1KT1A

Structure of the large fkbp-like protein, fkbp51, involved in steroid receptor complexes
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
394
structure length
374
Chain Sequence
KKDRGVLKIVHGEETPMIGDRVYVHYNGKLANPFVFSIGKGQVIKAWDIGVATMKKGEICHLLCAYGATGSLPKIPSNATLFFEVELLDFKGEDLLEDGGIIRRTKRRGEGYSNPNEGARVQIHLEGRCGGRVFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILHLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYVQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQIFMCQKKAKEHNERDRRTYANMFKKFAEQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein FKBP51
publication title STRUCTURE OF THE LARGE FK506-BINDING PROTEIN FKBP51, AN HSP90-BINDING PROTEIN AND A COMPONENT OF STEROID RECEPTOR COMPLEXES
pubmed doi rcsb
source organism Saimiri boliviensis
molecule tags Isomerase
total genus 108
structure length 374
sequence length 394
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2002-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF00515 TPR_1 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1kt1A03
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1kt1A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1kt1A02
2PPOA 4FAPA 4XIFA 1JNSA 4TYOA 2L2SA 2LKNA 5KJKA 3O5RA 4TW7A 2AVPA 3ZGQA 2MPHA 4ODKA 3O5KA 2VGXA 4QT3A 2LJ4A 2FF4A 1PC2A 2VSNA 2Q7FA 2M08A 2XPBA 4G24A 4W9OA 2FKEA 3LY8A 1B6CA 2E2EA 3VAWA 4GGQA 4ODMA 3ZFWA 2K8IA 1F8AB 1HH8A 2NC9A 2LGOA 2DBAA 4DRNA 4AY6A 2FI7A 2C0LA 1FKDA 1M5YA 3B7XA 1FKGA 3LY7A 3ZN3A 1QQEA 2PBCA 4LAYA 2XP5A 4N2SA 3TC5A 3KZ7A 4N5CA 2LSUA 3GPKA 5KJLA 3S7DA 3VTYA 4U84A 5BNWA 2FEZA 4G2VA 3ZHEB 4LAWA 4UI9C 3AS4A 2ZQTA 3LUOA 4BF8A 2XP7A 3U3WA 4WNFA 3O5PA 4N3CA 1T11A 5HKGA 3KAIA 3OOBA 3NRKA 1J4IA 4LAXA 3UQIA 4ODRA 1NMWA 4U0ZA 2MF9A 3CGNA 3MDYB 4Y6CA 5JJ7A 4DRQA 1QPFA 5AYWD 5KJNA 1NA0A 2LNIA 4H7XA 3NTPA 4JFIA 2UZ5A 5HW8A 2KATA 3FWVA 5HWBA 1P5QA 3NF1A 3MKRA 4JFKA 3TDBA 4APOA 2HYZA 2MLZA 4UI9J 4WNEA 1J6YA 2MHKA 1N1AA 3GZ1A 2KC7A 3IK8A 2ZQSA 3O5QA 4GYYA 4GA0A 2M1IA 3VTXA 4GZ5A 3TG4A 4B94A 1EYMA 4N19A 1J4RA 4DZ3A 5HI7A 3ODKA 2UY1B 3CVLA 4ABNA 3KCEA 2VQ2A 4W9PA 4QT2A 1OUVA 2XCCA 1YA0A 2JLBA 4CDRA 4J4OA 4J8FA 2ZR6A 4DRIA 4TW6A 5EKQD 4J8DA 1NMVA 3Q15A 2ZR4A 1Q6UA 2RURA 3R9AB 3CKBA 3KAEA 1JVWA 2F21A 3KABA 2JZVA 5DITA 2XGOA 1FKTA 1PBKA 1NSGA 2Q5AA 1A7XA 1U79A 3LY9A 3RO2A 4WUYA 1FKFA 1ELRA 3CVNA 4DIPA 3CKCA 3ULQA 3O5JA 4R0XA 3KAFA 3RO3A 3BEEA 3WXXA 2KGJA 2F4EA 5KJMA 2Y4TA 5CCMA 4RG6A 4HOQA 4N3BA 3PDNA 3N71A 2PPNA 1BL4A 3QWWA 3HYMB 4ODNA 2ZR5A 3AS8A 2HO1A 3O5FA 4H7YA 3KACA 1WM5A 4AY5A 3GZ2A 4GZ3A 3KAGA 4GIVA 3KD7A 4J8EA 3PE3A 4G26A 5DIUA 4WNDA 2M2AA 3TG5A 4JA9A 5EX0A 3RIBA 3SZ7A 2XP6A 3OXLA 2DG4A 1Q6HA 3GYZA 5FT9A 5CCLA 5EX3A 1ZU2A 2KCVA 1FKJA 2KCKA 4WNGA 2C2LA 1Q1CA 4N2QA 1EQ3A 4NQ0A 1D6OA 4I1AA 4DT4A 1TJCA 1A17A 3O5GA 3FFLA 4QIBA 5HUAA 4BTAA 4UQXA 3LPZA 4GCOA 2PL2A 5HQ8A 3JYMA 2N87A 3Q47B 3O5OA 1L1PA 1J4HA 3RFWA 4MGVA 3KAHA 1F40A 5FZQA 3S7BA 4DRMA 3O5MA 4DRPA 4KXKB 2OOEA 4DROA 4CGVA 3AS5A 3UF8A 4AIFA 1C9HA 4LEUA 3CK7A 3CK8A 4Y6WA 3ZHEA 3ASHA 4I9CA 1WAO1 3QWVA 4CGWA 3O5LA 2XPIA 4J0UA 4GZ6A 2L6JA 4BT9A 1PINA 5HTGA 3CVPA 3UQBA 2VN1A 1ZBPA 5B8IC 3RKVA 2RUDA 5FTPA 2XGMA 3LCAA 3CEQA 4U07A 1KT0A 2VCDA 2KO7A 1XNFA 4HOUA 4IPXA 1HZ4A 4G1TA 1YW5A 3TAXA 4GYWA 4HORA 3S7JA 4I9EA 2XP3A 3QKYA 4GA2A 3ASGA 1ZCNA 1FKBA 2PQRA 5D0QD 5M72A 1Y0OA 3UI6A 2FO7A 2VSYA 1B89A 4DRJA 3MV2B 2KR7A 2PQNA 3MA5A 1FJDA 5ARFA 3WH0A 4JYSA 4ODQA 1D7HA 2XP9A 4A1SA 1FKHA 4U0SA 3ESKA 4KYOB 1QPLA 4W9QA 3LYAA 5J6EA 3PE4A 3NI6A 2KFWA 2LSVA 4U04A 5D75A 4YVOA 5GPGA 5D0OD 4I17A 4YVQC 2UY1A 5FJYA 2QFCA 4TNSA 4O6FA 4TX0A 4RG9A 4DH0A 3RU0A 4I2ZA 2RUQA 3UPVA 3ASDA 3U4TA 1FKIA 3IKDA 2ZQUA 5CHEE 2F2DA 5BT1A 2PV1A 2RSEA 3O5DA 5G04C 2WQHA 2VGXB 2VYIA 3ASFA 3O48A 1HXIA 5BW8C 4ODPA 3Q49B 5FZRA 5HW6A 4UI9K 3FP3A 3O5EA 4ODOA 3OXGA 4BTBA 1ROUA 2XP4A 3UQ3A 3Q4AB 4EQFA 3MEKA 4IQCA 4DZ2A 2BUGA 5FZSA 4ODLA 1D7JA 3RGCA 2KE0A 4G25A 4U0UA 1NA3A 3CGMA 4J4NA 4ME2A 2I6HA 5DBKA 4O2TA 2DG9A 1FKRA 1W3BA 2ITKA 4U86A 1E96B 4JL0A 4U85A 4G50A 1KLXA 3KADA 2C0MA 4DRHA 2P58C 5G04J 2MLXA 1QZ2A 1TCOC 1KT1A 4W9RA 1FKSA 4TW8A 5G05C 4JFJA 3UI5A 5HT1A 2IF4A 4GPKA 2PV3A 5HW7A 2IFUA 3TCZA 4N3AA 2HR2A 3UUXA 2ONDA 2R5SA 2V5FA 4NRHB 4XI9A 5LCWC 4JA7A 4G2PA 3CK9A 4UQYA 4BWRA 4KBQA 1HXVA 3KS2A 3CVQA 4N39A 1NZNA 2GW1A 2XEVA 4GA1A 3S7FA 4LAVA 3IEGA 4IN3B 2KCLA 3JYJA 3OXFA 2XPAA 2Y78A 4JHRA 3EY6A 1FCHA 2MLYA 2Y4UA 5HWCA 1D7IA 2WPVA 3CV0A 5G05J 4GYOA 3I6CA 4G23A 4ITZA 4BT8A 3ZPJA 4JFLA 4UQZA 4YNDA 5JJTA 1W26A 3QDNA 3Q5MA 3H9RB 5LCWJ 1ROTA 2YQ8A 3TGOA 1FD9A 2ZQVA 3K9IA 3IHZA 2OFNA 3LKUA 1FKLA 4FN2A 3UI4A 1JNTA 5A7DB 2PPPA 5BXJA 3QWPA 5JJ6A 2YHCA 2LPVA 5DIZA 3EDTB 2J9QA 4IQ2A 1Y8MA 2RUCA 2PZIA 3QOUA 5DIVA 2UWJG 5I98A 5C1DA 2PV2A 1IYGA 1IHGA 4I2WA 1FKKA 2AWGA 4MSPA 1YATA 3UQAA 3PRBA 4C02B 3FAPA 3MV3B 5A6CA 1Q6IA 1R9HA 3RJVA 2D9FA 2VGYA 1FAPA 3PRDA 2FAPA 4XI0A 3JXVA 4F3VA 1ZK6A 4HOSA 4DRKA 3PA7A 4NNRA 4AM9A 3URZA 3JYSA 4HOTA 2XCBA 4GCNA 2KI3A 3O5IA 1ELWA 2FBNA 2DG3A 2XP8A 3E4BA 1BKFA 2RQSA 4JFMA 5ARGA 3IKGA 3SF4A 2MNTA 3GW4A 2XGSA
chains in the Genus database with same CATH superfamily
1X5BA 5C2YA 2L2SA 2MOWA 2A3AA 2IY0C 3D9MA 1D8DA 3ZGQA 1DCQA 2VGXA 4HBEA 2AJAA 2FF4A 3J5QB 1PC2A 2VSNA 2Q7FA 3D9IA 2M08A 4W9OA 2FKEA 3LY8A 3JXJA 2HE0A 2QYUA 2XHEA 2WXKA 2X6IA 2P9KG 3EHMA 2NC9A 3SQVA 1SQMA 3IKOB 2DBAA 4DRNA 2FI7A 2C0LA 1FPPA 1MQSA 4A3TA 4Z2HA 4U8HA 4P8UA 4ZS6A 2F8YA 4OYSA 4LAYA 2XP5A 3O4ZA 2LSUA 4N5CA 4DWSA 1HO8A 3LVQE 3VTYA 4G2VA 3ZHEB 4LAWA 3EIJA 3AS4A 4B8AA 4N3CA 4M3OA 1OWOA 2XS1A 1ITXA 1EIBA 2KBXA 1J4IA 1LL7A 2R03A 3UQIA 3B7UX 4I43A 4HBDA 4Y6CA 3DEPA 3QOKA 3ALFA 4UWLA 3CIAA 1UR8A 4H7XA 2UZ5A 4E85A 4GZCA 2KATA 4JHKA 1P5QA 1VDYA 4JEHA 4ANXA 4JFKA 3TDBA 1GPFA 3B9EA 3Q7AA 4GTOA 2HYZA 3V2OA 1J6YA 3Q79A 1N1AA 4IYPA 1E6ZA 3IK8A 1JPLA 1N52A 4P8WA 3VTXA 4B94A 1JUQA 4HB5A 3KCEA 4QT2A 1OUVA 3FH8A 3PUKA 3D9NA 2IONA 1DCEA 2X3MA 3QNKA 5J08A 3OTNA 2RURA 1JVWA 2F21A 1JCHB 2JZVA 2XGOA 1FKTA 1NSGA 3RO2A 1Z3YA 3QC1A 4DIPA 4JB8P 5LP0A 3BEEA 3WXXA 2KGJA 3AG1E 3FU3A 5GQBA 4AXHA 3DSTA 2I1JA 5KNGA 3HYMB 4ODNA 2ZR5A 3TJPA 2L0IA 3EU5A 1H6PA 3BMBA 1UR9A 3FTVA 3B7SA 3ASOE 4PUCA 3UMVA 3ZYKA 1E15A 4J8EA 5JHBA 3HXFA 4P8XA 4G26A 3TG5A 4DI3A 4WIWA 1Q6HA 2DYRE 3TWSA 3GYZA 1IXVA 1JWFA 4XZ4A 2X6JA 3LDZA 3HXBA 3ARQA 2JEKA 3FFLA 1TN6A 4QIBA 5HUAA 1NL4A 5ANRA 3T5XA 3JYMA 4U63A 3O5OA 4J7WA 4YDYA 1J4HA 3RFWA 3KAHA 3S7BA 2WQ7A 1H6KA 3B7BA 3C3RA 4KXKB 3O5MA 5A23A 2V5QC 3E33A 4WKHA 3MYVA 2O92A 3E37A 4CGVA 4AP2A 1FFRA 1C9HA 4UWFA 2XQ0A 2LUHA 1E7UA 3HVEA 2DWZA 4CGWA 3B8SA 5LX8A 4J0UA 4ACKA 4OAUC 5HTGA 1BU9A 2VN1A 2WXJA 1HKJA 3LCAA 4MTVA 4U07A 1KT0A 2KO7A 3AU4A 4GTTA 4P29A 3UKUG 3IHVA 4AVXA 4DLOA 3PNLB 1YW5A 3TWQA 2GRQB 4U7EB 4PH4B 1E8WA 3FUFA 3PEVB 4MAVA 4HVBA 5HBFA 4DRJA 1B89A 3MV2B 2KR7A 4PTMA 3D9HA 3APFA 3KSLA 1N4PA 4LNGA 1QPLA 2LAIA 3X2QE 2B5UB 2GRMA 4U04A 1HJVA 4I17A 3B7TA 2UY1A 4O1PA 2XEHA 4YVQC 3AS3A 4TNSA 4RG9A 3RU0A 3PEUB 3HDXA 2IQCA 3ASDA 1FKIA 5CHEE 1E6PA 4FHJA 3WIJA 5G04C 2WQHA 2VGXB 3ASFA 2GRLA 3O48A 4L72B 2H6FA 5HW6A 3D9OA 1N0RA 1ZU8A 2ZXWE 3FP3A 4EPZA 5CEDB 3OXGA 3ULYA 4BTBA 3O5EA 4ODOA 2IO2C 4JXTA 4A3VA 4EQFA 2XZTG 4F7AA 4NZCA 1S0PA 4ODLA 3RGCA 2KE0A 4FJZA 4BSZB 4GMJA 5CERB 2WXRA 3ENEA 2RD0A 3CGMA 3G6LA 1KPSB 2F37A 3TWTA 1N0QA 4JEUA 3CHFA 2ITKA 4G50A 1KLXA 4DWSB 4I1MA 2C0MA 3QJZA 1OWLA 5G04J 3ZIMA 2NYJA 2MLXA 2KZTA 3LXUX 2OLHA 1ZB1A 4TW8A 1KZPA 3CSFA 1EDQA 4GPKA 2PV3A 4BX9A 3TCZA 3NOCD 2F8XK 2HR2A 1X6LA 2Y1LE 2DZNA 3UUXA 2XRYA 2GRPB 2PN0A 3UIOC 2R5SA 2V5FA 4NRHB 5LCWC 3NOGD 3U66A 3SD5A 3CK9A 3SI5A 4P8VA 1TNBA 3AS2A 2GW1A 1OGGA 2JABA 4FP7A 3IEGA 4F53A 2WXMA 5HKPA 3PRZA 2GRRB 3BU8A 3I4RB 3WKZA 4ITZA 3ZNGA 3ISMC 4UQZA 1LD8A 4Z2LA 4LGXA 5B1BE 2VJ8A 2YHEA 3H9RB 5LCWJ 3TGOA 2OFNA 4FN2A 1U2VG 3CLJA 3OA5A 3SFYA 1LF8A 3QWPA 4FHKA 3L22A 5DIZA 4IQ2A 1DC2A 2PZIA 3QOUA 5I98A 5C1DA 1SR0A 3D9LA 1FKKA 5ENOD 3BUAA 3UQAA 1JWGA 3PRBA 3FULA 4BY6A 2WM9A 4HRLA 1S70B 4BSXA 2DT0A 2WQ6A 3RJVA 1FAPA 3PRDA 5DF0A 2FAPA 2G8ZA 4C9BB 3LS8A 3CGHA 3ML9A 3I5PA 4GB9A 3PA7A 2OEVA 3URZA 4CRWA 2AOSA 3WD0A 2KI3A 4EBAA 4IT6A 3E4BA 4Q22A 3UM3A 5KBAA 2DSVA 3IKGA 2XGSA 2DSUA 4FAPA 3ONKA 2ESCA 3HXCA 1JNSA 2G41A 4ANUA 4WKFA 3FTSA 1JCQA 2XPBA 3R7RA 5EILA 3V30A 5CBNA 1B6CA 3VAWA 3LEWA 4R5EA 3EIPA 3CVWA 1OWNA 1TNOA 3CH9A 1HH8A 1E8XA 4AY6A 2A5EA 1WB0A 1V54E 3LY7A 4MPKA 3ZN3A 1QQEA 2PBCA 5AJLA 3BQOA 3SBSA 5CECB 3TC5A 1PY1A 3KZ7A 3TXNA 3GPKA 3LJ3A 4U84A 3HVEB 3LUOA 3Q75A 1K9TA 1HG2A 4BF8A 4WNFA 2OV8A 3KAIA 4HS2A 1N9AA 3PR9A 2PNNA 1QYMA 3CHPA 3CQGB 3I4GA 1NMWA 4NSBA 2MF9A 5HS0A 3MDYB 3T9KA 4DRQA 1EDUA 3AS0A 3CHQA 3IBEA 4EECA 4GTRA 2LNIA 4XEIG 2EIME 4G11A 3FWVA 5CMWA 3NF1A 2L0TB 3UM1A 1N4SA 2MHKA 3WD3A 4XKBA 4UUCA 2KC7A 2I2OA 2ZQSA 4GA0A 4FADA 2IO3C 2DSZA 1D8EA 1J4RA 1UN8A 1NP7A 2UY1B 2R17C 3WQVA 3B7RL 3JQ1A 4W9PA 2JLBA 4MNJA 3WD1A 5EKQD 1NMVA 3Q15A 2A3EA 2ZR4A 4GTPA 2KM4A 3Q9NC 1PBKA 4U96D 1U79A 4RVBA 4K5AB 1RD6A 1FKFA 4EZLA 2LXMA 1ZBCA 3CKCA 1Z3XA 3ULQA 3O5JA 2E0IA 1H0GA 3G2TA 2Y4TA 4GPMA 4RG6A 4TV3A 3NZSA 1BLXB 4MKTA 5ENRD 4MS6A 1BL4A 2GGFA 1K3ZD 3PVLA 3QWWA 4CDMA 5ENNA 3B95A 1JNDA 4KZCA 3SHFA 4IULA 2KZTB 5EN5D 2EILE 5ENSD 4GIVA 2F23A 4ZPTR 1TR4A 2CFUA 3PE3A 2ZGGA 5DIUA 2M2AA 3D9KA 5E76A 4JA9A 1MZCA 5EX0A 4ML4A 2DG4A 1LL4A 1ZU2A 1PAQA 3Q9UC 1FKJA 2QF8A 2C2LA 1Q1CA 1EQ3A 3HHMA 1MYOA 5T8IA 3U64A 4DT4A 1TJCA 3PS6A 5D66A 1ZBKA 1OCZE 1E8ZA 4UQXA 3HXDA 4TRQA 1V55E 3W9GA 4MGVA 3AG4E 3UT7A 3CHMA 5B3SE 2CHXA 4DRPA 2OOEA 1TYQG 1Y6IA 3SY2A 2EINE 3AS5A 3UF8A 4KVMA 4QFVA 2PM7A 1ZL1A 5EIDA 2AXUA 3FUHA 1WAO1 3QWVA 3W4RA 4Z2KA 3FXYA 4GZ6A 1Z6TA 3UQBA 3FH5A 1ZBPA 5B8IC 4AEZC 3RKVA 5FTPA 4MBGA 3FEYA 4DX1A 4FU3A 4HBOA 3EHNA 2B0OE 4IPXA 1HZ4A 4G1TA 3CVUA 3PREA 3TAXA 3HRAA 4HORA 4D10C 3PZ3A 4I9EA 4X8QA 5BV0A 4HQDA 4GA2A 4CT0A 1H2VC 1ZCNA 3EJNA 2Y3AA 3UKRG 2PQRA 3GZSA 3FTUA 1FJDA 5ARFA 3RM8A 2M63A 3WH0A 2QC9A 2VGEA 1D7HA 2XP9A 1FKHA 1OT8A 3JCKC 4ZFHA 3E30A 4W9QA 3TXMA 1N4QA 1UOHA 1OWPA 3NI6A 3MX3A 1H2UA 2QFCA 2P2CP 4TX0A 5AN8A 4DH0A 4I2ZA 3UPVA 3U4TA 1N11A 4NURA 4GTSA 2F2DA 3ZVVA 5JH8A 2RSEA 3MZLB 2WXLA 4HRMB 4ZPWR 4OVUA 3UT8A 1HXIA 5BW8C 2J07A 4ODPA 5ENPD 2A5UA 5FZRA 4OAVB 4UI9K 4UWGA 1OCOE 1ROUA 1TNZA 2R2LA 2XP4A 2OCCE 2DVWA 1N94A 1ZBVA 3RRUA 1OWQA 3MEKA 4IQCA 5FZSA 1D7JA 4BESA 3LJNA 4WWPA 3NZUA 4U0UA 4J4NA 2I6HA 3RSEG 3NB2A 1W3BA 4TXQA 3BG1B 3T5VA 2QZAA 4E6HA 3KSQA 4PS8A 2XEEA 2P58C 2BEDA 3FTYA 3Q7FA 1TCOC 1Q2ZA 1K1AA 2XRZA 3T8MA 3G2UA 1VF8A 2H6IA 5AAOA 4XI9A 4JA7A 3P2BA 2OEWA 4UQYA 4BWRA 1OCRE 1L5JA 4Z2IA 3KS2A 5CRUA 4N39A 1NZNA 2XPZA 3TWRA 4GA1A 3S7FA 4LAVA 3DSXA 4AY1A 2XS8A 3EIQC 2MLYA 1TN8A 1D7IA 4GYOA 1OGBA 4G23A 4JFLA 2WLZA 2IOLA 1K1BA 4YNDA 1LJYA 2DSWA 1BI8B 2ETBA 3FDHA 2DT1A 1HG5A 3TWXA 2X6FA 1W9UA 2PPPA 5BXJA 3CHSA 3R7QA 4DX6D 4TXRA 3ARPA 3AROA 2J9QA 1Y8MA 5KNHD 5DIVA 4JC8A 2FDMA 2PV2A 3FTXA 2AWGA 3F6QA 3FUEA 4MSPA 2P9UG 3OAWA 4C02B 5A6CA 3UTMA 1R9HA 4GTVA 3ARRA 3C3QA 2IOSA 2IUZA 4XI0A 4F3VA 3V31A 2I1KA 1OXJA 4HOSA 4FLBA 3UINC 4URIA 2DCPA 4K5BA 1ELWA 3D9JA 2XP8A 1BKFA 2X38A 4JFMA 5EYPF 2L6BA 2PPOA 3V79K 4F1PA 5BUZA 4B8CB 1O1RA 5KJKA 4TW7A 3UIPC 4ODKA 3O5KA 4QT3A 4ILGA 4G24A 3PUJA 4G8LA 3G2VA 2CHWA 2WXOA 3BXWA 3AJIA 3FUNA 3ML8A 2P9IG 3RMEA 5DO2A 4LSZE 1M5YA 3B7XA 5AQ9A 4YDEA 3DEOA 3ARYA 2CHZA 2MRIA 3DSVA 4S3KA 2J8SD 5ENTD 3RRMB 1S63A 1NWRA 1TFVA 4ILIA 4JW1A 5BNWA 3FUMA 4ATZD 2WVIA 4UI9C 4W5UA 2ZQTA 1RW2A 3O5PA 3OOBA 2BTDA 4LRZA 2XPYA 3EU9A 4LAXA 2P4VA 2J4BA 4U0ZA 1RZ4A 3SBTB 5H7PA 3TL5A 1QPFA 4CCAA 5AYWD 1NA0A 2CFZA 3SFZA 2A3CA 4JFIA 1BPOA 4MNLA 5GPRA 3WD4A 2VSOE 2WMOA 5G2NA 5CMYA 4HLLA 1SVXA 3D3MA 4KQZA 1QBQA 4TUUA 4UI9J 3TWUA 4WNEA 2MLZA 4MNMA 3L16A 4Z2JA 3ASNE 3O5QA 1HF8A 3PZ1A 4GU5A 3TG4A 3ZYMA 4N19A 2RKKA 2KXPC 4QZVB 3ODKA 3CVLA 4TUMA 2VQ2A 2XCCA 3PZDA 4CDRA 4DRIA 4G8KA 4J8FA 2ZR6A 4MNKA 2LAHA 1IQRA 3WQWA 4HNAD 1Q6UA 3R9AB 3CKBA 2Q5AA 3DSUA 4GMRA 1XHGA 1HJXA 5FQ6A 3NQPA 3ZYQA 1YMPA 4C0EA 2Y69E 2EQXA 3RO3A 2LXLA 2DZOA 4JPSA 3SGHA 4DRXE 5KJMA 4LNUD 4WAFA 4ILHB 4WK9A 3HG0D 4DLQA 2ETAA 2DYSE 3MKQA 4K0RA 3AS8A 4F1SA 2XENA 4H7YA 4IT4A 4EZKA 3KACA 1WM5A 3E32A 4DUIA 1WG0A 3GZ2A 3CVVA 3KD7A 5AQ7A 2FULA 4KR0B 2IJGX 4WJXA 4WNDA 3RIBA 3Q73A 3OXLA 5E75A 2ILRA 5CCLA 5EX3A 2KCVA 3ABLE 2KCKA 2P9LG 2RFAA 1LD7A 2XZDG 4N2QA 3RM4A 4NQ0A 1D6OA 4I1AA 4A1GA 1GOIA 1DNPA 1A17A 5CBOA 3UT4A 1Z5SC 3APCA 3LPZA 4KZ0A 4U8YD 2PI6A 3IV0A 5EDSA 2N87A 1L1PA 5FZQA 4CT4A 4DRMA 3B13A 4IRUA 3UI2A 1N54A 1TNYA 4LG6A 4DROA 2Y0BG 3CHEA 4LEUA 4FLHA 1FVHA 3CK8A 3P1UA 4Y6WA 2YNQA 4GZDA 3CHCA 3ASHA 4L9PA 1JCRA 1NH6A 1LQ0A 4BT9A 1HKKA 5KWDA 2R02A 3CVPA 4GMLA 3AG3E 4KT6B 2RUDA 1JCSA 1W1PA 2XGMA 3R9MA 2WK2A 1XNFA 3FUKA 1AP7A 3QK0A 3ALGA 4GTQA 4GYWA 4BX8A 2XP3A 3QKYA 3TWVA 3UX4A 3VLFA 3ASGA 4DPRA 1TJFA 5T4YA 5D0QD 5M72A 1Y0OA 3FEXA 2V8SE 2VSYA 2R59A 1OY3D 3MA5A 4JYSA 4U0SA 3ESKA 5CRVA 5J6EA 3ZXPA 1GUVA 3PE4A 2DT2A 3CQCB 3ZEFA 4UWHA 4ZPVR 1D2KA 1W1VA 5FJYA 3ARTA 1NWTA 2RUQA 4APFA 1DVPA 1A5EA 1OCCE 5BT1A 2WXPA 3DXMG 1IQUA 2VYIA 3L6AA 2QYJA 4Z68A 4QQIA 2WLYA 1YCSB 4URKA 3W9FA 3ZXSA 1INZA 3ZW3A 3CR3A 2BUGA 4BEPA 1O5MA 5LFAA 4MRUA 1O6IA 3RRNB 3ARVA 1JNEA 4G25A 3DPDA 1NA3A 1E44A 1EPUA 5FQ4A 4HFGA 3ZU7B 4MLPA 1E9LA 4U85A 3VLDA 2WXIA 4DRHA 5AJDA 4I1OB 3ZUVB 1FKSA 1AWCB 5G05C 5HT1A 2IF4A 1NWSA 4JD2G 4N3AA 1CTNA 2P9PG 3C5RA 3JUIA 2YBUA 3DSSA 4HARA 3LVRE 5KCMA 5JMND 1IHBA 3C72A 4B89A 2IEJA 2XEVA 1U3CA 4IN3B 4YDOA 3OXFA 1S64A 5G55A 2XPAA 1X81A 3PH0C 1W1TA 3EY6A 1FCHA 2YINA 3B9DA 2AWIA 2Y4UA 2WPVA 3WD2A 2F0YA 4FJYA 5G05J 3JUEA 3L54A 3ZPJA 3FTWA 3AS1A 3VLEA 2V0PA 1LTXA 3IHYA 1ROTA 3IHZA 2ZQVA 2O9OA 4I6EA 1FKLA 4GTMA 4I6GA 1JNTA 1FT2A 4Q7NA 2A4ZA 2YHCA 5CEAA 2LPVA 3FHEA 2RUCA 2R05A 4J6IA 2NSZA 1IHGA 5T3RA 4I2WA 3T8KA 1SZAA 5AIJA 3MV3B 4ATGA 4CDNA 1ELKA 2RG8A 5FQ8A 2D9FA 2BF0X 1MHQA 1GRJA 2PM6A 1EHNA 3ARXA 3JXVA 4WKAA 3EHQA 1O1TA 3EHRA 3MKQB 4DRKA 2EIJE 4NNRA 3ABKE 3O5IA 3PZ2A 2DG3A 1IX5A 5ARGA 4J8SA 5B1AE 3SF4A 2MNTA 3GW4A 3FY1A 4XIFA 4TYOA 2LKNA 2LO6A 4BETA 3O5RA 2AVPA 2MPHA 4A63B 2LJ4A 4K5CA 2YBTA 4UDMA 4L7TA 5AARA 4CEMA 4LNBA 1N95A 2E2EA 2EIKE 1UN9A 1GW6A 3E34A 4GGQA 2ZIRA 1HU3A 4ODMA 5HRYA 3ZFWA 3DPYA 2K8IA 1F8AB 3L13A 4PS7A 2LGOA 2OVBA 4RQIA 3ARSA 2VTBA 1NWUA 1FKDA 3CVXA 2MYOA 1FVFA 1FKGA 2RFMA 4L3NA 4O60A 2ZGDA 4N2SA 5KJLA 3S7DA 1H2TC 2FEZA 3G2WA 1NFIE 2ZISA 2XP7A 1E90A 3U3WA 1T11A 3S2AA 4PS3A 4XKCA 4HXIA 5HKGA 1KZOA 3NRKA 3FU5A 5JHAA 4ODRA 2ETCA 3CGNA 4DWSD 5JJ7A 3HIZA 5FQ7A 3GTYX 1SYTA 3L08A 5KJNA 3SNXA 4F6RD 3ARUA 5JA4D 4FC8A 3NTPA 4KVOA 2DIWA 5HW8A 4LCTA 1HKMA 5HWBA 3C98A 3ONLA 4FA6A 3MKRA 4DK5A 1E6NA 3KEAA 3APDA 4YDWA 4APOA 4WWNA 3U9WA 4KMOA 3GZ1A 5BXOA 4GYYA 2M1IA 4GZ5A 1EYMA 3L9TA 3L82A 4DZ3A 4Z2GA 5HI7A 3FUDA 4ABNA 4B93B 2A3BA 1YA0A 4J4OA 4TW6A 1U3DA 3QAQA 1EYHA 2WB2A 3ZYLA 3UXGA 4J8DA 1WNOA 2AXZA 3KAEA 3KABA 5DITA 4ACLA 4HI8A 1A7XA 3LY9A 2VSXE 4WUYA 2B31A 3ZRHA 4R7LA 1ELRA 3CVNA 4BFRA 1BI7B 3CHOA 3AQUA 4R0XA 3KAFA 3JQ0A 4S3JA 2F4EA 1UJKA 4L2YA 5CCMA 4HOQA 4N3BA 3PDNA 3N71A 2PPNA 2I9CA 2V4LA 2J09A 2HO1A 3ESLA 5FWQA 2WMNA 3HXEA 3O5FA 3RK6A 5AENA 4JVSA 3DBSA 1X6NA 1SW6A 4AY5A 3WL1A 4GZ3A 3KAGA 5EYLA 4L23A 4M7CA 4K03A 3KEZA 1OWMA 1E8YA 3SZ7A 2XP6A 4DI4A 3ARWA 5FT9A 2ETNA 4HRNA 5BV1A 4WNGA 4ZHBA 4XX5A 1H19A 1K8KG 3DWLG 3G6MA 3O5GA 3MGBA 2V4HC 4BTAA 4L1BA 5AQAA 4GCOA 2PL2A 4N5QA 5HQ8A 5ANLA 5LOZA 3Q47B 2WXNA 1TEZA 1F40A 3PZ4A 2DT3A 3DRAA 1LL6A 4OVVA 4AIFA 1XGWA 4Q94A 4DX5D 3RM9A 2QY7A 1TN7A 2WXHA 3FU0A 3RAUA 4HLEA 3CK7A 3ZHEA 3SO8A 4I9CA 3O5LA 1H0AA 2XPIA 2L6JA 1PINA 3CZ8A 4AV7A 2FO1E 5J90A 3FUIA 3EUVA 4FULA 3CEQA 5BXUA 1W9VA 2VCDA 4NACA 4HOUA 4JZYA 1G3NB 3SFXA 3MCXA 4RSYA 3S7JA 2BKKB 2GROB 4CZ2D 5ENQD 3QARA 1FKBA 1HX8A 3UI6A 2FO7A 5D2MC 2PQNA 5IY5E 4ODQA 3AAAC 5FIOA 4A1SA 2HM8A 4EZJA 4KYOB 1WY6A 1LG1A 2CG2A 2ZU6B 3LYAA 4O1OA 4U95D 1N4RA 3NAWA 2KFWA 5AQBA 2NXPA 2LSVA 2P9SG 5D75A 4YVOA 1H0IA 5D0OD 5GPGA 3L17A 4O6FA 3UM2A 3CVYA 4NIKA 4TXPA 3BG0B 3FU6A 3IKDA 4RLYA 2ZQUA 2X6KA 3FUJA 2PV1A 1MX6A 1YYHA 1HS6A 1UW4B 5EIBE 1HKIA 3O5DA 3D9PA 4DJAA 3ULEG 1SA4A 3CSTA 2P9NG 1D9SA 1XRVA 1E6RA 3Q49B 3DXKG 1IKND 1MJ0A 4Q69A 4XAKA 1W1YA 3WL0A 3UQ3A 3Q4AB 4BERA 2EULA 1TNUA 3C3OA 4DZ2A 3ARZA 5FINA 4C0MA 4HI9A 2VTBB 5DEZA 1E7VA 2CG3A 4ME2A 5DBKA 4O2TA 2DG9A 1FKRA 2IU1A 2H6HA 4AOFA 4U86A 1E96B 3FH7A 4JL0A 2H6GA 4J8YA 4EHMA 3KADA 1EF1C 1QZ2A 1KT1A 4W9RA 4U8VD 3UI5A 4JFJA 1WDYA 3IXEA 5HW7A 2IFUA 1MX4A 3I3NA 4DX2A 1O1SA 4ANVA 1BD8A 4C48B 2ONDA 1NI1A 3J5PA 2AXVA 4EBAG 2WXGA 1ZB5A 1ZBWA 2J4DA 4WWOA 4G2PA 3V2XA 1HFAA 4KBQA 4CYMD 1HXVA 3CVQA 1WAWA 3DSWA 3AG2E 3CHRA 4B0ZA 1W9PA 2KCLA 3JYJA 5BPPA 2Y78A 4JHRA 1H6OA 4A55A 3NBNB 3PRAA 3FTZA 1HJWA 5HWCA 4PDXA 3CV0A 3I6CA 4ANWA 4BT8A 1KFWA 4Q96A 4GAAA 3WG7E 5JJTA 1W26A 4V3IA 3QDNA 4XE0A 3TWWA 2OVFA 3Q5MA 3GU0A 2YQ8A 1HE8A 3MJWA 1MX2A 1FD9A 3K9IA 1FFQA 3PNTB 3LKUA 3AU5A 3JXIA 3UI4A 2WXFA 5A7DB 3B9AA 3CHDA 5JJ6A 4DWSC 1SZ9A 4LUNU 2AW6A 3ABME 3EDTB 4LERA 1UG3A 2UWJG 1LG2A 4UWKA 1IYGA 1FT1A 4L2LA 3ZKJA 3QB2A 2J08A 3UM0A 1YATA 2J49A 4AJWA 3FAPA 2DPEA 1Q6IA 2B6CA 1QNFA 2X6HA 2VGYA 1SA5A 4JHJA 1ZK6A 5ITZF 2GRNB 1UJJA 2L9BA 2BKGA 2WXQA 4AM9A 3JYSA 4HOTA 2XCBA 4GCNA 2FBNA 2RQSA 4I6JA 3FY4A 3Q78A 3G2SA 2WM0A 4DX7D
chains in the Genus database with same CATH topology
1X5BA 5C2YA 2L2SA 2MOWA 2A3AA 3D9MA 3ZGQA 2VGXA 4HBEA 2FF4A 1PC2A 2VSNA 2Q7FA 3D9IA 2M08A 4W9OA 2FKEA 3LY8A 2XHEA 2WXKA 2X6IA 3EHMA 2NC9A 1SQMA 3IKOB 2DBAA 4DRNA 2FI7A 2C0LA 1MQSA 4A3TA 4Z2HA 4U8HA 4P8UA 4ZS6A 4OYSA 4LAYA 2XP5A 3O4ZA 2LSUA 4N5CA 4DWSA 1HO8A 3LVQE 3VTYA 4G2VA 3ZHEB 4LAWA 3EIJA 3AS4A 4B8AA 4N3CA 4M3OA 1OWOA 1ITXA 1EIBA 1J4IA 1LL7A 3UQIA 3B7UX 4I43A 4Y6CA 3QOKA 3ALFA 4UWLA 3CIAA 1UR8A 4H7XA 2UZ5A 4E85A 4GZCA 2KATA 4JHKA 1P5QA 1VDYA 4JEHA 4ANXA 4JFKA 3TDBA 1GPFA 3B9EA 2HYZA 1J6YA 1N1AA 4IYPA 1E6ZA 3IK8A 1JPLA 1N52A 4P8WA 3VTXA 4B94A 1JUQA 3KCEA 4QT2A 1OUVA 3FH8A 3PUKA 3D9NA 2IONA 2X3MA 3QNKA 5J08A 3OTNA 2RURA 1JVWA 2F21A 2JZVA 2XGOA 1FKTA 1NSGA 3RO2A 1Z3YA 3QC1A 4DIPA 5LP0A 3BEEA 3WXXA 2KGJA 3FU3A 5GQBA 4AXHA 2I1JA 3HYMB 4ODNA 2ZR5A 3TJPA 2L0IA 1UR9A 3FTVA 3B7SA 4PUCA 3UMVA 3ZYKA 1E15A 4J8EA 5JHBA 4P8XA 4G26A 3TG5A 4DI3A 4WIWA 1Q6HA 3GYZA 1JWFA 4XZ4A 2X6JA 3LDZA 3ARQA 2JEKA 3FFLA 4QIBA 5HUAA 5ANRA 3T5XA 3JYMA 4U63A 3O5OA 1J4HA 3RFWA 3KAHA 3S7BA 2WQ7A 1H6KA 3O5MA 4KXKB 5A23A 4WKHA 3MYVA 2O92A 4CGVA 4AP2A 1FFRA 1C9HA 4UWFA 2XQ0A 1E7UA 3HVEA 4CGWA 3B8SA 5LX8A 4J0UA 4ACKA 5HTGA 2VN1A 2WXJA 1HKJA 3LCAA 4MTVA 4U07A 1KT0A 2KO7A 3AU4A 4P29A 3IHVA 4AVXA 4DLOA 3PNLB 1YW5A 4PH4B 1E8WA 3FUFA 3PEVB 4MAVA 4HVBA 5HBFA 4DRJA 1B89A 3MV2B 2KR7A 4PTMA 3APFA 1QPLA 2LAIA 2GRMA 4U04A 1HJVA 4I17A 3B7TA 2UY1A 4YVQC 3AS3A 4TNSA 4RG9A 3RU0A 3PEUB 3HDXA 2IQCA 3ASDA 1FKIA 5CHEE 1E6PA 4FHJA 3WIJA 5G04C 2WQHA 2VGXB 3ASFA 2GRLA 3O48A 4L72B 5HW6A 3D9OA 1ZU8A 3FP3A 4EPZA 3O5EA 3OXGA 4BTBA 4ODOA 4JXTA 4A3VA 4EQFA 4F7AA 4NZCA 1S0PA 4ODLA 3RGCA 2KE0A 4FJZA 4GMJA 2WXRA 3ENEA 2RD0A 3CGMA 3G6LA 4JEUA 3CHFA 2ITKA 4G50A 1KLXA 4DWSB 4I1MA 2C0MA 3QJZA 1OWLA 5G04J 3ZIMA 2MLXA 2KZTA 3LXUX 2OLHA 4TW8A 3CSFA 1EDQA 4GPKA 2PV3A 4BX9A 3TCZA 2HR2A 1X6LA 3UUXA 2XRYA 2R5SA 2V5FA 4NRHB 5LCWC 3U66A 3SD5A 3CK9A 3SI5A 4P8VA 3AS2A 1OGGA 2GW1A 4FP7A 3IEGA 4F53A 2WXMA 3PRZA 3I4RB 3WKZA 4ITZA 4UQZA 4Z2LA 4LGXA 2VJ8A 2YHEA 3H9RB 5LCWJ 3TGOA 2OFNA 4FN2A 3CLJA 3OA5A 1LF8A 3QWPA 4FHKA 3L22A 5DIZA 4IQ2A 2PZIA 3QOUA 5I98A 5C1DA 1SR0A 3D9LA 1FKKA 3UQAA 1JWGA 3PRBA 3FULA 4BY6A 2WM9A 4BSXA 2DT0A 2WQ6A 3RJVA 1FAPA 3PRDA 5DF0A 2FAPA 2G8ZA 4C9BB 3LS8A 3CGHA 3ML9A 3I5PA 4GB9A 3PA7A 3URZA 4CRWA 2AOSA 3WD0A 2KI3A 4EBAA 4IT6A 3E4BA 4Q22A 2DSVA 3IKGA 2XGSA 2DSUA 4FAPA 3ONKA 2ESCA 1JNSA 2G41A 4ANUA 4WKFA 3FTSA 2XPBA 3R7RA 1B6CA 3VAWA 3LEWA 4R5EA 3CVWA 1OWNA 3CH9A 1HH8A 1E8XA 4AY6A 1WB0A 3LY7A 4MPKA 3ZN3A 1QQEA 2PBCA 5AJLA 3SBSA 3TC5A 1PY1A 3KZ7A 3TXNA 3GPKA 3LJ3A 4U84A 3HVEB 3LUOA 1K9TA 1HG2A 4BF8A 4WNFA 2OV8A 3KAIA 4HS2A 3PR9A 3CHPA 3CQGB 3I4GA 1NMWA 4NSBA 2MF9A 3MDYB 4DRQA 1EDUA 3AS0A 3CHQA 3IBEA 4EECA 2LNIA 4G11A 3FWVA 5CMWA 3NF1A 2L0TB 2MHKA 3WD3A 4XKBA 2KC7A 2I2OA 2ZQSA 4GA0A 4FADA 2DSZA 1J4RA 1UN8A 1NP7A 2UY1B 2R17C 3WQVA 3B7RL 3JQ1A 4W9PA 2JLBA 4MNJA 3WD1A 5EKQD 1NMVA 3Q15A 2A3EA 2ZR4A 2KM4A 1PBKA 1U79A 4RVBA 1RD6A 1FKFA 4EZLA 1ZBCA 3CKCA 1Z3XA 3ULQA 3O5JA 2E0IA 1H0GA 3G2TA 2Y4TA 4RG6A 4TV3A 3NZSA 4MKTA 4MS6A 1BL4A 2GGFA 3PVLA 3QWWA 4CDMA 5ENNA 1JNDA 4KZCA 3SHFA 4IULA 2KZTB 4GIVA 4ZPTR 2CFUA 3PE3A 5DIUA 2M2AA 3D9KA 5E76A 4JA9A 5EX0A 4ML4A 2DG4A 1LL4A 1ZU2A 1PAQA 1FKJA 2QF8A 2C2LA 1Q1CA 1EQ3A 3HHMA 5T8IA 3U64A 4DT4A 1TJCA 3PS6A 1ZBKA 1E8ZA 4UQXA 4TRQA 4MGVA 3UT7A 3CHMA 2CHXA 4DRPA 2OOEA 1Y6IA 3AS5A 3UF8A 4KVMA 4QFVA 2PM7A 1ZL1A 2AXUA 3FUHA 1WAO1 3QWVA 3W4RA 4Z2KA 3FXYA 4GZ6A 1Z6TA 3UQBA 3FH5A 1ZBPA 5B8IC 4AEZC 3RKVA 5FTPA 3FEYA 4FU3A 4HBOA 3EHNA 4IPXA 1HZ4A 4G1TA 3CVUA 3PREA 3TAXA 4HORA 4D10C 4I9EA 5BV0A 4GA2A 4CT0A 1H2VC 1ZCNA 3EJNA 2Y3AA 2PQRA 3GZSA 3FTUA 1FJDA 5ARFA 3RM8A 2M63A 3WH0A 1D7HA 2XP9A 1FKHA 3JCKC 4W9QA 3TXMA 1OWPA 3NI6A 3MX3A 1H2UA 2QFCA 4TX0A 4DH0A 4I2ZA 3UPVA 3U4TA 4NURA 2F2DA 3ZVVA 5JH8A 2RSEA 3MZLB 2WXLA 4ZPWR 4OVUA 3UT8A 1HXIA 5BW8C 2J07A 4ODPA 2A5UA 5FZRA 4UI9K 4UWGA 1ROUA 2XP4A 1ZBVA 3RRUA 1OWQA 3MEKA 4IQCA 5FZSA 1D7JA 4WWPA 3NZUA 4U0UA 4J4NA 2I6HA 1W3BA 3BG1B 3T5VA 4E6HA 4PS8A 2P58C 3FTYA 1TCOC 2XRZA 3T8MA 3G2UA 1VF8A 4XI9A 4JA7A 3P2BA 4UQYA 4BWRA 1L5JA 4Z2IA 3KS2A 4N39A 1NZNA 2XPZA 4GA1A 3S7FA 4LAVA 4AY1A 3EIQC 2MLYA 1D7IA 4GYOA 1OGBA 4G23A 4JFLA 2WLZA 2IOLA 4YNDA 1LJYA 2DSWA 3FDHA 2DT1A 1HG5A 2X6FA 1W9UA 2PPPA 5BXJA 3CHSA 3R7QA 3ARPA 3AROA 2J9QA 1Y8MA 5DIVA 4JC8A 2FDMA 2PV2A 3FTXA 2AWGA 3FUEA 4MSPA 3OAWA 4C02B 5A6CA 1R9HA 3ARRA 2IOSA 2IUZA 4XI0A 4F3VA 2I1KA 4HOSA 4FLBA 4URIA 2DCPA 1ELWA 3D9JA 2XP8A 1BKFA 2X38A 4JFMA 2PPOA 5BUZA 4B8CB 5KJKA 4TW7A 4ODKA 3O5KA 4QT3A 4ILGA 4G24A 3PUJA 3G2VA 2CHWA 2WXOA 3BXWA 3FUNA 3ML8A 3RMEA 5DO2A 1M5YA 3B7XA 3ARYA 2CHZA 2MRIA 4S3KA 3RRMB 1NWRA 1TFVA 4ILIA 4JW1A 5BNWA 3FUMA 2WVIA 4UI9C 4W5UA 2ZQTA 3O5PA 3OOBA 2BTDA 4LRZA 2XPYA 4LAXA 2J4BA 4U0ZA 3SBTB 3TL5A 1QPFA 4CCAA 5AYWD 1NA0A 2CFZA 3SFZA 2A3CA 4JFIA 1BPOA 4MNLA 5GPRA 3WD4A 2VSOE 2WMOA 5G2NA 5CMYA 3D3MA 4KQZA 4TUUA 2MLZA 4UI9J 4WNEA 4MNMA 3L16A 4Z2JA 3O5QA 1HF8A 4GU5A 3TG4A 3ZYMA 4N19A 4QZVB 3ODKA 3CVLA 2VQ2A 2XCCA 3PZDA 4CDRA 4DRIA 4J8FA 2ZR6A 4MNKA 2LAHA 1IQRA 3WQWA 1Q6UA 3R9AB 3CKBA 2Q5AA 1XHGA 1HJXA 5FQ6A 3NQPA 3ZYQA 4C0EA 2EQXA 3RO3A 4JPSA 3SGHA 5KJMA 4WAFA 4ILHB 4WK9A 4DLQA 3MKQA 4K0RA 3AS8A 4F1SA 4H7YA 4IT4A 4EZKA 3KACA 1WM5A 3GZ2A 3CVVA 3KD7A 2FULA 4KR0B 2IJGX 4WJXA 4WNDA 3RIBA 3OXLA 5E75A 2ILRA 5CCLA 5EX3A 2KCVA 2KCKA 3RM4A 4N2QA 4NQ0A 1D6OA 4I1AA 4A1GA 1GOIA 1DNPA 1A17A 3UT4A 3APCA 3LPZA 4KZ0A 2PI6A 3IV0A 5EDSA 2N87A 1L1PA 5FZQA 4CT4A 4DRMA 3B13A 4IRUA 1N54A 4DROA 3CHEA 4LEUA 4FLHA 3CK8A 1FVHA 3P1UA 4Y6WA 2YNQA 4GZDA 3CHCA 3ASHA 1NH6A 1LQ0A 4BT9A 1HKKA 3CVPA 4GMLA 4KT6B 2RUDA 1W1PA 2XGMA 2WK2A 1XNFA 3FUKA 3QK0A 3ALGA 4GYWA 4BX8A 2XP3A 3QKYA 3UX4A 3VLFA 3ASGA 4DPRA 1TJFA 5T4YA 5D0QD 1Y0OA 5M72A 3FEXA 2V8SE 2VSYA 2R59A 3MA5A 4JYSA 4U0SA 3ESKA 5J6EA 1GUVA 3PE4A 2DT2A 3CQCB 3ZEFA 4UWHA 4ZPVR 1D2KA 1W1VA 5FJYA 3ARTA 1NWTA 2RUQA 4APFA 1DVPA 5BT1A 2WXPA 1IQUA 2VYIA 3L6AA 2WLYA 4URKA 3ZXSA 1INZA 3ZW3A 3CR3A 2BUGA 5LFAA 4MRUA 1O6IA 3RRNB 3ARVA 1JNEA 4G25A 3DPDA 1NA3A 1EPUA 5FQ4A 4HFGA 4MLPA 1E9LA 4U85A 3VLDA 2WXIA 4DRHA 5AJDA 4I1OB 1FKSA 5G05C 5HT1A 2IF4A 1NWSA 4N3AA 1CTNA 3JUIA 2YBUA 4HARA 3LVRE 5KCMA 4B89A 2XEVA 1U3CA 4IN3B 3OXFA 5G55A 2XPAA 3PH0C 1W1TA 3EY6A 1FCHA 2YINA 3B9DA 2AWIA 2Y4UA 2WPVA 3WD2A 5G05J 4FJYA 3L54A 3ZPJA 3FTWA 3AS1A 3VLEA 2V0PA 3IHYA 1ROTA 3IHZA 2ZQVA 2O9OA 4I6EA 1FKLA 4I6GA 1JNTA 4Q7NA 2A4ZA 2YHCA 2LPVA 3FHEA 2RUCA 4J6IA 2NSZA 1IHGA 5T3RA 4I2WA 1SZAA 5AIJA 3MV3B 4ATGA 4CDNA 1ELKA 2RG8A 5FQ8A 2D9FA 2BF0X 1MHQA 2PM6A 1EHNA 3ARXA 3JXVA 4WKAA 3MKQB 4DRKA 4NNRA 3O5IA 2DG3A 1IX5A 5ARGA 4J8SA 3SF4A 2MNTA 3FY1A 3GW4A 4XIFA 4TYOA 2LKNA 2LO6A 3O5RA 2AVPA 2MPHA 2LJ4A 2YBTA 4L7TA 4CEMA 2E2EA 1UN9A 1GW6A 4GGQA 1HU3A 4ODMA 3ZFWA 2K8IA 1F8AB 3L13A 4PS7A 2LGOA 2OVBA 3ARSA 2VTBA 1NWUA 1FKDA 3CVXA 1FVFA 1FKGA 4L3NA 4N2SA 5KJLA 3S7DA 1H2TC 2FEZA 3G2WA 2XP7A 1E90A 3U3WA 1T11A 3S2AA 4PS3A 4XKCA 4HXIA 5HKGA 3NRKA 3FU5A 5JHAA 4ODRA 3CGNA 4DWSD 5JJ7A 3HIZA 5FQ7A 1SYTA 3L08A 5KJNA 3SNXA 3ARUA 4FC8A 3NTPA 4KVOA 2DIWA 5HW8A 4LCTA 1HKMA 5HWBA 3C98A 3ONLA 4FA6A 3MKRA 4DK5A 1E6NA 3APDA 4APOA 4WWNA 3U9WA 4KMOA 3GZ1A 4GYYA 2M1IA 4GZ5A 1EYMA 4DZ3A 4Z2GA 5HI7A 3FUDA 4ABNA 2A3BA 1YA0A 4J4OA 4TW6A 1U3DA 3QAQA 1EYHA 2WB2A 3ZYLA 4J8DA 1WNOA 2AXZA 3KAEA 3KABA 5DITA 4ACLA 1A7XA 3LY9A 2VSXE 4WUYA 2B31A 3ZRHA 4R7LA 1ELRA 3CVNA 4BFRA 3AQUA 3CHOA 4R0XA 3KAFA 3JQ0A 4S3JA 2F4EA 1UJKA 4L2YA 5CCMA 4HOQA 4N3BA 3PDNA 3N71A 2PPNA 2I9CA 2V4LA 2J09A 2HO1A 3ESLA 5FWQA 2WMNA 3O5FA 3RK6A 5AENA 4JVSA 3DBSA 1X6NA 4AY5A 3WL1A 4GZ3A 3KAGA 4L23A 4K03A 3KEZA 1OWMA 1E8YA 3SZ7A 2XP6A 4DI4A 3ARWA 5FT9A 5BV1A 4WNGA 4XX5A 1H19A 3G6MA 3O5GA 3MGBA 4BTAA 4L1BA 4GCOA 2PL2A 5HQ8A 5ANLA 5LOZA 3Q47B 2WXNA 1TEZA 1F40A 2DT3A 1LL6A 4OVVA 4AIFA 1XGWA 4Q94A 3RM9A 2QY7A 2WXHA 3FU0A 4HLEA 3CK7A 3ZHEA 4I9CA 3O5LA 1H0AA 2XPIA 2L6JA 1PINA 3CZ8A 4AV7A 5J90A 3FUIA 4FULA 3CEQA 1W9VA 2VCDA 4NACA 4HOUA 4JZYA 3MCXA 4RSYA 3S7JA 3QARA 1FKBA 1HX8A 3UI6A 2FO7A 2PQNA 4ODQA 4A1SA 2HM8A 4EZJA 4KYOB 1WY6A 1LG1A 2CG2A 2ZU6B 3LYAA 2KFWA 2NXPA 2LSVA 5D75A 4YVOA 1H0IA 5D0OD 5GPGA 3L17A 4O6FA 3CVYA 3BG0B 3FU6A 3IKDA 2ZQUA 2X6KA 3FUJA 2PV1A 1HS6A 1UW4B 1HKIA 3O5DA 3D9PA 4DJAA 3CSTA 1XRVA 1E6RA 3Q49B 4XAKA 4Q69A 1W1YA 3WL0A 3UQ3A 3Q4AB 4DZ2A 3ARZA 4C0MA 2VTBB 5DEZA 1E7VA 2CG3A 4ME2A 5DBKA 4O2TA 2DG9A 1FKRA 2IU1A 4AOFA 4U86A 1E96B 3FH7A 4JL0A 3KADA 1EF1C 1QZ2A 1KT1A 4W9RA 3UI5A 4JFJA 5HW7A 2IFUA 3I3NA 4ANVA 2ONDA 2AXVA 4EBAG 2WXGA 1ZB5A 1ZBWA 2J4DA 4WWOA 4G2PA 1HFAA 4KBQA 1HXVA 3CVQA 1WAWA 3CHRA 4B0ZA 1W9PA 2KCLA 3JYJA 5BPPA 2Y78A 4JHRA 3PRAA 4A55A 3FTZA 1HJWA 5HWCA 4PDXA 3CV0A 3I6CA 4ANWA 4BT8A 1KFWA 4Q96A 4GAAA 5JJTA 1W26A 4V3IA 3QDNA 4XE0A 2OVFA 3Q5MA 2YQ8A 1HE8A 3MJWA 1FD9A 3K9IA 1FFQA 3PNTB 3LKUA 3AU5A 3UI4A 2WXFA 5A7DB 3B9AA 3CHDA 5JJ6A 4DWSC 1SZ9A 4LUNU 2AW6A 3EDTB 4LERA 1UG3A 2UWJG 1LG2A 4UWKA 1IYGA 4L2LA 3QB2A 2J08A 1YATA 2J49A 4AJWA 3FAPA 2DPEA 1Q6IA 1QNFA 2X6HA 2VGYA 4JHJA 1ZK6A 1UJJA 2L9BA 2WXQA 4AM9A 3JYSA 4HOTA 2XCBA 4GCNA 2FBNA 2RQSA 4I6JA 3FY4A 3G2SA 2WM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PPO A;  4FAP A;  4XIF A;  1JNS A;  4TYO A;  2L2S A;  2LKN A;  5KJK A;  3O5R A;  4TW7 A;  2AVP A;  3ZGQ A;  2MPH A;  4ODK A;  3O5K A;  2VGX A;  4QT3 A;  2LJ4 A;  2FF4 A;  1PC2 A;  2VSN A;  2Q7F A;  2M08 A;  2XPB A;  4G24 A;  4W9O A;  2FKE A;  3LY8 A;  1B6C A;  2E2E A;  3VAW A;  4GGQ A;  4ODM A;  3ZFW A;  2K8I A;  1F8A B;  1HH8 A;  2NC9 A;  2LGO A;  2DBA A;  4DRN A;  4AY6 A;  2FI7 A;  2C0L A;  1FKD A;  1M5Y A;  3B7X A;  1FKG A;  3LY7 A;  3ZN3 A;  1QQE A;  2PBC A;  4LAY A;  2XP5 A;  4N2S A;  3TC5 A;  3KZ7 A;  4N5C A;  2LSU A;  3GPK A;  5KJL A;  3S7D A;  3VTY A;  4U84 A;  5BNW A;  2FEZ A;  4G2V A;  3ZHE B;  4LAW A;  4UI9 C;  3AS4 A;  2ZQT A;  3LUO A;  4BF8 A;  2XP7 A;  3U3W A;  4WNF A;  3O5P A;  4N3C A;  1T11 A;  5HKG A;  3KAI A;  3OOB A;  3NRK A;  1J4I A;  4LAX A;  3UQI A;  4ODR A;  1NMW A;  4U0Z A;  2MF9 A;  3CGN A;  3MDY B;  4Y6C A;  5JJ7 A;  4DRQ A;  1QPF A;  5AYW D;  5KJN A;  1NA0 A;  2LNI A;  4H7X A;  3NTP A;  4JFI A;  2UZ5 A;  5HW8 A;  2KAT A;  3FWV A;  5HWB A;  1P5Q A;  3NF1 A;  3MKR A;  4JFK A;  3TDB A;  4APO A;  2HYZ A;  2MLZ A;  4UI9 J;  4WNE A;  1J6Y A;  2MHK A;  1N1A A;  3GZ1 A;  2KC7 A;  3IK8 A;  2ZQS A;  3O5Q A;  4GYY A;  4GA0 A;  2M1I A;  3VTX A;  4GZ5 A;  3TG4 A;  4B94 A;  1EYM A;  4N19 A;  1J4R A;  4DZ3 A;  5HI7 A;  3ODK A;  2UY1 B;  3CVL A;  4ABN A;  3KCE A;  2VQ2 A;  4W9P A;  4QT2 A;  1OUV A;  2XCC A;  1YA0 A;  2JLB A;  4CDR A;  4J4O A;  4J8F A;  2ZR6 A;  4DRI A;  4TW6 A;  5EKQ D;  4J8D A;  1NMV A;  3Q15 A;  2ZR4 A;  1Q6U A;  2RUR A;  3R9A B;  3CKB A;  3KAE A;  1JVW A;  2F21 A;  3KAB A;  2JZV A;  5DIT A;  2XGO A;  1FKT A;  1PBK A;  1NSG A;  2Q5A A;  1A7X A;  1U79 A;  3LY9 A;  3RO2 A;  4WUY A;  1FKF A;  1ELR A;  3CVN A;  4DIP A;  3CKC A;  3ULQ A;  3O5J A;  4R0X A;  3KAF A;  3RO3 A;  3BEE A;  3WXX A;  2KGJ A;  2F4E A;  5KJM A;  2Y4T A;  5CCM A;  4RG6 A;  4HOQ A;  4N3B A;  3PDN A;  3N71 A;  2PPN A;  1BL4 A;  3QWW A;  3HYM B;  4ODN A;  2ZR5 A;  3AS8 A;  2HO1 A;  3O5F A;  4H7Y A;  3KAC A;  1WM5 A;  4AY5 A;  3GZ2 A;  4GZ3 A;  3KAG A;  4GIV A;  3KD7 A;  4J8E A;  3PE3 A;  4G26 A;  5DIU A;  4WND A;  2M2A A;  3TG5 A;  4JA9 A;  5EX0 A;  3RIB A;  3SZ7 A;  2XP6 A;  3OXL A;  2DG4 A;  1Q6H A;  3GYZ A;  5FT9 A;  5CCL A;  5EX3 A;  1ZU2 A;  2KCV A;  1FKJ A;  2KCK A;  4WNG A;  2C2L A;  1Q1C A;  4N2Q A;  1EQ3 A;  4NQ0 A;  1D6O A;  4I1A A;  4DT4 A;  1TJC A;  1A17 A;  3O5G A;  3FFL A;  4QIB A;  5HUA A;  4BTA A;  4UQX A;  3LPZ A;  4GCO A;  2PL2 A;  5HQ8 A;  3JYM A;  2N87 A;  3Q47 B;  3O5O A;  1L1P A;  1J4H A;  3RFW A;  4MGV A;  3KAH A;  1F40 A;  5FZQ A;  3S7B A;  4DRM A;  3O5M A;  4DRP A;  4KXK B;  2OOE A;  4DRO A;  4CGV A;  3AS5 A;  3UF8 A;  4AIF A;  1C9H A;  4LEU A;  3CK7 A;  3CK8 A;  4Y6W A;  3ZHE A;  3ASH A;  4I9C A;  1WAO 1;  3QWV A;  4CGW A;  3O5L A;  2XPI A;  4J0U A;  4GZ6 A;  2L6J A;  4BT9 A;  1PIN A;  5HTG A;  3CVP A;  3UQB A;  2VN1 A;  1ZBP A;  5B8I C;  3RKV A;  2RUD A;  5FTP A;  2XGM A;  3LCA A;  3CEQ A;  4U07 A;  1KT0 A;  2VCD A;  2KO7 A;  1XNF A;  4HOU A;  4IPX A;  1HZ4 A;  4G1T A;  1YW5 A;  3TAX A;  4GYW A;  4HOR A;  3S7J A;  4I9E A;  2XP3 A;  3QKY A;  4GA2 A;  3ASG A;  1ZCN A;  1FKB A;  2PQR A;  5D0Q D;  5M72 A;  1Y0O A;  3UI6 A;  2FO7 A;  2VSY A;  1B89 A;  4DRJ A;  3MV2 B;  2KR7 A;  2PQN A;  3MA5 A;  1FJD A;  5ARF A;  3WH0 A;  4JYS A;  4ODQ A;  1D7H A;  2XP9 A;  4A1S A;  1FKH A;  4U0S A;  3ESK A;  4KYO B;  1QPL A;  4W9Q A;  3LYA A;  5J6E A;  3PE4 A;  3NI6 A;  2KFW A;  2LSV A;  4U04 A;  5D75 A;  4YVO A;  5GPG A;  5D0O D;  4I17 A;  4YVQ C;  2UY1 A;  5FJY A;  2QFC A;  4TNS A;  4O6F A;  4TX0 A;  4RG9 A;  4DH0 A;  3RU0 A;  4I2Z A;  2RUQ A;  3UPV A;  3ASD A;  3U4T A;  1FKI A;  3IKD A;  2ZQU A;  5CHE E;  2F2D A;  5BT1 A;  2PV1 A;  2RSE A;  3O5D A;  5G04 C;  2WQH A;  2VGX B;  2VYI A;  3ASF A;  3O48 A;  1HXI A;  5BW8 C;  4ODP A;  3Q49 B;  5FZR A;  5HW6 A;  4UI9 K;  3FP3 A;  3O5E A;  4ODO A;  3OXG A;  4BTB A;  1ROU A;  2XP4 A;  3UQ3 A;  3Q4A B;  4EQF A;  3MEK A;  4IQC A;  4DZ2 A;  2BUG A;  5FZS A;  4ODL A;  1D7J A;  3RGC A;  2KE0 A;  4G25 A;  4U0U A;  1NA3 A;  3CGM A;  4J4N A;  4ME2 A;  2I6H A;  5DBK A;  4O2T A;  2DG9 A;  1FKR A;  1W3B A;  2ITK A;  4U86 A;  1E96 B;  4JL0 A;  4U85 A;  4G50 A;  1KLX A;  3KAD A;  2C0M A;  4DRH A;  2P58 C;  5G04 J;  2MLX A;  1QZ2 A;  1TCO C;  1KT1 A;  4W9R A;  1FKS A;  4TW8 A;  5G05 C;  4JFJ A;  3UI5 A;  5HT1 A;  2IF4 A;  4GPK A;  2PV3 A;  5HW7 A;  2IFU A;  3TCZ A;  4N3A A;  2HR2 A;  3UUX A;  2OND A;  2R5S A;  2V5F A;  4NRH B;  4XI9 A;  5LCW C;  4JA7 A;  4G2P A;  3CK9 A;  4UQY A;  4BWR A;  4KBQ A;  1HXV A;  3KS2 A;  3CVQ A;  4N39 A;  1NZN A;  2GW1 A;  2XEV A;  4GA1 A;  3S7F A;  4LAV A;  3IEG A;  4IN3 B;  2KCL A;  3JYJ A;  3OXF A;  2XPA A;  2Y78 A;  4JHR A;  3EY6 A;  1FCH A;  2MLY A;  2Y4U A;  5HWC A;  1D7I A;  2WPV A;  3CV0 A;  5G05 J;  4GYO A;  3I6C A;  4G23 A;  4ITZ A;  4BT8 A;  3ZPJ A;  4JFL A;  4UQZ A;  4YND A;  5JJT A;  1W26 A;  3QDN A;  3Q5M A;  3H9R B;  5LCW J;  1ROT A;  2YQ8 A;  3TGO A;  1FD9 A;  2ZQV A;  3K9I A;  3IHZ A;  2OFN A;  3LKU A;  1FKL A;  4FN2 A;  3UI4 A;  1JNT A;  5A7D B;  2PPP A;  5BXJ A;  3QWP A;  5JJ6 A;  2YHC A;  2LPV A;  5DIZ A;  3EDT B;  2J9Q A;  4IQ2 A;  1Y8M A;  2RUC A;  2PZI A;  3QOU A;  5DIV A;  2UWJ G;  5I98 A;  5C1D A;  2PV2 A;  1IYG A;  1IHG A;  4I2W A;  1FKK A;  2AWG A;  4MSP A;  1YAT A;  3UQA A;  3PRB A;  4C02 B;  3FAP A;  3MV3 B;  5A6C A;  1Q6I A;  1R9H A;  3RJV A;  2D9F A;  2VGY A;  1FAP A;  3PRD A;  2FAP A;  4XI0 A;  3JXV A;  4F3V A;  1ZK6 A;  4HOS A;  4DRK A;  3PA7 A;  4NNR A;  4AM9 A;  3URZ A;  3JYS A;  4HOT A;  2XCB A;  4GCN A;  2KI3 A;  3O5I A;  1ELW A;  2FBN A;  2DG3 A;  2XP8 A;  3E4B A;  1BKF A;  2RQS A;  4JFM A;  5ARG A;  3IKG A;  3SF4 A;  2MNT A;  3GW4 A;  2XGS A; 
#chains in the Genus database with same CATH topology
 1X5B A;  5C2Y A;  2L2S A;  2MOW A;  2A3A A;  2IY0 C;  3D9M A;  1D8D A;  3ZGQ A;  1DCQ A;  2VGX A;  4HBE A;  2AJA A;  2FF4 A;  3J5Q B;  1PC2 A;  2VSN A;  2Q7F A;  3D9I A;  2M08 A;  4W9O A;  2FKE A;  3LY8 A;  3JXJ A;  2HE0 A;  2QYU A;  2XHE A;  2WXK A;  2X6I A;  2P9K G;  3EHM A;  2NC9 A;  3SQV A;  1SQM A;  3IKO B;  2DBA A;  4DRN A;  2FI7 A;  2C0L A;  1FPP A;  1MQS A;  4A3T A;  4Z2H A;  4U8H A;  4P8U A;  4ZS6 A;  2F8Y A;  4OYS A;  4LAY A;  2XP5 A;  3O4Z A;  2LSU A;  4N5C A;  4DWS A;  1HO8 A;  3LVQ E;  3VTY A;  4G2V A;  3ZHE B;  4LAW A;  3EIJ A;  3AS4 A;  4B8A A;  4N3C A;  4M3O A;  1OWO A;  2XS1 A;  1ITX A;  1EIB A;  2KBX A;  1J4I A;  1LL7 A;  2R03 A;  3UQI A;  3B7U X;  4I43 A;  4HBD A;  4Y6C A;  3DEP A;  3QOK A;  3ALF A;  4UWL A;  3CIA A;  1UR8 A;  4H7X A;  2UZ5 A;  4E85 A;  4GZC A;  2KAT A;  4JHK A;  1P5Q A;  1VDY A;  4JEH A;  4ANX A;  4JFK A;  3TDB A;  1GPF A;  3B9E A;  3Q7A A;  4GTO A;  2HYZ A;  3V2O A;  1J6Y A;  3Q79 A;  1N1A A;  4IYP A;  1E6Z A;  3IK8 A;  1JPL A;  1N52 A;  4P8W A;  3VTX A;  4B94 A;  1JUQ A;  4HB5 A;  3KCE A;  4QT2 A;  1OUV A;  3FH8 A;  3PUK A;  3D9N A;  2ION A;  1DCE A;  2X3M A;  3QNK A;  5J08 A;  3OTN A;  2RUR A;  1JVW A;  2F21 A;  1JCH B;  2JZV A;  2XGO A;  1FKT A;  1NSG A;  3RO2 A;  1Z3Y A;  3QC1 A;  4DIP A;  4JB8 P;  5LP0 A;  3BEE A;  3WXX A;  2KGJ A;  3AG1 E;  3FU3 A;  5GQB A;  4AXH A;  3DST A;  2I1J A;  5KNG A;  3HYM B;  4ODN A;  2ZR5 A;  3TJP A;  2L0I A;  3EU5 A;  1H6P A;  3BMB A;  1UR9 A;  3FTV A;  3B7S A;  3ASO E;  4PUC A;  3UMV A;  3ZYK A;  1E15 A;  4J8E A;  5JHB A;  3HXF A;  4P8X A;  4G26 A;  3TG5 A;  4DI3 A;  4WIW A;  1Q6H A;  2DYR E;  3TWS A;  3GYZ A;  1IXV A;  1JWF A;  4XZ4 A;  2X6J A;  3LDZ A;  3HXB A;  3ARQ A;  2JEK A;  3FFL A;  1TN6 A;  4QIB A;  5HUA A;  1NL4 A;  5ANR A;  3T5X A;  3JYM A;  4U63 A;  3O5O A;  4J7W A;  4YDY A;  1J4H A;  3RFW A;  3KAH A;  3S7B A;  2WQ7 A;  1H6K A;  3B7B A;  3C3R A;  4KXK B;  3O5M A;  5A23 A;  2V5Q C;  3E33 A;  4WKH A;  3MYV A;  2O92 A;  3E37 A;  4CGV A;  4AP2 A;  1FFR A;  1C9H A;  4UWF A;  2XQ0 A;  2LUH A;  1E7U A;  3HVE A;  2DWZ A;  4CGW A;  3B8S A;  5LX8 A;  4J0U A;  4ACK A;  4OAU C;  5HTG A;  1BU9 A;  2VN1 A;  2WXJ A;  1HKJ A;  3LCA A;  4MTV A;  4U07 A;  1KT0 A;  2KO7 A;  3AU4 A;  4GTT A;  4P29 A;  3UKU G;  3IHV A;  4AVX A;  4DLO A;  3PNL B;  1YW5 A;  3TWQ A;  2GRQ B;  4U7E B;  4PH4 B;  1E8W A;  3FUF A;  3PEV B;  4MAV A;  4HVB A;  5HBF A;  4DRJ A;  1B89 A;  3MV2 B;  2KR7 A;  4PTM A;  3D9H A;  3APF A;  3KSL A;  1N4P A;  4LNG A;  1QPL A;  2LAI A;  3X2Q E;  2B5U B;  2GRM A;  4U04 A;  1HJV A;  4I17 A;  3B7T A;  2UY1 A;  4O1P A;  2XEH A;  4YVQ C;  3AS3 A;  4TNS A;  4RG9 A;  3RU0 A;  3PEU B;  3HDX A;  2IQC A;  3ASD A;  1FKI A;  5CHE E;  1E6P A;  4FHJ A;  3WIJ A;  5G04 C;  2WQH A;  2VGX B;  3ASF A;  2GRL A;  3O48 A;  4L72 B;  2H6F A;  5HW6 A;  3D9O A;  1N0R A;  1ZU8 A;  2ZXW E;  3FP3 A;  4EPZ A;  5CED B;  3OXG A;  3ULY A;  4BTB A;  3O5E A;  4ODO A;  2IO2 C;  4JXT A;  4A3V A;  4EQF A;  2XZT G;  4F7A A;  4NZC A;  1S0P A;  4ODL A;  3RGC A;  2KE0 A;  4FJZ A;  4BSZ B;  4GMJ A;  5CER B;  2WXR A;  3ENE A;  2RD0 A;  3CGM A;  3G6L A;  1KPS B;  2F37 A;  3TWT A;  1N0Q A;  4JEU A;  3CHF A;  2ITK A;  4G50 A;  1KLX A;  4DWS B;  4I1M A;  2C0M A;  3QJZ A;  1OWL A;  5G04 J;  3ZIM A;  2NYJ A;  2MLX A;  2KZT A;  3LXU X;  2OLH A;  1ZB1 A;  4TW8 A;  1KZP A;  3CSF A;  1EDQ A;  4GPK A;  2PV3 A;  4BX9 A;  3TCZ A;  3NOC D;  2F8X K;  2HR2 A;  1X6L A;  2Y1L E;  2DZN A;  3UUX A;  2XRY A;  2GRP B;  2PN0 A;  3UIO C;  2R5S A;  2V5F A;  4NRH B;  5LCW C;  3NOG D;  3U66 A;  3SD5 A;  3CK9 A;  3SI5 A;  4P8V A;  1TNB A;  3AS2 A;  2GW1 A;  1OGG A;  2JAB A;  4FP7 A;  3IEG A;  4F53 A;  2WXM A;  5HKP A;  3PRZ A;  2GRR B;  3BU8 A;  3I4R B;  3WKZ A;  4ITZ A;  3ZNG A;  3ISM C;  4UQZ A;  1LD8 A;  4Z2L A;  4LGX A;  5B1B E;  2VJ8 A;  2YHE A;  3H9R B;  5LCW J;  3TGO A;  2OFN A;  4FN2 A;  1U2V G;  3CLJ A;  3OA5 A;  3SFY A;  1LF8 A;  3QWP A;  4FHK A;  3L22 A;  5DIZ A;  4IQ2 A;  1DC2 A;  2PZI A;  3QOU A;  5I98 A;  5C1D A;  1SR0 A;  3D9L A;  1FKK A;  5ENO D;  3BUA A;  3UQA A;  1JWG A;  3PRB A;  3FUL A;  4BY6 A;  2WM9 A;  4HRL A;  1S70 B;  4BSX A;  2DT0 A;  2WQ6 A;  3RJV A;  1FAP A;  3PRD A;  5DF0 A;  2FAP A;  2G8Z A;  4C9B B;  3LS8 A;  3CGH A;  3ML9 A;  3I5P A;  4GB9 A;  3PA7 A;  2OEV A;  3URZ A;  4CRW A;  2AOS A;  3WD0 A;  2KI3 A;  4EBA A;  4IT6 A;  3E4B A;  4Q22 A;  3UM3 A;  5KBA A;  2DSV A;  3IKG A;  2XGS A;  2DSU A;  4FAP A;  3ONK A;  2ESC A;  3HXC A;  1JNS A;  2G41 A;  4ANU A;  4WKF A;  3FTS A;  1JCQ A;  2XPB A;  3R7R A;  5EIL A;  3V30 A;  5CBN A;  1B6C A;  3VAW A;  3LEW A;  4R5E A;  3EIP A;  3CVW A;  1OWN A;  1TNO A;  3CH9 A;  1HH8 A;  1E8X A;  4AY6 A;  2A5E A;  1WB0 A;  1V54 E;  3LY7 A;  4MPK A;  3ZN3 A;  1QQE A;  2PBC A;  5AJL A;  3BQO A;  3SBS A;  5CEC B;  3TC5 A;  1PY1 A;  3KZ7 A;  3TXN A;  3GPK A;  3LJ3 A;  4U84 A;  3HVE B;  3LUO A;  3Q75 A;  1K9T A;  1HG2 A;  4BF8 A;  4WNF A;  2OV8 A;  3KAI A;  4HS2 A;  1N9A A;  3PR9 A;  2PNN A;  1QYM A;  3CHP A;  3CQG B;  3I4G A;  1NMW A;  4NSB A;  2MF9 A;  5HS0 A;  3MDY B;  3T9K A;  4DRQ A;  1EDU A;  3AS0 A;  3CHQ A;  3IBE A;  4EEC A;  4GTR A;  2LNI A;  4XEI G;  2EIM E;  4G11 A;  3FWV A;  5CMW A;  3NF1 A;  2L0T B;  3UM1 A;  1N4S A;  2MHK A;  3WD3 A;  4XKB A;  4UUC A;  2KC7 A;  2I2O A;  2ZQS A;  4GA0 A;  4FAD A;  2IO3 C;  2DSZ A;  1D8E A;  1J4R A;  1UN8 A;  1NP7 A;  2UY1 B;  2R17 C;  3WQV A;  3B7R L;  3JQ1 A;  4W9P A;  2JLB A;  4MNJ A;  3WD1 A;  5EKQ D;  1NMV A;  3Q15 A;  2A3E A;  2ZR4 A;  4GTP A;  2KM4 A;  3Q9N C;  1PBK A;  4U96 D;  1U79 A;  4RVB A;  4K5A B;  1RD6 A;  1FKF A;  4EZL A;  2LXM A;  1ZBC A;  3CKC A;  1Z3X A;  3ULQ A;  3O5J A;  2E0I A;  1H0G A;  3G2T A;  2Y4T A;  4GPM A;  4RG6 A;  4TV3 A;  3NZS A;  1BLX B;  4MKT A;  5ENR D;  4MS6 A;  1BL4 A;  2GGF A;  1K3Z D;  3PVL A;  3QWW A;  4CDM A;  5ENN A;  3B95 A;  1JND A;  4KZC A;  3SHF A;  4IUL A;  2KZT B;  5EN5 D;  2EIL E;  5ENS D;  4GIV A;  2F23 A;  4ZPT R;  1TR4 A;  2CFU A;  3PE3 A;  2ZGG A;  5DIU A;  2M2A A;  3D9K A;  5E76 A;  4JA9 A;  1MZC A;  5EX0 A;  4ML4 A;  2DG4 A;  1LL4 A;  1ZU2 A;  1PAQ A;  3Q9U C;  1FKJ A;  2QF8 A;  2C2L A;  1Q1C A;  1EQ3 A;  3HHM A;  1MYO A;  5T8I A;  3U64 A;  4DT4 A;  1TJC A;  3PS6 A;  5D66 A;  1ZBK A;  1OCZ E;  1E8Z A;  4UQX A;  3HXD A;  4TRQ A;  1V55 E;  3W9G A;  4MGV A;  3AG4 E;  3UT7 A;  3CHM A;  5B3S E;  2CHX A;  4DRP A;  2OOE A;  1TYQ G;  1Y6I A;  3SY2 A;  2EIN E;  3AS5 A;  3UF8 A;  4KVM A;  4QFV A;  2PM7 A;  1ZL1 A;  5EID A;  2AXU A;  3FUH A;  1WAO 1;  3QWV A;  3W4R A;  4Z2K A;  3FXY A;  4GZ6 A;  1Z6T A;  3UQB A;  3FH5 A;  1ZBP A;  5B8I C;  4AEZ C;  3RKV A;  5FTP A;  4MBG A;  3FEY A;  4DX1 A;  4FU3 A;  4HBO A;  3EHN A;  2B0O E;  4IPX A;  1HZ4 A;  4G1T A;  3CVU A;  3PRE A;  3TAX A;  3HRA A;  4HOR A;  4D10 C;  3PZ3 A;  4I9E A;  4X8Q A;  5BV0 A;  4HQD A;  4GA2 A;  4CT0 A;  1H2V C;  1ZCN A;  3EJN A;  2Y3A A;  3UKR G;  2PQR A;  3GZS A;  3FTU A;  1FJD A;  5ARF A;  3RM8 A;  2M63 A;  3WH0 A;  2QC9 A;  2VGE A;  1D7H A;  2XP9 A;  1FKH A;  1OT8 A;  3JCK C;  4ZFH A;  3E30 A;  4W9Q A;  3TXM A;  1N4Q A;  1UOH A;  1OWP A;  3NI6 A;  3MX3 A;  1H2U A;  2QFC A;  2P2C P;  4TX0 A;  5AN8 A;  4DH0 A;  4I2Z A;  3UPV A;  3U4T A;  1N11 A;  4NUR A;  4GTS A;  2F2D A;  3ZVV A;  5JH8 A;  2RSE A;  3MZL B;  2WXL A;  4HRM B;  4ZPW R;  4OVU A;  3UT8 A;  1HXI A;  5BW8 C;  2J07 A;  4ODP A;  5ENP D;  2A5U A;  5FZR A;  4OAV B;  4UI9 K;  4UWG A;  1OCO E;  1ROU A;  1TNZ A;  2R2L A;  2XP4 A;  2OCC E;  2DVW A;  1N94 A;  1ZBV A;  3RRU A;  1OWQ A;  3MEK A;  4IQC A;  5FZS A;  1D7J A;  4BES A;  3LJN A;  4WWP A;  3NZU A;  4U0U A;  4J4N A;  2I6H A;  3RSE G;  3NB2 A;  1W3B A;  4TXQ A;  3BG1 B;  3T5V A;  2QZA A;  4E6H A;  3KSQ A;  4PS8 A;  2XEE A;  2P58 C;  2BED A;  3FTY A;  3Q7F A;  1TCO C;  1Q2Z A;  1K1A A;  2XRZ A;  3T8M A;  3G2U A;  1VF8 A;  2H6I A;  5AAO A;  4XI9 A;  4JA7 A;  3P2B A;  2OEW A;  4UQY A;  4BWR A;  1OCR E;  1L5J A;  4Z2I A;  3KS2 A;  5CRU A;  4N39 A;  1NZN A;  2XPZ A;  3TWR A;  4GA1 A;  3S7F A;  4LAV A;  3DSX A;  4AY1 A;  2XS8 A;  3EIQ C;  2MLY A;  1TN8 A;  1D7I A;  4GYO A;  1OGB A;  4G23 A;  4JFL A;  2WLZ A;  2IOL A;  1K1B A;  4YND A;  1LJY A;  2DSW A;  1BI8 B;  2ETB A;  3FDH A;  2DT1 A;  1HG5 A;  3TWX A;  2X6F A;  1W9U A;  2PPP A;  5BXJ A;  3CHS A;  3R7Q A;  4DX6 D;  4TXR A;  3ARP A;  3ARO A;  2J9Q A;  1Y8M A;  5KNH D;  5DIV A;  4JC8 A;  2FDM A;  2PV2 A;  3FTX A;  2AWG A;  3F6Q A;  3FUE A;  4MSP A;  2P9U G;  3OAW A;  4C02 B;  5A6C A;  3UTM A;  1R9H A;  4GTV A;  3ARR A;  3C3Q A;  2IOS A;  2IUZ A;  4XI0 A;  4F3V A;  3V31 A;  2I1K A;  1OXJ A;  4HOS A;  4FLB A;  3UIN C;  4URI A;  2DCP A;  4K5B A;  1ELW A;  3D9J A;  2XP8 A;  1BKF A;  2X38 A;  4JFM A;  5EYP F;  2L6B A;  2PPO A;  3V79 K;  4F1P A;  5BUZ A;  4B8C B;  1O1R A;  5KJK A;  4TW7 A;  3UIP C;  4ODK A;  3O5K A;  4QT3 A;  4ILG A;  4G24 A;  3PUJ A;  4G8L A;  3G2V A;  2CHW A;  2WXO A;  3BXW A;  3AJI A;  3FUN A;  3ML8 A;  2P9I G;  3RME A;  5DO2 A;  4LSZ E;  1M5Y A;  3B7X A;  5AQ9 A;  4YDE A;  3DEO A;  3ARY A;  2CHZ A;  2MRI A;  3DSV A;  4S3K A;  2J8S D;  5ENT D;  3RRM B;  1S63 A;  1NWR A;  1TFV A;  4ILI A;  4JW1 A;  5BNW A;  3FUM A;  4ATZ D;  2WVI A;  4UI9 C;  4W5U A;  2ZQT A;  1RW2 A;  3O5P A;  3OOB A;  2BTD A;  4LRZ A;  2XPY A;  3EU9 A;  4LAX A;  2P4V A;  2J4B A;  4U0Z A;  1RZ4 A;  3SBT B;  5H7P A;  3TL5 A;  1QPF A;  4CCA A;  5AYW D;  1NA0 A;  2CFZ A;  3SFZ A;  2A3C A;  4JFI A;  1BPO A;  4MNL A;  5GPR A;  3WD4 A;  2VSO E;  2WMO A;  5G2N A;  5CMY A;  4HLL A;  1SVX A;  3D3M A;  4KQZ A;  1QBQ A;  4TUU A;  4UI9 J;  3TWU A;  4WNE A;  2MLZ A;  4MNM A;  3L16 A;  4Z2J A;  3ASN E;  3O5Q A;  1HF8 A;  3PZ1 A;  4GU5 A;  3TG4 A;  3ZYM A;  4N19 A;  2RKK A;  2KXP C;  4QZV B;  3ODK A;  3CVL A;  4TUM A;  2VQ2 A;  2XCC A;  3PZD A;  4CDR A;  4DRI A;  4G8K A;  4J8F A;  2ZR6 A;  4MNK A;  2LAH A;  1IQR A;  3WQW A;  4HNA D;  1Q6U A;  3R9A B;  3CKB A;  2Q5A A;  3DSU A;  4GMR A;  1XHG A;  1HJX A;  5FQ6 A;  3NQP A;  3ZYQ A;  1YMP A;  4C0E A;  2Y69 E;  2EQX A;  3RO3 A;  2LXL A;  2DZO A;  4JPS A;  3SGH A;  4DRX E;  5KJM A;  4LNU D;  4WAF A;  4ILH B;  4WK9 A;  3HG0 D;  4DLQ A;  2ETA A;  2DYS E;  3MKQ A;  4K0R A;  3AS8 A;  4F1S A;  2XEN A;  4H7Y A;  4IT4 A;  4EZK A;  3KAC A;  1WM5 A;  3E32 A;  4DUI A;  1WG0 A;  3GZ2 A;  3CVV A;  3KD7 A;  5AQ7 A;  2FUL A;  4KR0 B;  2IJG X;  4WJX A;  4WND A;  3RIB A;  3Q73 A;  3OXL A;  5E75 A;  2ILR A;  5CCL A;  5EX3 A;  2KCV A;  3ABL E;  2KCK A;  2P9L G;  2RFA A;  1LD7 A;  2XZD G;  4N2Q A;  3RM4 A;  4NQ0 A;  1D6O A;  4I1A A;  4A1G A;  1GOI A;  1DNP A;  1A17 A;  5CBO A;  3UT4 A;  1Z5S C;  3APC A;  3LPZ A;  4KZ0 A;  4U8Y D;  2PI6 A;  3IV0 A;  5EDS A;  2N87 A;  1L1P A;  5FZQ A;  4CT4 A;  4DRM A;  3B13 A;  4IRU A;  3UI2 A;  1N54 A;  1TNY A;  4LG6 A;  4DRO A;  2Y0B G;  3CHE A;  4LEU A;  4FLH A;  1FVH A;  3CK8 A;  3P1U A;  4Y6W A;  2YNQ A;  4GZD A;  3CHC A;  3ASH A;  4L9P A;  1JCR A;  1NH6 A;  1LQ0 A;  4BT9 A;  1HKK A;  5KWD A;  2R02 A;  3CVP A;  4GML A;  3AG3 E;  4KT6 B;  2RUD A;  1JCS A;  1W1P A;  2XGM A;  3R9M A;  2WK2 A;  1XNF A;  3FUK A;  1AP7 A;  3QK0 A;  3ALG A;  4GTQ A;  4GYW A;  4BX8 A;  2XP3 A;  3QKY A;  3TWV A;  3UX4 A;  3VLF A;  3ASG A;  4DPR A;  1TJF A;  5T4Y A;  5D0Q D;  5M72 A;  1Y0O A;  3FEX A;  2V8S E;  2VSY A;  2R59 A;  1OY3 D;  3MA5 A;  4JYS A;  4U0S A;  3ESK A;  5CRV A;  5J6E A;  3ZXP A;  1GUV A;  3PE4 A;  2DT2 A;  3CQC B;  3ZEF A;  4UWH A;  4ZPV R;  1D2K A;  1W1V A;  5FJY A;  3ART A;  1NWT A;  2RUQ A;  4APF A;  1DVP A;  1A5E A;  1OCC E;  5BT1 A;  2WXP A;  3DXM G;  1IQU A;  2VYI A;  3L6A A;  2QYJ A;  4Z68 A;  4QQI A;  2WLY A;  1YCS B;  4URK A;  3W9F A;  3ZXS A;  1INZ A;  3ZW3 A;  3CR3 A;  2BUG A;  4BEP A;  1O5M A;  5LFA A;  4MRU A;  1O6I A;  3RRN B;  3ARV A;  1JNE A;  4G25 A;  3DPD A;  1NA3 A;  1E44 A;  1EPU A;  5FQ4 A;  4HFG A;  3ZU7 B;  4MLP A;  1E9L A;  4U85 A;  3VLD A;  2WXI A;  4DRH A;  5AJD A;  4I1O B;  3ZUV B;  1FKS A;  1AWC B;  5G05 C;  5HT1 A;  2IF4 A;  1NWS A;  4JD2 G;  4N3A A;  1CTN A;  2P9P G;  3C5R A;  3JUI A;  2YBU A;  3DSS A;  4HAR A;  3LVR E;  5KCM A;  5JMN D;  1IHB A;  3C72 A;  4B89 A;  2IEJ A;  2XEV A;  1U3C A;  4IN3 B;  4YDO A;  3OXF A;  1S64 A;  5G55 A;  2XPA A;  1X81 A;  3PH0 C;  1W1T A;  3EY6 A;  1FCH A;  2YIN A;  3B9D A;  2AWI A;  2Y4U A;  2WPV A;  3WD2 A;  2F0Y A;  4FJY A;  5G05 J;  3JUE A;  3L54 A;  3ZPJ A;  3FTW A;  3AS1 A;  3VLE A;  2V0P A;  1LTX A;  3IHY A;  1ROT A;  3IHZ A;  2ZQV A;  2O9O A;  4I6E A;  1FKL A;  4GTM A;  4I6G A;  1JNT A;  1FT2 A;  4Q7N A;  2A4Z A;  2YHC A;  5CEA A;  2LPV A;  3FHE A;  2RUC A;  2R05 A;  4J6I A;  2NSZ A;  1IHG A;  5T3R A;  4I2W A;  3T8K A;  1SZA A;  5AIJ A;  3MV3 B;  4ATG A;  4CDN A;  1ELK A;  2RG8 A;  5FQ8 A;  2D9F A;  2BF0 X;  1MHQ A;  1GRJ A;  2PM6 A;  1EHN A;  3ARX A;  3JXV A;  4WKA A;  3EHQ A;  1O1T A;  3EHR A;  3MKQ B;  4DRK A;  2EIJ E;  4NNR A;  3ABK E;  3O5I A;  3PZ2 A;  2DG3 A;  1IX5 A;  5ARG A;  4J8S A;  5B1A E;  3SF4 A;  2MNT A;  3GW4 A;  3FY1 A;  4XIF A;  4TYO A;  2LKN A;  2LO6 A;  4BET A;  3O5R A;  2AVP A;  2MPH A;  4A63 B;  2LJ4 A;  4K5C A;  2YBT A;  4UDM A;  4L7T A;  5AAR A;  4CEM A;  4LNB A;  1N95 A;  2E2E A;  2EIK E;  1UN9 A;  1GW6 A;  3E34 A;  4GGQ A;  2ZIR A;  1HU3 A;  4ODM A;  5HRY A;  3ZFW A;  3DPY A;  2K8I A;  1F8A B;  3L13 A;  4PS7 A;  2LGO A;  2OVB A;  4RQI A;  3ARS A;  2VTB A;  1NWU A;  1FKD A;  3CVX A;  2MYO A;  1FVF A;  1FKG A;  2RFM A;  4L3N A;  4O60 A;  2ZGD A;  4N2S A;  5KJL A;  3S7D A;  1H2T C;  2FEZ A;  3G2W A;  1NFI E;  2ZIS A;  2XP7 A;  1E90 A;  3U3W A;  1T11 A;  3S2A A;  4PS3 A;  4XKC A;  4HXI A;  5HKG A;  1KZO A;  3NRK A;  3FU5 A;  5JHA A;  4ODR A;  2ETC A;  3CGN A;  4DWS D;  5JJ7 A;  3HIZ A;  5FQ7 A;  3GTY X;  1SYT A;  3L08 A;  5KJN A;  3SNX A;  4F6R D;  3ARU A;  5JA4 D;  4FC8 A;  3NTP A;  4KVO A;  2DIW A;  5HW8 A;  4LCT A;  1HKM A;  5HWB A;  3C98 A;  3ONL A;  4FA6 A;  3MKR A;  4DK5 A;  1E6N A;  3KEA A;  3APD A;  4YDW A;  4APO A;  4WWN A;  3U9W A;  4KMO A;  3GZ1 A;  5BXO A;  4GYY A;  2M1I A;  4GZ5 A;  1EYM A;  3L9T A;  3L82 A;  4DZ3 A;  4Z2G A;  5HI7 A;  3FUD A;  4ABN A;  4B93 B;  2A3B A;  1YA0 A;  4J4O A;  4TW6 A;  1U3D A;  3QAQ A;  1EYH A;  2WB2 A;  3ZYL A;  3UXG A;  4J8D A;  1WNO A;  2AXZ A;  3KAE A;  3KAB A;  5DIT A;  4ACL A;  4HI8 A;  1A7X A;  3LY9 A;  2VSX E;  4WUY A;  2B31 A;  3ZRH A;  4R7L A;  1ELR A;  3CVN A;  4BFR A;  1BI7 B;  3CHO A;  3AQU A;  4R0X A;  3KAF A;  3JQ0 A;  4S3J A;  2F4E A;  1UJK A;  4L2Y A;  5CCM A;  4HOQ A;  4N3B A;  3PDN A;  3N71 A;  2PPN A;  2I9C A;  2V4L A;  2J09 A;  2HO1 A;  3ESL A;  5FWQ A;  2WMN A;  3HXE A;  3O5F A;  3RK6 A;  5AEN A;  4JVS A;  3DBS A;  1X6N A;  1SW6 A;  4AY5 A;  3WL1 A;  4GZ3 A;  3KAG A;  5EYL A;  4L23 A;  4M7C A;  4K03 A;  3KEZ A;  1OWM A;  1E8Y A;  3SZ7 A;  2XP6 A;  4DI4 A;  3ARW A;  5FT9 A;  2ETN A;  4HRN A;  5BV1 A;  4WNG A;  4ZHB A;  4XX5 A;  1H19 A;  1K8K G;  3DWL G;  3G6M A;  3O5G A;  3MGB A;  2V4H C;  4BTA A;  4L1B A;  5AQA A;  4GCO A;  2PL2 A;  4N5Q A;  5HQ8 A;  5ANL A;  5LOZ A;  3Q47 B;  2WXN A;  1TEZ A;  1F40 A;  3PZ4 A;  2DT3 A;  3DRA A;  1LL6 A;  4OVV A;  4AIF A;  1XGW A;  4Q94 A;  4DX5 D;  3RM9 A;  2QY7 A;  1TN7 A;  2WXH A;  3FU0 A;  3RAU A;  4HLE A;  3CK7 A;  3ZHE A;  3SO8 A;  4I9C A;  3O5L A;  1H0A A;  2XPI A;  2L6J A;  1PIN A;  3CZ8 A;  4AV7 A;  2FO1 E;  5J90 A;  3FUI A;  3EUV A;  4FUL A;  3CEQ A;  5BXU A;  1W9V A;  2VCD A;  4NAC A;  4HOU A;  4JZY A;  1G3N B;  3SFX A;  3MCX A;  4RSY A;  3S7J A;  2BKK B;  2GRO B;  4CZ2 D;  5ENQ D;  3QAR A;  1FKB A;  1HX8 A;  3UI6 A;  2FO7 A;  5D2M C;  2PQN A;  5IY5 E;  4ODQ A;  3AAA C;  5FIO A;  4A1S A;  2HM8 A;  4EZJ A;  4KYO B;  1WY6 A;  1LG1 A;  2CG2 A;  2ZU6 B;  3LYA A;  4O1O A;  4U95 D;  1N4R A;  3NAW A;  2KFW A;  5AQB A;  2NXP A;  2LSV A;  2P9S G;  5D75 A;  4YVO A;  1H0I A;  5D0O D;  5GPG A;  3L17 A;  4O6F A;  3UM2 A;  3CVY A;  4NIK A;  4TXP A;  3BG0 B;  3FU6 A;  3IKD A;  4RLY A;  2ZQU A;  2X6K A;  3FUJ A;  2PV1 A;  1MX6 A;  1YYH A;  1HS6 A;  1UW4 B;  5EIB E;  1HKI A;  3O5D A;  3D9P A;  4DJA A;  3ULE G;  1SA4 A;  3CST A;  2P9N G;  1D9S A;  1XRV A;  1E6R A;  3Q49 B;  3DXK G;  1IKN D;  1MJ0 A;  4Q69 A;  4XAK A;  1W1Y A;  3WL0 A;  3UQ3 A;  3Q4A B;  4BER A;  2EUL A;  1TNU A;  3C3O A;  4DZ2 A;  3ARZ A;  5FIN A;  4C0M A;  4HI9 A;  2VTB B;  5DEZ A;  1E7V A;  2CG3 A;  4ME2 A;  5DBK A;  4O2T A;  2DG9 A;  1FKR A;  2IU1 A;  2H6H A;  4AOF A;  4U86 A;  1E96 B;  3FH7 A;  4JL0 A;  2H6G A;  4J8Y A;  4EHM A;  3KAD A;  1EF1 C;  1QZ2 A;  1KT1 A;  4W9R A;  4U8V D;  3UI5 A;  4JFJ A;  1WDY A;  3IXE A;  5HW7 A;  2IFU A;  1MX4 A;  3I3N A;  4DX2 A;  1O1S A;  4ANV A;  1BD8 A;  4C48 B;  2OND A;  1NI1 A;  3J5P A;  2AXV A;  4EBA G;  2WXG A;  1ZB5 A;  1ZBW A;  2J4D A;  4WWO A;  4G2P A;  3V2X A;  1HFA A;  4KBQ A;  4CYM D;  1HXV A;  3CVQ A;  1WAW A;  3DSW A;  3AG2 E;  3CHR A;  4B0Z A;  1W9P A;  2KCL A;  3JYJ A;  5BPP A;  2Y78 A;  4JHR A;  1H6O A;  4A55 A;  3NBN B;  3PRA A;  3FTZ A;  1HJW A;  5HWC A;  4PDX A;  3CV0 A;  3I6C A;  4ANW A;  4BT8 A;  1KFW A;  4Q96 A;  4GAA A;  3WG7 E;  5JJT A;  1W26 A;  4V3I A;  3QDN A;  4XE0 A;  3TWW A;  2OVF A;  3Q5M A;  3GU0 A;  2YQ8 A;  1HE8 A;  3MJW A;  1MX2 A;  1FD9 A;  3K9I A;  1FFQ A;  3PNT B;  3LKU A;  3AU5 A;  3JXI A;  3UI4 A;  2WXF A;  5A7D B;  3B9A A;  3CHD A;  5JJ6 A;  4DWS C;  1SZ9 A;  4LUN U;  2AW6 A;  3ABM E;  3EDT B;  4LER A;  1UG3 A;  2UWJ G;  1LG2 A;  4UWK A;  1IYG A;  1FT1 A;  4L2L A;  3ZKJ A;  3QB2 A;  2J08 A;  3UM0 A;  1YAT A;  2J49 A;  4AJW A;  3FAP A;  2DPE A;  1Q6I A;  2B6C A;  1QNF A;  2X6H A;  2VGY A;  1SA5 A;  4JHJ A;  1ZK6 A;  5ITZ F;  2GRN B;  1UJJ A;  2L9B A;  2BKG A;  2WXQ A;  4AM9 A;  3JYS A;  4HOT A;  2XCB A;  4GCN A;  2FBN A;  2RQS A;  4I6J A;  3FY4 A;  3Q78 A;  3G2S A;  2WM0 A;  4DX7 D; 
#chains in the Genus database with same CATH homology
 1X5B A;  5C2Y A;  2L2S A;  2MOW A;  2A3A A;  3D9M A;  3ZGQ A;  2VGX A;  4HBE A;  2FF4 A;  1PC2 A;  2VSN A;  2Q7F A;  3D9I A;  2M08 A;  4W9O A;  2FKE A;  3LY8 A;  2XHE A;  2WXK A;  2X6I A;  3EHM A;  2NC9 A;  1SQM A;  3IKO B;  2DBA A;  4DRN A;  2FI7 A;  2C0L A;  1MQS A;  4A3T A;  4Z2H A;  4U8H A;  4P8U A;  4ZS6 A;  4OYS A;  4LAY A;  2XP5 A;  3O4Z A;  2LSU A;  4N5C A;  4DWS A;  1HO8 A;  3LVQ E;  3VTY A;  4G2V A;  3ZHE B;  4LAW A;  3EIJ A;  3AS4 A;  4B8A A;  4N3C A;  4M3O A;  1OWO A;  1ITX A;  1EIB A;  1J4I A;  1LL7 A;  3UQI A;  3B7U X;  4I43 A;  4Y6C A;  3QOK A;  3ALF A;  4UWL A;  3CIA A;  1UR8 A;  4H7X A;  2UZ5 A;  4E85 A;  4GZC A;  2KAT A;  4JHK A;  1P5Q A;  1VDY A;  4JEH A;  4ANX A;  4JFK A;  3TDB A;  1GPF A;  3B9E A;  2HYZ A;  1J6Y A;  1N1A A;  4IYP A;  1E6Z A;  3IK8 A;  1JPL A;  1N52 A;  4P8W A;  3VTX A;  4B94 A;  1JUQ A;  3KCE A;  4QT2 A;  1OUV A;  3FH8 A;  3PUK A;  3D9N A;  2ION A;  2X3M A;  3QNK A;  5J08 A;  3OTN A;  2RUR A;  1JVW A;  2F21 A;  2JZV A;  2XGO A;  1FKT A;  1NSG A;  3RO2 A;  1Z3Y A;  3QC1 A;  4DIP A;  5LP0 A;  3BEE A;  3WXX A;  2KGJ A;  3FU3 A;  5GQB A;  4AXH A;  2I1J A;  3HYM B;  4ODN A;  2ZR5 A;  3TJP A;  2L0I A;  1UR9 A;  3FTV A;  3B7S A;  4PUC A;  3UMV A;  3ZYK A;  1E15 A;  4J8E A;  5JHB A;  4P8X A;  4G26 A;  3TG5 A;  4DI3 A;  4WIW A;  1Q6H A;  3GYZ A;  1JWF A;  4XZ4 A;  2X6J A;  3LDZ A;  3ARQ A;  2JEK A;  3FFL A;  4QIB A;  5HUA A;  5ANR A;  3T5X A;  3JYM A;  4U63 A;  3O5O A;  1J4H A;  3RFW A;  3KAH A;  3S7B A;  2WQ7 A;  1H6K A;  3O5M A;  4KXK B;  5A23 A;  4WKH A;  3MYV A;  2O92 A;  4CGV A;  4AP2 A;  1FFR A;  1C9H A;  4UWF A;  2XQ0 A;  1E7U A;  3HVE A;  4CGW A;  3B8S A;  5LX8 A;  4J0U A;  4ACK A;  5HTG A;  2VN1 A;  2WXJ A;  1HKJ A;  3LCA A;  4MTV A;  4U07 A;  1KT0 A;  2KO7 A;  3AU4 A;  4P29 A;  3IHV A;  4AVX A;  4DLO A;  3PNL B;  1YW5 A;  4PH4 B;  1E8W A;  3FUF A;  3PEV B;  4MAV A;  4HVB A;  5HBF A;  4DRJ A;  1B89 A;  3MV2 B;  2KR7 A;  4PTM A;  3APF A;  1QPL A;  2LAI A;  2GRM A;  4U04 A;  1HJV A;  4I17 A;  3B7T A;  2UY1 A;  4YVQ C;  3AS3 A;  4TNS A;  4RG9 A;  3RU0 A;  3PEU B;  3HDX A;  2IQC A;  3ASD A;  1FKI A;  5CHE E;  1E6P A;  4FHJ A;  3WIJ A;  5G04 C;  2WQH A;  2VGX B;  3ASF A;  2GRL A;  3O48 A;  4L72 B;  5HW6 A;  3D9O A;  1ZU8 A;  3FP3 A;  4EPZ A;  3O5E A;  3OXG A;  4BTB A;  4ODO A;  4JXT A;  4A3V A;  4EQF A;  4F7A A;  4NZC A;  1S0P A;  4ODL A;  3RGC A;  2KE0 A;  4FJZ A;  4GMJ A;  2WXR A;  3ENE A;  2RD0 A;  3CGM A;  3G6L A;  4JEU A;  3CHF A;  2ITK A;  4G50 A;  1KLX A;  4DWS B;  4I1M A;  2C0M A;  3QJZ A;  1OWL A;  5G04 J;  3ZIM A;  2MLX A;  2KZT A;  3LXU X;  2OLH A;  4TW8 A;  3CSF A;  1EDQ A;  4GPK A;  2PV3 A;  4BX9 A;  3TCZ A;  2HR2 A;  1X6L A;  3UUX A;  2XRY A;  2R5S A;  2V5F A;  4NRH B;  5LCW C;  3U66 A;  3SD5 A;  3CK9 A;  3SI5 A;  4P8V A;  3AS2 A;  1OGG A;  2GW1 A;  4FP7 A;  3IEG A;  4F53 A;  2WXM A;  3PRZ A;  3I4R B;  3WKZ A;  4ITZ A;  4UQZ A;  4Z2L A;  4LGX A;  2VJ8 A;  2YHE A;  3H9R B;  5LCW J;  3TGO A;  2OFN A;  4FN2 A;  3CLJ A;  3OA5 A;  1LF8 A;  3QWP A;  4FHK A;  3L22 A;  5DIZ A;  4IQ2 A;  2PZI A;  3QOU A;  5I98 A;  5C1D A;  1SR0 A;  3D9L A;  1FKK A;  3UQA A;  1JWG A;  3PRB A;  3FUL A;  4BY6 A;  2WM9 A;  4BSX A;  2DT0 A;  2WQ6 A;  3RJV A;  1FAP A;  3PRD A;  5DF0 A;  2FAP A;  2G8Z A;  4C9B B;  3LS8 A;  3CGH A;  3ML9 A;  3I5P A;  4GB9 A;  3PA7 A;  3URZ A;  4CRW A;  2AOS A;  3WD0 A;  2KI3 A;  4EBA A;  4IT6 A;  3E4B A;  4Q22 A;  2DSV A;  3IKG A;  2XGS A;  2DSU A;  4FAP A;  3ONK A;  2ESC A;  1JNS A;  2G41 A;  4ANU A;  4WKF A;  3FTS A;  2XPB A;  3R7R A;  1B6C A;  3VAW A;  3LEW A;  4R5E A;  3CVW A;  1OWN A;  3CH9 A;  1HH8 A;  1E8X A;  4AY6 A;  1WB0 A;  3LY7 A;  4MPK A;  3ZN3 A;  1QQE A;  2PBC A;  5AJL A;  3SBS A;  3TC5 A;  1PY1 A;  3KZ7 A;  3TXN A;  3GPK A;  3LJ3 A;  4U84 A;  3HVE B;  3LUO A;  1K9T A;  1HG2 A;  4BF8 A;  4WNF A;  2OV8 A;  3KAI A;  4HS2 A;  3PR9 A;  3CHP A;  3CQG B;  3I4G A;  1NMW A;  4NSB A;  2MF9 A;  3MDY B;  4DRQ A;  1EDU A;  3AS0 A;  3CHQ A;  3IBE A;  4EEC A;  2LNI A;  4G11 A;  3FWV A;  5CMW A;  3NF1 A;  2L0T B;  2MHK A;  3WD3 A;  4XKB A;  2KC7 A;  2I2O A;  2ZQS A;  4GA0 A;  4FAD A;  2DSZ A;  1J4R A;  1UN8 A;  1NP7 A;  2UY1 B;  2R17 C;  3WQV A;  3B7R L;  3JQ1 A;  4W9P A;  2JLB A;  4MNJ A;  3WD1 A;  5EKQ D;  1NMV A;  3Q15 A;  2A3E A;  2ZR4 A;  2KM4 A;  1PBK A;  1U79 A;  4RVB A;  1RD6 A;  1FKF A;  4EZL A;  1ZBC A;  3CKC A;  1Z3X A;  3ULQ A;  3O5J A;  2E0I A;  1H0G A;  3G2T A;  2Y4T A;  4RG6 A;  4TV3 A;  3NZS A;  4MKT A;  4MS6 A;  1BL4 A;  2GGF A;  3PVL A;  3QWW A;  4CDM A;  5ENN A;  1JND A;  4KZC A;  3SHF A;  4IUL A;  2KZT B;  4GIV A;  4ZPT R;  2CFU A;  3PE3 A;  5DIU A;  2M2A A;  3D9K A;  5E76 A;  4JA9 A;  5EX0 A;  4ML4 A;  2DG4 A;  1LL4 A;  1ZU2 A;  1PAQ A;  1FKJ A;  2QF8 A;  2C2L A;  1Q1C A;  1EQ3 A;  3HHM A;  5T8I A;  3U64 A;  4DT4 A;  1TJC A;  3PS6 A;  1ZBK A;  1E8Z A;  4UQX A;  4TRQ A;  4MGV A;  3UT7 A;  3CHM A;  2CHX A;  4DRP A;  2OOE A;  1Y6I A;  3AS5 A;  3UF8 A;  4KVM A;  4QFV A;  2PM7 A;  1ZL1 A;  2AXU A;  3FUH A;  1WAO 1;  3QWV A;  3W4R A;  4Z2K A;  3FXY A;  4GZ6 A;  1Z6T A;  3UQB A;  3FH5 A;  1ZBP A;  5B8I C;  4AEZ C;  3RKV A;  5FTP A;  3FEY A;  4FU3 A;  4HBO A;  3EHN A;  4IPX A;  1HZ4 A;  4G1T A;  3CVU A;  3PRE A;  3TAX A;  4HOR A;  4D10 C;  4I9E A;  5BV0 A;  4GA2 A;  4CT0 A;  1H2V C;  1ZCN A;  3EJN A;  2Y3A A;  2PQR A;  3GZS A;  3FTU A;  1FJD A;  5ARF A;  3RM8 A;  2M63 A;  3WH0 A;  1D7H A;  2XP9 A;  1FKH A;  3JCK C;  4W9Q A;  3TXM A;  1OWP A;  3NI6 A;  3MX3 A;  1H2U A;  2QFC A;  4TX0 A;  4DH0 A;  4I2Z A;  3UPV A;  3U4T A;  4NUR A;  2F2D A;  3ZVV A;  5JH8 A;  2RSE A;  3MZL B;  2WXL A;  4ZPW R;  4OVU A;  3UT8 A;  1HXI A;  5BW8 C;  2J07 A;  4ODP A;  2A5U A;  5FZR A;  4UI9 K;  4UWG A;  1ROU A;  2XP4 A;  1ZBV A;  3RRU A;  1OWQ A;  3MEK A;  4IQC A;  5FZS A;  1D7J A;  4WWP A;  3NZU A;  4U0U A;  4J4N A;  2I6H A;  1W3B A;  3BG1 B;  3T5V A;  4E6H A;  4PS8 A;  2P58 C;  3FTY A;  1TCO C;  2XRZ A;  3T8M A;  3G2U A;  1VF8 A;  4XI9 A;  4JA7 A;  3P2B A;  4UQY A;  4BWR A;  1L5J A;  4Z2I A;  3KS2 A;  4N39 A;  1NZN A;  2XPZ A;  4GA1 A;  3S7F A;  4LAV A;  4AY1 A;  3EIQ C;  2MLY A;  1D7I A;  4GYO A;  1OGB A;  4G23 A;  4JFL A;  2WLZ A;  2IOL A;  4YND A;  1LJY A;  2DSW A;  3FDH A;  2DT1 A;  1HG5 A;  2X6F A;  1W9U A;  2PPP A;  5BXJ A;  3CHS A;  3R7Q A;  3ARP A;  3ARO A;  2J9Q A;  1Y8M A;  5DIV A;  4JC8 A;  2FDM A;  2PV2 A;  3FTX A;  2AWG A;  3FUE A;  4MSP A;  3OAW A;  4C02 B;  5A6C A;  1R9H A;  3ARR A;  2IOS A;  2IUZ A;  4XI0 A;  4F3V A;  2I1K A;  4HOS A;  4FLB A;  4URI A;  2DCP A;  1ELW A;  3D9J A;  2XP8 A;  1BKF A;  2X38 A;  4JFM A;  2PPO A;  5BUZ A;  4B8C B;  5KJK A;  4TW7 A;  4ODK A;  3O5K A;  4QT3 A;  4ILG A;  4G24 A;  3PUJ A;  3G2V A;  2CHW A;  2WXO A;  3BXW A;  3FUN A;  3ML8 A;  3RME A;  5DO2 A;  1M5Y A;  3B7X A;  3ARY A;  2CHZ A;  2MRI A;  4S3K A;  3RRM B;  1NWR A;  1TFV A;  4ILI A;  4JW1 A;  5BNW A;  3FUM A;  2WVI A;  4UI9 C;  4W5U A;  2ZQT A;  3O5P A;  3OOB A;  2BTD A;  4LRZ A;  2XPY A;  4LAX A;  2J4B A;  4U0Z A;  3SBT B;  3TL5 A;  1QPF A;  4CCA A;  5AYW D;  1NA0 A;  2CFZ A;  3SFZ A;  2A3C A;  4JFI A;  1BPO A;  4MNL A;  5GPR A;  3WD4 A;  2VSO E;  2WMO A;  5G2N A;  5CMY A;  3D3M A;  4KQZ A;  4TUU A;  2MLZ A;  4UI9 J;  4WNE A;  4MNM A;  3L16 A;  4Z2J A;  3O5Q A;  1HF8 A;  4GU5 A;  3TG4 A;  3ZYM A;  4N19 A;  4QZV B;  3ODK A;  3CVL A;  2VQ2 A;  2XCC A;  3PZD A;  4CDR A;  4DRI A;  4J8F A;  2ZR6 A;  4MNK A;  2LAH A;  1IQR A;  3WQW A;  1Q6U A;  3R9A B;  3CKB A;  2Q5A A;  1XHG A;  1HJX A;  5FQ6 A;  3NQP A;  3ZYQ A;  4C0E A;  2EQX A;  3RO3 A;  4JPS A;  3SGH A;  5KJM A;  4WAF A;  4ILH B;  4WK9 A;  4DLQ A;  3MKQ A;  4K0R A;  3AS8 A;  4F1S A;  4H7Y A;  4IT4 A;  4EZK A;  3KAC A;  1WM5 A;  3GZ2 A;  3CVV A;  3KD7 A;  2FUL A;  4KR0 B;  2IJG X;  4WJX A;  4WND A;  3RIB A;  3OXL A;  5E75 A;  2ILR A;  5CCL A;  5EX3 A;  2KCV A;  2KCK A;  3RM4 A;  4N2Q A;  4NQ0 A;  1D6O A;  4I1A A;  4A1G A;  1GOI A;  1DNP A;  1A17 A;  3UT4 A;  3APC A;  3LPZ A;  4KZ0 A;  2PI6 A;  3IV0 A;  5EDS A;  2N87 A;  1L1P A;  5FZQ A;  4CT4 A;  4DRM A;  3B13 A;  4IRU A;  1N54 A;  4DRO A;  3CHE A;  4LEU A;  4FLH A;  3CK8 A;  1FVH A;  3P1U A;  4Y6W A;  2YNQ A;  4GZD A;  3CHC A;  3ASH A;  1NH6 A;  1LQ0 A;  4BT9 A;  1HKK A;  3CVP A;  4GML A;  4KT6 B;  2RUD A;  1W1P A;  2XGM A;  2WK2 A;  1XNF A;  3FUK A;  3QK0 A;  3ALG A;  4GYW A;  4BX8 A;  2XP3 A;  3QKY A;  3UX4 A;  3VLF A;  3ASG A;  4DPR A;  1TJF A;  5T4Y A;  5D0Q D;  1Y0O A;  5M72 A;  3FEX A;  2V8S E;  2VSY A;  2R59 A;  3MA5 A;  4JYS A;  4U0S A;  3ESK A;  5J6E A;  1GUV A;  3PE4 A;  2DT2 A;  3CQC B;  3ZEF A;  4UWH A;  4ZPV R;  1D2K A;  1W1V A;  5FJY A;  3ART A;  1NWT A;  2RUQ A;  4APF A;  1DVP A;  5BT1 A;  2WXP A;  1IQU A;  2VYI A;  3L6A A;  2WLY A;  4URK A;  3ZXS A;  1INZ A;  3ZW3 A;  3CR3 A;  2BUG A;  5LFA A;  4MRU A;  1O6I A;  3RRN B;  3ARV A;  1JNE A;  4G25 A;  3DPD A;  1NA3 A;  1EPU A;  5FQ4 A;  4HFG A;  4MLP A;  1E9L A;  4U85 A;  3VLD A;  2WXI A;  4DRH A;  5AJD A;  4I1O B;  1FKS A;  5G05 C;  5HT1 A;  2IF4 A;  1NWS A;  4N3A A;  1CTN A;  3JUI A;  2YBU A;  4HAR A;  3LVR E;  5KCM A;  4B89 A;  2XEV A;  1U3C A;  4IN3 B;  3OXF A;  5G55 A;  2XPA A;  3PH0 C;  1W1T A;  3EY6 A;  1FCH A;  2YIN A;  3B9D A;  2AWI A;  2Y4U A;  2WPV A;  3WD2 A;  5G05 J;  4FJY A;  3L54 A;  3ZPJ A;  3FTW A;  3AS1 A;  3VLE A;  2V0P A;  3IHY A;  1ROT A;  3IHZ A;  2ZQV A;  2O9O A;  4I6E A;  1FKL A;  4I6G A;  1JNT A;  4Q7N A;  2A4Z A;  2YHC A;  2LPV A;  3FHE A;  2RUC A;  4J6I A;  2NSZ A;  1IHG A;  5T3R A;  4I2W A;  1SZA A;  5AIJ A;  3MV3 B;  4ATG A;  4CDN A;  1ELK A;  2RG8 A;  5FQ8 A;  2D9F A;  2BF0 X;  1MHQ A;  2PM6 A;  1EHN A;  3ARX A;  3JXV A;  4WKA A;  3MKQ B;  4DRK A;  4NNR A;  3O5I A;  2DG3 A;  1IX5 A;  5ARG A;  4J8S A;  3SF4 A;  2MNT A;  3FY1 A;  3GW4 A;  4XIF A;  4TYO A;  2LKN A;  2LO6 A;  3O5R A;  2AVP A;  2MPH A;  2LJ4 A;  2YBT A;  4L7T A;  4CEM A;  2E2E A;  1UN9 A;  1GW6 A;  4GGQ A;  1HU3 A;  4ODM A;  3ZFW A;  2K8I A;  1F8A B;  3L13 A;  4PS7 A;  2LGO A;  2OVB A;  3ARS A;  2VTB A;  1NWU A;  1FKD A;  3CVX A;  1FVF A;  1FKG A;  4L3N A;  4N2S A;  5KJL A;  3S7D A;  1H2T C;  2FEZ A;  3G2W A;  2XP7 A;  1E90 A;  3U3W A;  1T11 A;  3S2A A;  4PS3 A;  4XKC A;  4HXI A;  5HKG A;  3NRK A;  3FU5 A;  5JHA A;  4ODR A;  3CGN A;  4DWS D;  5JJ7 A;  3HIZ A;  5FQ7 A;  1SYT A;  3L08 A;  5KJN A;  3SNX A;  3ARU A;  4FC8 A;  3NTP A;  4KVO A;  2DIW A;  5HW8 A;  4LCT A;  1HKM A;  5HWB A;  3C98 A;  3ONL A;  4FA6 A;  3MKR A;  4DK5 A;  1E6N A;  3APD A;  4APO A;  4WWN A;  3U9W A;  4KMO A;  3GZ1 A;  4GYY A;  2M1I A;  4GZ5 A;  1EYM A;  4DZ3 A;  4Z2G A;  5HI7 A;  3FUD A;  4ABN A;  2A3B A;  1YA0 A;  4J4O A;  4TW6 A;  1U3D A;  3QAQ A;  1EYH A;  2WB2 A;  3ZYL A;  4J8D A;  1WNO A;  2AXZ A;  3KAE A;  3KAB A;  5DIT A;  4ACL A;  1A7X A;  3LY9 A;  2VSX E;  4WUY A;  2B31 A;  3ZRH A;  4R7L A;  1ELR A;  3CVN A;  4BFR A;  3AQU A;  3CHO A;  4R0X A;  3KAF A;  3JQ0 A;  4S3J A;  2F4E A;  1UJK A;  4L2Y A;  5CCM A;  4HOQ A;  4N3B A;  3PDN A;  3N71 A;  2PPN A;  2I9C A;  2V4L A;  2J09 A;  2HO1 A;  3ESL A;  5FWQ A;  2WMN A;  3O5F A;  3RK6 A;  5AEN A;  4JVS A;  3DBS A;  1X6N A;  4AY5 A;  3WL1 A;  4GZ3 A;  3KAG A;  4L23 A;  4K03 A;  3KEZ A;  1OWM A;  1E8Y A;  3SZ7 A;  2XP6 A;  4DI4 A;  3ARW A;  5FT9 A;  5BV1 A;  4WNG A;  4XX5 A;  1H19 A;  3G6M A;  3O5G A;  3MGB A;  4BTA A;  4L1B A;  4GCO A;  2PL2 A;  5HQ8 A;  5ANL A;  5LOZ A;  3Q47 B;  2WXN A;  1TEZ A;  1F40 A;  2DT3 A;  1LL6 A;  4OVV A;  4AIF A;  1XGW A;  4Q94 A;  3RM9 A;  2QY7 A;  2WXH A;  3FU0 A;  4HLE A;  3CK7 A;  3ZHE A;  4I9C A;  3O5L A;  1H0A A;  2XPI A;  2L6J A;  1PIN A;  3CZ8 A;  4AV7 A;  5J90 A;  3FUI A;  4FUL A;  3CEQ A;  1W9V A;  2VCD A;  4NAC A;  4HOU A;  4JZY A;  3MCX A;  4RSY A;  3S7J A;  3QAR A;  1FKB A;  1HX8 A;  3UI6 A;  2FO7 A;  2PQN A;  4ODQ A;  4A1S A;  2HM8 A;  4EZJ A;  4KYO B;  1WY6 A;  1LG1 A;  2CG2 A;  2ZU6 B;  3LYA A;  2KFW A;  2NXP A;  2LSV A;  5D75 A;  4YVO A;  1H0I A;  5D0O D;  5GPG A;  3L17 A;  4O6F A;  3CVY A;  3BG0 B;  3FU6 A;  3IKD A;  2ZQU A;  2X6K A;  3FUJ A;  2PV1 A;  1HS6 A;  1UW4 B;  1HKI A;  3O5D A;  3D9P A;  4DJA A;  3CST A;  1XRV A;  1E6R A;  3Q49 B;  4XAK A;  4Q69 A;  1W1Y A;  3WL0 A;  3UQ3 A;  3Q4A B;  4DZ2 A;  3ARZ A;  4C0M A;  2VTB B;  5DEZ A;  1E7V A;  2CG3 A;  4ME2 A;  5DBK A;  4O2T A;  2DG9 A;  1FKR A;  2IU1 A;  4AOF A;  4U86 A;  1E96 B;  3FH7 A;  4JL0 A;  3KAD A;  1EF1 C;  1QZ2 A;  1KT1 A;  4W9R A;  3UI5 A;  4JFJ A;  5HW7 A;  2IFU A;  3I3N A;  4ANV A;  2OND A;  2AXV A;  4EBA G;  2WXG A;  1ZB5 A;  1ZBW A;  2J4D A;  4WWO A;  4G2P A;  1HFA A;  4KBQ A;  1HXV A;  3CVQ A;  1WAW A;  3CHR A;  4B0Z A;  1W9P A;  2KCL A;  3JYJ A;  5BPP A;  2Y78 A;  4JHR A;  3PRA A;  4A55 A;  3FTZ A;  1HJW A;  5HWC A;  4PDX A;  3CV0 A;  3I6C A;  4ANW A;  4BT8 A;  1KFW A;  4Q96 A;  4GAA A;  5JJT A;  1W26 A;  4V3I A;  3QDN A;  4XE0 A;  2OVF A;  3Q5M A;  2YQ8 A;  1HE8 A;  3MJW A;  1FD9 A;  3K9I A;  1FFQ A;  3PNT B;  3LKU A;  3AU5 A;  3UI4 A;  2WXF A;  5A7D B;  3B9A A;  3CHD A;  5JJ6 A;  4DWS C;  1SZ9 A;  4LUN U;  2AW6 A;  3EDT B;  4LER A;  1UG3 A;  2UWJ G;  1LG2 A;  4UWK A;  1IYG A;  4L2L A;  3QB2 A;  2J08 A;  1YAT A;  2J49 A;  4AJW A;  3FAP A;  2DPE A;  1Q6I A;  1QNF A;  2X6H A;  2VGY A;  4JHJ A;  1ZK6 A;  1UJJ A;  2L9B A;  2WXQ A;  4AM9 A;  3JYS A;  4HOT A;  2XCB A;  4GCN A;  2FBN A;  2RQS A;  4I6J A;  3FY4 A;  3G2S A;  2WM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...