1KT1A

Structure of the large fkbp-like protein, fkbp51, involved in steroid receptor complexes
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
394
structure length
374
Chain Sequence
KKDRGVLKIVHGEETPMIGDRVYVHYNGKLANPFVFSIGKGQVIKAWDIGVATMKKGEICHLLCAYGATGSLPKIPSNATLFFEVELLDFKGEDLLEDGGIIRRTKRRGEGYSNPNEGARVQIHLEGRCGGRVFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILHLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYVQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQIFMCQKKAKEHNERDRRTYANMFKKFAEQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title STRUCTURE OF THE LARGE FK506-BINDING PROTEIN FKBP51, AN HSP90-BINDING PROTEIN AND A COMPONENT OF STEROID RECEPTOR COMPLEXES
pubmed doi rcsb
molecule keywords FK506-binding protein FKBP51
molecule tags Isomerase
source organism Saimiri boliviensis
total genus 108
structure length 374
sequence length 394
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2002-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF00515 TPR_1 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1kt1A03
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1kt1A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1kt1A02
5HWCA 2E2EA 3OXLA 3KAIA 3OOBA 3LYAA 3FFLA 5D0QD 4NRHB 2LSVA 4IPXA 3O5MA 4JYSA 4RG6A 3KADA 3CKCA 2ONDA 5FT9A 4BT9A 3MEKA 1ZU2A 4HOTA 2FKEA 3CK7A 3MV3B 2LGOA 1PC2A 4N39A 1FKSA 4N3CA 3O5QA 4NNRA 2NC9A 3KZ7A 3MA5A 1Q1CA 1IHGA 3VTYA 4DRKA 4G50A 2MNTA 2ZQSA 4ODQA 4ODKA 2QFCA 4DRPA 1FKGA 4CDRA 5J6EA 1FD9A 1FKBA 1KT0A 1QZ2A 4UQZA 2FBNA 1QPLA 2VSNA 2AWGA 4GCOA 3ZGQA 3QWVA 2DG3A 1QQEA 4GPKA 4ODLA 4DH0A 4BT8A 4AY6A 4BTAA 3U3WA 1B6CA 3UQ3A 2ITKA 3ZHEB 4U0ZA 4A1SA 3TGOA 2I6HA 3QWWA 4AIFA 1BKFA 5M72A 3EY6A 4DRJA 2VGYA 4BF8A 5G05C 4DRIA 5DBKA 3ASDA 1JNTA 3GPKA 4ITZA 1FKDA 1TCOC 2PZIA 2Q5AA 3JXVA 4DROA 4AY5A 3PDNA 4H7YA 2L6JA 3KCEA 1EQ3A 5ARFA 3U4TA 2MF9A 3NRKA 1NA3A 3O5GA 2PV2A 1FKIA 4WNDA 3BEEA 3RKVA 4YVOA 1NSGA 4GYYA 4TW6A 2PBCA 1JNSA 1P5QA 3AS4A 3KAGA 1F40A 4QIBA 2ZQVA 4U04A 4CGVA 4G25A 3S7BA 4KBQA 1XNFA 4BWRA 2XEVA 4GCNA 4EQFA 3LY8A 1J6YA 2HO1A 4J8FA 3ASHA 4U0UA 1KT1A 3ODKA 1HZ4A 2RUDA 5HI7A 4G2VA 4W9OA 3S7DA 2FEZA 4WNFA 2XPAA 5CCMA 3O5IA 3HYMB 3CGMA 1A7XA 5HW8A 4IN3B 2UY1A 3B7XA 2Y4TA 2JZVA 2RURA 2DG4A 2PQNA 2L2SA 4GZ6A 4HORA 3Q15A 4G2PA 2XCCA 4JFMA 1D7IA 4JFIA 4KYOB 3GZ1A 3IKDA 5KJKA 5EKQD 4GYWA 1NMWA 4DT4A 1N1AA 1ZCNA 2RQSA 2XGOA 1NZNA 2FI7A 2OFNA 4UQXA 2PQRA 2DBAA 3IKGA 3UQAA 1YW5A 5DIZA 4J8DA 4AM9A 5HW7A 4GA0A 4U07A 4G24A 2MPHA 2BUGA 1ELWA 3GZ2A 1J4HA 4GIVA 1D7JA 4U84A 2PV3A 4YVQC 1B89A 2VCDA 1PINA 3PA7A 2GW1A 3QOUA 3IHZA 2IFUA 1C9HA 2M08A 3FAPA 4FN2A 5JJ6A 4XI0A 2HYZA 3CEQA 4QT2A 4BTBA 2FF4A 4U85A 3JYSA 5FZSA 4LAWA 4LAVA 2KATA 3CVPA 3S7FA 4LAYA 2M1IA 1WM5A 4UI9J 2F4EA 5G05J 5LCWC 5DITA 5GPGA 3LPZA 4MSPA 4TW7A 2UY1B 4Y6WA 4JA9A 3UI5A 2KFWA 5C1DA 3R9AB 4I9CA 3ASGA 1HXIA 1ZBPA 3NF1A 5HUAA 1IYGA 2KO7A 1PBKA 5HTGA 4G23A 3E4BA 2F21A 4H7XA 2F2DA 4O2TA 4ODRA 3KABA 3TAXA 4UI9C 3FWVA 3QDNA 2FAPA 4I1AA 2XP4A 2XP6A 5FTPA 1ROTA 5HQ8A 2C2LA 2VQ2A 1F8AB 3O5OA 5DIUA 3LY7A 5EX0A 2XP3A 4C02B 5BT1A 4UI9K 5D75A 4W9PA 4WUYA 5BW8C 3K9IA 3JYMA 2IF4A 5HW6A 4G1TA 2MLXA 3O5PA 3RIBA 4XI9A 1FKKA 4APOA 2PL2A 2DG9A 5I98A 2LPVA 4TW8A 3QWPA 2YQ8A 3CK9A 3RO3A 1NMVA 2ZQTA 4B94A 5CCLA 4DZ3A 3WXXA 1OUVA 3TDBA 4XIFA 4QT3A 3KAHA 1YA0A 4N2QA 5HWBA 4JL0A 3URZA 2V5FA 3CVLA 2XP8A 4HOQA 3ZFWA 3ZPJA 2KCKA 3CKBA 1FKLA 4FAPA 1FAPA 3Q4AB 1FCHA 1WAO1 4JHRA 2PPOA 5FZQA 1T11A 1NA0A 2RSEA 5G04C 2MHKA 2LKNA 1FKRA 2OOEA 4UQYA 2PPNA 2P58C 3LKUA 2RUQA 4W9QA 4IQ2A 4MGVA 3GW4A 4I9EA 2VGXA 4WNEA 3RJVA 2UZ5A 4DZ2A 4GA1A 2M2AA 4F3VA 2C0LA 2PPPA 3OXFA 2Y78A 4R0XA 2WPVA 5B8IC 4LAXA 1J4IA 5A6CA 4ODPA 3PRBA 2WQHA 3TG4A 2XP9A 3MDYB 4HOSA 1W3BA 3O5JA 3ZHEA 4N5CA 1D6OA 1FKHA 3UI6A 4N3BA 1HH8A 4J0UA 5LCWJ 2ZR4A 5HT1A 2UWJG 1BL4A 2LJ4A 1E96B 4DIPA 2KR7A 4YNDA 4DRMA 4ODMA 2VSYA 4GA2A 3S7JA 4JFKA 2D9FA 3CVQA 3PE3A 4J8EA 1Q6UA 1HXVA 1J4RA 4I2WA 3CV0A 2VYIA 5BNWA 2KC7A 3CVNA 4IQCA 3NI6A 2FO7A 4JFLA 2C0MA 4ABNA 3LY9A 3I6CA 3ESKA 2Q7FA 4WNGA 5BXJA 3OXGA 3TG5A 3VAWA 4TNSA 3Q49B 2N87A 3VTXA 1FKFA 2JLBA 3KAEA 3MKRA 3QKYA 3MV2B 4JA7A 3TC5A 4DRQA 2VGXB 4JFJA 3RGCA 2XPIA 2XGSA 4U0SA 4Y6CA 2VN1A 2PV1A 4N2SA 2KE0A 3TCZA 1L1PA 5FJYA 2LSUA 4DRHA 4LEUA 3ZN3A 5HKGA 1Y8MA 4GYOA 4G26A 4J4OA 1ROUA 1U79A 5KJMA 3AS8A 3O48A 2KGJA 3PE4A 5AYWD 2HR2A 1R9HA 4ODNA 1FJDA 3O5RA 2XGMA 1Q6IA 3N71A 1KLXA 1Q6HA 4W9RA 3O5LA 5DIVA 2MLZA 1A17A 2YHCA 3GYZA 4CGWA 3LUOA 1JVWA 4HOUA 3KACA 4O6FA 3KAFA 3UF8A 3ASFA 2LNIA 2ZQUA 4GZ5A 2K8IA 3FP3A 4J4NA 3Q47B 2ZR5A 3O5EA 3O5KA 3PRDA 3LCAA 5G04J 2KCVA 1EYMA 5JJ7A 5EX3A 4U86A 3NTPA 3O5DA 4I17A 5D0OD 3CK8A 2MLYA 1ELRA 5KJLA 1YATA 2ZR6A 2R5SA 1Y0OA 4KXKB 2Y4UA 5CHEE 3SF4A 2XPBA 3UUXA 4ODOA 3IEGA 2XCBA 4ME2A 3UQIA 4GZ3A 1TJCA 3AS5A 3IK8A 1W26A 2KI3A 4I2ZA 5ARGA 3CGNA 3EDTB 2KCLA 2AVPA 4TYOA 1QPFA 3JYJA 3H9RB 4N19A 3SZ7A 4TX0A 1ZK6A 5A7DB 3O5FA 3Q5MA 3RU0A 1D7HA 3RFWA 3WH0A 3KS2A 5FZRA 2XP5A 3UI4A 1FKJA 4GGQA 1FKTA 2J9QA 1M5YA 4N3AA 4RG9A 4NQ0A 5JJTA 3RO2A 3KD7A 4DRNA 3UQBA 3UPVA 2RUCA 2XP7A 3ULQA 5KJNA
chains in the Genus database with same CATH superfamily
2E2EA 4JEUA 2EIJE 4MAVA 1U3CA 5D0QD 3UIPC 2F8XK 4RG6A 5ENPD 3CKCA 2ONDA 5FT9A 4BT9A 4FJYA 4BFRA 1UJJA 3LJNA 1ZU2A 4I6JA 1O5MA 1Q2ZA 1OWOA 3MZLB 4N3CA 2XEHA 3KZ7A 4JW1A 3HXCA 4FP7A 3B7RL 4PUCA 5HKPA 5HBFA 2MYOA 3ML8A 4QZVB 4TXQA 5KBAA 3APDA 3WL0A 2QFCA 3FY4A 2J8SD 3B9DA 1FD9A 1SQMA 1HU3A 1JPLA 2XPYA 4L2YA 3CVXA 2OEVA 1QPLA 4GCOA 3QWVA 2DG3A 2IQCA 4CT4A 1WB0A 1N9AA 2P9PG 4ODLA 5BXUA 4HRLA 5C2YA 4BTAA 3AS2A 3UQ3A 1O1SA 2I6HA 3IHYA 2Y0BG 1W9PA 4AIFA 1EDQA 3B7BA 1LL7A 2VGYA 4CDMA 3RRUA 4C48B 2PM6A 1OY3D 3ASDA 3UT4A 3ZYKA 4DPRA 2H6HA 1FKDA 3UTMA 4Z2HA 1X6LA 2Q5AA 1EYHA 1FT2A 3B7SA 3PDNA 3ZYQA 4H7YA 2L6JA 4GTQA 1D9SA 3U4TA 1UN9A 3ZEFA 2I1KA 2OV8A 3NRKA 2I9CA 3RKVA 3V79K 1NSGA 3UT7A 2A5EA 5AAOA 1TN6A 4Q7NA 1WG0A 3KAGA 4QFVA 5JHAA 3MGBA 4KBQA 1XNFA 4AJWA 4F53A 4EQFA 2B31A 4J8FA 1O6IA 2QYJA 1IQRA 4W9OA 1HJWA 2P9NG 3AG4E 2R02A 2XEEA 1A7XA 2UY1A 4P8WA 4K5AB 2PQNA 4GZ6A 3Q15A 3T8KA 2XCCA 4DWSA 4JFMA 3WKZA 4A1GA 3GZ1A 3DXMG 3CZ8A 2AW6A 2RQSA 1FFRA 2DBAA 3IKGA 4TRQA 5DIZA 1DCEA 1OCZE 3CGHA 4MRUA 5EN5D 2QZAA 1ZU8A 4GIVA 1NWTA 2F37A 4MTVA 3BUAA 2DT1A 1B89A 5D2MC 1XRVA 3JQ0A 2XZTG 2IFUA 2M08A 4J8YA 2ETBA 4XI0A 4U85A 3JYSA 2KATA 3ASNE 1TR4A 3ZYLA 2EINE 2M1IA 4UI9J 2F4EA 1YCSB 2WXOA 5DITA 4BERA 3LPZA 4Y6WA 4GTRA 4GTTA 3AS1A 3FTZA 3ASGA 1HXIA 1ZBPA 1BI8B 3NF1A 3ZXPA 3DSXA 4DUIA 3AQUA 4N5QA 1PBKA 4FHJA 4WK9A 1FVHA 4O2TA 4DX1A 2DCPA 1QYMA 4NACA 3TXNA 1ZB5A 2XP4A 3D9NA 4A55A 5HQ8A 2C2LA 1F8AB 1AWCB 5EX0A 3PS6A 4MNKA 3B13A 2R05A 1K3ZD 2MLXA 3ALFA 3O5PA 3CHDA 4XI9A 4ZHBA 1FKKA 2CFUA 4IULA 4U8VD 2LPVA 3QWPA 2BTDA 1NMVA 2ZQTA 3FXYA 5CCLA 3ABKE 4DZ3A 2V5QC 3FEXA 4GU5A 1E7VA 2H6GA 1JCHB 3KAHA 1IXVA 5HWBA 2DT2A 3URZA 2XP8A 3CH9A 3ZFWA 4LNGA 3ZPJA 3Q9NC 1NL4A 4ILGA 1YMPA 2OEWA 5FZQA 2QC9A 3FTUA 5JMND 1FKRA 3ISMC 3V30A 2RUQA 4HI9A 4MGVA 3GW4A 4FU3A 3EIQC 4DZ2A 2KZTA 4GA1A 5T8IA 3IHVA 3DPDA 3OXFA 3KEZA 4DLQA 2WPVA 5B8IC 2WQHA 3MDYB 1Z3YA 5LFAA 1TJFA 4L1BA 3O5JA 3ZHEA 1UR9A 5LX8A 1D6OA 3LVRE 4JC8A 4UWHA 3SNXA 1E96B 5EIDA 4ODMA 3PUJA 4PDXA 2EIKE 4KMOA 4URKA 5J90A 3QOKA 3CIAA 1KPSB 3EHNA 3Q7FA 3X2QE 3CVNA 3BQOA 1ZBCA 5T4YA 2FO7A 2XZDG 2GRRB 5ENNA 3ESKA 4WNGA 3PNTB 3TG5A 2QF8A 4TNSA 3Q49B 1SA4A 3TWXA 3VTXA 4RSYA 2P9KG 3NZUA 4JFJA 1ELKA 5FQ4A 3NBNB 3IV0A 1HS6A 4Y6CA 2PV1A 4EZLA 4N2SA 2LSUA 4DRHA 4LEUA 5HKGA 4L9PA 2P9UG 3JUEA 1ROUA 2ILRA 2DT0A 3LDZA 1E8WA 2KGJA 4EECA 3E37A 3QARA 2LUHA 3Q7AA 3AROA 3EUVA 1MX4A 2XGMA 1Q6IA 4ILHB 1KLXA 4F1SA 3FTYA 1A17A 2YHCA 4I6GA 3GYZA 1S0PA 1JVWA 3WD2A 3KAFA 3UF8A 3FUIA 4LERA 4J4NA 3LCAA 3RAUA 3FUFA 1EPUA 4GTOA 3UM1A 5BUZA 3NTPA 1LQ0A 4TXPA 3DSWA 3DSTA 2O92A 4UWKA 3HDXA 1JCRA 3ZNGA 3ZIMA 3UUXA 4ODOA 4V3IA 3FULA 4GZ3A 2ZGGA 3AS5A 4JPSA 3IK8A 1OWPA 1LTXA 1N54A 2KI3A 2WVIA 3CGNA 3EDTB 1QPFA 4N19A 1RD6A 4ACKA 1IKND 5A7DB 2J08A 3DSVA 4G8LA 4L3NA 3Q5MA 3RFWA 4GPMA 4GGQA 2J07A 4Z2IA 5CMWA 2F23A 4DRNA 3G2TA 4OYSA 5HWCA 3SO8A 3OXLA 1V54E 1JWFA 5FWQA 4NRHB 4DLOA 1Z5SC 1ZL1A 5AARA 3L54A 3FTWA 5CBNA 4MKTA 5J08A 3CK7A 3SFXA 2OVFA 1XHGA 4MS6A 3T9KA 3UX4A 3AG2E 1FKSA 3D9OA 1H6OA 2YBUA 1GRJA 4EBAG 3JXIA 3CHCA 1Q1CA 1HKKA 4OAUC 4XKBA 3L08A 1W9VA 5EDSA 3G2UA 2A3BA 4ODKA 1TNBA 4WAFA 5CEAA 2PM7A 3LVQE 4GB9A 2A3EA 1QZ2A 4UQZA 3FH7A 2WXMA 3TXMA 4BT8A 3SBTB 3I5PA 3NAWA 3UMVA 1A5EA 1O1RA 2ITKA 2RKKA 4R5EA 4U0ZA 2GRNB 2EULA 2IUZA 4UWFA 1BKFA 5M72A 2WXFA 4WWPA 4MNLA 4HI8A 1HFAA 1RW2A 2Y69E 3G2VA 3WIJA 2PZIA 5FQ7A 3JXVA 4BETA 4DROA 3KCEA 5ARFA 5D66A 3RSEG 3DSSA 2WLYA 3O5GA 2PV2A 3SFZA 1N94A 4YVOA 4TW6A 1JNSA 3AS4A 4P29A 4F1PA 3PRAA 3RK6A 3S7BA 3SBSA 2J4DA 4BWRA 1QNFA 3I3NA 3LS8A 4UWLA 1J6YA 3TWVA 2HO1A 4EBAA 4OVUA 1MJ0A 3PNLB 2RUDA 4KVMA 3NOGD 2VSXE 2FEZA 4WNFA 3WQWA 3IXEA 1NFIE 3PEVB 3D3MA 4IN3B 2CFZA 2J4BA 1OCRE 3B7XA 2Y4TA 1MYOA 2RURA 1X5BA 2DG4A 3U66A 4G2PA 1D7IA 4JFIA 3TWRA 1WNOA 2IOSA 1KZPA 5LOZA 2YHEA 4GYWA 4DWSC 2AXZA 4DT4A 1N1AA 3RM9A 2FI7A 4UWGA 3SY2A 4UQXA 3GU0A 1ZB1A 4DI3A 3UM3A 3BG0B 3R7RA 2MOWA 5DO2A 2DSWA 2ETAA 3V2XA 5HW7A 3UXGA 4G24A 3ARWA 4L72B 3HXFA 1U3DA 1ELWA 3GZ2A 1TNYA 2YNQA 5BV0A 1O1TA 3PA7A 3QOUA 3IHZA 4NSBA 4HXIA 2V4HC 4DX7D 3PZ3A 1C9HA 4FN2A 4TV3A 3CEQA 1HO8A 5FZSA 4LAVA 3CVPA 4LAYA 1LL4A 4ZFHA 4GZDA 4MSPA 2UY1B 4JA9A 3UI5A 2KFWA 4HBOA 3QJZA 4DWSB 1H2VC 1Z6TA 1HKIA 4F7AA 1Y6IA 4G23A 5HTGA 3TWSA 3FU3A 4GMRA 3E4BA 2R2LA 1ZBKA 4H7XA 3VLDA 2F2DA 4CZ2D 1DVPA 3L16A 3E30A 3KSQA 4UI9C 2FAPA 3IBEA 2XP6A 4GZCA 4GTSA 1OWMA 2XP3A 4C02B 5BT1A 3CLJA 3ONLA 1SYTA 3B7TA 3FHEA 5D75A 3UM2A 4W9PA 3G2SA 4PS8A 3MX3A 1H0AA 2JABA 4G1TA 2WB2A 5CECB 1FVFA 1WDYA 2PL2A 2DG9A 4TW8A 2IEJA 1NWRA 4M7CA 3RO3A 4FJZA 3WXXA 1TEZA 2WLZA 4XIFA 4YDOA 2XPZA 1YA0A 4N2QA 2RG8A 2V5FA 1H0IA 4WJXA 3CR3A 2IONA 2KCKA 5ANRA 4MNJA 4NIKA 4U96D 4ATZD 2R17C 1W1PA 2I2OA 3Q75A 4APFA 1GUVA 3MCXA 4L2LA 1TNOA 5KCMA 3G6LA 3E33A 2RSEA 2MHKA 5T3RA 3EHMA 1N0RA 2WXLA 4UQYA 2PPNA 4KT6B 2P58C 1TFVA 4PTMA 4HRMB 4IQ2A 1DC2A 1MZCA 4JD2G 2M2AA 2PPPA 2BKKB 4K5CA 4HQDA 3EHQA 3C98A 5A6CA 2DYRE 3TG4A 2FULA 3PRBA 2CHXA 2L6BA 4TXRA 4N5CA 2CHZA 4J8SA 1FKHA 3V31A 1HH8A 2ZR4A 5HT1A 2XRZA 2WQ7A 1BL4A 2DYSE 2LJ4A 4DIPA 3W4RA 3W9FA 1XGWA 2L0IA 4A63B 2VSYA 3T8MA 1NWSA 4GA2A 3PZ1A 2GRQB 1UR8A 1K8KG 1LD8A 3L6AA 4J8EA 3PE3A 5B3SE 1OWQA 4I2WA 1JWGA 3CV0A 5EIBE 2KC7A 3D9HA 4JFLA 2C0MA 4ABNA 3ARYA 4DRXE 3CVVA 4CEMA 3UI2A 5ENRD 1HG5A 4ZPTR 3D9IA 3KAEA 4DRQA 4MBGA 3FUKA 3G6MA 2KZTB 4ZPVR 3RRMB 3L22A 2XPIA 4CCAA 3TCZA 2VN1A 4I1OB 1NP7A 4GTPA 4XKCA 1Y8MA 4G26A 5KJMA 3FUHA 3GZSA 3D9LA 2HE0A 2HR2A 3FUDA 3N71A 3B7UX 2MRIA 4W9RA 2MLZA 4FHKA 4PH4B 1N11A 3ZRHA 3ARUA 2M63A 3ASFA 2P4VA 2LO6A 3J5PA 3PZDA 2R59A 3RRNB 1E6RA 4HBEA 2ZR5A 4PS7A 1OGBA 2VSOE 2WXKA 3FTVA 2KCVA 5AQAA 4DX2A 5JJ7A 1UG3A 4U86A 3O5DA 4I17A 5D0OD 1LF8A 3CK8A 2DIWA 1HJVA 2MLYA 2KM4A 1OWNA 4FADA 1ELRA 4C0EA 3FEYA 3T5VA 2ZR6A 1Y0OA 1VDYA 4KXKB 4M3OA 3SF4A 2XPBA 5AJDA 2XCBA 4ME2A 3UQIA 1TJCA 1H2UA 1K1BA 3ZXSA 4GMJA 2LXMA 1LG1A 1UJKA 4AP2A 3JYJA 3U9WA 4UDMA 3C72A 3QC1A 2NXPA 3IKOB 3SZ7A 2CHWA 1W1TA 5ENOD 2DWZA 1D7HA 3WH0A 3KS2A 4S3JA 1FKTA 1EHNA 4BX9A 3ARRA 2XS8A 2J9QA 2X6JA 4NQ0A 5JJTA 2A3AA 3EHRA 3QB2A 5KJNA 3UI6A 3TWWA 3LXUX 3Q9UC 2IO3C 3O5MA 4JYSA 1E15A 3KADA 1HKMA 3L9TA 3MEKA 2FKEA 3D9MA 3MV3B 4N39A 3HVEA 4WWOA 3JXJA 4NNRA 4Z2JA 1N4RA 4EZKA 3ARZA 1IHGA 3FU5A 3D9PA 5FIOA 4OAVB 4F6RD 4G50A 5AJLA 2WM0A 4DRPA 4GAAA 3TWQA 4S3KA 1NH6A 2A5UA 1QQEA 4GPKA 3ARTA 5FQ8A 5CERB 2FDMA 3TWTA 4BESA 4WIWA 3ALGA 3ULYA 2VGEA 3TGOA 3GTYX 4DWSD 1Z3XA 2PI6A 3EY6A 1HF8A 4DRJA 4DRIA 5G05C 5DBKA 1JNTA 3VLFA 3GPKA 4AY1A 3D9JA 3PZ4A 4ITZA 1TCOC 4AY5A 1FFQA 3EIPA 2DVWA 2MF9A 3B8SA 1K9TA 1NA3A 2GRMA 1FKIA 4GYYA 1OT8A 3T5XA 3CHOA 1F40A 4QIBA 3PRZA 4U04A 4CGVA 5IY5E 1BI7B 1ZBVA 3FUNA 3SHFA 1BU9A 4JZYA 3ML9A 5AQ7A 2L9BA 3ASHA 3FUEA 1KT1A 3ODKA 2J49A 5HI7A 3P1UA 3S7DA 4TUMA 2XPAA 5CCMA 3OAWA 4P8VA 3CGMA 1E44A 4ANXA 5HW8A 2B6CA 1HJXA 1E8YA 4HLLA 3JUIA 5E76A 5JA4D 4HORA 4ZS6A 2V8SE 1EDUA 3IKDA 3FH5A 5KJKA 5EKQD 3V2OA 3WD4A 4BSZB 3RMEA 4ATGA 3L13A 1ZCNA 2XGOA 3CVUA 1NZNA 3ULEG 3EIJA 2KBXA 2VJ8A 5BV1A 3UM0A 3SQVA 2PQRA 3SI5A 3UQAA 5DF0A 1IX5A 4GA0A 4U07A 1V55E 4JVSA 3CSFA 4XX5A 3CVYA 2B0OE 4U84A 2WXJA 3W9GA 1UOHA 4YVQC 2R03A 2VCDA 3MJWA 3AAAC 3UINC 3HXEA 4AV7A 3ARQA 1LG2A 1W9UA 5AIJA 4IYPA 5BPPA 2DPEA 3UKRG 5GPRA 3S7FA 1WM5A 5G05J 5LCWC 5GPGA 1OWLA 4AOFA 4TW7A 4HNAD 4I6EA 3QNKA 4A3VA 5C1DA 3TL5A 5LP0A 4CYMD 2F21A 2V0PA 4DX5D 3AS3A 3BG1B 2AJAA 4ODRA 4R7LA 1BD8A 3KABA 1NWUA 3TAXA 5KNHD 4I1AA 4NURA 1ROTA 3O5OA 5DIUA 4U8HA 4JEHA 3AU4A 1OCOE 4GTVA 3K9IA 5CRUA 1RZ4A 2IF4A 4LSZE 3JYMA 5JHBA 2ZU6B 3RIBA 1VF8A 2WXHA 2AWIA 1WAWA 4AEZC 3LEWA 1X81A 2YQ8A 3CK9A 3NOCD 2RFAA 4FA6A 4ACLA 3PEUB 3TDBA 2WK2A 1DNPA 5AN8A 4QT3A 3MKQA 5EYLA 4HBDA 3UT8A 4JL0A 3LJ3A 3CVLA 4Z68A 1S64A 4HOQA 2ZXWE 2WXQA 1FKLA 1JCQA 1FAPA 1UN8A 3Q4AB 1FCHA 3DPYA 1WAO1 3PH0C 1N4QA 4JHRA 2ETCA 2PPOA 1T11A 1BPOA 3HIZA 1MX2A 3BU8A 5G04C 2LKNA 4CDNA 3ABLE 1MQSA 2BKGA 4MNMA 3LKUA 3EJNA 4FULA 4W9QA 4GMLA 4I9EA 3NZSA 3RJVA 4WNEA 2VGXA 2XENA 4CRWA 2C0LA 3KEAA 3C3RA 3ONKA 4BSXA 1D8EA 3S2AA 4R0XA 4MPKA 4LAXA 4ODPA 2XP9A 2BF0X 5CBOA 3CHRA 3TJPA 4J0UA 5LCWJ 1L5JA 3L17A 4LNUD 3JQ1A 2KR7A 4YNDA 4DRMA 3ARVA 1N4PA 4DJAA 2VTBA 4KVOA 3CVQA 1Q6UA 2V4LA 1J4RA 1HX8A 3FY1A 3PR9A 4HVBA 4IRUA 4FLHA 2VYIA 4Q69A 3B95A 3QAQA 3NI6A 2IY0C 2WXRA 5BXJA 3OXGA 1N52A 3VAWA 1W1YA 3UIOC 4EZJA 2N87A 5KNGA 2JLBA 4LNBA 3MKRA 3RM8A 3QKYA 3MV2B 4JA7A 3O4ZA 4W5UA 3RGCA 1ZBWA 4XEIG 5G2NA 1L1PA 2IJGX 4J4OA 4EPZA 3AS8A 3O48A 4GTMA 3CQGB 4C0MA 1LD7A 4ODNA 1FJDA 3B9AA 3CHEA 1OXJA 3O5LA 5GQBA 4LGXA 2DSUA 3B9EA 3APCA 2LNIA 2ZQUA 3FP3A 3Q47B 2F8YA 3HHMA 4Z2KA 2O9OA 5G04J 2H6IA 3FU6A 5EX3A 3ARPA 4U63A 2AXVA 1GPFA 2Y1LE 2WXNA 5B1BE 3ENEA 4XZ4A 5KWDA 1GW6A 5KJLA 1YATA 2EQXA 3AG1E 5CHEE 3IEGA 2PNNA 3D9KA 4I1MA 4MLPA 3NB2A 4I2ZA 2WQ6A 1DCQA 1MX6A 2AVPA 3H9RB 4J7WA 3CHFA 2P9LG 4ZPWR 3O5FA 3RU0A 4ML4A 2P9SG 3UI4A 2OVBA 4FLBA 2NSZA 4N3AA 2E0IA 4C9BB 3KD7A 4K5BA 3UPVA 2RUCA 1U2VG 1H19A 4FAPA 3G2WA 3KAIA 3OOBA 3Q78A 4BX8A 3LYAA 3ZU7B 3FFLA 4E85A 1E6ZA 2LAHA 2LSVA 4IPXA 2H6FA 4U7EB 1JNEA 2GRLA 4XAKA 4ILIA 4HOTA 2EILE 3PVLA 1W1VA 3HG0D 2LGOA 1PC2A 3C5RA 5HS0A 3O5QA 2NC9A 3FUJA 4AXHA 3CHPA 4URIA 3MA5A 3WG7E 1NI1A 4WKFA 3SFYA 3VTYA 2HM8A 4EHMA 4DRKA 2CG2A 2MNTA 1H6PA 2ZQSA 4ODQA 4OVVA 2WMOA 3SD5A 2YINA 3ARXA 3EU5A 5ENTD 2GRPB 1FKGA 3DXKG 2DZNA 4CDRA 2DZOA 5J6EA 1G3NB 4Q22A 4YDEA 2Y3AA 1FKBA 2AOSA 1KT0A 1H0GA 2X38A 2FBNA 2B5UB 3R7QA 2VSNA 2AWGA 2CG3A 3ZGQA 4DH0A 4LCTA 2J09A 4AY6A 3ZW3A 5ENQD 2AXUA 3U3WA 1B6CA 3ZHEB 3PUKA 4HARA 1D8DA 4A1SA 3Q79A 5E75A 3QWWA 4KZ0A 2P9IG 4BF8A 3AS0A 1HKJA 1QBQA 3C3OA 1S70B 4NZCA 3RM4A 3I4GA 2KXPC 3HVEB 1EQ3A 4DX6D 1S63A 2EIME 4J6IA 4WNDA 3BEEA 4Z2LA 5HRYA 2PBCA 2ZIRA 3ABME 1P5QA 2WMNA 5H7PA 2ZQVA 3DRAA 4G25A 1HG2A 2A3CA 4WWNA 3ZYMA 2XEVA 4GCNA 3LY8A 3CQCB 3Q73A 5BXOA 3HXDA 4U0UA 1JUQA 1HZ4A 4G2VA 4ANVA 3AG3E 3NQPA 4ANUA 2G41A 3O5IA 3HYMB 4HRNA 3OA5A 4JXTA 3ASOE 2JZVA 4D10C 1D2KA 4IT4A 2L2SA 1X6NA 4U8YD 5CMYA 4KYOB 2WXPA 4FC8A 5B1AE 1LJYA 3FTSA 5ENSD 4JHJA 4B8CB 1NMWA 2IU1A 3E32A 1E90A 4HB5A 3TWUA 2OFNA 2I1JA 1TYQG 4RVBA 3CHSA 1YW5A 5JH8A 4J8DA 4AM9A 2MPHA 2BUGA 3ESLA 3PZ2A 3I4RB 2OLHA 1J4HA 3AJIA 1D7JA 1SZAA 3DBSA 2PV3A 3PREA 4O1OA 4ANWA 1PINA 2GW1A 1N95A 4JB8P 3FAPA 1ITXA 5JJ6A 2HYZA 1SR0A 1PAQA 4QT2A 4BTBA 2FF4A 1HE8A 4P8XA 3WD3A 2IOLA 4LAWA 1WY6A 1TNUA 4K0RA 4Z2GA 5CRVA 5ITZF 2WXIA 1OCCE 3R9AB 1FPPA 4I9CA 1IHBA 1TN8A 5HUAA 1IYGA 1K1AA 2KO7A 4P8UA 4B89A 1FT1A 3J5QB 1PY1A 4HS2A 3FWVA 3QDNA 1YYHA 1MHQA 5FTPA 5ANLA 2VQ2A 4BY6A 3LY7A 3OTNA 4UI9K 2XQ0A 3EU9A 3DWLG 4L7TA 1SVXA 4A3TA 4WUYA 5BW8C 1E8XA 5HW6A 2JEKA 3UKUG 1AP7A 4APOA 4RLYA 5I98A 1KZOA 2X6KA 2ZGDA 4B94A 4G11A 4O60A 1BLXB 2X3MA 1OUVA 3CHQA 3CHMA 2IO2C 5AENA 3U64A 3ARSA 2F0YA 4HLEA 5DEZA 2NYJA 3ZKJA 1LL6A 4O1PA 2P2CP 4UUCA 3CKBA 3CSTA 3R9MA 3L82A 2X6IA 2OCCE 4RQIA 5A23A 1NA0A 2OOEA 4LG6A 2LXLA 3DEOA 3KSLA 2UZ5A 4X8QA 2QYUA 5FINA 4F3VA 1EF1C 3DSUA 2Y78A 3ZVVA 1N4SA 1TNZA 1J4IA 2G8ZA 3WL1A 2XRYA 4KR0B 4KZCA 4HOSA 2XS1A 1W3BA 4N3BA 4DI4A 2UWJG 3FTXA 3S7JA 3MKQB 4IT6A 4JFKA 3FU0A 2D9FA 2L0TB 3ZUVB 1HXVA 4TUUA 2WXGA 1SA5A 2GGFA 3FDHA 1GOIA 5BNWA 1KFWA 4DK5A 4IQCA 3BMBA 1IQUA 2RFMA 4WKHA 3LY9A 3I6CA 3F6QA 2Q7FA 5EYPF 2A4ZA 5G55A 4B93B 1INZA 4U95D 2WM9A 3QK0A 5CEDB 1FKFA 2ZISA 2X6HA 3TC5A 4E6HA 2VGXB 1N0QA 4K03A 3WD1A 2GROB 4Q94A 5EILA 2XGSA 3APFA 3MYVA 4U0SA 2KE0A 3JCKC 5FJYA 3ZN3A 2RD0A 4GYOA 3P2BA 1U79A 1SZ9A 3PE4A 3WQVA 5AYWD 1R9HA 3WD0A 4YDWA 3SGHA 4HFGA 3O5RA 3E34A 2LAIA 2ETNA 1Q6HA 4G8KA 5DIVA 4WKAA 4CGWA 2ESCA 3C3QA 3LUOA 4HOUA 3KACA 4O6FA 3BXWA 1H6KA 2VTBB 4GZ5A 2K8IA 4PS3A 1EIBA 3O5EA 3O5KA 5FQ6A 4JHKA 4B0ZA 1H2TC 3PRDA 4KQZA 4QQIA 1EYMA 2DSVA 2FO1E 4BEPA 4XE0A 1E7UA 4B8AA 4CT0A 2YBTA 2DT3A 3CVWA 1JNDA 3AU5A 2R5SA 3DEPA 2Y4UA 3VLEA 1SW6A 5AQ9A 4YDYA 2DSZA 1TN7A 1E6NA 1CTNA 4AVXA 2XHEA 4LUNU 1W26A 1OGGA 5ARGA 3HRAA 2KCLA 3FH8A 1E6PA 1E8ZA 4TYOA 4LRZA 2BEDA 4TX0A 1ZK6A 1E9LA 5FZRA 2XP5A 2PN0A 1FKJA 1JCSA 2X6FA 3HXBA 4L23A 5AQBA 3FUMA 4RG9A 1M5YA 1UW4B 3RO2A 2QY7A 3UQBA 4I43A 2XP7A 3ULQA 4Q96A
chains in the Genus database with same CATH topology
2E2EA 4JEUA 4MAVA 1U3CA 5D0QD 4RG6A 3CKCA 2ONDA 5FT9A 4BT9A 4FJYA 4BFRA 1UJJA 1ZU2A 4I6JA 1OWOA 3MZLB 4N3CA 3KZ7A 4JW1A 4FP7A 3B7RL 4PUCA 5HBFA 3ML8A 4QZVB 3APDA 3WL0A 2QFCA 3FY4A 3B9DA 1FD9A 1SQMA 1HU3A 1JPLA 2XPYA 4L2YA 3CVXA 1QPLA 4GCOA 3QWVA 2DG3A 2IQCA 4CT4A 1WB0A 4ODLA 5C2YA 4BTAA 3AS2A 3UQ3A 2I6HA 3IHYA 1W9PA 4AIFA 1EDQA 1LL7A 2VGYA 4CDMA 3RRUA 2PM6A 3ASDA 3UT4A 3ZYKA 4DPRA 1FKDA 4Z2HA 1X6LA 2Q5AA 1EYHA 3B7SA 3PDNA 3ZYQA 4H7YA 2L6JA 3U4TA 1UN9A 3ZEFA 2I1KA 2OV8A 3NRKA 2I9CA 3RKVA 1NSGA 3UT7A 4Q7NA 3KAGA 4QFVA 5JHAA 3MGBA 4KBQA 1XNFA 4AJWA 4F53A 4EQFA 2B31A 4J8FA 1O6IA 1IQRA 4W9OA 1HJWA 1A7XA 2UY1A 4P8WA 2PQNA 4GZ6A 3Q15A 2XCCA 4DWSA 4JFMA 3WKZA 4A1GA 3GZ1A 3CZ8A 2AW6A 2RQSA 1FFRA 2DBAA 3IKGA 4TRQA 5DIZA 3CGHA 4MRUA 1ZU8A 4GIVA 1NWTA 4MTVA 2DT1A 1B89A 1XRVA 3JQ0A 2IFUA 2M08A 4XI0A 4U85A 3JYSA 2KATA 3ZYLA 2M1IA 4UI9J 2F4EA 2WXOA 5DITA 3LPZA 4Y6WA 3AS1A 3FTZA 3ASGA 1HXIA 1ZBPA 3NF1A 3AQUA 1PBKA 4FHJA 4WK9A 1FVHA 4O2TA 2DCPA 4NACA 3TXNA 1ZB5A 2XP4A 3D9NA 4A55A 5HQ8A 2C2LA 1F8AB 5EX0A 3PS6A 4MNKA 3B13A 2MLXA 3ALFA 3O5PA 3CHDA 4XI9A 1FKKA 2CFUA 4IULA 2LPVA 3QWPA 2BTDA 1NMVA 2ZQTA 3FXYA 5CCLA 4DZ3A 3FEXA 4GU5A 1E7VA 3KAHA 5HWBA 2DT2A 3URZA 2XP8A 3CH9A 3ZFWA 3ZPJA 4ILGA 5FZQA 3FTUA 1FKRA 2RUQA 4MGVA 3GW4A 4FU3A 3EIQC 4DZ2A 2KZTA 4GA1A 5T8IA 3IHVA 3DPDA 3OXFA 3KEZA 4DLQA 2WPVA 5B8IC 2WQHA 3MDYB 1Z3YA 5LFAA 1TJFA 4L1BA 3O5JA 3ZHEA 1UR9A 5LX8A 1D6OA 3LVRE 4JC8A 4UWHA 3SNXA 1E96B 4ODMA 3PUJA 4PDXA 4KMOA 4URKA 5J90A 3QOKA 3CIAA 3EHNA 3CVNA 1ZBCA 5T4YA 2FO7A 5ENNA 3ESKA 4WNGA 3PNTB 3TG5A 2QF8A 4TNSA 3Q49B 3VTXA 4RSYA 3NZUA 4JFJA 1ELKA 5FQ4A 3IV0A 1HS6A 4Y6CA 2PV1A 4EZLA 4N2SA 2LSUA 4DRHA 4LEUA 5HKGA 1ROUA 2ILRA 2DT0A 3LDZA 1E8WA 2KGJA 4EECA 3QARA 3AROA 2XGMA 1Q6IA 4ILHB 1KLXA 4F1SA 3FTYA 1A17A 2YHCA 4I6GA 3GYZA 1S0PA 1JVWA 3WD2A 3KAFA 3UF8A 3FUIA 4LERA 4J4NA 3LCAA 3FUFA 1EPUA 5BUZA 3NTPA 1LQ0A 2O92A 4UWKA 3HDXA 3ZIMA 3UUXA 4ODOA 4V3IA 3FULA 4GZ3A 3AS5A 3IK8A 4JPSA 1OWPA 1N54A 2KI3A 2WVIA 3CGNA 3EDTB 1QPFA 4N19A 1RD6A 4ACKA 4L3NA 5A7DB 2J08A 3Q5MA 3RFWA 4GGQA 2J07A 4Z2IA 5CMWA 4DRNA 3G2TA 4OYSA 5HWCA 3OXLA 1JWFA 5FWQA 4NRHB 4DLOA 1ZL1A 3L54A 3FTWA 4MKTA 5J08A 3CK7A 2OVFA 1XHGA 4MS6A 3UX4A 1FKSA 3D9OA 2YBUA 4EBAG 3CHCA 1Q1CA 1HKKA 4XKBA 3L08A 1W9VA 5EDSA 3G2UA 2A3BA 4ODKA 4WAFA 2PM7A 3LVQE 4GB9A 2A3EA 1QZ2A 4UQZA 3FH7A 2WXMA 3TXMA 4BT8A 3SBTB 3I5PA 3UMVA 2ITKA 4R5EA 4U0ZA 2IUZA 4UWFA 1BKFA 5M72A 2WXFA 4WWPA 4MNLA 1HFAA 3G2VA 3WIJA 2PZIA 5FQ7A 3JXVA 4DROA 3KCEA 5ARFA 2WLYA 3O5GA 2PV2A 3SFZA 4YVOA 4TW6A 1JNSA 3AS4A 4P29A 3PRAA 3RK6A 3S7BA 3SBSA 2J4DA 4BWRA 1QNFA 3I3NA 3LS8A 4UWLA 1J6YA 2HO1A 4EBAA 4OVUA 3PNLB 2RUDA 4KVMA 2VSXE 2FEZA 4WNFA 3WQWA 3PEVB 3D3MA 4IN3B 2CFZA 2J4BA 3B7XA 2Y4TA 2RURA 1X5BA 2DG4A 3U66A 4G2PA 1D7IA 4JFIA 1WNOA 2IOSA 5LOZA 2YHEA 4GYWA 4DWSC 2AXZA 4DT4A 1N1AA 3RM9A 2FI7A 4UWGA 4UQXA 4DI3A 3BG0B 3R7RA 2MOWA 5DO2A 2DSWA 5HW7A 4G24A 3ARWA 4L72B 1U3DA 1ELWA 3GZ2A 2YNQA 5BV0A 3PA7A 3QOUA 3IHZA 4NSBA 4HXIA 1C9HA 4FN2A 4TV3A 3CEQA 1HO8A 5FZSA 4LAVA 3CVPA 4LAYA 1LL4A 4GZDA 4MSPA 2UY1B 4JA9A 3UI5A 2KFWA 4HBOA 3QJZA 4DWSB 1H2VC 1Z6TA 1HKIA 4F7AA 1Y6IA 4G23A 5HTGA 3FU3A 3E4BA 1ZBKA 4H7XA 3VLDA 2F2DA 1DVPA 3L16A 4UI9C 2FAPA 3IBEA 2XP6A 4GZCA 1OWMA 2XP3A 4C02B 5BT1A 3CLJA 3ONLA 1SYTA 3B7TA 3FHEA 5D75A 4W9PA 3G2SA 4PS8A 3MX3A 1H0AA 4G1TA 2WB2A 1FVFA 2PL2A 2DG9A 4TW8A 1NWRA 3RO3A 4FJZA 3WXXA 1TEZA 2WLZA 4XIFA 2XPZA 1YA0A 4N2QA 2RG8A 2V5FA 1H0IA 4WJXA 3CR3A 2IONA 2KCKA 5ANRA 4MNJA 2R17C 1W1PA 2I2OA 4APFA 1GUVA 3MCXA 4L2LA 5KCMA 3G6LA 2RSEA 2MHKA 5T3RA 3EHMA 2WXLA 4UQYA 2PPNA 4KT6B 2P58C 1TFVA 4PTMA 4IQ2A 2M2AA 2PPPA 3C98A 5A6CA 3PRBA 3TG4A 2FULA 2CHXA 4N5CA 2CHZA 4J8SA 1FKHA 1HH8A 2ZR4A 5HT1A 2XRZA 2WQ7A 1BL4A 2LJ4A 4DIPA 3W4RA 1XGWA 2L0IA 2VSYA 3T8MA 1NWSA 4GA2A 1UR8A 3L6AA 4J8EA 3PE3A 1OWQA 4I2WA 1JWGA 3CV0A 2KC7A 4JFLA 2C0MA 4ABNA 3ARYA 3CVVA 4CEMA 1HG5A 4ZPTR 3D9IA 3KAEA 4DRQA 3FUKA 3G6MA 2KZTB 4ZPVR 3RRMB 3L22A 2XPIA 4CCAA 3TCZA 2VN1A 4I1OB 1NP7A 4XKCA 1Y8MA 4G26A 5KJMA 3FUHA 3GZSA 3D9LA 2HR2A 3FUDA 3N71A 3B7UX 2MRIA 4W9RA 2MLZA 4FHKA 4PH4B 3ZRHA 3ARUA 2M63A 3ASFA 2LO6A 3PZDA 2R59A 3RRNB 1E6RA 4HBEA 2ZR5A 4PS7A 1OGBA 2VSOE 2WXKA 3FTVA 2KCVA 5JJ7A 1UG3A 4U86A 3O5DA 4I17A 5D0OD 1LF8A 3CK8A 2DIWA 1HJVA 2MLYA 2KM4A 1OWNA 4FADA 1ELRA 4C0EA 3FEYA 3T5VA 2ZR6A 1Y0OA 1VDYA 4KXKB 4M3OA 3SF4A 2XPBA 5AJDA 2XCBA 4ME2A 3UQIA 1TJCA 1H2UA 3ZXSA 4GMJA 1LG1A 1UJKA 4AP2A 3JYJA 3U9WA 3QC1A 2NXPA 3IKOB 3SZ7A 2CHWA 1W1TA 1D7HA 3WH0A 3KS2A 4S3JA 1FKTA 1EHNA 4BX9A 3ARRA 2J9QA 2A3AA 2X6JA 4NQ0A 5JJTA 3QB2A 5KJNA 3UI6A 3LXUX 3O5MA 4JYSA 1E15A 3KADA 1HKMA 3MEKA 2FKEA 3D9MA 3MV3B 4N39A 3HVEA 4WWOA 4NNRA 4Z2JA 4EZKA 3ARZA 1IHGA 3FU5A 3D9PA 4G50A 5AJLA 2WM0A 4DRPA 4GAAA 4S3KA 1NH6A 2A5UA 1QQEA 4GPKA 3ARTA 5FQ8A 2FDMA 4WIWA 3ALGA 3TGOA 4DWSD 1Z3XA 2PI6A 3EY6A 1HF8A 4DRJA 4DRIA 5G05C 5DBKA 1JNTA 3VLFA 3GPKA 4AY1A 3D9JA 4ITZA 1TCOC 4AY5A 1FFQA 2MF9A 3B8SA 1K9TA 1NA3A 2GRMA 1FKIA 4GYYA 3T5XA 3CHOA 1F40A 4QIBA 3PRZA 4U04A 4CGVA 1ZBVA 3FUNA 3SHFA 4JZYA 3ML9A 2L9BA 3ASHA 3FUEA 1KT1A 3ODKA 2J49A 5HI7A 3P1UA 3S7DA 2XPAA 5CCMA 3OAWA 4P8VA 3CGMA 4ANXA 5HW8A 1HJXA 1E8YA 3JUIA 5E76A 4ZS6A 4HORA 2V8SE 1EDUA 3IKDA 3FH5A 5KJKA 5EKQD 3WD4A 3RMEA 4ATGA 3L13A 1ZCNA 2XGOA 3CVUA 1NZNA 3EIJA 2VJ8A 5BV1A 2PQRA 3SI5A 3UQAA 5DF0A 1IX5A 4GA0A 4U07A 4JVSA 3CSFA 4XX5A 3CVYA 4U84A 2WXJA 4YVQC 2VCDA 3MJWA 4AV7A 3ARQA 1LG2A 1W9UA 5AIJA 4IYPA 5BPPA 2DPEA 5GPRA 3S7FA 1WM5A 5G05J 5LCWC 5GPGA 1OWLA 4AOFA 4TW7A 4I6EA 3QNKA 4A3VA 5C1DA 3TL5A 5LP0A 2F21A 2V0PA 3AS3A 3BG1B 4ODRA 4R7LA 3KABA 1NWUA 3TAXA 4I1AA 4NURA 1ROTA 3O5OA 5DIUA 4U8HA 4JEHA 3AU4A 3K9IA 3JYMA 2IF4A 5JHBA 2ZU6B 3RIBA 1VF8A 2WXHA 2AWIA 1WAWA 4AEZC 3LEWA 2YQ8A 3CK9A 4FA6A 4ACLA 3PEUB 3TDBA 2WK2A 1DNPA 4QT3A 3MKQA 3UT8A 4JL0A 3LJ3A 3CVLA 4HOQA 2WXQA 1FKLA 1FAPA 1UN8A 3Q4AB 1FCHA 1WAO1 3PH0C 4JHRA 2PPOA 1T11A 1BPOA 3HIZA 5G04C 2LKNA 4CDNA 1MQSA 4MNMA 3LKUA 3EJNA 4FULA 4W9QA 4GMLA 4I9EA 3NZSA 2VGXA 4WNEA 3RJVA 4CRWA 2C0LA 3ONKA 4BSXA 3S2AA 4R0XA 4MPKA 4LAXA 4ODPA 2XP9A 2BF0X 3CHRA 3TJPA 4J0UA 5LCWJ 1L5JA 3L17A 3JQ1A 2KR7A 4YNDA 4DRMA 3ARVA 4DJAA 2VTBA 4KVOA 3CVQA 1Q6UA 2V4LA 1J4RA 1HX8A 3FY1A 3PR9A 4HVBA 4IRUA 4FLHA 2VYIA 4Q69A 3QAQA 3NI6A 2WXRA 5BXJA 3OXGA 1N52A 3VAWA 1W1YA 4EZJA 2N87A 2JLBA 3MKRA 3RM8A 3QKYA 3MV2B 4JA7A 3O4ZA 4W5UA 3RGCA 1ZBWA 5G2NA 1L1PA 2IJGX 4J4OA 4EPZA 3AS8A 3O48A 3CQGB 4C0MA 4ODNA 1FJDA 3B9AA 3CHEA 3O5LA 5GQBA 4LGXA 2DSUA 3B9EA 3APCA 2LNIA 2ZQUA 3FP3A 3Q47B 3HHMA 4Z2KA 2O9OA 5G04J 3FU6A 5EX3A 3ARPA 4U63A 2AXVA 1GPFA 2WXNA 3ENEA 4XZ4A 1GW6A 5KJLA 1YATA 2EQXA 5CHEE 3IEGA 3D9KA 4I1MA 4MLPA 4I2ZA 2WQ6A 2AVPA 3H9RB 3CHFA 4ZPWR 3O5FA 3RU0A 4ML4A 3UI4A 2OVBA 4FLBA 2NSZA 4N3AA 2E0IA 4C9BB 3KD7A 3UPVA 2RUCA 1H19A 4FAPA 3G2WA 3KAIA 3OOBA 4BX8A 3LYAA 3FFLA 4E85A 1E6ZA 2LAHA 2LSVA 4IPXA 1JNEA 2GRLA 4XAKA 4ILIA 4HOTA 3PVLA 1W1VA 2LGOA 1PC2A 3O5QA 2NC9A 3FUJA 4AXHA 3CHPA 4URIA 3MA5A 4WKFA 3VTYA 2HM8A 4DRKA 2CG2A 2MNTA 2ZQSA 4ODQA 4OVVA 2WMOA 3SD5A 2YINA 3ARXA 1FKGA 4CDRA 5J6EA 4Q22A 2Y3AA 1FKBA 2AOSA 1KT0A 1H0GA 2X38A 2FBNA 3R7QA 2VSNA 2AWGA 2CG3A 3ZGQA 4DH0A 4LCTA 2J09A 4AY6A 3ZW3A 2AXUA 3U3WA 1B6CA 3ZHEB 3PUKA 4HARA 4A1SA 5E75A 3QWWA 4KZ0A 4BF8A 3AS0A 1HKJA 4NZCA 3RM4A 3I4GA 3HVEB 1EQ3A 4J6IA 4WNDA 3BEEA 4Z2LA 2PBCA 1P5QA 2WMNA 2ZQVA 4G25A 1HG2A 2A3CA 4WWNA 3ZYMA 2XEVA 4GCNA 3LY8A 3CQCB 4U0UA 1JUQA 1HZ4A 4G2VA 4ANVA 3NQPA 4ANUA 2G41A 3O5IA 3HYMB 3OA5A 4JXTA 2JZVA 4D10C 1D2KA 4IT4A 2L2SA 1X6NA 5CMYA 4KYOB 2WXPA 4FC8A 1LJYA 3FTSA 4JHJA 4B8CB 1NMWA 2IU1A 1E90A 2OFNA 2I1JA 4RVBA 3CHSA 1YW5A 5JH8A 4J8DA 4AM9A 2MPHA 2BUGA 3ESLA 3I4RB 2OLHA 1J4HA 1D7JA 1SZAA 3DBSA 2PV3A 3PREA 4ANWA 1PINA 2GW1A 3FAPA 1ITXA 5JJ6A 2HYZA 1SR0A 1PAQA 4QT2A 4BTBA 2FF4A 1HE8A 4P8XA 3WD3A 2IOLA 4LAWA 1WY6A 4K0RA 4Z2GA 2WXIA 3R9AB 4I9CA 5HUAA 1IYGA 2KO7A 4P8UA 4B89A 1PY1A 4HS2A 3FWVA 3QDNA 1MHQA 5FTPA 5ANLA 2VQ2A 4BY6A 3LY7A 3OTNA 4UI9K 2XQ0A 4L7TA 4A3TA 4WUYA 5BW8C 1E8XA 5HW6A 2JEKA 4APOA 5I98A 2X6KA 4B94A 4G11A 2X3MA 1OUVA 3CHQA 3CHMA 5AENA 3ARSA 3U64A 4HLEA 5DEZA 1LL6A 3CKBA 3CSTA 2X6IA 5A23A 1NA0A 2OOEA 2UZ5A 4F3VA 1EF1C 2Y78A 3ZVVA 1J4IA 2G8ZA 3WL1A 2XRYA 4KR0B 4KZCA 4HOSA 1W3BA 4N3BA 4DI4A 2UWJG 3FTXA 3S7JA 3MKQB 4IT6A 4JFKA 3FU0A 2D9FA 2L0TB 1HXVA 4TUUA 2WXGA 2GGFA 3FDHA 1GOIA 5BNWA 1KFWA 4DK5A 4IQCA 1IQUA 4WKHA 3LY9A 3I6CA 2Q7FA 2A4ZA 5G55A 1INZA 2WM9A 3QK0A 1FKFA 2X6HA 3TC5A 4E6HA 2VGXB 4K03A 3WD1A 4Q94A 2XGSA 3APFA 3MYVA 4U0SA 2KE0A 3JCKC 5FJYA 3ZN3A 2RD0A 4GYOA 3P2BA 1U79A 1SZ9A 3PE4A 3WQVA 5AYWD 1R9HA 3WD0A 3SGHA 4HFGA 3O5RA 2LAIA 1Q6HA 5DIVA 4WKAA 4CGWA 2ESCA 3LUOA 4HOUA 3KACA 4O6FA 3BXWA 1H6KA 2VTBB 4GZ5A 2K8IA 4PS3A 1EIBA 3O5EA 3O5KA 5FQ6A 4JHKA 4B0ZA 1H2TC 3PRDA 4KQZA 1EYMA 2DSVA 4XE0A 1E7UA 4B8AA 4CT0A 2YBTA 2DT3A 3CVWA 1JNDA 3AU5A 2R5SA 2Y4UA 3VLEA 2DSZA 1E6NA 1CTNA 4AVXA 2XHEA 4LUNU 1W26A 1OGGA 5ARGA 2KCLA 3FH8A 1E6PA 1E8ZA 4TYOA 4LRZA 4TX0A 1ZK6A 1E9LA 5FZRA 2XP5A 1FKJA 2X6FA 4L23A 3FUMA 4RG9A 1M5YA 1UW4B 3RO2A 2QY7A 3UQBA 4I43A 2XP7A 3ULQA 4Q96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HWC A;  2E2E A;  3OXL A;  3KAI A;  3OOB A;  3LYA A;  3FFL A;  5D0Q D;  4NRH B;  2LSV A;  4IPX A;  3O5M A;  4JYS A;  4RG6 A;  3KAD A;  3CKC A;  2OND A;  5FT9 A;  4BT9 A;  3MEK A;  1ZU2 A;  4HOT A;  2FKE A;  3CK7 A;  3MV3 B;  2LGO A;  1PC2 A;  4N39 A;  1FKS A;  4N3C A;  3O5Q A;  4NNR A;  2NC9 A;  3KZ7 A;  3MA5 A;  1Q1C A;  1IHG A;  3VTY A;  4DRK A;  4G50 A;  2MNT A;  2ZQS A;  4ODQ A;  4ODK A;  2QFC A;  4DRP A;  1FKG A;  4CDR A;  5J6E A;  1FD9 A;  1FKB A;  1KT0 A;  1QZ2 A;  4UQZ A;  2FBN A;  1QPL A;  2VSN A;  2AWG A;  4GCO A;  3ZGQ A;  3QWV A;  2DG3 A;  1QQE A;  4GPK A;  4ODL A;  4DH0 A;  4BT8 A;  4AY6 A;  4BTA A;  3U3W A;  1B6C A;  3UQ3 A;  2ITK A;  3ZHE B;  4U0Z A;  4A1S A;  3TGO A;  2I6H A;  3QWW A;  4AIF A;  1BKF A;  5M72 A;  3EY6 A;  4DRJ A;  2VGY A;  4BF8 A;  5G05 C;  4DRI A;  5DBK A;  3ASD A;  1JNT A;  3GPK A;  4ITZ A;  1FKD A;  1TCO C;  2PZI A;  2Q5A A;  3JXV A;  4DRO A;  4AY5 A;  3PDN A;  4H7Y A;  2L6J A;  3KCE A;  1EQ3 A;  5ARF A;  3U4T A;  2MF9 A;  3NRK A;  1NA3 A;  3O5G A;  2PV2 A;  1FKI A;  4WND A;  3BEE A;  3RKV A;  4YVO A;  1NSG A;  4GYY A;  4TW6 A;  2PBC A;  1JNS A;  1P5Q A;  3AS4 A;  3KAG A;  1F40 A;  4QIB A;  2ZQV A;  4U04 A;  4CGV A;  4G25 A;  3S7B A;  4KBQ A;  1XNF A;  4BWR A;  2XEV A;  4GCN A;  4EQF A;  3LY8 A;  1J6Y A;  2HO1 A;  4J8F A;  3ASH A;  4U0U A;  1KT1 A;  3ODK A;  1HZ4 A;  2RUD A;  5HI7 A;  4G2V A;  4W9O A;  3S7D A;  2FEZ A;  4WNF A;  2XPA A;  5CCM A;  3O5I A;  3HYM B;  3CGM A;  1A7X A;  5HW8 A;  4IN3 B;  2UY1 A;  3B7X A;  2Y4T A;  2JZV A;  2RUR A;  2DG4 A;  2PQN A;  2L2S A;  4GZ6 A;  4HOR A;  3Q15 A;  4G2P A;  2XCC A;  4JFM A;  1D7I A;  4JFI A;  4KYO B;  3GZ1 A;  3IKD A;  5KJK A;  5EKQ D;  4GYW A;  1NMW A;  4DT4 A;  1N1A A;  1ZCN A;  2RQS A;  2XGO A;  1NZN A;  2FI7 A;  2OFN A;  4UQX A;  2PQR A;  2DBA A;  3IKG A;  3UQA A;  1YW5 A;  5DIZ A;  4J8D A;  4AM9 A;  5HW7 A;  4GA0 A;  4U07 A;  4G24 A;  2MPH A;  2BUG A;  1ELW A;  3GZ2 A;  1J4H A;  4GIV A;  1D7J A;  4U84 A;  2PV3 A;  4YVQ C;  1B89 A;  2VCD A;  1PIN A;  3PA7 A;  2GW1 A;  3QOU A;  3IHZ A;  2IFU A;  1C9H A;  2M08 A;  3FAP A;  4FN2 A;  5JJ6 A;  4XI0 A;  2HYZ A;  3CEQ A;  4QT2 A;  4BTB A;  2FF4 A;  4U85 A;  3JYS A;  5FZS A;  4LAW A;  4LAV A;  2KAT A;  3CVP A;  3S7F A;  4LAY A;  2M1I A;  1WM5 A;  4UI9 J;  2F4E A;  5G05 J;  5LCW C;  5DIT A;  5GPG A;  3LPZ A;  4MSP A;  4TW7 A;  2UY1 B;  4Y6W A;  4JA9 A;  3UI5 A;  2KFW A;  5C1D A;  3R9A B;  4I9C A;  3ASG A;  1HXI A;  1ZBP A;  3NF1 A;  5HUA A;  1IYG A;  2KO7 A;  1PBK A;  5HTG A;  4G23 A;  3E4B A;  2F21 A;  4H7X A;  2F2D A;  4O2T A;  4ODR A;  3KAB A;  3TAX A;  4UI9 C;  3FWV A;  3QDN A;  2FAP A;  4I1A A;  2XP4 A;  2XP6 A;  5FTP A;  1ROT A;  5HQ8 A;  2C2L A;  2VQ2 A;  1F8A B;  3O5O A;  5DIU A;  3LY7 A;  5EX0 A;  2XP3 A;  4C02 B;  5BT1 A;  4UI9 K;  5D75 A;  4W9P A;  4WUY A;  5BW8 C;  3K9I A;  3JYM A;  2IF4 A;  5HW6 A;  4G1T A;  2MLX A;  3O5P A;  3RIB A;  4XI9 A;  1FKK A;  4APO A;  2PL2 A;  2DG9 A;  5I98 A;  2LPV A;  4TW8 A;  3QWP A;  2YQ8 A;  3CK9 A;  3RO3 A;  1NMV A;  2ZQT A;  4B94 A;  5CCL A;  4DZ3 A;  3WXX A;  1OUV A;  3TDB A;  4XIF A;  4QT3 A;  3KAH A;  1YA0 A;  4N2Q A;  5HWB A;  4JL0 A;  3URZ A;  2V5F A;  3CVL A;  2XP8 A;  4HOQ A;  3ZFW A;  3ZPJ A;  2KCK A;  3CKB A;  1FKL A;  4FAP A;  1FAP A;  3Q4A B;  1FCH A;  1WAO 1;  4JHR A;  2PPO A;  5FZQ A;  1T11 A;  1NA0 A;  2RSE A;  5G04 C;  2MHK A;  2LKN A;  1FKR A;  2OOE A;  4UQY A;  2PPN A;  2P58 C;  3LKU A;  2RUQ A;  4W9Q A;  4IQ2 A;  4MGV A;  3GW4 A;  4I9E A;  2VGX A;  4WNE A;  3RJV A;  2UZ5 A;  4DZ2 A;  4GA1 A;  2M2A A;  4F3V A;  2C0L A;  2PPP A;  3OXF A;  2Y78 A;  4R0X A;  2WPV A;  5B8I C;  4LAX A;  1J4I A;  5A6C A;  4ODP A;  3PRB A;  2WQH A;  3TG4 A;  2XP9 A;  3MDY B;  4HOS A;  1W3B A;  3O5J A;  3ZHE A;  4N5C A;  1D6O A;  1FKH A;  3UI6 A;  4N3B A;  1HH8 A;  4J0U A;  5LCW J;  2ZR4 A;  5HT1 A;  2UWJ G;  1BL4 A;  2LJ4 A;  1E96 B;  4DIP A;  2KR7 A;  4YND A;  4DRM A;  4ODM A;  2VSY A;  4GA2 A;  3S7J A;  4JFK A;  2D9F A;  3CVQ A;  3PE3 A;  4J8E A;  1Q6U A;  1HXV A;  1J4R A;  4I2W A;  3CV0 A;  2VYI A;  5BNW A;  2KC7 A;  3CVN A;  4IQC A;  3NI6 A;  2FO7 A;  4JFL A;  2C0M A;  4ABN A;  3LY9 A;  3I6C A;  3ESK A;  2Q7F A;  4WNG A;  5BXJ A;  3OXG A;  3TG5 A;  3VAW A;  4TNS A;  3Q49 B;  2N87 A;  3VTX A;  1FKF A;  2JLB A;  3KAE A;  3MKR A;  3QKY A;  3MV2 B;  4JA7 A;  3TC5 A;  4DRQ A;  2VGX B;  4JFJ A;  3RGC A;  2XPI A;  2XGS A;  4U0S A;  4Y6C A;  2VN1 A;  2PV1 A;  4N2S A;  2KE0 A;  3TCZ A;  1L1P A;  5FJY A;  2LSU A;  4DRH A;  4LEU A;  3ZN3 A;  5HKG A;  1Y8M A;  4GYO A;  4G26 A;  4J4O A;  1ROU A;  1U79 A;  5KJM A;  3AS8 A;  3O48 A;  2KGJ A;  3PE4 A;  5AYW D;  2HR2 A;  1R9H A;  4ODN A;  1FJD A;  3O5R A;  2XGM A;  1Q6I A;  3N71 A;  1KLX A;  1Q6H A;  4W9R A;  3O5L A;  5DIV A;  2MLZ A;  1A17 A;  2YHC A;  3GYZ A;  4CGW A;  3LUO A;  1JVW A;  4HOU A;  3KAC A;  4O6F A;  3KAF A;  3UF8 A;  3ASF A;  2LNI A;  2ZQU A;  4GZ5 A;  2K8I A;  3FP3 A;  4J4N A;  3Q47 B;  2ZR5 A;  3O5E A;  3O5K A;  3PRD A;  3LCA A;  5G04 J;  2KCV A;  1EYM A;  5JJ7 A;  5EX3 A;  4U86 A;  3NTP A;  3O5D A;  4I17 A;  5D0O D;  3CK8 A;  2MLY A;  1ELR A;  5KJL A;  1YAT A;  2ZR6 A;  2R5S A;  1Y0O A;  4KXK B;  2Y4U A;  5CHE E;  3SF4 A;  2XPB A;  3UUX A;  4ODO A;  3IEG A;  2XCB A;  4ME2 A;  3UQI A;  4GZ3 A;  1TJC A;  3AS5 A;  3IK8 A;  1W26 A;  2KI3 A;  4I2Z A;  5ARG A;  3CGN A;  3EDT B;  2KCL A;  2AVP A;  4TYO A;  1QPF A;  3JYJ A;  3H9R B;  4N19 A;  3SZ7 A;  4TX0 A;  1ZK6 A;  5A7D B;  3O5F A;  3Q5M A;  3RU0 A;  1D7H A;  3RFW A;  3WH0 A;  3KS2 A;  5FZR A;  2XP5 A;  3UI4 A;  1FKJ A;  4GGQ A;  1FKT A;  2J9Q A;  1M5Y A;  4N3A A;  4RG9 A;  4NQ0 A;  5JJT A;  3RO2 A;  3KD7 A;  4DRN A;  3UQB A;  3UPV A;  2RUC A;  2XP7 A;  3ULQ A;  5KJN A; 
#chains in the Genus database with same CATH topology
 2E2E A;  4JEU A;  2EIJ E;  4MAV A;  1U3C A;  5D0Q D;  3UIP C;  2F8X K;  4RG6 A;  5ENP D;  3CKC A;  2OND A;  5FT9 A;  4BT9 A;  4FJY A;  4BFR A;  1UJJ A;  3LJN A;  1ZU2 A;  4I6J A;  1O5M A;  1Q2Z A;  1OWO A;  3MZL B;  4N3C A;  2XEH A;  3KZ7 A;  4JW1 A;  3HXC A;  4FP7 A;  3B7R L;  4PUC A;  5HKP A;  5HBF A;  2MYO A;  3ML8 A;  4QZV B;  4TXQ A;  5KBA A;  3APD A;  3WL0 A;  2QFC A;  3FY4 A;  2J8S D;  3B9D A;  1FD9 A;  1SQM A;  1HU3 A;  1JPL A;  2XPY A;  4L2Y A;  3CVX A;  2OEV A;  1QPL A;  4GCO A;  3QWV A;  2DG3 A;  2IQC A;  4CT4 A;  1WB0 A;  1N9A A;  2P9P G;  4ODL A;  5BXU A;  4HRL A;  5C2Y A;  4BTA A;  3AS2 A;  3UQ3 A;  1O1S A;  2I6H A;  3IHY A;  2Y0B G;  1W9P A;  4AIF A;  1EDQ A;  3B7B A;  1LL7 A;  2VGY A;  4CDM A;  3RRU A;  4C48 B;  2PM6 A;  1OY3 D;  3ASD A;  3UT4 A;  3ZYK A;  4DPR A;  2H6H A;  1FKD A;  3UTM A;  4Z2H A;  1X6L A;  2Q5A A;  1EYH A;  1FT2 A;  3B7S A;  3PDN A;  3ZYQ A;  4H7Y A;  2L6J A;  4GTQ A;  1D9S A;  3U4T A;  1UN9 A;  3ZEF A;  2I1K A;  2OV8 A;  3NRK A;  2I9C A;  3RKV A;  3V79 K;  1NSG A;  3UT7 A;  2A5E A;  5AAO A;  1TN6 A;  4Q7N A;  1WG0 A;  3KAG A;  4QFV A;  5JHA A;  3MGB A;  4KBQ A;  1XNF A;  4AJW A;  4F53 A;  4EQF A;  2B31 A;  4J8F A;  1O6I A;  2QYJ A;  1IQR A;  4W9O A;  1HJW A;  2P9N G;  3AG4 E;  2R02 A;  2XEE A;  1A7X A;  2UY1 A;  4P8W A;  4K5A B;  2PQN A;  4GZ6 A;  3Q15 A;  3T8K A;  2XCC A;  4DWS A;  4JFM A;  3WKZ A;  4A1G A;  3GZ1 A;  3DXM G;  3CZ8 A;  2AW6 A;  2RQS A;  1FFR A;  2DBA A;  3IKG A;  4TRQ A;  5DIZ A;  1DCE A;  1OCZ E;  3CGH A;  4MRU A;  5EN5 D;  2QZA A;  1ZU8 A;  4GIV A;  1NWT A;  2F37 A;  4MTV A;  3BUA A;  2DT1 A;  1B89 A;  5D2M C;  1XRV A;  3JQ0 A;  2XZT G;  2IFU A;  2M08 A;  4J8Y A;  2ETB A;  4XI0 A;  4U85 A;  3JYS A;  2KAT A;  3ASN E;  1TR4 A;  3ZYL A;  2EIN E;  2M1I A;  4UI9 J;  2F4E A;  1YCS B;  2WXO A;  5DIT A;  4BER A;  3LPZ A;  4Y6W A;  4GTR A;  4GTT A;  3AS1 A;  3FTZ A;  3ASG A;  1HXI A;  1ZBP A;  1BI8 B;  3NF1 A;  3ZXP A;  3DSX A;  4DUI A;  3AQU A;  4N5Q A;  1PBK A;  4FHJ A;  4WK9 A;  1FVH A;  4O2T A;  4DX1 A;  2DCP A;  1QYM A;  4NAC A;  3TXN A;  1ZB5 A;  2XP4 A;  3D9N A;  4A55 A;  5HQ8 A;  2C2L A;  1F8A B;  1AWC B;  5EX0 A;  3PS6 A;  4MNK A;  3B13 A;  2R05 A;  1K3Z D;  2MLX A;  3ALF A;  3O5P A;  3CHD A;  4XI9 A;  4ZHB A;  1FKK A;  2CFU A;  4IUL A;  4U8V D;  2LPV A;  3QWP A;  2BTD A;  1NMV A;  2ZQT A;  3FXY A;  5CCL A;  3ABK E;  4DZ3 A;  2V5Q C;  3FEX A;  4GU5 A;  1E7V A;  2H6G A;  1JCH B;  3KAH A;  1IXV A;  5HWB A;  2DT2 A;  3URZ A;  2XP8 A;  3CH9 A;  3ZFW A;  4LNG A;  3ZPJ A;  3Q9N C;  1NL4 A;  4ILG A;  1YMP A;  2OEW A;  5FZQ A;  2QC9 A;  3FTU A;  5JMN D;  1FKR A;  3ISM C;  3V30 A;  2RUQ A;  4HI9 A;  4MGV A;  3GW4 A;  4FU3 A;  3EIQ C;  4DZ2 A;  2KZT A;  4GA1 A;  5T8I A;  3IHV A;  3DPD A;  3OXF A;  3KEZ A;  4DLQ A;  2WPV A;  5B8I C;  2WQH A;  3MDY B;  1Z3Y A;  5LFA A;  1TJF A;  4L1B A;  3O5J A;  3ZHE A;  1UR9 A;  5LX8 A;  1D6O A;  3LVR E;  4JC8 A;  4UWH A;  3SNX A;  1E96 B;  5EID A;  4ODM A;  3PUJ A;  4PDX A;  2EIK E;  4KMO A;  4URK A;  5J90 A;  3QOK A;  3CIA A;  1KPS B;  3EHN A;  3Q7F A;  3X2Q E;  3CVN A;  3BQO A;  1ZBC A;  5T4Y A;  2FO7 A;  2XZD G;  2GRR B;  5ENN A;  3ESK A;  4WNG A;  3PNT B;  3TG5 A;  2QF8 A;  4TNS A;  3Q49 B;  1SA4 A;  3TWX A;  3VTX A;  4RSY A;  2P9K G;  3NZU A;  4JFJ A;  1ELK A;  5FQ4 A;  3NBN B;  3IV0 A;  1HS6 A;  4Y6C A;  2PV1 A;  4EZL A;  4N2S A;  2LSU A;  4DRH A;  4LEU A;  5HKG A;  4L9P A;  2P9U G;  3JUE A;  1ROU A;  2ILR A;  2DT0 A;  3LDZ A;  1E8W A;  2KGJ A;  4EEC A;  3E37 A;  3QAR A;  2LUH A;  3Q7A A;  3ARO A;  3EUV A;  1MX4 A;  2XGM A;  1Q6I A;  4ILH B;  1KLX A;  4F1S A;  3FTY A;  1A17 A;  2YHC A;  4I6G A;  3GYZ A;  1S0P A;  1JVW A;  3WD2 A;  3KAF A;  3UF8 A;  3FUI A;  4LER A;  4J4N A;  3LCA A;  3RAU A;  3FUF A;  1EPU A;  4GTO A;  3UM1 A;  5BUZ A;  3NTP A;  1LQ0 A;  4TXP A;  3DSW A;  3DST A;  2O92 A;  4UWK A;  3HDX A;  1JCR A;  3ZNG A;  3ZIM A;  3UUX A;  4ODO A;  4V3I A;  3FUL A;  4GZ3 A;  2ZGG A;  3AS5 A;  4JPS A;  3IK8 A;  1OWP A;  1LTX A;  1N54 A;  2KI3 A;  2WVI A;  3CGN A;  3EDT B;  1QPF A;  4N19 A;  1RD6 A;  4ACK A;  1IKN D;  5A7D B;  2J08 A;  3DSV A;  4G8L A;  4L3N A;  3Q5M A;  3RFW A;  4GPM A;  4GGQ A;  2J07 A;  4Z2I A;  5CMW A;  2F23 A;  4DRN A;  3G2T A;  4OYS A;  5HWC A;  3SO8 A;  3OXL A;  1V54 E;  1JWF A;  5FWQ A;  4NRH B;  4DLO A;  1Z5S C;  1ZL1 A;  5AAR A;  3L54 A;  3FTW A;  5CBN A;  4MKT A;  5J08 A;  3CK7 A;  3SFX A;  2OVF A;  1XHG A;  4MS6 A;  3T9K A;  3UX4 A;  3AG2 E;  1FKS A;  3D9O A;  1H6O A;  2YBU A;  1GRJ A;  4EBA G;  3JXI A;  3CHC A;  1Q1C A;  1HKK A;  4OAU C;  4XKB A;  3L08 A;  1W9V A;  5EDS A;  3G2U A;  2A3B A;  4ODK A;  1TNB A;  4WAF A;  5CEA A;  2PM7 A;  3LVQ E;  4GB9 A;  2A3E A;  1QZ2 A;  4UQZ A;  3FH7 A;  2WXM A;  3TXM A;  4BT8 A;  3SBT B;  3I5P A;  3NAW A;  3UMV A;  1A5E A;  1O1R A;  2ITK A;  2RKK A;  4R5E A;  4U0Z A;  2GRN B;  2EUL A;  2IUZ A;  4UWF A;  1BKF A;  5M72 A;  2WXF A;  4WWP A;  4MNL A;  4HI8 A;  1HFA A;  1RW2 A;  2Y69 E;  3G2V A;  3WIJ A;  2PZI A;  5FQ7 A;  3JXV A;  4BET A;  4DRO A;  3KCE A;  5ARF A;  5D66 A;  3RSE G;  3DSS A;  2WLY A;  3O5G A;  2PV2 A;  3SFZ A;  1N94 A;  4YVO A;  4TW6 A;  1JNS A;  3AS4 A;  4P29 A;  4F1P A;  3PRA A;  3RK6 A;  3S7B A;  3SBS A;  2J4D A;  4BWR A;  1QNF A;  3I3N A;  3LS8 A;  4UWL A;  1J6Y A;  3TWV A;  2HO1 A;  4EBA A;  4OVU A;  1MJ0 A;  3PNL B;  2RUD A;  4KVM A;  3NOG D;  2VSX E;  2FEZ A;  4WNF A;  3WQW A;  3IXE A;  1NFI E;  3PEV B;  3D3M A;  4IN3 B;  2CFZ A;  2J4B A;  1OCR E;  3B7X A;  2Y4T A;  1MYO A;  2RUR A;  1X5B A;  2DG4 A;  3U66 A;  4G2P A;  1D7I A;  4JFI A;  3TWR A;  1WNO A;  2IOS A;  1KZP A;  5LOZ A;  2YHE A;  4GYW A;  4DWS C;  2AXZ A;  4DT4 A;  1N1A A;  3RM9 A;  2FI7 A;  4UWG A;  3SY2 A;  4UQX A;  3GU0 A;  1ZB1 A;  4DI3 A;  3UM3 A;  3BG0 B;  3R7R A;  2MOW A;  5DO2 A;  2DSW A;  2ETA A;  3V2X A;  5HW7 A;  3UXG A;  4G24 A;  3ARW A;  4L72 B;  3HXF A;  1U3D A;  1ELW A;  3GZ2 A;  1TNY A;  2YNQ A;  5BV0 A;  1O1T A;  3PA7 A;  3QOU A;  3IHZ A;  4NSB A;  4HXI A;  2V4H C;  4DX7 D;  3PZ3 A;  1C9H A;  4FN2 A;  4TV3 A;  3CEQ A;  1HO8 A;  5FZS A;  4LAV A;  3CVP A;  4LAY A;  1LL4 A;  4ZFH A;  4GZD A;  4MSP A;  2UY1 B;  4JA9 A;  3UI5 A;  2KFW A;  4HBO A;  3QJZ A;  4DWS B;  1H2V C;  1Z6T A;  1HKI A;  4F7A A;  1Y6I A;  4G23 A;  5HTG A;  3TWS A;  3FU3 A;  4GMR A;  3E4B A;  2R2L A;  1ZBK A;  4H7X A;  3VLD A;  2F2D A;  4CZ2 D;  1DVP A;  3L16 A;  3E30 A;  3KSQ A;  4UI9 C;  2FAP A;  3IBE A;  2XP6 A;  4GZC A;  4GTS A;  1OWM A;  2XP3 A;  4C02 B;  5BT1 A;  3CLJ A;  3ONL A;  1SYT A;  3B7T A;  3FHE A;  5D75 A;  3UM2 A;  4W9P A;  3G2S A;  4PS8 A;  3MX3 A;  1H0A A;  2JAB A;  4G1T A;  2WB2 A;  5CEC B;  1FVF A;  1WDY A;  2PL2 A;  2DG9 A;  4TW8 A;  2IEJ A;  1NWR A;  4M7C A;  3RO3 A;  4FJZ A;  3WXX A;  1TEZ A;  2WLZ A;  4XIF A;  4YDO A;  2XPZ A;  1YA0 A;  4N2Q A;  2RG8 A;  2V5F A;  1H0I A;  4WJX A;  3CR3 A;  2ION A;  2KCK A;  5ANR A;  4MNJ A;  4NIK A;  4U96 D;  4ATZ D;  2R17 C;  1W1P A;  2I2O A;  3Q75 A;  4APF A;  1GUV A;  3MCX A;  4L2L A;  1TNO A;  5KCM A;  3G6L A;  3E33 A;  2RSE A;  2MHK A;  5T3R A;  3EHM A;  1N0R A;  2WXL A;  4UQY A;  2PPN A;  4KT6 B;  2P58 C;  1TFV A;  4PTM A;  4HRM B;  4IQ2 A;  1DC2 A;  1MZC A;  4JD2 G;  2M2A A;  2PPP A;  2BKK B;  4K5C A;  4HQD A;  3EHQ A;  3C98 A;  5A6C A;  2DYR E;  3TG4 A;  2FUL A;  3PRB A;  2CHX A;  2L6B A;  4TXR A;  4N5C A;  2CHZ A;  4J8S A;  1FKH A;  3V31 A;  1HH8 A;  2ZR4 A;  5HT1 A;  2XRZ A;  2WQ7 A;  1BL4 A;  2DYS E;  2LJ4 A;  4DIP A;  3W4R A;  3W9F A;  1XGW A;  2L0I A;  4A63 B;  2VSY A;  3T8M A;  1NWS A;  4GA2 A;  3PZ1 A;  2GRQ B;  1UR8 A;  1K8K G;  1LD8 A;  3L6A A;  4J8E A;  3PE3 A;  5B3S E;  1OWQ A;  4I2W A;  1JWG A;  3CV0 A;  5EIB E;  2KC7 A;  3D9H A;  4JFL A;  2C0M A;  4ABN A;  3ARY A;  4DRX E;  3CVV A;  4CEM A;  3UI2 A;  5ENR D;  1HG5 A;  4ZPT R;  3D9I A;  3KAE A;  4DRQ A;  4MBG A;  3FUK A;  3G6M A;  2KZT B;  4ZPV R;  3RRM B;  3L22 A;  2XPI A;  4CCA A;  3TCZ A;  2VN1 A;  4I1O B;  1NP7 A;  4GTP A;  4XKC A;  1Y8M A;  4G26 A;  5KJM A;  3FUH A;  3GZS A;  3D9L A;  2HE0 A;  2HR2 A;  3FUD A;  3N71 A;  3B7U X;  2MRI A;  4W9R A;  2MLZ A;  4FHK A;  4PH4 B;  1N11 A;  3ZRH A;  3ARU A;  2M63 A;  3ASF A;  2P4V A;  2LO6 A;  3J5P A;  3PZD A;  2R59 A;  3RRN B;  1E6R A;  4HBE A;  2ZR5 A;  4PS7 A;  1OGB A;  2VSO E;  2WXK A;  3FTV A;  2KCV A;  5AQA A;  4DX2 A;  5JJ7 A;  1UG3 A;  4U86 A;  3O5D A;  4I17 A;  5D0O D;  1LF8 A;  3CK8 A;  2DIW A;  1HJV A;  2MLY A;  2KM4 A;  1OWN A;  4FAD A;  1ELR A;  4C0E A;  3FEY A;  3T5V A;  2ZR6 A;  1Y0O A;  1VDY A;  4KXK B;  4M3O A;  3SF4 A;  2XPB A;  5AJD A;  2XCB A;  4ME2 A;  3UQI A;  1TJC A;  1H2U A;  1K1B A;  3ZXS A;  4GMJ A;  2LXM A;  1LG1 A;  1UJK A;  4AP2 A;  3JYJ A;  3U9W A;  4UDM A;  3C72 A;  3QC1 A;  2NXP A;  3IKO B;  3SZ7 A;  2CHW A;  1W1T A;  5ENO D;  2DWZ A;  1D7H A;  3WH0 A;  3KS2 A;  4S3J A;  1FKT A;  1EHN A;  4BX9 A;  3ARR A;  2XS8 A;  2J9Q A;  2X6J A;  4NQ0 A;  5JJT A;  2A3A A;  3EHR A;  3QB2 A;  5KJN A;  3UI6 A;  3TWW A;  3LXU X;  3Q9U C;  2IO3 C;  3O5M A;  4JYS A;  1E15 A;  3KAD A;  1HKM A;  3L9T A;  3MEK A;  2FKE A;  3D9M A;  3MV3 B;  4N39 A;  3HVE A;  4WWO A;  3JXJ A;  4NNR A;  4Z2J A;  1N4R A;  4EZK A;  3ARZ A;  1IHG A;  3FU5 A;  3D9P A;  5FIO A;  4OAV B;  4F6R D;  4G50 A;  5AJL A;  2WM0 A;  4DRP A;  4GAA A;  3TWQ A;  4S3K A;  1NH6 A;  2A5U A;  1QQE A;  4GPK A;  3ART A;  5FQ8 A;  5CER B;  2FDM A;  3TWT A;  4BES A;  4WIW A;  3ALG A;  3ULY A;  2VGE A;  3TGO A;  3GTY X;  4DWS D;  1Z3X A;  2PI6 A;  3EY6 A;  1HF8 A;  4DRJ A;  4DRI A;  5G05 C;  5DBK A;  1JNT A;  3VLF A;  3GPK A;  4AY1 A;  3D9J A;  3PZ4 A;  4ITZ A;  1TCO C;  4AY5 A;  1FFQ A;  3EIP A;  2DVW A;  2MF9 A;  3B8S A;  1K9T A;  1NA3 A;  2GRM A;  1FKI A;  4GYY A;  1OT8 A;  3T5X A;  3CHO A;  1F40 A;  4QIB A;  3PRZ A;  4U04 A;  4CGV A;  5IY5 E;  1BI7 B;  1ZBV A;  3FUN A;  3SHF A;  1BU9 A;  4JZY A;  3ML9 A;  5AQ7 A;  2L9B A;  3ASH A;  3FUE A;  1KT1 A;  3ODK A;  2J49 A;  5HI7 A;  3P1U A;  3S7D A;  4TUM A;  2XPA A;  5CCM A;  3OAW A;  4P8V A;  3CGM A;  1E44 A;  4ANX A;  5HW8 A;  2B6C A;  1HJX A;  1E8Y A;  4HLL A;  3JUI A;  5E76 A;  5JA4 D;  4HOR A;  4ZS6 A;  2V8S E;  1EDU A;  3IKD A;  3FH5 A;  5KJK A;  5EKQ D;  3V2O A;  3WD4 A;  4BSZ B;  3RME A;  4ATG A;  3L13 A;  1ZCN A;  2XGO A;  3CVU A;  1NZN A;  3ULE G;  3EIJ A;  2KBX A;  2VJ8 A;  5BV1 A;  3UM0 A;  3SQV A;  2PQR A;  3SI5 A;  3UQA A;  5DF0 A;  1IX5 A;  4GA0 A;  4U07 A;  1V55 E;  4JVS A;  3CSF A;  4XX5 A;  3CVY A;  2B0O E;  4U84 A;  2WXJ A;  3W9G A;  1UOH A;  4YVQ C;  2R03 A;  2VCD A;  3MJW A;  3AAA C;  3UIN C;  3HXE A;  4AV7 A;  3ARQ A;  1LG2 A;  1W9U A;  5AIJ A;  4IYP A;  5BPP A;  2DPE A;  3UKR G;  5GPR A;  3S7F A;  1WM5 A;  5G05 J;  5LCW C;  5GPG A;  1OWL A;  4AOF A;  4TW7 A;  4HNA D;  4I6E A;  3QNK A;  4A3V A;  5C1D A;  3TL5 A;  5LP0 A;  4CYM D;  2F21 A;  2V0P A;  4DX5 D;  3AS3 A;  3BG1 B;  2AJA A;  4ODR A;  4R7L A;  1BD8 A;  3KAB A;  1NWU A;  3TAX A;  5KNH D;  4I1A A;  4NUR A;  1ROT A;  3O5O A;  5DIU A;  4U8H A;  4JEH A;  3AU4 A;  1OCO E;  4GTV A;  3K9I A;  5CRU A;  1RZ4 A;  2IF4 A;  4LSZ E;  3JYM A;  5JHB A;  2ZU6 B;  3RIB A;  1VF8 A;  2WXH A;  2AWI A;  1WAW A;  4AEZ C;  3LEW A;  1X81 A;  2YQ8 A;  3CK9 A;  3NOC D;  2RFA A;  4FA6 A;  4ACL A;  3PEU B;  3TDB A;  2WK2 A;  1DNP A;  5AN8 A;  4QT3 A;  3MKQ A;  5EYL A;  4HBD A;  3UT8 A;  4JL0 A;  3LJ3 A;  3CVL A;  4Z68 A;  1S64 A;  4HOQ A;  2ZXW E;  2WXQ A;  1FKL A;  1JCQ A;  1FAP A;  1UN8 A;  3Q4A B;  1FCH A;  3DPY A;  1WAO 1;  3PH0 C;  1N4Q A;  4JHR A;  2ETC A;  2PPO A;  1T11 A;  1BPO A;  3HIZ A;  1MX2 A;  3BU8 A;  5G04 C;  2LKN A;  4CDN A;  3ABL E;  1MQS A;  2BKG A;  4MNM A;  3LKU A;  3EJN A;  4FUL A;  4W9Q A;  4GML A;  4I9E A;  3NZS A;  3RJV A;  4WNE A;  2VGX A;  2XEN A;  4CRW A;  2C0L A;  3KEA A;  3C3R A;  3ONK A;  4BSX A;  1D8E A;  3S2A A;  4R0X A;  4MPK A;  4LAX A;  4ODP A;  2XP9 A;  2BF0 X;  5CBO A;  3CHR A;  3TJP A;  4J0U A;  5LCW J;  1L5J A;  3L17 A;  4LNU D;  3JQ1 A;  2KR7 A;  4YND A;  4DRM A;  3ARV A;  1N4P A;  4DJA A;  2VTB A;  4KVO A;  3CVQ A;  1Q6U A;  2V4L A;  1J4R A;  1HX8 A;  3FY1 A;  3PR9 A;  4HVB A;  4IRU A;  4FLH A;  2VYI A;  4Q69 A;  3B95 A;  3QAQ A;  3NI6 A;  2IY0 C;  2WXR A;  5BXJ A;  3OXG A;  1N52 A;  3VAW A;  1W1Y A;  3UIO C;  4EZJ A;  2N87 A;  5KNG A;  2JLB A;  4LNB A;  3MKR A;  3RM8 A;  3QKY A;  3MV2 B;  4JA7 A;  3O4Z A;  4W5U A;  3RGC A;  1ZBW A;  4XEI G;  5G2N A;  1L1P A;  2IJG X;  4J4O A;  4EPZ A;  3AS8 A;  3O48 A;  4GTM A;  3CQG B;  4C0M A;  1LD7 A;  4ODN A;  1FJD A;  3B9A A;  3CHE A;  1OXJ A;  3O5L A;  5GQB A;  4LGX A;  2DSU A;  3B9E A;  3APC A;  2LNI A;  2ZQU A;  3FP3 A;  3Q47 B;  2F8Y A;  3HHM A;  4Z2K A;  2O9O A;  5G04 J;  2H6I A;  3FU6 A;  5EX3 A;  3ARP A;  4U63 A;  2AXV A;  1GPF A;  2Y1L E;  2WXN A;  5B1B E;  3ENE A;  4XZ4 A;  5KWD A;  1GW6 A;  5KJL A;  1YAT A;  2EQX A;  3AG1 E;  5CHE E;  3IEG A;  2PNN A;  3D9K A;  4I1M A;  4MLP A;  3NB2 A;  4I2Z A;  2WQ6 A;  1DCQ A;  1MX6 A;  2AVP A;  3H9R B;  4J7W A;  3CHF A;  2P9L G;  4ZPW R;  3O5F A;  3RU0 A;  4ML4 A;  2P9S G;  3UI4 A;  2OVB A;  4FLB A;  2NSZ A;  4N3A A;  2E0I A;  4C9B B;  3KD7 A;  4K5B A;  3UPV A;  2RUC A;  1U2V G;  1H19 A;  4FAP A;  3G2W A;  3KAI A;  3OOB A;  3Q78 A;  4BX8 A;  3LYA A;  3ZU7 B;  3FFL A;  4E85 A;  1E6Z A;  2LAH A;  2LSV A;  4IPX A;  2H6F A;  4U7E B;  1JNE A;  2GRL A;  4XAK A;  4ILI A;  4HOT A;  2EIL E;  3PVL A;  1W1V A;  3HG0 D;  2LGO A;  1PC2 A;  3C5R A;  5HS0 A;  3O5Q A;  2NC9 A;  3FUJ A;  4AXH A;  3CHP A;  4URI A;  3MA5 A;  3WG7 E;  1NI1 A;  4WKF A;  3SFY A;  3VTY A;  2HM8 A;  4EHM A;  4DRK A;  2CG2 A;  2MNT A;  1H6P A;  2ZQS A;  4ODQ A;  4OVV A;  2WMO A;  3SD5 A;  2YIN A;  3ARX A;  3EU5 A;  5ENT D;  2GRP B;  1FKG A;  3DXK G;  2DZN A;  4CDR A;  2DZO A;  5J6E A;  1G3N B;  4Q22 A;  4YDE A;  2Y3A A;  1FKB A;  2AOS A;  1KT0 A;  1H0G A;  2X38 A;  2FBN A;  2B5U B;  3R7Q A;  2VSN A;  2AWG A;  2CG3 A;  3ZGQ A;  4DH0 A;  4LCT A;  2J09 A;  4AY6 A;  3ZW3 A;  5ENQ D;  2AXU A;  3U3W A;  1B6C A;  3ZHE B;  3PUK A;  4HAR A;  1D8D A;  4A1S A;  3Q79 A;  5E75 A;  3QWW A;  4KZ0 A;  2P9I G;  4BF8 A;  3AS0 A;  1HKJ A;  1QBQ A;  3C3O A;  1S70 B;  4NZC A;  3RM4 A;  3I4G A;  2KXP C;  3HVE B;  1EQ3 A;  4DX6 D;  1S63 A;  2EIM E;  4J6I A;  4WND A;  3BEE A;  4Z2L A;  5HRY A;  2PBC A;  2ZIR A;  3ABM E;  1P5Q A;  2WMN A;  5H7P A;  2ZQV A;  3DRA A;  4G25 A;  1HG2 A;  2A3C A;  4WWN A;  3ZYM A;  2XEV A;  4GCN A;  3LY8 A;  3CQC B;  3Q73 A;  5BXO A;  3HXD A;  4U0U A;  1JUQ A;  1HZ4 A;  4G2V A;  4ANV A;  3AG3 E;  3NQP A;  4ANU A;  2G41 A;  3O5I A;  3HYM B;  4HRN A;  3OA5 A;  4JXT A;  3ASO E;  2JZV A;  4D10 C;  1D2K A;  4IT4 A;  2L2S A;  1X6N A;  4U8Y D;  5CMY A;  4KYO B;  2WXP A;  4FC8 A;  5B1A E;  1LJY A;  3FTS A;  5ENS D;  4JHJ A;  4B8C B;  1NMW A;  2IU1 A;  3E32 A;  1E90 A;  4HB5 A;  3TWU A;  2OFN A;  2I1J A;  1TYQ G;  4RVB A;  3CHS A;  1YW5 A;  5JH8 A;  4J8D A;  4AM9 A;  2MPH A;  2BUG A;  3ESL A;  3PZ2 A;  3I4R B;  2OLH A;  1J4H A;  3AJI A;  1D7J A;  1SZA A;  3DBS A;  2PV3 A;  3PRE A;  4O1O A;  4ANW A;  1PIN A;  2GW1 A;  1N95 A;  4JB8 P;  3FAP A;  1ITX A;  5JJ6 A;  2HYZ A;  1SR0 A;  1PAQ A;  4QT2 A;  4BTB A;  2FF4 A;  1HE8 A;  4P8X A;  3WD3 A;  2IOL A;  4LAW A;  1WY6 A;  1TNU A;  4K0R A;  4Z2G A;  5CRV A;  5ITZ F;  2WXI A;  1OCC E;  3R9A B;  1FPP A;  4I9C A;  1IHB A;  1TN8 A;  5HUA A;  1IYG A;  1K1A A;  2KO7 A;  4P8U A;  4B89 A;  1FT1 A;  3J5Q B;  1PY1 A;  4HS2 A;  3FWV A;  3QDN A;  1YYH A;  1MHQ A;  5FTP A;  5ANL A;  2VQ2 A;  4BY6 A;  3LY7 A;  3OTN A;  4UI9 K;  2XQ0 A;  3EU9 A;  3DWL G;  4L7T A;  1SVX A;  4A3T A;  4WUY A;  5BW8 C;  1E8X A;  5HW6 A;  2JEK A;  3UKU G;  1AP7 A;  4APO A;  4RLY A;  5I98 A;  1KZO A;  2X6K A;  2ZGD A;  4B94 A;  4G11 A;  4O60 A;  1BLX B;  2X3M A;  1OUV A;  3CHQ A;  3CHM A;  2IO2 C;  5AEN A;  3U64 A;  3ARS A;  2F0Y A;  4HLE A;  5DEZ A;  2NYJ A;  3ZKJ A;  1LL6 A;  4O1P A;  2P2C P;  4UUC A;  3CKB A;  3CST A;  3R9M A;  3L82 A;  2X6I A;  2OCC E;  4RQI A;  5A23 A;  1NA0 A;  2OOE A;  4LG6 A;  2LXL A;  3DEO A;  3KSL A;  2UZ5 A;  4X8Q A;  2QYU A;  5FIN A;  4F3V A;  1EF1 C;  3DSU A;  2Y78 A;  3ZVV A;  1N4S A;  1TNZ A;  1J4I A;  2G8Z A;  3WL1 A;  2XRY A;  4KR0 B;  4KZC A;  4HOS A;  2XS1 A;  1W3B A;  4N3B A;  4DI4 A;  2UWJ G;  3FTX A;  3S7J A;  3MKQ B;  4IT6 A;  4JFK A;  3FU0 A;  2D9F A;  2L0T B;  3ZUV B;  1HXV A;  4TUU A;  2WXG A;  1SA5 A;  2GGF A;  3FDH A;  1GOI A;  5BNW A;  1KFW A;  4DK5 A;  4IQC A;  3BMB A;  1IQU A;  2RFM A;  4WKH A;  3LY9 A;  3I6C A;  3F6Q A;  2Q7F A;  5EYP F;  2A4Z A;  5G55 A;  4B93 B;  1INZ A;  4U95 D;  2WM9 A;  3QK0 A;  5CED B;  1FKF A;  2ZIS A;  2X6H A;  3TC5 A;  4E6H A;  2VGX B;  1N0Q A;  4K03 A;  3WD1 A;  2GRO B;  4Q94 A;  5EIL A;  2XGS A;  3APF A;  3MYV A;  4U0S A;  2KE0 A;  3JCK C;  5FJY A;  3ZN3 A;  2RD0 A;  4GYO A;  3P2B A;  1U79 A;  1SZ9 A;  3PE4 A;  3WQV A;  5AYW D;  1R9H A;  3WD0 A;  4YDW A;  3SGH A;  4HFG A;  3O5R A;  3E34 A;  2LAI A;  2ETN A;  1Q6H A;  4G8K A;  5DIV A;  4WKA A;  4CGW A;  2ESC A;  3C3Q A;  3LUO A;  4HOU A;  3KAC A;  4O6F A;  3BXW A;  1H6K A;  2VTB B;  4GZ5 A;  2K8I A;  4PS3 A;  1EIB A;  3O5E A;  3O5K A;  5FQ6 A;  4JHK A;  4B0Z A;  1H2T C;  3PRD A;  4KQZ A;  4QQI A;  1EYM A;  2DSV A;  2FO1 E;  4BEP A;  4XE0 A;  1E7U A;  4B8A A;  4CT0 A;  2YBT A;  2DT3 A;  3CVW A;  1JND A;  3AU5 A;  2R5S A;  3DEP A;  2Y4U A;  3VLE A;  1SW6 A;  5AQ9 A;  4YDY A;  2DSZ A;  1TN7 A;  1E6N A;  1CTN A;  4AVX A;  2XHE A;  4LUN U;  1W26 A;  1OGG A;  5ARG A;  3HRA A;  2KCL A;  3FH8 A;  1E6P A;  1E8Z A;  4TYO A;  4LRZ A;  2BED A;  4TX0 A;  1ZK6 A;  1E9L A;  5FZR A;  2XP5 A;  2PN0 A;  1FKJ A;  1JCS A;  2X6F A;  3HXB A;  4L23 A;  5AQB A;  3FUM A;  4RG9 A;  1M5Y A;  1UW4 B;  3RO2 A;  2QY7 A;  3UQB A;  4I43 A;  2XP7 A;  3ULQ A;  4Q96 A; 
#chains in the Genus database with same CATH homology
 2E2E A;  4JEU A;  4MAV A;  1U3C A;  5D0Q D;  4RG6 A;  3CKC A;  2OND A;  5FT9 A;  4BT9 A;  4FJY A;  4BFR A;  1UJJ A;  1ZU2 A;  4I6J A;  1OWO A;  3MZL B;  4N3C A;  3KZ7 A;  4JW1 A;  4FP7 A;  3B7R L;  4PUC A;  5HBF A;  3ML8 A;  4QZV B;  3APD A;  3WL0 A;  2QFC A;  3FY4 A;  3B9D A;  1FD9 A;  1SQM A;  1HU3 A;  1JPL A;  2XPY A;  4L2Y A;  3CVX A;  1QPL A;  4GCO A;  3QWV A;  2DG3 A;  2IQC A;  4CT4 A;  1WB0 A;  4ODL A;  5C2Y A;  4BTA A;  3AS2 A;  3UQ3 A;  2I6H A;  3IHY A;  1W9P A;  4AIF A;  1EDQ A;  1LL7 A;  2VGY A;  4CDM A;  3RRU A;  2PM6 A;  3ASD A;  3UT4 A;  3ZYK A;  4DPR A;  1FKD A;  4Z2H A;  1X6L A;  2Q5A A;  1EYH A;  3B7S A;  3PDN A;  3ZYQ A;  4H7Y A;  2L6J A;  3U4T A;  1UN9 A;  3ZEF A;  2I1K A;  2OV8 A;  3NRK A;  2I9C A;  3RKV A;  1NSG A;  3UT7 A;  4Q7N A;  3KAG A;  4QFV A;  5JHA A;  3MGB A;  4KBQ A;  1XNF A;  4AJW A;  4F53 A;  4EQF A;  2B31 A;  4J8F A;  1O6I A;  1IQR A;  4W9O A;  1HJW A;  1A7X A;  2UY1 A;  4P8W A;  2PQN A;  4GZ6 A;  3Q15 A;  2XCC A;  4DWS A;  4JFM A;  3WKZ A;  4A1G A;  3GZ1 A;  3CZ8 A;  2AW6 A;  2RQS A;  1FFR A;  2DBA A;  3IKG A;  4TRQ A;  5DIZ A;  3CGH A;  4MRU A;  1ZU8 A;  4GIV A;  1NWT A;  4MTV A;  2DT1 A;  1B89 A;  1XRV A;  3JQ0 A;  2IFU A;  2M08 A;  4XI0 A;  4U85 A;  3JYS A;  2KAT A;  3ZYL A;  2M1I A;  4UI9 J;  2F4E A;  2WXO A;  5DIT A;  3LPZ A;  4Y6W A;  3AS1 A;  3FTZ A;  3ASG A;  1HXI A;  1ZBP A;  3NF1 A;  3AQU A;  1PBK A;  4FHJ A;  4WK9 A;  1FVH A;  4O2T A;  2DCP A;  4NAC A;  3TXN A;  1ZB5 A;  2XP4 A;  3D9N A;  4A55 A;  5HQ8 A;  2C2L A;  1F8A B;  5EX0 A;  3PS6 A;  4MNK A;  3B13 A;  2MLX A;  3ALF A;  3O5P A;  3CHD A;  4XI9 A;  1FKK A;  2CFU A;  4IUL A;  2LPV A;  3QWP A;  2BTD A;  1NMV A;  2ZQT A;  3FXY A;  5CCL A;  4DZ3 A;  3FEX A;  4GU5 A;  1E7V A;  3KAH A;  5HWB A;  2DT2 A;  3URZ A;  2XP8 A;  3CH9 A;  3ZFW A;  3ZPJ A;  4ILG A;  5FZQ A;  3FTU A;  1FKR A;  2RUQ A;  4MGV A;  3GW4 A;  4FU3 A;  3EIQ C;  4DZ2 A;  2KZT A;  4GA1 A;  5T8I A;  3IHV A;  3DPD A;  3OXF A;  3KEZ A;  4DLQ A;  2WPV A;  5B8I C;  2WQH A;  3MDY B;  1Z3Y A;  5LFA A;  1TJF A;  4L1B A;  3O5J A;  3ZHE A;  1UR9 A;  5LX8 A;  1D6O A;  3LVR E;  4JC8 A;  4UWH A;  3SNX A;  1E96 B;  4ODM A;  3PUJ A;  4PDX A;  4KMO A;  4URK A;  5J90 A;  3QOK A;  3CIA A;  3EHN A;  3CVN A;  1ZBC A;  5T4Y A;  2FO7 A;  5ENN A;  3ESK A;  4WNG A;  3PNT B;  3TG5 A;  2QF8 A;  4TNS A;  3Q49 B;  3VTX A;  4RSY A;  3NZU A;  4JFJ A;  1ELK A;  5FQ4 A;  3IV0 A;  1HS6 A;  4Y6C A;  2PV1 A;  4EZL A;  4N2S A;  2LSU A;  4DRH A;  4LEU A;  5HKG A;  1ROU A;  2ILR A;  2DT0 A;  3LDZ A;  1E8W A;  2KGJ A;  4EEC A;  3QAR A;  3ARO A;  2XGM A;  1Q6I A;  4ILH B;  1KLX A;  4F1S A;  3FTY A;  1A17 A;  2YHC A;  4I6G A;  3GYZ A;  1S0P A;  1JVW A;  3WD2 A;  3KAF A;  3UF8 A;  3FUI A;  4LER A;  4J4N A;  3LCA A;  3FUF A;  1EPU A;  5BUZ A;  3NTP A;  1LQ0 A;  2O92 A;  4UWK A;  3HDX A;  3ZIM A;  3UUX A;  4ODO A;  4V3I A;  3FUL A;  4GZ3 A;  3AS5 A;  3IK8 A;  4JPS A;  1OWP A;  1N54 A;  2KI3 A;  2WVI A;  3CGN A;  3EDT B;  1QPF A;  4N19 A;  1RD6 A;  4ACK A;  4L3N A;  5A7D B;  2J08 A;  3Q5M A;  3RFW A;  4GGQ A;  2J07 A;  4Z2I A;  5CMW A;  4DRN A;  3G2T A;  4OYS A;  5HWC A;  3OXL A;  1JWF A;  5FWQ A;  4NRH B;  4DLO A;  1ZL1 A;  3L54 A;  3FTW A;  4MKT A;  5J08 A;  3CK7 A;  2OVF A;  1XHG A;  4MS6 A;  3UX4 A;  1FKS A;  3D9O A;  2YBU A;  4EBA G;  3CHC A;  1Q1C A;  1HKK A;  4XKB A;  3L08 A;  1W9V A;  5EDS A;  3G2U A;  2A3B A;  4ODK A;  4WAF A;  2PM7 A;  3LVQ E;  4GB9 A;  2A3E A;  1QZ2 A;  4UQZ A;  3FH7 A;  2WXM A;  3TXM A;  4BT8 A;  3SBT B;  3I5P A;  3UMV A;  2ITK A;  4R5E A;  4U0Z A;  2IUZ A;  4UWF A;  1BKF A;  5M72 A;  2WXF A;  4WWP A;  4MNL A;  1HFA A;  3G2V A;  3WIJ A;  2PZI A;  5FQ7 A;  3JXV A;  4DRO A;  3KCE A;  5ARF A;  2WLY A;  3O5G A;  2PV2 A;  3SFZ A;  4YVO A;  4TW6 A;  1JNS A;  3AS4 A;  4P29 A;  3PRA A;  3RK6 A;  3S7B A;  3SBS A;  2J4D A;  4BWR A;  1QNF A;  3I3N A;  3LS8 A;  4UWL A;  1J6Y A;  2HO1 A;  4EBA A;  4OVU A;  3PNL B;  2RUD A;  4KVM A;  2VSX E;  2FEZ A;  4WNF A;  3WQW A;  3PEV B;  3D3M A;  4IN3 B;  2CFZ A;  2J4B A;  3B7X A;  2Y4T A;  2RUR A;  1X5B A;  2DG4 A;  3U66 A;  4G2P A;  1D7I A;  4JFI A;  1WNO A;  2IOS A;  5LOZ A;  2YHE A;  4GYW A;  4DWS C;  2AXZ A;  4DT4 A;  1N1A A;  3RM9 A;  2FI7 A;  4UWG A;  4UQX A;  4DI3 A;  3BG0 B;  3R7R A;  2MOW A;  5DO2 A;  2DSW A;  5HW7 A;  4G24 A;  3ARW A;  4L72 B;  1U3D A;  1ELW A;  3GZ2 A;  2YNQ A;  5BV0 A;  3PA7 A;  3QOU A;  3IHZ A;  4NSB A;  4HXI A;  1C9H A;  4FN2 A;  4TV3 A;  3CEQ A;  1HO8 A;  5FZS A;  4LAV A;  3CVP A;  4LAY A;  1LL4 A;  4GZD A;  4MSP A;  2UY1 B;  4JA9 A;  3UI5 A;  2KFW A;  4HBO A;  3QJZ A;  4DWS B;  1H2V C;  1Z6T A;  1HKI A;  4F7A A;  1Y6I A;  4G23 A;  5HTG A;  3FU3 A;  3E4B A;  1ZBK A;  4H7X A;  3VLD A;  2F2D A;  1DVP A;  3L16 A;  4UI9 C;  2FAP A;  3IBE A;  2XP6 A;  4GZC A;  1OWM A;  2XP3 A;  4C02 B;  5BT1 A;  3CLJ A;  3ONL A;  1SYT A;  3B7T A;  3FHE A;  5D75 A;  4W9P A;  3G2S A;  4PS8 A;  3MX3 A;  1H0A A;  4G1T A;  2WB2 A;  1FVF A;  2PL2 A;  2DG9 A;  4TW8 A;  1NWR A;  3RO3 A;  4FJZ A;  3WXX A;  1TEZ A;  2WLZ A;  4XIF A;  2XPZ A;  1YA0 A;  4N2Q A;  2RG8 A;  2V5F A;  1H0I A;  4WJX A;  3CR3 A;  2ION A;  2KCK A;  5ANR A;  4MNJ A;  2R17 C;  1W1P A;  2I2O A;  4APF A;  1GUV A;  3MCX A;  4L2L A;  5KCM A;  3G6L A;  2RSE A;  2MHK A;  5T3R A;  3EHM A;  2WXL A;  4UQY A;  2PPN A;  4KT6 B;  2P58 C;  1TFV A;  4PTM A;  4IQ2 A;  2M2A A;  2PPP A;  3C98 A;  5A6C A;  3PRB A;  3TG4 A;  2FUL A;  2CHX A;  4N5C A;  2CHZ A;  4J8S A;  1FKH A;  1HH8 A;  2ZR4 A;  5HT1 A;  2XRZ A;  2WQ7 A;  1BL4 A;  2LJ4 A;  4DIP A;  3W4R A;  1XGW A;  2L0I A;  2VSY A;  3T8M A;  1NWS A;  4GA2 A;  1UR8 A;  3L6A A;  4J8E A;  3PE3 A;  1OWQ A;  4I2W A;  1JWG A;  3CV0 A;  2KC7 A;  4JFL A;  2C0M A;  4ABN A;  3ARY A;  3CVV A;  4CEM A;  1HG5 A;  4ZPT R;  3D9I A;  3KAE A;  4DRQ A;  3FUK A;  3G6M A;  2KZT B;  4ZPV R;  3RRM B;  3L22 A;  2XPI A;  4CCA A;  3TCZ A;  2VN1 A;  4I1O B;  1NP7 A;  4XKC A;  1Y8M A;  4G26 A;  5KJM A;  3FUH A;  3GZS A;  3D9L A;  2HR2 A;  3FUD A;  3N71 A;  3B7U X;  2MRI A;  4W9R A;  2MLZ A;  4FHK A;  4PH4 B;  3ZRH A;  3ARU A;  2M63 A;  3ASF A;  2LO6 A;  3PZD A;  2R59 A;  3RRN B;  1E6R A;  4HBE A;  2ZR5 A;  4PS7 A;  1OGB A;  2VSO E;  2WXK A;  3FTV A;  2KCV A;  5JJ7 A;  1UG3 A;  4U86 A;  3O5D A;  4I17 A;  5D0O D;  1LF8 A;  3CK8 A;  2DIW A;  1HJV A;  2MLY A;  2KM4 A;  1OWN A;  4FAD A;  1ELR A;  4C0E A;  3FEY A;  3T5V A;  2ZR6 A;  1Y0O A;  1VDY A;  4KXK B;  4M3O A;  3SF4 A;  2XPB A;  5AJD A;  2XCB A;  4ME2 A;  3UQI A;  1TJC A;  1H2U A;  3ZXS A;  4GMJ A;  1LG1 A;  1UJK A;  4AP2 A;  3JYJ A;  3U9W A;  3QC1 A;  2NXP A;  3IKO B;  3SZ7 A;  2CHW A;  1W1T A;  1D7H A;  3WH0 A;  3KS2 A;  4S3J A;  1FKT A;  1EHN A;  4BX9 A;  3ARR A;  2J9Q A;  2A3A A;  2X6J A;  4NQ0 A;  5JJT A;  3QB2 A;  5KJN A;  3UI6 A;  3LXU X;  3O5M A;  4JYS A;  1E15 A;  3KAD A;  1HKM A;  3MEK A;  2FKE A;  3D9M A;  3MV3 B;  4N39 A;  3HVE A;  4WWO A;  4NNR A;  4Z2J A;  4EZK A;  3ARZ A;  1IHG A;  3FU5 A;  3D9P A;  4G50 A;  5AJL A;  2WM0 A;  4DRP A;  4GAA A;  4S3K A;  1NH6 A;  2A5U A;  1QQE A;  4GPK A;  3ART A;  5FQ8 A;  2FDM A;  4WIW A;  3ALG A;  3TGO A;  4DWS D;  1Z3X A;  2PI6 A;  3EY6 A;  1HF8 A;  4DRJ A;  4DRI A;  5G05 C;  5DBK A;  1JNT A;  3VLF A;  3GPK A;  4AY1 A;  3D9J A;  4ITZ A;  1TCO C;  4AY5 A;  1FFQ A;  2MF9 A;  3B8S A;  1K9T A;  1NA3 A;  2GRM A;  1FKI A;  4GYY A;  3T5X A;  3CHO A;  1F40 A;  4QIB A;  3PRZ A;  4U04 A;  4CGV A;  1ZBV A;  3FUN A;  3SHF A;  4JZY A;  3ML9 A;  2L9B A;  3ASH A;  3FUE A;  1KT1 A;  3ODK A;  2J49 A;  5HI7 A;  3P1U A;  3S7D A;  2XPA A;  5CCM A;  3OAW A;  4P8V A;  3CGM A;  4ANX A;  5HW8 A;  1HJX A;  1E8Y A;  3JUI A;  5E76 A;  4ZS6 A;  4HOR A;  2V8S E;  1EDU A;  3IKD A;  3FH5 A;  5KJK A;  5EKQ D;  3WD4 A;  3RME A;  4ATG A;  3L13 A;  1ZCN A;  2XGO A;  3CVU A;  1NZN A;  3EIJ A;  2VJ8 A;  5BV1 A;  2PQR A;  3SI5 A;  3UQA A;  5DF0 A;  1IX5 A;  4GA0 A;  4U07 A;  4JVS A;  3CSF A;  4XX5 A;  3CVY A;  4U84 A;  2WXJ A;  4YVQ C;  2VCD A;  3MJW A;  4AV7 A;  3ARQ A;  1LG2 A;  1W9U A;  5AIJ A;  4IYP A;  5BPP A;  2DPE A;  5GPR A;  3S7F A;  1WM5 A;  5G05 J;  5LCW C;  5GPG A;  1OWL A;  4AOF A;  4TW7 A;  4I6E A;  3QNK A;  4A3V A;  5C1D A;  3TL5 A;  5LP0 A;  2F21 A;  2V0P A;  3AS3 A;  3BG1 B;  4ODR A;  4R7L A;  3KAB A;  1NWU A;  3TAX A;  4I1A A;  4NUR A;  1ROT A;  3O5O A;  5DIU A;  4U8H A;  4JEH A;  3AU4 A;  3K9I A;  3JYM A;  2IF4 A;  5JHB A;  2ZU6 B;  3RIB A;  1VF8 A;  2WXH A;  2AWI A;  1WAW A;  4AEZ C;  3LEW A;  2YQ8 A;  3CK9 A;  4FA6 A;  4ACL A;  3PEU B;  3TDB A;  2WK2 A;  1DNP A;  4QT3 A;  3MKQ A;  3UT8 A;  4JL0 A;  3LJ3 A;  3CVL A;  4HOQ A;  2WXQ A;  1FKL A;  1FAP A;  1UN8 A;  3Q4A B;  1FCH A;  1WAO 1;  3PH0 C;  4JHR A;  2PPO A;  1T11 A;  1BPO A;  3HIZ A;  5G04 C;  2LKN A;  4CDN A;  1MQS A;  4MNM A;  3LKU A;  3EJN A;  4FUL A;  4W9Q A;  4GML A;  4I9E A;  3NZS A;  2VGX A;  4WNE A;  3RJV A;  4CRW A;  2C0L A;  3ONK A;  4BSX A;  3S2A A;  4R0X A;  4MPK A;  4LAX A;  4ODP A;  2XP9 A;  2BF0 X;  3CHR A;  3TJP A;  4J0U A;  5LCW J;  1L5J A;  3L17 A;  3JQ1 A;  2KR7 A;  4YND A;  4DRM A;  3ARV A;  4DJA A;  2VTB A;  4KVO A;  3CVQ A;  1Q6U A;  2V4L A;  1J4R A;  1HX8 A;  3FY1 A;  3PR9 A;  4HVB A;  4IRU A;  4FLH A;  2VYI A;  4Q69 A;  3QAQ A;  3NI6 A;  2WXR A;  5BXJ A;  3OXG A;  1N52 A;  3VAW A;  1W1Y A;  4EZJ A;  2N87 A;  2JLB A;  3MKR A;  3RM8 A;  3QKY A;  3MV2 B;  4JA7 A;  3O4Z A;  4W5U A;  3RGC A;  1ZBW A;  5G2N A;  1L1P A;  2IJG X;  4J4O A;  4EPZ A;  3AS8 A;  3O48 A;  3CQG B;  4C0M A;  4ODN A;  1FJD A;  3B9A A;  3CHE A;  3O5L A;  5GQB A;  4LGX A;  2DSU A;  3B9E A;  3APC A;  2LNI A;  2ZQU A;  3FP3 A;  3Q47 B;  3HHM A;  4Z2K A;  2O9O A;  5G04 J;  3FU6 A;  5EX3 A;  3ARP A;  4U63 A;  2AXV A;  1GPF A;  2WXN A;  3ENE A;  4XZ4 A;  1GW6 A;  5KJL A;  1YAT A;  2EQX A;  5CHE E;  3IEG A;  3D9K A;  4I1M A;  4MLP A;  4I2Z A;  2WQ6 A;  2AVP A;  3H9R B;  3CHF A;  4ZPW R;  3O5F A;  3RU0 A;  4ML4 A;  3UI4 A;  2OVB A;  4FLB A;  2NSZ A;  4N3A A;  2E0I A;  4C9B B;  3KD7 A;  3UPV A;  2RUC A;  1H19 A;  4FAP A;  3G2W A;  3KAI A;  3OOB A;  4BX8 A;  3LYA A;  3FFL A;  4E85 A;  1E6Z A;  2LAH A;  2LSV A;  4IPX A;  1JNE A;  2GRL A;  4XAK A;  4ILI A;  4HOT A;  3PVL A;  1W1V A;  2LGO A;  1PC2 A;  3O5Q A;  2NC9 A;  3FUJ A;  4AXH A;  3CHP A;  4URI A;  3MA5 A;  4WKF A;  3VTY A;  2HM8 A;  4DRK A;  2CG2 A;  2MNT A;  2ZQS A;  4ODQ A;  4OVV A;  2WMO A;  3SD5 A;  2YIN A;  3ARX A;  1FKG A;  4CDR A;  5J6E A;  4Q22 A;  2Y3A A;  1FKB A;  2AOS A;  1KT0 A;  1H0G A;  2X38 A;  2FBN A;  3R7Q A;  2VSN A;  2AWG A;  2CG3 A;  3ZGQ A;  4DH0 A;  4LCT A;  2J09 A;  4AY6 A;  3ZW3 A;  2AXU A;  3U3W A;  1B6C A;  3ZHE B;  3PUK A;  4HAR A;  4A1S A;  5E75 A;  3QWW A;  4KZ0 A;  4BF8 A;  3AS0 A;  1HKJ A;  4NZC A;  3RM4 A;  3I4G A;  3HVE B;  1EQ3 A;  4J6I A;  4WND A;  3BEE A;  4Z2L A;  2PBC A;  1P5Q A;  2WMN A;  2ZQV A;  4G25 A;  1HG2 A;  2A3C A;  4WWN A;  3ZYM A;  2XEV A;  4GCN A;  3LY8 A;  3CQC B;  4U0U A;  1JUQ A;  1HZ4 A;  4G2V A;  4ANV A;  3NQP A;  4ANU A;  2G41 A;  3O5I A;  3HYM B;  3OA5 A;  4JXT A;  2JZV A;  4D10 C;  1D2K A;  4IT4 A;  2L2S A;  1X6N A;  5CMY A;  4KYO B;  2WXP A;  4FC8 A;  1LJY A;  3FTS A;  4JHJ A;  4B8C B;  1NMW A;  2IU1 A;  1E90 A;  2OFN A;  2I1J A;  4RVB A;  3CHS A;  1YW5 A;  5JH8 A;  4J8D A;  4AM9 A;  2MPH A;  2BUG A;  3ESL A;  3I4R B;  2OLH A;  1J4H A;  1D7J A;  1SZA A;  3DBS A;  2PV3 A;  3PRE A;  4ANW A;  1PIN A;  2GW1 A;  3FAP A;  1ITX A;  5JJ6 A;  2HYZ A;  1SR0 A;  1PAQ A;  4QT2 A;  4BTB A;  2FF4 A;  1HE8 A;  4P8X A;  3WD3 A;  2IOL A;  4LAW A;  1WY6 A;  4K0R A;  4Z2G A;  2WXI A;  3R9A B;  4I9C A;  5HUA A;  1IYG A;  2KO7 A;  4P8U A;  4B89 A;  1PY1 A;  4HS2 A;  3FWV A;  3QDN A;  1MHQ A;  5FTP A;  5ANL A;  2VQ2 A;  4BY6 A;  3LY7 A;  3OTN A;  4UI9 K;  2XQ0 A;  4L7T A;  4A3T A;  4WUY A;  5BW8 C;  1E8X A;  5HW6 A;  2JEK A;  4APO A;  5I98 A;  2X6K A;  4B94 A;  4G11 A;  2X3M A;  1OUV A;  3CHQ A;  3CHM A;  5AEN A;  3ARS A;  3U64 A;  4HLE A;  5DEZ A;  1LL6 A;  3CKB A;  3CST A;  2X6I A;  5A23 A;  1NA0 A;  2OOE A;  2UZ5 A;  4F3V A;  1EF1 C;  2Y78 A;  3ZVV A;  1J4I A;  2G8Z A;  3WL1 A;  2XRY A;  4KR0 B;  4KZC A;  4HOS A;  1W3B A;  4N3B A;  4DI4 A;  2UWJ G;  3FTX A;  3S7J A;  3MKQ B;  4IT6 A;  4JFK A;  3FU0 A;  2D9F A;  2L0T B;  1HXV A;  4TUU A;  2WXG A;  2GGF A;  3FDH A;  1GOI A;  5BNW A;  1KFW A;  4DK5 A;  4IQC A;  1IQU A;  4WKH A;  3LY9 A;  3I6C A;  2Q7F A;  2A4Z A;  5G55 A;  1INZ A;  2WM9 A;  3QK0 A;  1FKF A;  2X6H A;  3TC5 A;  4E6H A;  2VGX B;  4K03 A;  3WD1 A;  4Q94 A;  2XGS A;  3APF A;  3MYV A;  4U0S A;  2KE0 A;  3JCK C;  5FJY A;  3ZN3 A;  2RD0 A;  4GYO A;  3P2B A;  1U79 A;  1SZ9 A;  3PE4 A;  3WQV A;  5AYW D;  1R9H A;  3WD0 A;  3SGH A;  4HFG A;  3O5R A;  2LAI A;  1Q6H A;  5DIV A;  4WKA A;  4CGW A;  2ESC A;  3LUO A;  4HOU A;  3KAC A;  4O6F A;  3BXW A;  1H6K A;  2VTB B;  4GZ5 A;  2K8I A;  4PS3 A;  1EIB A;  3O5E A;  3O5K A;  5FQ6 A;  4JHK A;  4B0Z A;  1H2T C;  3PRD A;  4KQZ A;  1EYM A;  2DSV A;  4XE0 A;  1E7U A;  4B8A A;  4CT0 A;  2YBT A;  2DT3 A;  3CVW A;  1JND A;  3AU5 A;  2R5S A;  2Y4U A;  3VLE A;  2DSZ A;  1E6N A;  1CTN A;  4AVX A;  2XHE A;  4LUN U;  1W26 A;  1OGG A;  5ARG A;  2KCL A;  3FH8 A;  1E6P A;  1E8Z A;  4TYO A;  4LRZ A;  4TX0 A;  1ZK6 A;  1E9L A;  5FZR A;  2XP5 A;  1FKJ A;  2X6F A;  4L23 A;  3FUM A;  4RG9 A;  1M5Y A;  1UW4 B;  3RO2 A;  2QY7 A;  3UQB A;  4I43 A;  2XP7 A;  3ULQ A;  4Q96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...