 1N4SA 4DJAA 4GB9A 3TWSA 2NC9A 3LEWA 5GQBA 3UF8A 2MLZA 1WY6A 3LY8A 1A17A 4DZ3A 3B7UX 1IQRA 2WXMA 1MX6A 3PH0C 3VLDA 3TL5A 4KBQA 4P8WA 5ENQD 1OWPA 2UY1B 4DX2A 2EQXA 3JYMA 4PS7A 2PL2A 5JH8A 5D66A 3FUEA 4NIKA 3UKRG 4U04A 5EILA 3WQVA 3CZ8A 4JA7A 3MV2B 2I1KA 1V55E 1ZB5A 1IXVA 4DX1A 4C48B 2L0TB 5FQ6A 1HX8A 3Q15A 1WAO1 2XPAA 2KO7A 2Y0BG 4YVOA 3HVEB 2EIKE 5T3RA 2OVBA 3U9WA 1N0RA 3O5QA 3MGBA 3Q73A 3ASDA 4GGQA 4AY5A 2FAPA 3B8SA 1EHNA 3ABLE 4G25A 3ARPA 3WD4A 3TDBA 4KVOA 4FC8A 4UQYA 3S7DA 1FKLA 3FUIA 3CK9A 2CG3A 2YBTA 3E34A 3Q78A 1MX2A 4G11A 3EHNA 3IHYA 2F8XK 3G2VA 3P1UA 3RAUA 3EU5A 3TWUA 3W9FA 4ILHB 3WD3A 3T8MA 4G23A 3SFYA 1EPUA 1HF8A 3DSWA 3GZSA 2XPZA 3EDTB 3TXNA 3G2TA 3QKYA 1INZA 3TCZA 2XEEA 1TJFA 3Q5MA 2DYSE 4O2TA 2MHKA 3PNLB 5CCMA 4GTVA 5HW7A 3PS6A 2I6HA 3B9DA 4CDMA 4ANVA 3L16A 4I17A 4XIFA 4AP2A 1RW2A 1HJXA 1NWSA 1MQSA 4GTMA 1E6PA 3RM4A 4FA6A 1NWUA 2M63A 4IQCA 3MKQA 4BESA 4GZ6A 3RKVA 2KM4A 1LG1A 1WG0A 1ZCNA 4DRKA 2PI6A 1FKHA 3NZUA 3SO8A 2H6FA 2BKGA 3KAEA 2XPBA 4URIA 5KWDA 3IHVA 1QQEA 4GTSA 4TYOA 5GPGA 3ABME 1LL7A 2DT0A 3C3RA 1BL4A 2IFUA 2NYJA 4ANUA 2WMOA 4DH0A 3UI4A 3FTWA 1DCQA 3GYZA 2LUHA 1E8WA 2Y3AA 3CK7A 1FKFA 1E15A 4U8VD 2A3AA 2ETNA 3PZ3A 4ZFHA 3O5RA 1OY3D 2X6IA 1MHQA 1GUVA 4C02B 4GTQA 4N3AA 4HQDA 3SBSA 3HG0D 4A63B 3HXFA 1K1BA 1ZBPA 1YW5A 1UN9A 2J9QA 2YNQA 5A23A 3UQ3A 3RM8A 2XGMA 3VLFA 4DI4A 3DEPA 3C98A 4QT2A 1QZ2A 4YDOA 3TWWA 4WKAA 4JB8P 1JCSA 1Q6IA 2H6IA 1N4PA 4J8EA 5CERB 3MJWA 4U86A 2VTBB 2G8ZA 2WQHA 3V79K 3PR9A 4ILGA 3FUMA 4NNRA 2GRNB 4W9PA 2AVPA 2XEVA 3D3MA 1PC2A 4FU3A 3L82A 3LVQE 4DLOA 5BNWA 4AEZC 3WIJA 1H2UA 3KEAA 4AM9A 3FTVA 1S0PA 3BG1B 1LD8A 3G6LA 3O4ZA 4N5QA 1IYGA 3ARQA 2KCLA 3ULQA 3S7JA 3R7QA 1FKDA 2Y4TA 1QNFA 4TW7A 3PVLA 3UQBA 1EYHA 2Y69E 4ZPTR 4BWRA 1OGGA 3PZ2A 1PBKA 2GROB 3OA5A 4MTVA 1B89A 1J4IA 5IY5E 4KMOA 1HKIA 2R02A 5G04J 3R9MA 4WWPA 2CFZA 1ELRA 3EJNA 4H7YA 5H7PA 5FT9A 4UWFA 3CHQA 4TUMA 3KS2A 2M1IA 4TXQA 3TXMA 1ROTA 3CVQA 1MZCA 2CHWA 2LXMA 1TNBA 4Q69A 1H6PA 2ZISA 1E9LA 5AQ7A 2DIWA 5J08A 1KZPA 3DBSA 1TCOC 3Q4AB 2FO7A 2RFMA 5EYPF 3CHSA 4GU5A 3Q7AA 4RLYA 1IQUA 3LUOA 4UDMA 3CGNA 5BT1A 3KABA 3O5GA 2DBAA 4Z2IA 1NWRA 4HARA 4YDEA 4S3JA 3QB2A 2UZ5A 4Q22A 2C0LA 4DZ2A 2ZR5A 3ZGQA 1DNPA 3ASGA 1M5YA 4U85A 1LL4A 4W9QA 5FZQA 3H9RB 4BT9A 4JFMA 2Q5AA 4I2ZA 4MSPA 3SI5A 2R03A 4HORA 2X38A 3D9LA 3KACA 3FU0A 3BQOA 1L5JA 2KGJA 4V3IA 4U63A 2KI3A 4N19A 3TWQA 2H6HA 4I1OB 3AS3A 4HOQA 4L2LA 2OCCE 2L9BA 1D6OA 5C1DA 4BFRA 2VYIA 4J4NA 3QWWA 1N4RA 3PA7A 4GZ5A 1VF8A 1DC2A 4MGVA 1ZU8A 4F3VA 4G1TA 4FULA 4CEMA 4ODLA 4JHJA 2MF9A 5CMWA 4W9OA 1OWNA 1R9HA 2VSYA 4XKBA 3CHCA 4ILIA 3L08A 5HW6A 4C9BB 2WXOA 4F6RD 2RSEA 5A7DB 3UINC 1ROUA 4G24A 3UKUG 5CEDB 5HI7A 4ACKA 5ENRD 3UM1A 5CBOA 2J4BA 4GIVA 4EPZA 3ML8A 2X6JA 1O1TA 3JXIA 5EIBE 4GZDA 2XP4A 4Z68A 3FU5A 2E2EA 4ODRA 4B89A 3T9KA 3QJZA 2MPHA 2AXZA 5LCWC 3ZRHA 3CV0A 2RKKA 3PRZA 4P8UA 4UI9C 3AS2A 2ZQVA 2LSVA 2IEJA 3GTYX 4URKA 1EYMA 2KBXA 3DSSA 4MBGA 4GTOA 1ZB1A 2KR7A 5KBAA 3GZ1A 4W9RA 3ASNE 2OOEA 5AENA 1AWCB 1E6ZA 2DT2A 2AWGA 1TNUA 5KCMA 1EIBA 2MLYA 2OV8A 2DSWA 1ZBKA 3OXFA 4LEUA 5CECB 3FEYA 5T4YA 4EECA 1OCOE 2ETCA 3AQUA 5B8IC 3KAHA 5FQ8A 3PRDA 3S7BA 2X6FA 2ETBA 4UQXA 4FP7A 4HLEA 3D9OA 3WL1A 2X6HA 1QPFA 4LSZE 3DRAA 5J90A 4BX9A 1FPPA 4I6JA 4K5CA 2BEDA 3NOCD 2YQ8A 2A4ZA 4MKTA 2ESCA 4HI8A 5HS0A 2FBNA 3MKRA 4E85A 4TUUA 3ARTA 4MRUA 4GMJA 4QT3A 4JHKA 2IOSA 2DZNA 1J4RA 2QFCA 1IKND 1LD7A 3HRAA 2QF8A 4MAVA 1JCRA 2KXPC 4ZHBA 2LNIA 3SZ7A 3UX4A 5I98A 2V8SE 5GPRA 3MYVA 3UI6A 1E8XA 2IUZA 1J6YA 2WXHA 3K9IA 1WAWA 3ZVVA 4HBEA 2RURA 5FWQA 3CHOA 3LCAA 5AAOA 4U95D 5BV1A 3FP3A 1O6IA 5HUAA 4JW1A 3ZHEB 1PAQA 1H19A 4HOTA 2UWJG 4XI9A 3WXXA 2LPVA 2F37A 4G2PA 1D2KA 1TFVA 2FULA 4LNUD 4JEUA 3LY9A 3BXWA 4JFLA 4A55A 3OXLA 3EUVA 3KZ7A 4BEPA 4HRLA 2NXPA 3B7SA 1HKKA 5CBNA 1E96B 4JPSA 2VSOE 2PPPA 3RJVA 5EN5D 5CHEE 2DG4A 3U3WA 2F21A 2F23A 4J7WA 4JFIA 1OWOA 5FINA 2MRIA 4PS3A 3G6MA 2UY1A 3KD7A 3CHRA 4W5UA 2ZXWE 3ZUVB 5KJKA 3U66A 4XX5A 3MDYB 2WXRA 4A1SA 2KCKA 1UG3A 4CDNA 1FD9A 3V31A 4AIFA 1SA4A 4IYPA 1E8YA 4WWNA 4G50A 4FN2A 1Z6TA 1W1VA 3ESLA 4OAUC 3HVEA 2X3MA 3KSQA 4I1MA 2P9SG 2ETAA 4UI9J 3UM2A 2QY7A 4CZ2D 1WM5A 1HU3A 1NMVA 3UQAA 3KSLA 2WXIA 2DZOA 3Q9UC 3UT8A 2P9KG 5EX0A 3I6CA 1U3DA 4AY1A 5EDSA 1FKSA 1XGWA 1U3CA 2DYRE 4K5BA 1KT1A 4R7LA 4C0MA 5G05J 1WB0A 5D75A 4RSYA 1X81A 3FH7A 2OEWA 2B5UB 3FFLA 3B7RL 2HM8A 1EDUA 1N4QA 1JCHB 1HXVA 1H0GA 3FWVA 5CMYA 4CGVA 3B7BA 1RZ4A 3ONKA 5KNHD 5JJ7A 3QOKA 2P58C 2A3EA 5BW8C 1TN6A 3UI2A 1DCEA 2DG9A 4APFA 3WG7E 4LAYA 5EX3A 2XP7A 3RU0A 5JMND 1IHGA 1QPLA 1KT0A 4BT8A 4DI3A 1HH8A 4K0RA 3E33A 4Y6CA 4B0ZA 3ARUA 4CT0A 4BSZB 1Q1CA 3WH0A 5HWBA 5E76A 5LFAA 1EDQA 1FCHA 4WJXA 1NP7A 1UJJA 2CHXA 4FLBA 5BV0A 3SF4A 4ABNA 2LAIA 4L72B 1YYHA 4J8YA 3X2QE 4J8FA 2ZU6B 2MNTA 2J8SD 3W4RA 4FADA 1FKIA 4JHRA 2Q7FA 3MCXA 3HHMA 3C5RA 1JNDA 5D0QD 3Q79A 1NSGA 1C9HA 2VSXE 3SHFA 4WNDA 2OEVA 1OWQA 2V5FA 3KADA 4GPMA 2A3CA 3BEEA 4PDXA 4HVBA 2WXFA 3L54A 5DIUA 3RK6A 4P8XA 3PNTB 3TJPA 4UWHA 2F4EA 2WMNA 3CH9A 1JWGA 3FEXA 4U8HA 5FIOA 4I43A 5AJLA 2ILRA 3I4GA 5ENTD 4ML4A 2AW6A 3IXEA 4CCAA 1A5EA 4WIWA 2V4HC 5DO2A 4U07A 4G26A 4JD2G 3KAIA 5JHBA 3DSTA 3CVLA 3SY2A 4O60A 3JUIA 3PDNA 2EILE 3VLEA 4GTRA 3SD5A 3CKBA 2VTBA 3FTYA 5HKGA 1W9UA 4LAXA 1Y0OA 2C2LA 4LRZA 4RG9A 1TNYA 2A5EA 1OUVA 3FH5A 3S2AA 3T5XA 4EBAA 2VGXB 3CK8A 3I3NA 1H6OA 4Z2GA 3D9HA 3TC5A 4RVBA 1W9PA 3V30A 3CKCA 3Q49B 4JYSA 1LF8A 3AJIA 4MNKA 3LJNA 5HW8A 3HIZA 3DSUA 2ZGGA 4WNGA 1UOHA 4KQZA 5B1BE 3FTXA 1IX5A 5AQBA 5DITA 3ZKJA 1LTXA 3CEQA 3FDHA 3B13A 1L1PA 2J08A 4GA1A 1D9SA 2A3BA 5CEAA 5D0OD 4TW8A 3UIPC 2RQSA 2IOLA 1IHBA 3L13A 1BLXB 2D9FA 4LG6A 1OCZE 1UW4B 5ANLA 4DPRA 1ZL1A 1BI8B 2FEZA 3FTSA 3ARXA 1HXIA 4N3BA 4ZS6A 4BERA 4Z2LA 1NFIE 5HBFA 4EZJA 4DWSC 1YATA 3APDA 1FT1A 2ZIRA 4MNLA 4GMRA 2GRRB 4IRUA 4DX6D 3EHMA 1JCQA 3GW4A 3ULYA 4J6IA 2WQ7A 1TNOA 5HQ8A 4AVXA 3WD1A 3QNKA 3HXCA 4MLPA 1D8DA 4Z2JA 4YDWA 3UTMA 1E6RA 3FU6A 2AXUA 1OT8A 2V4LA 4S3KA 3FHEA 4CGWA 3AS1A 3FU3A 3LPZA 2XZTG 5KNGA 4APOA 2O9OA 3ZYQA 3G2SA 2Y78A 3KAFA 1TEZA 2IY0C 2KC7A 2WXJA 3J5PA 4OAVB 1D7HA 4JL0A 2XP8A 3QARA 4CRWA 5BUZA 3FUNA 2G41A 4U7EB 5AYWD 4U0SA 3ZW3A 3UM3A 1Y8MA 4AXHA 4BSXA 1TN7A 4ZPVR 3Q9NC 2GW1A 1U2VG 3LXUX 2HYZA 3AG1E 1X6NA 1QYMA 3I4RB 1LL6A 1JNTA 1G3NB 3JXJA 4DIPA 1EQ3A 1Z3XA 3PE3A 1Z3YA 2GRMA 4TRQA 5B1AE 4CT4A 2M2AA 1W1YA 2HO1A 3DXMG 4J4OA 2WXKA 4NURA 4O1OA 2ZQSA 4DWSB 4GCNA 3TG5A 2XQ0A 1YCSB 2NSZA 3PEUB 4E6HA 3MA5A 3PRBA 3IKDA 3CVYA 3CLJA 2YHEA 1AP7A 2WXQA 4EZLA 1UR9A 3RIBA 4HS2A 2L2SA 2PQRA 3P2BA 2CFUA 2ZGDA 4WUYA 4D10C 4EZKA 2GGFA 4I6EA 3MX3A 5BXJA 2O92A 4U0ZA 3HXBA 4I1AA 3CR3A 3DWLG 2AXVA 3WD2A 4ODPA 4N2SA 3DSXA 3ULEG 4M3OA 1KZOA 2XP5A 3APCA 4ITZA 5BXOA 1ELWA 3L17A 3UPVA 4KYOB 1HS6A 2DWZA 3FUFA 3PZ1A 1W1TA 4XEIG 1KFWA 2ZR6A 4WKHA 3AS8A 1B6CA 2F0YA 1FKBA 4QFVA 3SGHA 4TXPA 1O1RA 2VGYA 2BTDA 3OTNA 2VSNA 3V2XA 2IF4A 4XI0A 2XGSA 3FULA 4DRNA 1A7XA 5DIVA 4AV7A 4Q96A 4TX0A 4DRPA 1XNFA 4DRHA 1HKJA 5A6CA 2RUQA 2KE0A 3CHFA 1JPLA 2FF4A 3PZDA 3G2UA 2ZQTA 2ITKA 4KVMA 5E75A 2VJ8A 4DRJA 3CHMA 1SW6A 1Y6IA 3QOUA 2XZDG 4GTTA 1CTNA 2ZQUA 2KZTB 4XAKA 3N71A 3C3OA 3QDNA 1SQMA 1D7IA 1NZNA 4GPKA 4LGXA 3CVPA 4UI9K 1YMPA 3B9EA 3O5OA 4B8AA 2WB2A 2EINE 4JZYA 4JVSA 3EHRA 2XRZA 5T8IA 1JNSA 3O5JA 4HNAD 1NI1A 4DX5D 3QWPA 1NL4A 4CDRA 3VAWA 1GPFA 1E44A 1FFQA 3ZHEA 4NZCA 5FZSA 3CHPA 4GA2A 1UN8A 1HG2A 4BTBA 1ZBWA 5CRVA 2PPOA 4DT4A 3QK0A 2LJ4A 3RO2A 2E0IA 2FDMA 2WM9A 4A3VA 3JXVA 3NBNB 3TWTA 3BU8A 2WLYA 3UT4A 1LQ0A 1TR4A 1ITXA 4DRQA 2MOWA 1X6LA 3B7TA 3SNXA 1FKKA 2P4VA 5J6EA 5BPPA 1SZ9A 2XPYA 5ENOD 3ZNGA 3PUKA 2X6KA 2P9IG 1QBQA 2GRQB 4C0EA 1NH6A 4CYMD 1H0IA 2PQNA 3Q47B 2VGEA 3UMVA 2PN0A 4IPXA 2JLBA 3CVNA 5HKPA 1HKMA 1OWMA 3CVUA 1NMWA 3UQIA 2XENA 1TJCA 2DSUA 4A1GA 2A5UA 2CG2A 2P9NG 5ENNA 3EIJA 3I5PA 4KR0B 3WQWA 4RQIA 4GZCA 4WKFA 3ZXPA 3WD0A 2EIME 1E6NA 3UXGA 3HDXA 2LSUA 4Y6WA 1OCCE 5LP0A 5FQ7A 1WDYA 4L9PA 4UQZA 4KT6B 3TGOA 4GAAA 4N2QA 2XS8A 3ALGA 4R0XA 1FAPA 4ZPWR 4ODNA 4P8VA 2PV3A 4QIBA 1F40A 4WNEA 5LCWJ 3IBEA 3GPKA 5FTPA 2WPVA 3ZN3A 1N54A 4B93B 2I9CA 3O5EA 4LERA 2Y1LE 3LS8A 4J8DA 4YDYA 5B3SE 5D2MC 3RRNB 4O6FA 3D9JA 3TWXA 2EULA 1W26A 1F8AB 4DLQA 2MYOA 3FUKA 1PINA 2HE0A 3Q7FA 3ZIMA 3TWVA 1OWLA 3SFXA 3PZ4A 4FHKA 4RG6A 5FZRA 3QC1A 1E7UA 1T11A 5LOZA 4OVVA 1MYOA 1D7JA 4DWSD 2PNNA 4TXRA 3O5FA 2WXLA 3AS5A 1N9AA 4FJYA 1E90A 3E32A 4KXKB 2XCCA 3SFZA 2QC9A 5DF0A 3OAWA 2DSVA 2LO6A 4J8SA 3BMBA 1HJVA 1N11A 5FQ4A 1VDYA 3B9AA 2IO3C 2IONA 2LKNA 1FFRA 2KFWA 1TNZA 4WWOA 3ZXSA 3GU0A 3CIAA 3L6AA 4WNFA 3U4TA 1H2VC 3EU9A 4MNJA 2RD0A 1SYTA 1U79A 1O5MA 1OCRE 3D9NA 2WM0A 4XZ4A 1K9TA 4XE0A 3D9KA 3G2WA 2R5SA 2DSZA 1WNOA 4IT4A 2H6GA 1SZAA 4HOUA 3S7FA 2J49A 3ZPJA 1BPOA 3C3QA 1FJDA 3CSFA 3DPDA 5G04C 5HTGA 5AJDA 3ARYA 4I9EA 3KEZA 2XEHA 3HXEA 1FKRA 1BI7B 3EIPA 4N5CA 2WXNA 3ASOE 3PRAA 1HJWA 2DT1A 5FJYA 4BX8A 1HE8A 4B94A 2PZIA 2FKEA 3NI6A 3FTUA 3FAPA 4HBDA 1HFAA 4EQFA 3NOGD 1N95A 2XCBA 4L23A 3AS0A 4FAPA 3JQ0A 5DEZA 4L1BA 1NA3A 2IO2C 2VGXA 1Q6UA 1XHGA 4MS6A 3T5VA 3NB2A 2QZAA 3AS4A 3OOBA 2Y4UA 2KATA 3LJ3A 3RRMB 3ARRA 2VCDA 2R2LA 3O5MA
chains in the Genus database with same CATH topology
3IHZA 3ENEA 2LAHA 1JWFA 4TNSA 4ME2A 4B8CB 4IT6A 2XP9A 2YINA 3PUJA 4NACA 3FY1A 3MKQB 1FVHA 3FH8A 3ARZA 3CVWA 4MNMA 5HWCA 3FTZA 3CVXA 1H0AA 4KZCA 2BUGA 4HBOA 4GA0A 5C2YA 2OLHA 3NTPA 3MV3B 2LGOA 4HFGA 4NQ0A 4JEHA 1ZK6A 2K8IA 1DVPA 4Q7NA 4J0UA 3NQPA 2ONDA 4ACLA 3ZFWA 4A3TA 2PPNA 2XHEA 3JQ1A 4IQ2A 4F53A 5ANRA 3RGCA 4FLHA 4DK5A 2C0MA 2PV1A 4PS8A 3ML9A 3TAXA 3CGMA 2XPIA 3NRKA 4ODKA 1HZ4A 3ASHA 3ARSA 3LY7A 2IJGX 4DRMA 3FY4A 2BF0X 5KJMA 4LAWA 4Z2KA 1J4HA 3KAGA 3RO3A 4LCTA 3SBTB 1UJKA 4IULA 4OYSA 4AY6A 3CSTA 2XP6A 1YA0A 3E4BA 3O5IA 2FI7A 3HYMB 3CHDA 2PBCA 2YBUA 4N39A 3KCEA 4GZ3A 3D9MA 3ARWA 4EBAG 2M08A 1Q6HA 3UT7A 5ARFA 3PREA 4MPKA 3D9PA 4U84A 1EF1C 2HR2A 2JEKA 1UR8A 3RRUA 2L0IA 4JFJA 1ZBCA 4WK9A 2OVFA 4Q94A 4U0UA 4DWSA 3CQGB 3UUXA 1JVWA 1FKTA 2JZVA 3RMEA 1P5QA 4TW6A 4F7AA 2DT3A 3ASFA 1FVFA 4BTAA 1LG2A 4XKCA 3WKZA 2XRYA 2XP3A 3AROA 1GOIA 4PTMA 4HOSA 3URZA 3EY6A 4PH4B 3MZLB 3MEKA 3NZSA 4KZ0A 1RD6A 5G2NA 4H7XA 5DIZA 1KLXA 4JFKA 3FXYA 1NWTA 2WQ6A 3PE4A 2DG3A 3IEGA 3IKGA 4LAVA 2J07A 5CCLA 3LYAA 2PM7A 3CVVA 3ESKA 1E7VA 4P29A 4ANXA 1XRVA 3VTYA 3QWVA 3PEVB 2WLZA 1W3BA 2I2OA 1H6KA 2B31A 3EIQC 4BY6A 4HXIA 1HG5A 2PM6A 3O5DA 3JCKC 4N3CA 3NF1A 4WAFA 4ODQA 3ONLA 2DPEA 2KZTA 2WXGA 1W1PA 1PY1A 4G2VA 5G55A 4R5EA 4GYOA 3ZEFA 3IK8A 2XGOA 2N87A 3ALFA 2V0PA 4ODMA 3R7RA 4JC8A 2IU1A 1FKGA 3FUHA 4YVQC 3B7XA 4UWKA 1JNEA 3RM9A 4Z2HA 1ZBVA 3APFA 5KJNA 1H2TC 4I9CA 2WXPA 3U64A 3AU5A 4AJWA 3ZYMA 1SR0A 5EKQD 5JHAA 3O5LA 3UI5A 5ARGA 5KJLA 4UWGA 2CHZA 2DCPA 1GW6A 5M72A 3O48A 3BG0B 1E8ZA 3D9IA 3JYSA 3ARVA 5G05C 3O5KA 4JXTA 3LVRE 3OXGA 4PUCA 4L3NA 3VTXA 3CHEA 4BF8A 3IKOB 2F2DA 4NSBA 3QAQA 4JA9A 4AOFA 2VQ2A 3ZYKA 4GMLA 4L7TA 3TG4A 1W9VA 2KCVA 4L2YA 3L22A 3AU4A 3FUDA 5LX8A 4TV3A 1ZU2A 4GYYA 4UWLA 3O5PA 3ZYLA 5JJTA 2RG8A 2AOSA 2GRLA 2IQCA 1LJYA 2R59A 4F1SA 3IV0A 3LKUA 2MLXA 3FUJA 3RFWA 2R17C 1FKJA 1BKFA 5AIJA 2YHCA 1N52A 4FJZA 2J4DA 5JJ6A 4ODOA 4I2WA 4I6GA 3GZ2A 4YNDA 1OGBA 4ATGA 3WL0A 2J09A 1NA0A 4K03A 5DBKA 4GCOA 1N1AA 2ZR4A 4ANWA 2WVIA 4QZVB 3CGHA 5HT1A 1JUQA 3LDZA 2VN1A 4DRIA 4LUNU 4IN3B 2I1JA 1ELKA 2RUCA 4FHJA 3CQCB 4DROA 3ODKA 2L6JA 1X5BA 1HO8A 2WK2A 4GYWA 2OFNA 4OVUA 3R9AB 4NRHB 2PV2A 2RUDA 3JYJA 2AWIA 4DJAA 4GB9A 2NC9A 3LEWA 5GQBA 3UF8A 2MLZA 1WY6A 3LY8A 1A17A 4DZ3A 3B7UX 1IQRA 2WXMA 3PH0C 3VLDA 3TL5A 4KBQA 4P8WA 1OWPA 2UY1B 2EQXA 3JYMA 4PS7A 2PL2A 5JH8A 3FUEA 4U04A 3WQVA 3CZ8A 4JA7A 3MV2B 2I1KA 1ZB5A 2L0TB 5FQ6A 1HX8A 3Q15A 1WAO1 2XPAA 2KO7A 4YVOA 3HVEB 5T3RA 2OVBA 3U9WA 3O5QA 3MGBA 3ASDA 4GGQA 3B8SA 4AY5A 2FAPA 1EHNA 4G25A 3WD4A 3ARPA 3TDBA 4KVOA 4FC8A 4UQYA 3S7DA 1FKLA 3FUIA 3CK9A 2CG3A 2YBTA 4G11A 3EHNA 3IHYA 3G2VA 3P1UA 4ILHB 3WD3A 3T8MA 4G23A 1EPUA 1HF8A 3GZSA 2XPZA 3EDTB 3TXNA 3G2TA 3QKYA 1INZA 3TCZA 1TJFA 3Q5MA 4O2TA 2MHKA 3PNLB 5CCMA 5HW7A 3PS6A 2I6HA 3B9DA 4CDMA 4ANVA 3L16A 4I17A 4XIFA 4AP2A 1HJXA 1NWSA 1MQSA 1E6PA 3RM4A 4FA6A 1NWUA 2M63A 4IQCA 3MKQA 4GZ6A 3RKVA 2KM4A 1LG1A 1ZCNA 4DRKA 2PI6A 1FKHA 3NZUA 3KAEA 2XPBA 4URIA 3IHVA 1QQEA 4TYOA 5GPGA 1LL7A 2DT0A 1BL4A 2IFUA 4ANUA 2WMOA 4DH0A 3UI4A 3FTWA 3GYZA 2Y3AA 1E8WA 3CK7A 1FKFA 1E15A 2A3AA 3O5RA 2X6IA 1MHQA 1GUVA 4C02B 4N3AA 3SBSA 1ZBPA 1YW5A 1UN9A 2J9QA 2YNQA 5A23A 3UQ3A 3RM8A 2XGMA 3VLFA 4DI4A 3C98A 4QT2A 1QZ2A 4WKAA 1Q6IA 4J8EA 3MJWA 4U86A 2VTBB 2G8ZA 2WQHA 3PR9A 4ILGA 3FUMA 4NNRA 4W9PA 2AVPA 2XEVA 3D3MA 1PC2A 4FU3A 3LVQE 4DLOA 5BNWA 4AEZC 3WIJA 1H2UA 4AM9A 3FTVA 1S0PA 3BG1B 3G6LA 3O4ZA 1IYGA 3ARQA 2KCLA 3ULQA 3S7JA 3R7QA 1FKDA 2Y4TA 1QNFA 4TW7A 3PVLA 3UQBA 1EYHA 4ZPTR 4BWRA 1OGGA 1PBKA 3OA5A 4MTVA 1B89A 1J4IA 4KMOA 1HKIA 5G04J 4WWPA 2CFZA 1ELRA 3EJNA 4H7YA 5FT9A 4UWFA 3CHQA 3KS2A 2M1IA 3TXMA 1ROTA 3CVQA 2CHWA 4Q69A 1E9LA 2DIWA 5J08A 3DBSA 1TCOC 3Q4AB 2FO7A 3CHSA 4GU5A 1IQUA 3LUOA 3CGNA 5BT1A 3KABA 3O5GA 2DBAA 4Z2IA 1NWRA 4HARA 4S3JA 3QB2A 2UZ5A 4Q22A 2C0LA 4DZ2A 2ZR5A 3ZGQA 1DNPA 3ASGA 1M5YA 4U85A 1LL4A 4W9QA 5FZQA 3H9RB 4BT9A 4JFMA 2Q5AA 4I2ZA 4MSPA 3SI5A 4HORA 2X38A 3D9LA 3KACA 3FU0A 1L5JA 2KGJA 4V3IA 4U63A 2KI3A 4N19A 4I1OB 3AS3A 4HOQA 4L2LA 2L9BA 1D6OA 5C1DA 4BFRA 2VYIA 4J4NA 3QWWA 3PA7A 4GZ5A 1VF8A 4MGVA 1ZU8A 4F3VA 4G1TA 4FULA 4CEMA 4ODLA 4JHJA 2MF9A 5CMWA 4W9OA 1OWNA 1R9HA 2VSYA 4XKBA 3CHCA 4ILIA 3L08A 5HW6A 4C9BB 2WXOA 2RSEA 5A7DB 1ROUA 4G24A 5HI7A 4ACKA 2J4BA 4GIVA 4EPZA 3ML8A 2X6JA 4GZDA 2XP4A 3FU5A 2E2EA 4ODRA 4B89A 3QJZA 2MPHA 2AXZA 5LCWC 3ZRHA 3CV0A 3PRZA 4P8UA 4UI9C 3AS2A 2ZQVA 2LSVA 4URKA 1EYMA 2KR7A 3GZ1A 4W9RA 2DT2A 2OOEA 5AENA 1E6ZA 2AWGA 5KCMA 1EIBA 2MLYA 2OV8A 2DSWA 1ZBKA 3OXFA 4LEUA 3FEYA 5T4YA 4EECA 3AQUA 5B8IC 3KAHA 5FQ8A 3PRDA 3S7BA 2X6FA 4UQXA 4FP7A 4HLEA 3D9OA 3WL1A 2X6HA 1QPFA 5J90A 4BX9A 4I6JA 2YQ8A 2A4ZA 4MKTA 2ESCA 2FBNA 3MKRA 4E85A 4TUUA 3ARTA 4MRUA 4GMJA 4QT3A 4JHKA 2IOSA 1J4RA 2QFCA 2QF8A 4MAVA 2LNIA 3SZ7A 3UX4A 5I98A 2V8SE 5GPRA 3MYVA 3UI6A 1E8XA 2IUZA 1J6YA 2WXHA 3K9IA 1WAWA 3ZVVA 4HBEA 2RURA 5FWQA 3CHOA 3LCAA 5BV1A 3FP3A 1O6IA 5HUAA 4JW1A 3ZHEB 1PAQA 1H19A 4HOTA 2UWJG 4XI9A 3WXXA 2LPVA 4G2PA 1D2KA 1TFVA 2FULA 4JEUA 3LY9A 3BXWA 4JFLA 4A55A 3OXLA 3KZ7A 2NXPA 3B7SA 1HKKA 1E96B 4JPSA 2VSOE 2PPPA 3RJVA 5CHEE 2DG4A 3U3WA 2F21A 4JFIA 1OWOA 2MRIA 4PS3A 3G6MA 2UY1A 3KD7A 3CHRA 4W5UA 5KJKA 3U66A 4XX5A 3MDYB 2WXRA 4A1SA 2KCKA 1UG3A 4CDNA 1FD9A 4AIFA 4IYPA 1E8YA 4WWNA 4G50A 4FN2A 1Z6TA 1W1VA 3ESLA 3HVEA 2X3MA 4I1MA 4UI9J 2QY7A 1WM5A 1HU3A 1NMVA 3UQAA 2WXIA 3UT8A 5EX0A 3I6CA 1U3DA 4AY1A 5EDSA 1FKSA 1XGWA 1U3CA 1KT1A 4R7LA 4C0MA 5G05J 1WB0A 5D75A 4RSYA 3FH7A 3FFLA 3B7RL 2HM8A 1EDUA 1HXVA 1H0GA 3FWVA 5CMYA 4CGVA 3ONKA 5JJ7A 3QOKA 2P58C 2A3EA 5BW8C 2DG9A 4APFA 4LAYA 5EX3A 2XP7A 3RU0A 1IHGA 1QPLA 1KT0A 4BT8A 4DI3A 1HH8A 4K0RA 4Y6CA 4B0ZA 3ARUA 4CT0A 1Q1CA 3WH0A 5HWBA 5E76A 5LFAA 1EDQA 1FCHA 4WJXA 1NP7A 1UJJA 2CHXA 4FLBA 5BV0A 3SF4A 4ABNA 2LAIA 4L72B 4J8FA 2ZU6B 2MNTA 3W4RA 4FADA 1FKIA 4JHRA 2Q7FA 3MCXA 3HHMA 1JNDA 5D0QD 1NSGA 1C9HA 2VSXE 3SHFA 4WNDA 1OWQA 2V5FA 3KADA 2A3CA 3BEEA 4PDXA 4HVBA 2WXFA 3L54A 5DIUA 3RK6A 4P8XA 3PNTB 3TJPA 4UWHA 2F4EA 2WMNA 3CH9A 1JWGA 3FEXA 4U8HA 4I43A 5AJLA 2ILRA 3I4GA 4ML4A 2AW6A 4CCAA 4WIWA 5DO2A 4U07A 4G26A 3KAIA 5JHBA 3CVLA 3JUIA 3PDNA 3VLEA 3SD5A 3CKBA 2VTBA 3FTYA 5HKGA 1W9UA 4LAXA 1Y0OA 2C2LA 4LRZA 4RG9A 1OUVA 3FH5A 3S2AA 3T5XA 4EBAA 2VGXB 3CK8A 3I3NA 4Z2GA 3TC5A 4RVBA 1W9PA 3CKCA 3Q49B 4JYSA 1LF8A 4MNKA 5HW8A 3HIZA 4WNGA 4KQZA 3FTXA 1IX5A 5DITA 3CEQA 3FDHA 3B13A 1L1PA 2J08A 4GA1A 2A3BA 4TW8A 5D0OD 2RQSA 2IOLA 3L13A 2D9FA 1UW4B 5ANLA 4DPRA 1ZL1A 2FEZA 3FTSA 3ARXA 1HXIA 4N3BA 4ZS6A 4Z2LA 5HBFA 4EZJA 4DWSC 1YATA 3APDA 4MNLA 4IRUA 3EHMA 3GW4A 4J6IA 2WQ7A 5HQ8A 4AVXA 3WD1A 3QNKA 4MLPA 4Z2JA 1E6RA 3FU6A 2AXUA 2V4LA 4S3KA 3FHEA 4CGWA 3AS1A 3FU3A 3LPZA 4APOA 2O9OA 3ZYQA 3G2SA 2Y78A 3KAFA 1TEZA 2KC7A 2WXJA 1D7HA 4JL0A 2XP8A 3QARA 4CRWA 5BUZA 3FUNA 2G41A 5AYWD 4U0SA 3ZW3A 1Y8MA 4AXHA 4BSXA 4ZPVR 2GW1A 3LXUX 2HYZA 1X6NA 3I4RB 1LL6A 1JNTA 4DIPA 1EQ3A 1Z3XA 3PE3A 1Z3YA 2GRMA 4TRQA 4CT4A 2M2AA 1W1YA 2HO1A 4J4OA 2WXKA 4NURA 2ZQSA 4DWSB 4GCNA 3TG5A 2XQ0A 2NSZA 3PEUB 4E6HA 3MA5A 3PRBA 3IKDA 3CVYA 3CLJA 2YHEA 2WXQA 4EZLA 1UR9A 3RIBA 4HS2A 2L2SA 2PQRA 3P2BA 2CFUA 4WUYA 4D10C 4EZKA 2GGFA 4I6EA 3MX3A 5BXJA 2O92A 4U0ZA 4I1AA 3CR3A 2AXVA 3WD2A 4ODPA 4N2SA 4M3OA 2XP5A 3APCA 4ITZA 1ELWA 3L17A 3UPVA 4KYOB 1HS6A 3FUFA 1W1TA 1KFWA 2ZR6A 4WKHA 3AS8A 1B6CA 1FKBA 4QFVA 3SGHA 2VGYA 2BTDA 3OTNA 2VSNA 2IF4A 4XI0A 2XGSA 3FULA 4DRNA 1A7XA 5DIVA 4AV7A 4Q96A 4TX0A 4DRPA 1XNFA 4DRHA 1HKJA 5A6CA 2RUQA 2KE0A 3CHFA 1JPLA 2FF4A 3PZDA 3G2UA 2ZQTA 2ITKA 4KVMA 5E75A 2VJ8A 4DRJA 3CHMA 1Y6IA 3QOUA 1CTNA 2ZQUA 2KZTB 4XAKA 3N71A 3QDNA 1SQMA 1D7IA 1NZNA 4GPKA 4LGXA 3CVPA 4UI9K 3B9EA 3O5OA 4B8AA 2WB2A 4JZYA 4JVSA 2XRZA 5T8IA 1JNSA 3O5JA 3QWPA 4CDRA 3VAWA 1GPFA 1FFQA 3ZHEA 4NZCA 5FZSA 3CHPA 4GA2A 1UN8A 1HG2A 4BTBA 1ZBWA 2PPOA 4DT4A 3QK0A 2LJ4A 3RO2A 2E0IA 2FDMA 2WM9A 4A3VA 3JXVA 2WLYA 3UT4A 1LQ0A 1ITXA 4DRQA 2MOWA 1X6LA 3B7TA 3SNXA 1FKKA 5J6EA 5BPPA 1SZ9A 2XPYA 3PUKA 2X6KA 4C0EA 1NH6A 1H0IA 2PQNA 3Q47B 3UMVA 4IPXA 2JLBA 3CVNA 1HKMA 1OWMA 3CVUA 1NMWA 3UQIA 1TJCA 2DSUA 4A1GA 2A5UA 2CG2A 5ENNA 3EIJA 3I5PA 4KR0B 3WQWA 4GZCA 4WKFA 3WD0A 1E6NA 3HDXA 2LSUA 4Y6WA 5LP0A 5FQ7A 4UQZA 4KT6B 3TGOA 4GAAA 4N2QA 3ALGA 4R0XA 1FAPA 4ZPWR 4ODNA 4P8VA 2PV3A 4QIBA 1F40A 4WNEA 5LCWJ 3IBEA 3GPKA 5FTPA 2WPVA 3ZN3A 1N54A 2I9CA 3O5EA 4LERA 3LS8A 4J8DA 3RRNB 4O6FA 3D9JA 1W26A 1F8AB 4DLQA 3FUKA 1PINA 3ZIMA 1OWLA 4FHKA 4RG6A 5FZRA 3QC1A 1E7UA 1T11A 5LOZA 4OVVA 1D7JA 4DWSD 3O5FA 2WXLA 3AS5A 4FJYA 1E90A 4KXKB 2XCCA 3SFZA 5DF0A 3OAWA 2DSVA 2LO6A 4J8SA 1HJVA 5FQ4A 1VDYA 3B9AA 2IONA 2LKNA 1FFRA 2KFWA 4WWOA 3ZXSA 3CIAA 3L6AA 4WNFA 3U4TA 1H2VC 4MNJA 2RD0A 1SYTA 1U79A 3D9NA 2WM0A 4XZ4A 1K9TA 4XE0A 3D9KA 3G2WA 2R5SA 2DSZA 1WNOA 4IT4A 1SZAA 4HOUA 3S7FA 2J49A 3ZPJA 1BPOA 1FJDA 3CSFA 3DPDA 5G04C 5HTGA 5AJDA 3ARYA 4I9EA 3KEZA 1FKRA 4N5CA 2WXNA 3PRAA 1HJWA 2DT1A 5FJYA 4BX8A 1HE8A 4B94A 2PZIA 2FKEA 3NI6A 3FTUA 3FAPA 1HFAA 4EQFA 2XCBA 4L23A 3AS0A 4FAPA 3JQ0A 5DEZA 4L1BA 1NA3A 2VGXA 1Q6UA 1XHGA 4MS6A 3T5VA 3AS4A 3OOBA 2Y4UA 2KATA 3LJ3A 3RRMB 3ARRA 2VCDA 3O5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IHZ A;  3S7B A;  1D7H A;  4JL0 A;  2XP8 A;  4UQX A;  4TNS A;  4ME2 A;  4KBQ A;  5AYW D;  4U0S A;  1QPF A;  2XP9 A;  2UY1 B;  1Y8M A;  3JYM A;  2PL2 A;  5HWC A;  2YQ8 A;  4U04 A;  2GW1 A;  4JA7 A;  2BUG A;  3MV2 B;  2HYZ A;  2FBN A;  4GA0 A;  3MKR A;  1JNT A;  3NTP A;  4DIP A;  1EQ3 A;  3PE3 A;  3Q15 A;  1WAO 1;  2XPA A;  2KO7 A;  4QT3 A;  3MV3 B;  4YVO A;  2M2A A;  1J4R A;  2HO1 A;  4J4O A;  2ZQS A;  2LGO A;  2QFC A;  4NQ0 A;  4GCN A;  3TG5 A;  3O5Q A;  1ZK6 A;  3ASD A;  2LNI A;  3SZ7 A;  2K8I A;  4GGQ A;  4J0U A;  4AY5 A;  2FAP A;  2OND A;  5I98 A;  3MA5 A;  4G25 A;  3PRB A;  3TDB A;  3IKD A;  3ZFW A;  3UI6 A;  1J6Y A;  3K9I A;  2PPN A;  2RUR A;  4UQY A;  3RIB A;  3LCA A;  4IQ2 A;  3RGC A;  3S7D A;  1FKL A;  2L2S A;  2PQR A;  3FP3 A;  4WUY A;  3CK9 A;  2C0M A;  2PV1 A;  5HUA A;  3ZHE B;  4HOT A;  5BXJ A;  2UWJ G;  4XI9 A;  3WXX A;  2LPV A;  4G2P A;  4U0Z A;  3TAX A;  3CGM A;  2XPI A;  3NRK A;  4I1A A;  4ODK A;  1HZ4 A;  3ASH A;  3LY7 A;  3LY9 A;  4ODP A;  4N2S A;  4G23 A;  4JFL A;  4DRM A;  3OXL A;  2XP5 A;  3EDT B;  5KJM A;  4ITZ A;  1ELW A;  3KZ7 A;  3QKY A;  4LAW A;  3TCZ A;  3UPV A;  4KYO B;  3Q5M A;  1E96 B;  4O2T A;  2MHK A;  1J4H A;  3KAG A;  5CCM A;  2PPP A;  2ZR6 A;  3RO3 A;  5HW7 A;  3AS8 A;  3RJV A;  1B6C A;  5CHE E;  2DG4 A;  2I6H A;  4AY6 A;  1FKB A;  3U3W A;  2VGY A;  2XP6 A;  2VSN A;  4I17 A;  4XIF A;  2F21 A;  1YA0 A;  2IF4 A;  3E4B A;  4XI0 A;  3O5I A;  2XGS A;  4JFI A;  2FI7 A;  3HYM B;  4DRN A;  1A7X A;  5DIV A;  2PBC A;  2UY1 A;  4N39 A;  3KD7 A;  3KCE A;  4IQC A;  4TX0 A;  4DRP A;  1XNF A;  4GZ6 A;  3RKV A;  4DRH A;  2RUQ A;  5A6C A;  4GZ3 A;  1ZCN A;  2KE0 A;  4DRK A;  2FF4 A;  5KJK A;  1FKH A;  2ZQT A;  2M08 A;  1Q6H A;  2ITK A;  3MDY B;  4A1S A;  2KCK A;  4DRJ A;  5ARF A;  3KAE A;  2XPB A;  1FD9 A;  4AIF A;  4TYO A;  1QQE A;  4U84 A;  3QOU A;  2HR2 A;  5GPG A;  2ZQU A;  4G50 A;  4FN2 A;  4JFJ A;  3N71 A;  1BL4 A;  4U0U A;  2IFU A;  3QDN A;  1D7I A;  1NZN A;  4DH0 A;  4GPK A;  4UI9 J;  3UI4 A;  3CVP A;  3GYZ A;  3CK7 A;  1FKF A;  4UI9 K;  1WM5 A;  3UUX A;  1JVW A;  1NMV A;  3O5O A;  3UQA A;  1FKT A;  2JZV A;  3O5R A;  1P5Q A;  4TW6 A;  1JNS A;  3O5J A;  4C02 B;  3ASF A;  5EX0 A;  4N3A A;  3I6C A;  4BTA A;  3QWP A;  4CDR A;  1ZBP A;  1YW5 A;  3VAW A;  1FKS A;  2J9Q A;  3ZHE A;  3UQ3 A;  5FZS A;  2XP3 A;  1KT1 A;  4GA2 A;  5G05 J;  5D75 A;  2XGM A;  4BTB A;  4HOS A;  3URZ A;  3EY6 A;  3FFL A;  4QT2 A;  1QZ2 A;  2PPO A;  1HXV A;  3FWV A;  3MEK A;  4DT4 A;  4CGV A;  2LJ4 A;  3RO2 A;  1Q6I A;  5JJ7 A;  3JXV A;  4J8E A;  4H7X A;  2P58 C;  5BW8 C;  5DIZ A;  1KLX A;  4U86 A;  2WQH A;  4JFK A;  4NNR A;  4DRQ A;  1FKK A;  3PE4 A;  2DG3 A;  3IEG A;  2DG9 A;  3IKG A;  4LAV A;  4W9P A;  5J6E A;  2AVP A;  5CCL A;  4LAY A;  5EX3 A;  3LYA A;  2XEV A;  3ESK A;  2XP7 A;  3RU0 A;  1PC2 A;  1IHG A;  1QPL A;  1KT0 A;  4BT8 A;  3VTY A;  3QWV A;  5BNW A;  2PQN A;  1W3B A;  1HH8 A;  3Q47 B;  4Y6C A;  3WH0 A;  4IPX A;  1Q1C A;  5HWB A;  2JLB A;  4AM9 A;  3CVN A;  1FCH A;  1NMW A;  3UQI A;  3SF4 A;  1IYG A;  4ABN A;  1TJC A;  2KCL A;  3ULQ A;  3S7J A;  3O5D A;  1FKD A;  2Y4T A;  4J8F A;  4N3C A;  4TW7 A;  3NF1 A;  2MNT A;  4ODQ A;  3UQB A;  1FKI A;  4JHR A;  4G2V A;  2Q7F A;  4GYO A;  4BWR A;  3IK8 A;  2XGO A;  1PBK A;  2N87 A;  1B89 A;  5D0Q D;  1J4I A;  1NSG A;  4ODM A;  5G04 J;  1C9H A;  1FKG A;  2LSU A;  4Y6W A;  4WND A;  4YVQ C;  3B7X A;  2V5F A;  1ELR A;  3KAD A;  4H7Y A;  4UQZ A;  3BEE A;  5FT9 A;  5KJN A;  3TGO A;  4I9C A;  4N2Q A;  5DIU A;  3KS2 A;  2M1I A;  1ROT A;  4R0X A;  3CVQ A;  1FAP A;  2F4E A;  4ODN A;  2PV3 A;  4QIB A;  1F40 A;  4WNE A;  5LCW J;  5EKQ D;  3GPK A;  5FTP A;  2WPV A;  3O5L A;  3UI5 A;  3ZN3 A;  5ARG A;  1TCO C;  3Q4A B;  2FO7 A;  4U07 A;  5KJL A;  3O5E A;  4J8D A;  4G26 A;  3KAI A;  3LUO A;  5M72 A;  3CGN A;  5BT1 A;  3O48 A;  4O6F A;  3KAB A;  3O5G A;  3CVL A;  1F8A B;  1W26 A;  2DBA A;  3JYS A;  3PDN A;  5G05 C;  3O5K A;  1PIN A;  2UZ5 A;  3CKB A;  2C0L A;  3OXG A;  4DZ2 A;  2ZR5 A;  5HKG A;  4LAX A;  3ZGQ A;  3VTX A;  3ASG A;  1Y0O A;  2C2L A;  4RG6 A;  5FZR A;  1M5Y A;  4BF8 A;  4RG9 A;  4U85 A;  1OUV A;  2F2D A;  4W9Q A;  1T11 A;  5FZQ A;  2VGX B;  4JA9 A;  3H9R B;  4BT9 A;  3CK8 A;  4JFM A;  1D7J A;  2VQ2 A;  2Q5A A;  4I2Z A;  3O5F A;  3TG4 A;  3AS5 A;  4MSP A;  3TC5 A;  2KCV A;  4HOR A;  3CKC A;  3Q49 B;  4JYS A;  4KXK B;  2XCC A;  3KAC A;  2KGJ A;  5HW8 A;  2KI3 A;  4N19 A;  4WNG A;  1ZU2 A;  4GYY A;  4HOQ A;  3O5P A;  5JJT A;  2LKN A;  2KFW A;  1D6O A;  5DIT A;  5C1D A;  4WNF A;  3U4T A;  3LKU A;  2VYI A;  4J4N A;  3CEQ A;  3QWW A;  1U79 A;  2MLX A;  3RFW A;  1L1P A;  3PA7 A;  1FKJ A;  4GZ5 A;  4GA1 A;  1BKF A;  4TW8 A;  5D0O D;  2YHC A;  2RQS A;  4MGV A;  4F3V A;  2D9F A;  2R5S A;  2FEZ A;  4G1T A;  5JJ6 A;  1HXI A;  4ODL A;  4HOU A;  2MF9 A;  4ODO A;  1R9H A;  4W9O A;  4I2W A;  3S7F A;  4N3B A;  3GZ2 A;  4YND A;  3ZPJ A;  2VSY A;  5HW6 A;  1FJD A;  1YAT A;  2RSE A;  1NA0 A;  5G04 C;  5A7D B;  5HTG A;  5DBK A;  4GCO A;  1ROU A;  1N1A A;  4G24 A;  2ZR4 A;  4I9E A;  5HI7 A;  4GIV A;  1FKR A;  5HT1 A;  4DZ3 A;  4N5C A;  3GW4 A;  2VN1 A;  2XP4 A;  4DRI A;  4IN3 B;  2E2E A;  4ODR A;  5FJY A;  5HQ8 A;  4B94 A;  2MPH A;  2PZI A;  2FKE A;  5LCW C;  3CV0 A;  2RUC A;  3NI6 A;  4UI9 C;  2ZQV A;  3FAP A;  2LSV A;  1EYM A;  4DRO A;  4EQF A;  2XCB A;  3ODK A;  2KR7 A;  2L6J A;  3GZ1 A;  4W9R A;  4CGW A;  4FAP A;  4GYW A;  2OFN A;  2OOE A;  3R9A B;  3LPZ A;  2AWG A;  1NA3 A;  4NRH B;  4APO A;  2PV2 A;  2VGX A;  1Q6U A;  2RUD A;  2MLY A;  3JYJ A;  2Y78 A;  3KAF A;  2NC9 A;  3OXF A;  3AS4 A;  4LEU A;  3OOB A;  2Y4U A;  2KAT A;  3UF8 A;  2MLZ A;  5B8I C;  2KC7 A;  3LY8 A;  3KAH A;  2VCD A;  1A17 A;  3O5M A;  3PRD A; 
#chains in the Genus database with same CATH topology
 3IHZ A;  3ENE A;  2LAH A;  1JWF A;  4TNS A;  4ME2 A;  4ATZ D;  4LNG A;  4B8C B;  4IT6 A;  2XP9 A;  2YIN A;  3PUJ A;  4NAC A;  5ENP D;  3FY1 A;  3MKQ B;  1FVH A;  3FH8 A;  3JUE A;  3ARZ A;  3CVW A;  4MNM A;  5HWC A;  3FTZ A;  3CVX A;  1H0A A;  4KZC A;  3DEO A;  1O1S A;  2BUG A;  4HBO A;  4GA0 A;  5AN8 A;  5C2Y A;  2OLH A;  1K1A A;  3NTP A;  2P9L G;  3MV3 B;  4HRN A;  3T8K A;  2LGO A;  5HRY A;  4HFG A;  4NQ0 A;  3J5Q B;  4HB5 A;  3AG3 E;  4JEH A;  1ZK6 A;  2K8I A;  4DUI A;  1DVP A;  4Q7N A;  4J0U A;  3NQP A;  2OND A;  4ACL A;  1Z5S C;  3ZFW A;  5EID A;  4A3T A;  2PPN A;  1K3Z D;  2XHE A;  3JQ1 A;  4IQ2 A;  4F53 A;  5ANR A;  3RGC A;  4FLH A;  1D8E A;  4DK5 A;  2C0M A;  2PV1 A;  4PS8 A;  2V5Q C;  3ML9 A;  2AJA A;  3TAX A;  3CGM A;  2XPI A;  3NRK A;  4ODK A;  1HZ4 A;  3ASH A;  3ARS A;  3LY7 A;  4DRX E;  3RSE G;  4HRM B;  3V2O A;  2IJG X;  4DRM A;  3FY4 A;  2BF0 X;  5KJM A;  3ISM C;  4LAW A;  4Z2K A;  5AQ9 A;  1N0Q A;  1J4H A;  3KAG A;  3RO3 A;  4LCT A;  3SBT B;  1UJK A;  4IUL A;  4OYS A;  4AY6 A;  3CST A;  4HLL A;  5CRU A;  2XP6 A;  1YA0 A;  3E4B A;  4EHM A;  3O5I A;  2FI7 A;  3HYM B;  2FO1 E;  3CHD A;  2PBC A;  2YBU A;  4N39 A;  3KCE A;  4GZ3 A;  3C72 A;  3D9M A;  3ARW A;  4EBA G;  4K5A B;  2M08 A;  1Q6H A;  3UT7 A;  5ARF A;  3TWR A;  3PRE A;  4MPK A;  3D9P A;  4U84 A;  1EF1 C;  1FT2 A;  2HR2 A;  2JEK A;  1UR8 A;  4GTP A;  3RRU A;  2L0I A;  1N94 A;  1MJ0 A;  4JFJ A;  1ZBC A;  4WK9 A;  2OVF A;  4Q94 A;  4U0U A;  4DWS A;  3CQG B;  3E37 A;  5JA4 D;  3UUX A;  1JVW A;  1FKT A;  2JZV A;  3RME A;  3Q75 A;  1BD8 A;  1P5Q A;  4TW6 A;  4F7A A;  5BXU A;  1V54 E;  2DT3 A;  3ASF A;  1FVF A;  4BTA A;  1S70 B;  1LG2 A;  4XKC A;  3ZU7 B;  2RFA A;  3WKZ A;  2F8Y A;  2XRY A;  4U96 D;  2XP3 A;  3ARO A;  1GOI A;  4PTM A;  1TYQ G;  4HOS A;  3URZ A;  3EY6 A;  4PH4 B;  3MZL B;  3DXK G;  4U8Y D;  3B95 A;  3MEK A;  3HXD A;  3UIO C;  3NZS A;  4KZ0 A;  1RD6 A;  5G2N A;  4H7X A;  5DIZ A;  1KLX A;  3AG2 E;  5AAR A;  4JFK A;  3FXY A;  1NWT A;  1S63 A;  2P2C P;  2WQ6 A;  3PE4 A;  2QYJ A;  3IEG A;  2DG3 A;  3IKG A;  4LAV A;  2J07 A;  2P9P G;  5CCL A;  3LYA A;  2PM7 A;  3CVV A;  3ESK A;  1E7V A;  4P29 A;  4ANX A;  1XRV A;  3VTY A;  3QWV A;  3PEV B;  3DSV A;  2WLZ A;  1W3B A;  3UM0 A;  1TN8 A;  2I2O A;  1H6K A;  2BKK B;  4G8L A;  2B31 A;  3EIQ C;  4BY6 A;  2P9U G;  4HXI A;  1HG5 A;  2PM6 A;  3NAW A;  3O5D A;  3JCK C;  3L9T A;  4N3C A;  4M7C A;  3NF1 A;  4WAF A;  4ODQ A;  3ONL A;  2DPE A;  2KZT A;  2WXG A;  1W1P A;  3EHQ A;  1K8K G;  1PY1 A;  4G2V A;  5G55 A;  4R5E A;  4GYO A;  3ZEF A;  3IK8 A;  2XGO A;  2N87 A;  3ALF A;  2V0P A;  2B6C A;  4ODM A;  1SVX A;  3R7R A;  4JC8 A;  2IU1 A;  1FKG A;  3FUH A;  4YVQ C;  3B7X A;  4UWK A;  1JNE A;  3RM9 A;  4Z2H A;  1ZBV A;  3APF A;  3SQV A;  2JAB A;  5KJN A;  1H2T C;  2QYU A;  3AAA C;  4I9C A;  4BET A;  2WXP A;  3U64 A;  3AU5 A;  4AJW A;  3BUA A;  3ZYM A;  1SR0 A;  5EKQ D;  5JHA A;  4HI9 A;  3O5L A;  3UI5 A;  1SA5 A;  5EYL A;  5ARG A;  5KJL A;  4UWG A;  2CHZ A;  2DCP A;  1GW6 A;  5M72 A;  3O48 A;  3BG0 B;  4DX7 D;  1E8Z A;  3D9I A;  3JYS A;  3ARV A;  4UUC A;  4F1P A;  5G05 C;  4G8K A;  3O5K A;  4JXT A;  3LVR E;  3OXG A;  4PUC A;  4L3N A;  3VTX A;  3CHE A;  4BF8 A;  1KPS B;  3AG4 E;  3IKO B;  2F2D A;  4NSB A;  3QAQ A;  4JA9 A;  4AOF A;  2VQ2 A;  3ZYK A;  4GML A;  4L7T A;  3TG4 A;  1W9V A;  2XS1 A;  2KCV A;  4L2Y A;  1OXJ A;  3L22 A;  3AU4 A;  3FUD A;  1Q2Z A;  1GRJ A;  4O1P A;  5LX8 A;  4TV3 A;  2R05 A;  1ZU2 A;  4GYY A;  4UWL A;  3O5P A;  3ZYL A;  5JJT A;  1BU9 A;  2RG8 A;  2AOS A;  2GRL A;  2IQC A;  5AQA A;  1LJY A;  2R59 A;  4F1S A;  3IV0 A;  3LKU A;  2MLX A;  3FUJ A;  3RFW A;  4LNB A;  2R17 C;  1FKJ A;  1BKF A;  5AIJ A;  2YHC A;  1N52 A;  4FJZ A;  4QQI A;  3W9G A;  2J4D A;  3DPY A;  5JJ6 A;  4ODO A;  4I2W A;  4I6G A;  3GZ2 A;  4YND A;  1OGB A;  5ENS D;  2LXL A;  4X8Q A;  4ATG A;  3WL0 A;  5ITZ F;  2J09 A;  1NA0 A;  4K03 A;  5DBK A;  4GCO A;  1N1A A;  2ZR4 A;  4ANW A;  2WVI A;  4QZV B;  2DVW A;  3CGH A;  5HT1 A;  1JUQ A;  3LDZ A;  2VN1 A;  4DRI A;  4LUN U;  4IN3 B;  2I1J A;  3F6Q A;  2L6B A;  2GRP B;  3ABK E;  2B0O E;  1ELK A;  2RUC A;  4FHJ A;  3CQC B;  4DRO A;  2EIJ E;  3ODK A;  2L6J A;  1X5B A;  3E30 A;  1HO8 A;  1MX4 A;  1S64 A;  2WK2 A;  4GYW A;  2OFN A;  4OVU A;  3R9A B;  4NRH B;  2PV2 A;  2RUD A;  3JYJ A;  2AWI A;  1N4S A;  4DJA A;  4GB9 A;  3TWS A;  2NC9 A;  3LEW A;  5GQB A;  3UF8 A;  2MLZ A;  1WY6 A;  3LY8 A;  1A17 A;  4DZ3 A;  3B7U X;  1IQR A;  2WXM A;  1MX6 A;  3PH0 C;  3VLD A;  3TL5 A;  4KBQ A;  4P8W A;  5ENQ D;  1OWP A;  2UY1 B;  4DX2 A;  2EQX A;  3JYM A;  4PS7 A;  2PL2 A;  5JH8 A;  5D66 A;  3FUE A;  4NIK A;  3UKR G;  4U04 A;  5EIL A;  3WQV A;  3CZ8 A;  4JA7 A;  3MV2 B;  2I1K A;  1V55 E;  1ZB5 A;  1IXV A;  4DX1 A;  4C48 B;  2L0T B;  5FQ6 A;  1HX8 A;  3Q15 A;  1WAO 1;  2XPA A;  2KO7 A;  2Y0B G;  4YVO A;  3HVE B;  2EIK E;  5T3R A;  2OVB A;  3U9W A;  1N0R A;  3O5Q A;  3MGB A;  3Q73 A;  3ASD A;  4GGQ A;  4AY5 A;  2FAP A;  3B8S A;  1EHN A;  3ABL E;  4G25 A;  3ARP A;  3WD4 A;  3TDB A;  4KVO A;  4FC8 A;  4UQY A;  3S7D A;  1FKL A;  3FUI A;  3CK9 A;  2CG3 A;  2YBT A;  3E34 A;  3Q78 A;  1MX2 A;  4G11 A;  3EHN A;  3IHY A;  2F8X K;  3G2V A;  3P1U A;  3RAU A;  3EU5 A;  3TWU A;  3W9F A;  4ILH B;  3WD3 A;  3T8M A;  4G23 A;  3SFY A;  1EPU A;  1HF8 A;  3DSW A;  3GZS A;  2XPZ A;  3EDT B;  3TXN A;  3G2T A;  3QKY A;  1INZ A;  3TCZ A;  2XEE A;  1TJF A;  3Q5M A;  2DYS E;  4O2T A;  2MHK A;  3PNL B;  5CCM A;  4GTV A;  5HW7 A;  3PS6 A;  2I6H A;  3B9D A;  4CDM A;  4ANV A;  3L16 A;  4I17 A;  4XIF A;  4AP2 A;  1RW2 A;  1HJX A;  1NWS A;  1MQS A;  4GTM A;  1E6P A;  3RM4 A;  4FA6 A;  1NWU A;  2M63 A;  4IQC A;  3MKQ A;  4BES A;  4GZ6 A;  3RKV A;  2KM4 A;  1LG1 A;  1WG0 A;  1ZCN A;  4DRK A;  2PI6 A;  1FKH A;  3NZU A;  3SO8 A;  2H6F A;  2BKG A;  3KAE A;  2XPB A;  4URI A;  5KWD A;  3IHV A;  1QQE A;  4GTS A;  4TYO A;  5GPG A;  3ABM E;  1LL7 A;  2DT0 A;  3C3R A;  1BL4 A;  2IFU A;  2NYJ A;  4ANU A;  2WMO A;  4DH0 A;  3UI4 A;  3FTW A;  1DCQ A;  3GYZ A;  2LUH A;  1E8W A;  2Y3A A;  3CK7 A;  1FKF A;  1E15 A;  4U8V D;  2A3A A;  2ETN A;  3PZ3 A;  4ZFH A;  3O5R A;  1OY3 D;  2X6I A;  1MHQ A;  1GUV A;  4C02 B;  4GTQ A;  4N3A A;  4HQD A;  3SBS A;  3HG0 D;  4A63 B;  3HXF A;  1K1B A;  1ZBP A;  1YW5 A;  1UN9 A;  2J9Q A;  2YNQ A;  5A23 A;  3UQ3 A;  3RM8 A;  2XGM A;  3VLF A;  4DI4 A;  3DEP A;  3C98 A;  4QT2 A;  1QZ2 A;  4YDO A;  3TWW A;  4WKA A;  4JB8 P;  1JCS A;  1Q6I A;  2H6I A;  1N4P A;  4J8E A;  5CER B;  3MJW A;  4U86 A;  2VTB B;  2G8Z A;  2WQH A;  3V79 K;  3PR9 A;  4ILG A;  3FUM A;  4NNR A;  2GRN B;  4W9P A;  2AVP A;  2XEV A;  3D3M A;  1PC2 A;  4FU3 A;  3L82 A;  3LVQ E;  4DLO A;  5BNW A;  4AEZ C;  3WIJ A;  1H2U A;  3KEA A;  4AM9 A;  3FTV A;  1S0P A;  3BG1 B;  1LD8 A;  3G6L A;  3O4Z A;  4N5Q A;  1IYG A;  3ARQ A;  2KCL A;  3ULQ A;  3S7J A;  3R7Q A;  1FKD A;  2Y4T A;  1QNF A;  4TW7 A;  3PVL A;  3UQB A;  1EYH A;  2Y69 E;  4ZPT R;  4BWR A;  1OGG A;  3PZ2 A;  1PBK A;  2GRO B;  3OA5 A;  4MTV A;  1B89 A;  1J4I A;  5IY5 E;  4KMO A;  1HKI A;  2R02 A;  5G04 J;  3R9M A;  4WWP A;  2CFZ A;  1ELR A;  3EJN A;  4H7Y A;  5H7P A;  5FT9 A;  4UWF A;  3CHQ A;  4TUM A;  3KS2 A;  2M1I A;  4TXQ A;  3TXM A;  1ROT A;  3CVQ A;  1MZC A;  2CHW A;  2LXM A;  1TNB A;  4Q69 A;  1H6P A;  2ZIS A;  1E9L A;  5AQ7 A;  2DIW A;  5J08 A;  1KZP A;  3DBS A;  1TCO C;  3Q4A B;  2FO7 A;  2RFM A;  5EYP F;  3CHS A;  4GU5 A;  3Q7A A;  4RLY A;  1IQU A;  3LUO A;  4UDM A;  3CGN A;  5BT1 A;  3KAB A;  3O5G A;  2DBA A;  4Z2I A;  1NWR A;  4HAR A;  4YDE A;  4S3J A;  3QB2 A;  2UZ5 A;  4Q22 A;  2C0L A;  4DZ2 A;  2ZR5 A;  3ZGQ A;  1DNP A;  3ASG A;  1M5Y A;  4U85 A;  1LL4 A;  4W9Q A;  5FZQ A;  3H9R B;  4BT9 A;  4JFM A;  2Q5A A;  4I2Z A;  4MSP A;  3SI5 A;  2R03 A;  4HOR A;  2X38 A;  3D9L A;  3KAC A;  3FU0 A;  3BQO A;  1L5J A;  2KGJ A;  4V3I A;  4U63 A;  2KI3 A;  4N19 A;  3TWQ A;  2H6H A;  4I1O B;  3AS3 A;  4HOQ A;  4L2L A;  2OCC E;  2L9B A;  1D6O A;  5C1D A;  4BFR A;  2VYI A;  4J4N A;  3QWW A;  1N4R A;  3PA7 A;  4GZ5 A;  1VF8 A;  1DC2 A;  4MGV A;  1ZU8 A;  4F3V A;  4G1T A;  4FUL A;  4CEM A;  4ODL A;  4JHJ A;  2MF9 A;  5CMW A;  4W9O A;  1OWN A;  1R9H A;  2VSY A;  4XKB A;  3CHC A;  4ILI A;  3L08 A;  5HW6 A;  4C9B B;  2WXO A;  4F6R D;  2RSE A;  5A7D B;  3UIN C;  1ROU A;  4G24 A;  3UKU G;  5CED B;  5HI7 A;  4ACK A;  5ENR D;  3UM1 A;  5CBO A;  2J4B A;  4GIV A;  4EPZ A;  3ML8 A;  2X6J A;  1O1T A;  3JXI A;  5EIB E;  4GZD A;  2XP4 A;  4Z68 A;  3FU5 A;  2E2E A;  4ODR A;  4B89 A;  3T9K A;  3QJZ A;  2MPH A;  2AXZ A;  5LCW C;  3ZRH A;  3CV0 A;  2RKK A;  3PRZ A;  4P8U A;  4UI9 C;  3AS2 A;  2ZQV A;  2LSV A;  2IEJ A;  3GTY X;  4URK A;  1EYM A;  2KBX A;  3DSS A;  4MBG A;  4GTO A;  1ZB1 A;  2KR7 A;  5KBA A;  3GZ1 A;  4W9R A;  3ASN E;  2OOE A;  5AEN A;  1AWC B;  1E6Z A;  2DT2 A;  2AWG A;  1TNU A;  5KCM A;  1EIB A;  2MLY A;  2OV8 A;  2DSW A;  1ZBK A;  3OXF A;  4LEU A;  5CEC B;  3FEY A;  5T4Y A;  4EEC A;  1OCO E;  2ETC A;  3AQU A;  5B8I C;  3KAH A;  5FQ8 A;  3PRD A;  3S7B A;  2X6F A;  2ETB A;  4UQX A;  4FP7 A;  4HLE A;  3D9O A;  3WL1 A;  2X6H A;  1QPF A;  4LSZ E;  3DRA A;  5J90 A;  4BX9 A;  1FPP A;  4I6J A;  4K5C A;  2BED A;  3NOC D;  2YQ8 A;  2A4Z A;  4MKT A;  2ESC A;  4HI8 A;  5HS0 A;  2FBN A;  3MKR A;  4E85 A;  4TUU A;  3ART A;  4MRU A;  4GMJ A;  4QT3 A;  4JHK A;  2IOS A;  2DZN A;  1J4R A;  2QFC A;  1IKN D;  1LD7 A;  3HRA A;  2QF8 A;  4MAV A;  1JCR A;  2KXP C;  4ZHB A;  2LNI A;  3SZ7 A;  3UX4 A;  5I98 A;  2V8S E;  5GPR A;  3MYV A;  3UI6 A;  1E8X A;  2IUZ A;  1J6Y A;  2WXH A;  3K9I A;  1WAW A;  3ZVV A;  4HBE A;  2RUR A;  5FWQ A;  3CHO A;  3LCA A;  5AAO A;  4U95 D;  5BV1 A;  3FP3 A;  1O6I A;  5HUA A;  4JW1 A;  3ZHE B;  1PAQ A;  1H19 A;  4HOT A;  2UWJ G;  4XI9 A;  3WXX A;  2LPV A;  2F37 A;  4G2P A;  1D2K A;  1TFV A;  2FUL A;  4LNU D;  4JEU A;  3LY9 A;  3BXW A;  4JFL A;  4A55 A;  3OXL A;  3EUV A;  3KZ7 A;  4BEP A;  4HRL A;  2NXP A;  3B7S A;  1HKK A;  5CBN A;  1E96 B;  4JPS A;  2VSO E;  2PPP A;  3RJV A;  5EN5 D;  5CHE E;  2DG4 A;  3U3W A;  2F21 A;  2F23 A;  4J7W A;  4JFI A;  1OWO A;  5FIN A;  2MRI A;  4PS3 A;  3G6M A;  2UY1 A;  3KD7 A;  3CHR A;  4W5U A;  2ZXW E;  3ZUV B;  5KJK A;  3U66 A;  4XX5 A;  3MDY B;  2WXR A;  4A1S A;  2KCK A;  1UG3 A;  4CDN A;  1FD9 A;  3V31 A;  4AIF A;  1SA4 A;  4IYP A;  1E8Y A;  4WWN A;  4G50 A;  4FN2 A;  1Z6T A;  1W1V A;  3ESL A;  4OAU C;  3HVE A;  2X3M A;  3KSQ A;  4I1M A;  2P9S G;  2ETA A;  4UI9 J;  3UM2 A;  2QY7 A;  4CZ2 D;  1WM5 A;  1HU3 A;  1NMV A;  3UQA A;  3KSL A;  2WXI A;  2DZO A;  3Q9U C;  3UT8 A;  2P9K G;  5EX0 A;  3I6C A;  1U3D A;  4AY1 A;  5EDS A;  1FKS A;  1XGW A;  1U3C A;  2DYR E;  4K5B A;  1KT1 A;  4R7L A;  4C0M A;  5G05 J;  1WB0 A;  5D75 A;  4RSY A;  1X81 A;  3FH7 A;  2OEW A;  2B5U B;  3FFL A;  3B7R L;  2HM8 A;  1EDU A;  1N4Q A;  1JCH B;  1HXV A;  1H0G A;  3FWV A;  5CMY A;  4CGV A;  3B7B A;  1RZ4 A;  3ONK A;  5KNH D;  5JJ7 A;  3QOK A;  2P58 C;  2A3E A;  5BW8 C;  1TN6 A;  3UI2 A;  1DCE A;  2DG9 A;  4APF A;  3WG7 E;  4LAY A;  5EX3 A;  2XP7 A;  3RU0 A;  5JMN D;  1IHG A;  1QPL A;  1KT0 A;  4BT8 A;  4DI3 A;  1HH8 A;  4K0R A;  3E33 A;  4Y6C A;  4B0Z A;  3ARU A;  4CT0 A;  4BSZ B;  1Q1C A;  3WH0 A;  5HWB A;  5E76 A;  5LFA A;  1EDQ A;  1FCH A;  4WJX A;  1NP7 A;  1UJJ A;  2CHX A;  4FLB A;  5BV0 A;  3SF4 A;  4ABN A;  2LAI A;  4L72 B;  1YYH A;  4J8Y A;  3X2Q E;  4J8F A;  2ZU6 B;  2MNT A;  2J8S D;  3W4R A;  4FAD A;  1FKI A;  4JHR A;  2Q7F A;  3MCX A;  3HHM A;  3C5R A;  1JND A;  5D0Q D;  3Q79 A;  1NSG A;  1C9H A;  2VSX E;  3SHF A;  4WND A;  2OEV A;  1OWQ A;  2V5F A;  3KAD A;  4GPM A;  2A3C A;  3BEE A;  4PDX A;  4HVB A;  2WXF A;  3L54 A;  5DIU A;  3RK6 A;  4P8X A;  3PNT B;  3TJP A;  4UWH A;  2F4E A;  2WMN A;  3CH9 A;  1JWG A;  3FEX A;  4U8H A;  5FIO A;  4I43 A;  5AJL A;  2ILR A;  3I4G A;  5ENT D;  4ML4 A;  2AW6 A;  3IXE A;  4CCA A;  1A5E A;  4WIW A;  2V4H C;  5DO2 A;  4U07 A;  4G26 A;  4JD2 G;  3KAI A;  5JHB A;  3DST A;  3CVL A;  3SY2 A;  4O60 A;  3JUI A;  3PDN A;  2EIL E;  3VLE A;  4GTR A;  3SD5 A;  3CKB A;  2VTB A;  3FTY A;  5HKG A;  1W9U A;  4LAX A;  1Y0O A;  2C2L A;  4LRZ A;  4RG9 A;  1TNY A;  2A5E A;  1OUV A;  3FH5 A;  3S2A A;  3T5X A;  4EBA A;  2VGX B;  3CK8 A;  3I3N A;  1H6O A;  4Z2G A;  3D9H A;  3TC5 A;  4RVB A;  1W9P A;  3V30 A;  3CKC A;  3Q49 B;  4JYS A;  1LF8 A;  3AJI A;  4MNK A;  3LJN A;  5HW8 A;  3HIZ A;  3DSU A;  2ZGG A;  4WNG A;  1UOH A;  4KQZ A;  5B1B E;  3FTX A;  1IX5 A;  5AQB A;  5DIT A;  3ZKJ A;  1LTX A;  3CEQ A;  3FDH A;  3B13 A;  1L1P A;  2J08 A;  4GA1 A;  1D9S A;  2A3B A;  5CEA A;  5D0O D;  4TW8 A;  3UIP C;  2RQS A;  2IOL A;  1IHB A;  3L13 A;  1BLX B;  2D9F A;  4LG6 A;  1OCZ E;  1UW4 B;  5ANL A;  4DPR A;  1ZL1 A;  1BI8 B;  2FEZ A;  3FTS A;  3ARX A;  1HXI A;  4N3B A;  4ZS6 A;  4BER A;  4Z2L A;  1NFI E;  5HBF A;  4EZJ A;  4DWS C;  1YAT A;  3APD A;  1FT1 A;  2ZIR A;  4MNL A;  4GMR A;  2GRR B;  4IRU A;  4DX6 D;  3EHM A;  1JCQ A;  3GW4 A;  3ULY A;  4J6I A;  2WQ7 A;  1TNO A;  5HQ8 A;  4AVX A;  3WD1 A;  3QNK A;  3HXC A;  4MLP A;  1D8D A;  4Z2J A;  4YDW A;  3UTM A;  1E6R A;  3FU6 A;  2AXU A;  1OT8 A;  2V4L A;  4S3K A;  3FHE A;  4CGW A;  3AS1 A;  3FU3 A;  3LPZ A;  2XZT G;  5KNG A;  4APO A;  2O9O A;  3ZYQ A;  3G2S A;  2Y78 A;  3KAF A;  1TEZ A;  2IY0 C;  2KC7 A;  2WXJ A;  3J5P A;  4OAV B;  1D7H A;  4JL0 A;  2XP8 A;  3QAR A;  4CRW A;  5BUZ A;  3FUN A;  2G41 A;  4U7E B;  5AYW D;  4U0S A;  3ZW3 A;  3UM3 A;  1Y8M A;  4AXH A;  4BSX A;  1TN7 A;  4ZPV R;  3Q9N C;  2GW1 A;  1U2V G;  3LXU X;  2HYZ A;  3AG1 E;  1X6N A;  1QYM A;  3I4R B;  1LL6 A;  1JNT A;  1G3N B;  3JXJ A;  4DIP A;  1EQ3 A;  1Z3X A;  3PE3 A;  1Z3Y A;  2GRM A;  4TRQ A;  5B1A E;  4CT4 A;  2M2A A;  1W1Y A;  2HO1 A;  3DXM G;  4J4O A;  2WXK A;  4NUR A;  4O1O A;  2ZQS A;  4DWS B;  4GCN A;  3TG5 A;  2XQ0 A;  1YCS B;  2NSZ A;  3PEU B;  4E6H A;  3MA5 A;  3PRB A;  3IKD A;  3CVY A;  3CLJ A;  2YHE A;  1AP7 A;  2WXQ A;  4EZL A;  1UR9 A;  3RIB A;  4HS2 A;  2L2S A;  2PQR A;  3P2B A;  2CFU A;  2ZGD A;  4WUY A;  4D10 C;  4EZK A;  2GGF A;  4I6E A;  3MX3 A;  5BXJ A;  2O92 A;  4U0Z A;  3HXB A;  4I1A A;  3CR3 A;  3DWL G;  2AXV A;  3WD2 A;  4ODP A;  4N2S A;  3DSX A;  3ULE G;  4M3O A;  1KZO A;  2XP5 A;  3APC A;  4ITZ A;  5BXO A;  1ELW A;  3L17 A;  3UPV A;  4KYO B;  1HS6 A;  2DWZ A;  3FUF A;  3PZ1 A;  1W1T A;  4XEI G;  1KFW A;  2ZR6 A;  4WKH A;  3AS8 A;  1B6C A;  2F0Y A;  1FKB A;  4QFV A;  3SGH A;  4TXP A;  1O1R A;  2VGY A;  2BTD A;  3OTN A;  2VSN A;  3V2X A;  2IF4 A;  4XI0 A;  2XGS A;  3FUL A;  4DRN A;  1A7X A;  5DIV A;  4AV7 A;  4Q96 A;  4TX0 A;  4DRP A;  1XNF A;  4DRH A;  1HKJ A;  5A6C A;  2RUQ A;  2KE0 A;  3CHF A;  1JPL A;  2FF4 A;  3PZD A;  3G2U A;  2ZQT A;  2ITK A;  4KVM A;  5E75 A;  2VJ8 A;  4DRJ A;  3CHM A;  1SW6 A;  1Y6I A;  3QOU A;  2XZD G;  4GTT A;  1CTN A;  2ZQU A;  2KZT B;  4XAK A;  3N71 A;  3C3O A;  3QDN A;  1SQM A;  1D7I A;  1NZN A;  4GPK A;  4LGX A;  3CVP A;  4UI9 K;  1YMP A;  3B9E A;  3O5O A;  4B8A A;  2WB2 A;  2EIN E;  4JZY A;  4JVS A;  3EHR A;  2XRZ A;  5T8I A;  1JNS A;  3O5J A;  4HNA D;  1NI1 A;  4DX5 D;  3QWP A;  1NL4 A;  4CDR A;  3VAW A;  1GPF A;  1E44 A;  1FFQ A;  3ZHE A;  4NZC A;  5FZS A;  3CHP A;  4GA2 A;  1UN8 A;  1HG2 A;  4BTB A;  1ZBW A;  5CRV A;  2PPO A;  4DT4 A;  3QK0 A;  2LJ4 A;  3RO2 A;  2E0I A;  2FDM A;  2WM9 A;  4A3V A;  3JXV A;  3NBN B;  3TWT A;  3BU8 A;  2WLY A;  3UT4 A;  1LQ0 A;  1TR4 A;  1ITX A;  4DRQ A;  2MOW A;  1X6L A;  3B7T A;  3SNX A;  1FKK A;  2P4V A;  5J6E A;  5BPP A;  1SZ9 A;  2XPY A;  5ENO D;  3ZNG A;  3PUK A;  2X6K A;  2P9I G;  1QBQ A;  2GRQ B;  4C0E A;  1NH6 A;  4CYM D;  1H0I A;  2PQN A;  3Q47 B;  2VGE A;  3UMV A;  2PN0 A;  4IPX A;  2JLB A;  3CVN A;  5HKP A;  1HKM A;  1OWM A;  3CVU A;  1NMW A;  3UQI A;  2XEN A;  1TJC A;  2DSU A;  4A1G A;  2A5U A;  2CG2 A;  2P9N G;  5ENN A;  3EIJ A;  3I5P A;  4KR0 B;  3WQW A;  4RQI A;  4GZC A;  4WKF A;  3ZXP A;  3WD0 A;  2EIM E;  1E6N A;  3UXG A;  3HDX A;  2LSU A;  4Y6W A;  1OCC E;  5LP0 A;  5FQ7 A;  1WDY A;  4L9P A;  4UQZ A;  4KT6 B;  3TGO A;  4GAA A;  4N2Q A;  2XS8 A;  3ALG A;  4R0X A;  1FAP A;  4ZPW R;  4ODN A;  4P8V A;  2PV3 A;  4QIB A;  1F40 A;  4WNE A;  5LCW J;  3IBE A;  3GPK A;  5FTP A;  2WPV A;  3ZN3 A;  1N54 A;  4B93 B;  2I9C A;  3O5E A;  4LER A;  2Y1L E;  3LS8 A;  4J8D A;  4YDY A;  5B3S E;  5D2M C;  3RRN B;  4O6F A;  3D9J A;  3TWX A;  2EUL A;  1W26 A;  1F8A B;  4DLQ A;  2MYO A;  3FUK A;  1PIN A;  2HE0 A;  3Q7F A;  3ZIM A;  3TWV A;  1OWL A;  3SFX A;  3PZ4 A;  4FHK A;  4RG6 A;  5FZR A;  3QC1 A;  1E7U A;  1T11 A;  5LOZ A;  4OVV A;  1MYO A;  1D7J A;  4DWS D;  2PNN A;  4TXR A;  3O5F A;  2WXL A;  3AS5 A;  1N9A A;  4FJY A;  1E90 A;  3E32 A;  4KXK B;  2XCC A;  3SFZ A;  2QC9 A;  5DF0 A;  3OAW A;  2DSV A;  2LO6 A;  4J8S A;  3BMB A;  1HJV A;  1N11 A;  5FQ4 A;  1VDY A;  3B9A A;  2IO3 C;  2ION A;  2LKN A;  1FFR A;  2KFW A;  1TNZ A;  4WWO A;  3ZXS A;  3GU0 A;  3CIA A;  3L6A A;  4WNF A;  3U4T A;  1H2V C;  3EU9 A;  4MNJ A;  2RD0 A;  1SYT A;  1U79 A;  1O5M A;  1OCR E;  3D9N A;  2WM0 A;  4XZ4 A;  1K9T A;  4XE0 A;  3D9K A;  3G2W A;  2R5S A;  2DSZ A;  1WNO A;  4IT4 A;  2H6G A;  1SZA A;  4HOU A;  3S7F A;  2J49 A;  3ZPJ A;  1BPO A;  3C3Q A;  1FJD A;  3CSF A;  3DPD A;  5G04 C;  5HTG A;  5AJD A;  3ARY A;  4I9E A;  3KEZ A;  2XEH A;  3HXE A;  1FKR A;  1BI7 B;  3EIP A;  4N5C A;  2WXN A;  3ASO E;  3PRA A;  1HJW A;  2DT1 A;  5FJY A;  4BX8 A;  1HE8 A;  4B94 A;  2PZI A;  2FKE A;  3NI6 A;  3FTU A;  3FAP A;  4HBD A;  1HFA A;  4EQF A;  3NOG D;  1N95 A;  2XCB A;  4L23 A;  3AS0 A;  4FAP A;  3JQ0 A;  5DEZ A;  4L1B A;  1NA3 A;  2IO2 C;  2VGX A;  1Q6U A;  1XHG A;  4MS6 A;  3T5V A;  3NB2 A;  2QZA A;  3AS4 A;  3OOB A;  2Y4U A;  2KAT A;  3LJ3 A;  3RRM B;  3ARR A;  2VCD A;  2R2L A;  3O5M A; 
#chains in the Genus database with same CATH homology
 3IHZ A;  3ENE A;  2LAH A;  1JWF A;  4TNS A;  4ME2 A;  4B8C B;  4IT6 A;  2XP9 A;  2YIN A;  3PUJ A;  4NAC A;  3FY1 A;  3MKQ B;  1FVH A;  3FH8 A;  3ARZ A;  3CVW A;  4MNM A;  5HWC A;  3FTZ A;  3CVX A;  1H0A A;  4KZC A;  2BUG A;  4HBO A;  4GA0 A;  5C2Y A;  2OLH A;  3NTP A;  3MV3 B;  2LGO A;  4HFG A;  4NQ0 A;  4JEH A;  1ZK6 A;  2K8I A;  1DVP A;  4Q7N A;  4J0U A;  3NQP A;  2OND A;  4ACL A;  3ZFW A;  4A3T A;  2PPN A;  2XHE A;  3JQ1 A;  4IQ2 A;  4F53 A;  5ANR A;  3RGC A;  4FLH A;  4DK5 A;  2C0M A;  2PV1 A;  4PS8 A;  3ML9 A;  3TAX A;  3CGM A;  2XPI A;  3NRK A;  4ODK A;  1HZ4 A;  3ASH A;  3ARS A;  3LY7 A;  2IJG X;  4DRM A;  3FY4 A;  2BF0 X;  5KJM A;  4LAW A;  4Z2K A;  1J4H A;  3KAG A;  3RO3 A;  4LCT A;  3SBT B;  1UJK A;  4IUL A;  4OYS A;  4AY6 A;  3CST A;  2XP6 A;  1YA0 A;  3E4B A;  3O5I A;  2FI7 A;  3HYM B;  3CHD A;  2PBC A;  2YBU A;  4N39 A;  3KCE A;  4GZ3 A;  3D9M A;  3ARW A;  4EBA G;  2M08 A;  1Q6H A;  3UT7 A;  5ARF A;  3PRE A;  4MPK A;  3D9P A;  4U84 A;  1EF1 C;  2HR2 A;  2JEK A;  1UR8 A;  3RRU A;  2L0I A;  4JFJ A;  1ZBC A;  4WK9 A;  2OVF A;  4Q94 A;  4U0U A;  4DWS A;  3CQG B;  3UUX A;  1JVW A;  1FKT A;  2JZV A;  3RME A;  1P5Q A;  4TW6 A;  4F7A A;  2DT3 A;  3ASF A;  1FVF A;  4BTA A;  1LG2 A;  4XKC A;  3WKZ A;  2XRY A;  2XP3 A;  3ARO A;  1GOI A;  4PTM A;  4HOS A;  3URZ A;  3EY6 A;  4PH4 B;  3MZL B;  3MEK A;  3NZS A;  4KZ0 A;  1RD6 A;  5G2N A;  4H7X A;  5DIZ A;  1KLX A;  4JFK A;  3FXY A;  1NWT A;  2WQ6 A;  3PE4 A;  2DG3 A;  3IEG A;  3IKG A;  4LAV A;  2J07 A;  5CCL A;  3LYA A;  2PM7 A;  3CVV A;  3ESK A;  1E7V A;  4P29 A;  4ANX A;  1XRV A;  3VTY A;  3QWV A;  3PEV B;  2WLZ A;  1W3B A;  2I2O A;  1H6K A;  2B31 A;  3EIQ C;  4BY6 A;  4HXI A;  1HG5 A;  2PM6 A;  3O5D A;  3JCK C;  4N3C A;  3NF1 A;  4WAF A;  4ODQ A;  3ONL A;  2DPE A;  2KZT A;  2WXG A;  1W1P A;  1PY1 A;  4G2V A;  5G55 A;  4R5E A;  4GYO A;  3ZEF A;  3IK8 A;  2XGO A;  2N87 A;  3ALF A;  2V0P A;  4ODM A;  3R7R A;  4JC8 A;  2IU1 A;  1FKG A;  3FUH A;  4YVQ C;  3B7X A;  4UWK A;  1JNE A;  3RM9 A;  4Z2H A;  1ZBV A;  3APF A;  5KJN A;  1H2T C;  4I9C A;  2WXP A;  3U64 A;  3AU5 A;  4AJW A;  3ZYM A;  1SR0 A;  5EKQ D;  5JHA A;  3O5L A;  3UI5 A;  5ARG A;  5KJL A;  4UWG A;  2CHZ A;  2DCP A;  1GW6 A;  5M72 A;  3O48 A;  3BG0 B;  1E8Z A;  3D9I A;  3JYS A;  3ARV A;  5G05 C;  3O5K A;  4JXT A;  3LVR E;  3OXG A;  4PUC A;  4L3N A;  3VTX A;  3CHE A;  4BF8 A;  3IKO B;  2F2D A;  4NSB A;  3QAQ A;  4JA9 A;  4AOF A;  2VQ2 A;  3ZYK A;  4GML A;  4L7T A;  3TG4 A;  1W9V A;  2KCV A;  4L2Y A;  3L22 A;  3AU4 A;  3FUD A;  5LX8 A;  4TV3 A;  1ZU2 A;  4GYY A;  4UWL A;  3O5P A;  3ZYL A;  5JJT A;  2RG8 A;  2AOS A;  2GRL A;  2IQC A;  1LJY A;  2R59 A;  4F1S A;  3IV0 A;  3LKU A;  2MLX A;  3FUJ A;  3RFW A;  2R17 C;  1FKJ A;  1BKF A;  5AIJ A;  2YHC A;  1N52 A;  4FJZ A;  2J4D A;  5JJ6 A;  4ODO A;  4I2W A;  4I6G A;  3GZ2 A;  4YND A;  1OGB A;  4ATG A;  3WL0 A;  2J09 A;  1NA0 A;  4K03 A;  5DBK A;  4GCO A;  1N1A A;  2ZR4 A;  4ANW A;  2WVI A;  4QZV B;  3CGH A;  5HT1 A;  1JUQ A;  3LDZ A;  2VN1 A;  4DRI A;  4LUN U;  4IN3 B;  2I1J A;  1ELK A;  2RUC A;  4FHJ A;  3CQC B;  4DRO A;  3ODK A;  2L6J A;  1X5B A;  1HO8 A;  2WK2 A;  4GYW A;  2OFN A;  4OVU A;  3R9A B;  4NRH B;  2PV2 A;  2RUD A;  3JYJ A;  2AWI A;  4DJA A;  4GB9 A;  2NC9 A;  3LEW A;  5GQB A;  3UF8 A;  2MLZ A;  1WY6 A;  3LY8 A;  1A17 A;  4DZ3 A;  3B7U X;  1IQR A;  2WXM A;  3PH0 C;  3VLD A;  3TL5 A;  4KBQ A;  4P8W A;  1OWP A;  2UY1 B;  2EQX A;  3JYM A;  4PS7 A;  2PL2 A;  5JH8 A;  3FUE A;  4U04 A;  3WQV A;  3CZ8 A;  4JA7 A;  3MV2 B;  2I1K A;  1ZB5 A;  2L0T B;  5FQ6 A;  1HX8 A;  3Q15 A;  1WAO 1;  2XPA A;  2KO7 A;  4YVO A;  3HVE B;  5T3R A;  2OVB A;  3U9W A;  3O5Q A;  3MGB A;  3ASD A;  4GGQ A;  3B8S A;  4AY5 A;  2FAP A;  1EHN A;  4G25 A;  3WD4 A;  3ARP A;  3TDB A;  4KVO A;  4FC8 A;  4UQY A;  3S7D A;  1FKL A;  3FUI A;  3CK9 A;  2CG3 A;  2YBT A;  4G11 A;  3EHN A;  3IHY A;  3G2V A;  3P1U A;  4ILH B;  3WD3 A;  3T8M A;  4G23 A;  1EPU A;  1HF8 A;  3GZS A;  2XPZ A;  3EDT B;  3TXN A;  3G2T A;  3QKY A;  1INZ A;  3TCZ A;  1TJF A;  3Q5M A;  4O2T A;  2MHK A;  3PNL B;  5CCM A;  5HW7 A;  3PS6 A;  2I6H A;  3B9D A;  4CDM A;  4ANV A;  3L16 A;  4I17 A;  4XIF A;  4AP2 A;  1HJX A;  1NWS A;  1MQS A;  1E6P A;  3RM4 A;  4FA6 A;  1NWU A;  2M63 A;  4IQC A;  3MKQ A;  4GZ6 A;  3RKV A;  2KM4 A;  1LG1 A;  1ZCN A;  4DRK A;  2PI6 A;  1FKH A;  3NZU A;  3KAE A;  2XPB A;  4URI A;  3IHV A;  1QQE A;  4TYO A;  5GPG A;  1LL7 A;  2DT0 A;  1BL4 A;  2IFU A;  4ANU A;  2WMO A;  4DH0 A;  3UI4 A;  3FTW A;  3GYZ A;  2Y3A A;  1E8W A;  3CK7 A;  1FKF A;  1E15 A;  2A3A A;  3O5R A;  2X6I A;  1MHQ A;  1GUV A;  4C02 B;  4N3A A;  3SBS A;  1ZBP A;  1YW5 A;  1UN9 A;  2J9Q A;  2YNQ A;  5A23 A;  3UQ3 A;  3RM8 A;  2XGM A;  3VLF A;  4DI4 A;  3C98 A;  4QT2 A;  1QZ2 A;  4WKA A;  1Q6I A;  4J8E A;  3MJW A;  4U86 A;  2VTB B;  2G8Z A;  2WQH A;  3PR9 A;  4ILG A;  3FUM A;  4NNR A;  4W9P A;  2AVP A;  2XEV A;  3D3M A;  1PC2 A;  4FU3 A;  3LVQ E;  4DLO A;  5BNW A;  4AEZ C;  3WIJ A;  1H2U A;  4AM9 A;  3FTV A;  1S0P A;  3BG1 B;  3G6L A;  3O4Z A;  1IYG A;  3ARQ A;  2KCL A;  3ULQ A;  3S7J A;  3R7Q A;  1FKD A;  2Y4T A;  1QNF A;  4TW7 A;  3PVL A;  3UQB A;  1EYH A;  4ZPT R;  4BWR A;  1OGG A;  1PBK A;  3OA5 A;  4MTV A;  1B89 A;  1J4I A;  4KMO A;  1HKI A;  5G04 J;  4WWP A;  2CFZ A;  1ELR A;  3EJN A;  4H7Y A;  5FT9 A;  4UWF A;  3CHQ A;  3KS2 A;  2M1I A;  3TXM A;  1ROT A;  3CVQ A;  2CHW A;  4Q69 A;  1E9L A;  2DIW A;  5J08 A;  3DBS A;  1TCO C;  3Q4A B;  2FO7 A;  3CHS A;  4GU5 A;  1IQU A;  3LUO A;  3CGN A;  5BT1 A;  3KAB A;  3O5G A;  2DBA A;  4Z2I A;  1NWR A;  4HAR A;  4S3J A;  3QB2 A;  2UZ5 A;  4Q22 A;  2C0L A;  4DZ2 A;  2ZR5 A;  3ZGQ A;  1DNP A;  3ASG A;  1M5Y A;  4U85 A;  1LL4 A;  4W9Q A;  5FZQ A;  3H9R B;  4BT9 A;  4JFM A;  2Q5A A;  4I2Z A;  4MSP A;  3SI5 A;  4HOR A;  2X38 A;  3D9L A;  3KAC A;  3FU0 A;  1L5J A;  2KGJ A;  4V3I A;  4U63 A;  2KI3 A;  4N19 A;  4I1O B;  3AS3 A;  4HOQ A;  4L2L A;  2L9B A;  1D6O A;  5C1D A;  4BFR A;  2VYI A;  4J4N A;  3QWW A;  3PA7 A;  4GZ5 A;  1VF8 A;  4MGV A;  1ZU8 A;  4F3V A;  4G1T A;  4FUL A;  4CEM A;  4ODL A;  4JHJ A;  2MF9 A;  5CMW A;  4W9O A;  1OWN A;  1R9H A;  2VSY A;  4XKB A;  3CHC A;  4ILI A;  3L08 A;  5HW6 A;  4C9B B;  2WXO A;  2RSE A;  5A7D B;  1ROU A;  4G24 A;  5HI7 A;  4ACK A;  2J4B A;  4GIV A;  4EPZ A;  3ML8 A;  2X6J A;  4GZD A;  2XP4 A;  3FU5 A;  2E2E A;  4ODR A;  4B89 A;  3QJZ A;  2MPH A;  2AXZ A;  5LCW C;  3ZRH A;  3CV0 A;  3PRZ A;  4P8U A;  4UI9 C;  3AS2 A;  2ZQV A;  2LSV A;  4URK A;  1EYM A;  2KR7 A;  3GZ1 A;  4W9R A;  2DT2 A;  2OOE A;  5AEN A;  1E6Z A;  2AWG A;  5KCM A;  1EIB A;  2MLY A;  2OV8 A;  2DSW A;  1ZBK A;  3OXF A;  4LEU A;  3FEY A;  5T4Y A;  4EEC A;  3AQU A;  5B8I C;  3KAH A;  5FQ8 A;  3PRD A;  3S7B A;  2X6F A;  4UQX A;  4FP7 A;  4HLE A;  3D9O A;  3WL1 A;  2X6H A;  1QPF A;  5J90 A;  4BX9 A;  4I6J A;  2YQ8 A;  2A4Z A;  4MKT A;  2ESC A;  2FBN A;  3MKR A;  4E85 A;  4TUU A;  3ART A;  4MRU A;  4GMJ A;  4QT3 A;  4JHK A;  2IOS A;  1J4R A;  2QFC A;  2QF8 A;  4MAV A;  2LNI A;  3SZ7 A;  3UX4 A;  5I98 A;  2V8S E;  5GPR A;  3MYV A;  3UI6 A;  1E8X A;  2IUZ A;  1J6Y A;  2WXH A;  3K9I A;  1WAW A;  3ZVV A;  4HBE A;  2RUR A;  5FWQ A;  3CHO A;  3LCA A;  5BV1 A;  3FP3 A;  1O6I A;  5HUA A;  4JW1 A;  3ZHE B;  1PAQ A;  1H19 A;  4HOT A;  2UWJ G;  4XI9 A;  3WXX A;  2LPV A;  4G2P A;  1D2K A;  1TFV A;  2FUL A;  4JEU A;  3LY9 A;  3BXW A;  4JFL A;  4A55 A;  3OXL A;  3KZ7 A;  2NXP A;  3B7S A;  1HKK A;  1E96 B;  4JPS A;  2VSO E;  2PPP A;  3RJV A;  5CHE E;  2DG4 A;  3U3W A;  2F21 A;  4JFI A;  1OWO A;  2MRI A;  4PS3 A;  3G6M A;  2UY1 A;  3KD7 A;  3CHR A;  4W5U A;  5KJK A;  3U66 A;  4XX5 A;  3MDY B;  2WXR A;  4A1S A;  2KCK A;  1UG3 A;  4CDN A;  1FD9 A;  4AIF A;  4IYP A;  1E8Y A;  4WWN A;  4G50 A;  4FN2 A;  1Z6T A;  1W1V A;  3ESL A;  3HVE A;  2X3M A;  4I1M A;  4UI9 J;  2QY7 A;  1WM5 A;  1HU3 A;  1NMV A;  3UQA A;  2WXI A;  3UT8 A;  5EX0 A;  3I6C A;  1U3D A;  4AY1 A;  5EDS A;  1FKS A;  1XGW A;  1U3C A;  1KT1 A;  4R7L A;  4C0M A;  5G05 J;  1WB0 A;  5D75 A;  4RSY A;  3FH7 A;  3FFL A;  3B7R L;  2HM8 A;  1EDU A;  1HXV A;  1H0G A;  3FWV A;  5CMY A;  4CGV A;  3ONK A;  5JJ7 A;  3QOK A;  2P58 C;  2A3E A;  5BW8 C;  2DG9 A;  4APF A;  4LAY A;  5EX3 A;  2XP7 A;  3RU0 A;  1IHG A;  1QPL A;  1KT0 A;  4BT8 A;  4DI3 A;  1HH8 A;  4K0R A;  4Y6C A;  4B0Z A;  3ARU A;  4CT0 A;  1Q1C A;  3WH0 A;  5HWB A;  5E76 A;  5LFA A;  1EDQ A;  1FCH A;  4WJX A;  1NP7 A;  1UJJ A;  2CHX A;  4FLB A;  5BV0 A;  3SF4 A;  4ABN A;  2LAI A;  4L72 B;  4J8F A;  2ZU6 B;  2MNT A;  3W4R A;  4FAD A;  1FKI A;  4JHR A;  2Q7F A;  3MCX A;  3HHM A;  1JND A;  5D0Q D;  1NSG A;  1C9H A;  2VSX E;  3SHF A;  4WND A;  1OWQ A;  2V5F A;  3KAD A;  2A3C A;  3BEE A;  4PDX A;  4HVB A;  2WXF A;  3L54 A;  5DIU A;  3RK6 A;  4P8X A;  3PNT B;  3TJP A;  4UWH A;  2F4E A;  2WMN A;  3CH9 A;  1JWG A;  3FEX A;  4U8H A;  4I43 A;  5AJL A;  2ILR A;  3I4G A;  4ML4 A;  2AW6 A;  4CCA A;  4WIW A;  5DO2 A;  4U07 A;  4G26 A;  3KAI A;  5JHB A;  3CVL A;  3JUI A;  3PDN A;  3VLE A;  3SD5 A;  3CKB A;  2VTB A;  3FTY A;  5HKG A;  1W9U A;  4LAX A;  1Y0O A;  2C2L A;  4LRZ A;  4RG9 A;  1OUV A;  3FH5 A;  3S2A A;  3T5X A;  4EBA A;  2VGX B;  3CK8 A;  3I3N A;  4Z2G A;  3TC5 A;  4RVB A;  1W9P A;  3CKC A;  3Q49 B;  4JYS A;  1LF8 A;  4MNK A;  5HW8 A;  3HIZ A;  4WNG A;  4KQZ A;  3FTX A;  1IX5 A;  5DIT A;  3CEQ A;  3FDH A;  3B13 A;  1L1P A;  2J08 A;  4GA1 A;  2A3B A;  4TW8 A;  5D0O D;  2RQS A;  2IOL A;  3L13 A;  2D9F A;  1UW4 B;  5ANL A;  4DPR A;  1ZL1 A;  2FEZ A;  3FTS A;  3ARX A;  1HXI A;  4N3B A;  4ZS6 A;  4Z2L A;  5HBF A;  4EZJ A;  4DWS C;  1YAT A;  3APD A;  4MNL A;  4IRU A;  3EHM A;  3GW4 A;  4J6I A;  2WQ7 A;  5HQ8 A;  4AVX A;  3WD1 A;  3QNK A;  4MLP A;  4Z2J A;  1E6R A;  3FU6 A;  2AXU A;  2V4L A;  4S3K A;  3FHE A;  4CGW A;  3AS1 A;  3FU3 A;  3LPZ A;  4APO A;  2O9O A;  3ZYQ A;  3G2S A;  2Y78 A;  3KAF A;  1TEZ A;  2KC7 A;  2WXJ A;  1D7H A;  4JL0 A;  2XP8 A;  3QAR A;  4CRW A;  5BUZ A;  3FUN A;  2G41 A;  5AYW D;  4U0S A;  3ZW3 A;  1Y8M A;  4AXH A;  4BSX A;  4ZPV R;  2GW1 A;  3LXU X;  2HYZ A;  1X6N A;  3I4R B;  1LL6 A;  1JNT A;  4DIP A;  1EQ3 A;  1Z3X A;  3PE3 A;  1Z3Y A;  2GRM A;  4TRQ A;  4CT4 A;  2M2A A;  1W1Y A;  2HO1 A;  4J4O A;  2WXK A;  4NUR A;  2ZQS A;  4DWS B;  4GCN A;  3TG5 A;  2XQ0 A;  2NSZ A;  3PEU B;  4E6H A;  3MA5 A;  3PRB A;  3IKD A;  3CVY A;  3CLJ A;  2YHE A;  2WXQ A;  4EZL A;  1UR9 A;  3RIB A;  4HS2 A;  2L2S A;  2PQR A;  3P2B A;  2CFU A;  4WUY A;  4D10 C;  4EZK A;  2GGF A;  4I6E A;  3MX3 A;  5BXJ A;  2O92 A;  4U0Z A;  4I1A A;  3CR3 A;  2AXV A;  3WD2 A;  4ODP A;  4N2S A;  4M3O A;  2XP5 A;  3APC A;  4ITZ A;  1ELW A;  3L17 A;  3UPV A;  4KYO B;  1HS6 A;  3FUF A;  1W1T A;  1KFW A;  2ZR6 A;  4WKH A;  3AS8 A;  1B6C A;  1FKB A;  4QFV A;  3SGH A;  2VGY A;  2BTD A;  3OTN A;  2VSN A;  2IF4 A;  4XI0 A;  2XGS A;  3FUL A;  4DRN A;  1A7X A;  5DIV A;  4AV7 A;  4Q96 A;  4TX0 A;  4DRP A;  1XNF A;  4DRH A;  1HKJ A;  5A6C A;  2RUQ A;  2KE0 A;  3CHF A;  1JPL A;  2FF4 A;  3PZD A;  3G2U A;  2ZQT A;  2ITK A;  4KVM A;  5E75 A;  2VJ8 A;  4DRJ A;  3CHM A;  1Y6I A;  3QOU A;  1CTN A;  2ZQU A;  2KZT B;  4XAK A;  3N71 A;  3QDN A;  1SQM A;  1D7I A;  1NZN A;  4GPK A;  4LGX A;  3CVP A;  4UI9 K;  3B9E A;  3O5O A;  4B8A A;  2WB2 A;  4JZY A;  4JVS A;  2XRZ A;  5T8I A;  1JNS A;  3O5J A;  3QWP A;  4CDR A;  3VAW A;  1GPF A;  1FFQ A;  3ZHE A;  4NZC A;  5FZS A;  3CHP A;  4GA2 A;  1UN8 A;  1HG2 A;  4BTB A;  1ZBW A;  2PPO A;  4DT4 A;  3QK0 A;  2LJ4 A;  3RO2 A;  2E0I A;  2FDM A;  2WM9 A;  4A3V A;  3JXV A;  2WLY A;  3UT4 A;  1LQ0 A;  1ITX A;  4DRQ A;  2MOW A;  1X6L A;  3B7T A;  3SNX A;  1FKK A;  5J6E A;  5BPP A;  1SZ9 A;  2XPY A;  3PUK A;  2X6K A;  4C0E A;  1NH6 A;  1H0I A;  2PQN A;  3Q47 B;  3UMV A;  4IPX A;  2JLB A;  3CVN A;  1HKM A;  1OWM A;  3CVU A;  1NMW A;  3UQI A;  1TJC A;  2DSU A;  4A1G A;  2A5U A;  2CG2 A;  5ENN A;  3EIJ A;  3I5P A;  4KR0 B;  3WQW A;  4GZC A;  4WKF A;  3WD0 A;  1E6N A;  3HDX A;  2LSU A;  4Y6W A;  5LP0 A;  5FQ7 A;  4UQZ A;  4KT6 B;  3TGO A;  4GAA A;  4N2Q A;  3ALG A;  4R0X A;  1FAP A;  4ZPW R;  4ODN A;  4P8V A;  2PV3 A;  4QIB A;  1F40 A;  4WNE A;  5LCW J;  3IBE A;  3GPK A;  5FTP A;  2WPV A;  3ZN3 A;  1N54 A;  2I9C A;  3O5E A;  4LER A;  3LS8 A;  4J8D A;  3RRN B;  4O6F A;  3D9J A;  1W26 A;  1F8A B;  4DLQ A;  3FUK A;  1PIN A;  3ZIM A;  1OWL A;  4FHK A;  4RG6 A;  5FZR A;  3QC1 A;  1E7U A;  1T11 A;  5LOZ A;  4OVV A;  1D7J A;  4DWS D;  3O5F A;  2WXL A;  3AS5 A;  4FJY A;  1E90 A;  4KXK B;  2XCC A;  3SFZ A;  5DF0 A;  3OAW A;  2DSV A;  2LO6 A;  4J8S A;  1HJV A;  5FQ4 A;  1VDY A;  3B9A A;  2ION A;  2LKN A;  1FFR A;  2KFW A;  4WWO A;  3ZXS A;  3CIA A;  3L6A A;  4WNF A;  3U4T A;  1H2V C;  4MNJ A;  2RD0 A;  1SYT A;  1U79 A;  3D9N A;  2WM0 A;  4XZ4 A;  1K9T A;  4XE0 A;  3D9K A;  3G2W A;  2R5S A;  2DSZ A;  1WNO A;  4IT4 A;  1SZA A;  4HOU A;  3S7F A;  2J49 A;  3ZPJ A;  1BPO A;  1FJD A;  3CSF A;  3DPD A;  5G04 C;  5HTG A;  5AJD A;  3ARY A;  4I9E A;  3KEZ A;  1FKR A;  4N5C A;  2WXN A;  3PRA A;  1HJW A;  2DT1 A;  5FJY A;  4BX8 A;  1HE8 A;  4B94 A;  2PZI A;  2FKE A;  3NI6 A;  3FTU A;  3FAP A;  1HFA A;  4EQF A;  2XCB A;  4L23 A;  3AS0 A;  4FAP A;  3JQ0 A;  5DEZ A;  4L1B A;  1NA3 A;  2VGX A;  1Q6U A;  1XHG A;  4MS6 A;  3T5V A;  3AS4 A;  3OOB A;  2Y4U A;  2KAT A;  3LJ3 A;  3RRM B;  3ARR A;  2VCD A;  3O5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...