1KT1A

Structure of the large fkbp-like protein, fkbp51, involved in steroid receptor complexes
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
394
structure length
374
Chain Sequence
KKDRGVLKIVHGEETPMIGDRVYVHYNGKLANPFVFSIGKGQVIKAWDIGVATMKKGEICHLLCAYGATGSLPKIPSNATLFFEVELLDFKGEDLLEDGGIIRRTKRRGEGYSNPNEGARVQIHLEGRCGGRVFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILHLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYVQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQIFMCQKKAKEHNERDRRTYANMFKKFAEQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title STRUCTURE OF THE LARGE FK506-BINDING PROTEIN FKBP51, AN HSP90-BINDING PROTEIN AND A COMPONENT OF STEROID RECEPTOR COMPLEXES
pubmed doi rcsb
source organism Saimiri boliviensis
molecule tags Isomerase
molecule keywords FK506-binding protein FKBP51
total genus 108
structure length 374
sequence length 394
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2002-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF00515 TPR_1 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1kt1A03
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1kt1A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1kt1A02
1JVWA 3CKBA 3RGCA 2Q5AA 1D7JA 3RKVA 4IPXA 5AYWD 4GA2A 3ZFWA 4MGVA 1FKGA 3JYMA 2XP8A 4GCOA 1D6OA 2IFUA 3OOBA 5D75A 4J8EA 4ODQA 2ZQVA 1QPLA 4O6FA 3ESKA 3EY6A 3O5IA 2P58C 2KE0A 2ZR5A 3ASGA 2ZQTA 1EQ3A 1F40A 3U3WA 2KCKA 2QFCA 3O5LA 2C0MA 4W9PA 4WNFA 4DIPA 3O5QA 1Q6HA 4DZ3A 2XEVA 3S7BA 1L1PA 3ASDA 1Q6IA 2FEZA 2N87A 1KT1A 3NF1A 2AVPA 3CVQA 3QWVA 4I9CA 2XP4A 1JNTA 3UUXA 3CVPA 4GA1A 1B89A 4N2QA 4XI9A 2LSVA 1OUVA 4UQYA 3QOUA 3LUOA 4JFMA 4BT8A 3O48A 2XGMA 3S7JA 3LCAA 5EX3A 4BTAA 4I9EA 4G2VA 3FFLA 4UI9C 4ODRA 4HOTA 2LSUA 5D0QD 1Y8MA 5LCWJ 5B8IC 3E4BA 4J0UA 4DRMA 3FWVA 2PPOA 3H9RB 4IQCA 4DRKA 1FCHA 1ELRA 3S7FA 1JNSA 2V5FA 1FKBA 1PINA 1FJDA 3QWWA 4N19A 3GZ2A 1B6CA 2DG4A 4BTBA 2PV3A 3KZ7A 1NMWA 4UQZA 4TYOA 2PPNA 2XP3A 2RSEA 5G04J 3KADA 5KJKA 4W9RA 5KJNA 4ABNA 4AY5A 2LGOA 2M2AA 1PC2A 4DRQA 3GZ1A 2RURA 1F8AB 5DBKA 2OFNA 4APOA 1EYMA 3KACA 2KI3A 1ROTA 5G04C 4HOQA 5ARFA 5A6CA 3TG4A 3MEKA 3SZ7A 4G26A 1FKLA 4JYSA 2FF4A 4AM9A 1FKJA 3Q47B 2WPVA 2VN1A 4JA9A 3RO2A 2ONDA 3MDYB 5BW8C 4WNGA 3AS4A 3CK9A 1HH8A 5J6EA 4C02B 2J9QA 5FZQA 1YATA 2JLBA 1KLXA 2XCBA 5HW6A 4WNDA 4G24A 1NSGA 4A1SA 5LCWC 4H7XA 4TNSA 2DG3A 4DH0A 3O5KA 2LPVA 4ODPA 5BT1A 3LY8A 3RU0A 2M08A 3KAHA 4B94A 4J4OA 3PRBA 3IKGA 5HWCA 4G1TA 2MHKA 2XPAA 5FJYA 4IN3B 4J8DA 3PE3A 3UF8A 2RUDA 5BXJA 2AWGA 3LPZA 2FBNA 3UQ3A 1HXIA 3PA7A 3QKYA 4JHRA 3Q5MA 4GGQA 3RIBA 1Q1CA 4JFIA 1WM5A 1E96B 1QQEA 4N39A 2F2DA 5FT9A 2KCVA 3ODKA 5FZRA 5GPGA 3HYMB 4GYOA 5G05C 5D0OD 5JJTA 2UY1B 2MNTA 4DRNA 3PE4A 2MLXA 4W9OA 3MA5A 4ODMA 4JFJA 4Y6CA 3UQAA 4G25A 2LKNA 5EX0A 2R5SA 5JJ6A 1TCOC 4HORA 5HW8A 1BKFA 2KCLA 5HI7A 4QT2A 5M72A 2M1IA 4KYOB 4DROA 4TW6A 3UQBA 2C2LA 3KAGA 4U04A 4JFKA 4QT3A 3PRDA 1R9HA 3CGMA 5DITA 2YQ8A 3CK8A 2FI7A 4G50A 1N1AA 4R0XA 4GIVA 2L2SA 1TJCA 1FKSA 3ZHEB 4CDRA 4I2WA 2VGYA 3K9IA 3FP3A 3ZPJA 2F4EA 5KJMA 2KC7A 2PV2A 1FKFA 3TDBA 2JZVA 2UWJG 5BNWA 1XNFA 4GPKA 4XIFA 3GYZA 2UY1A 2HYZA 4J4NA 3KS2A 1IYGA 2HR2A 1M5YA 4LAWA 4U84A 1FKRA 3LY9A 2VQ2A 1U79A 2XP7A 2ZQUA 3LKUA 2KO7A 2UZ5A 2XP6A 4LAYA 3N71A 4UI9K 3WXXA 4NRHB 1W3BA 3TCZA 3UQIA 3URZA 1YA0A 4CGWA 3O5RA 4HOUA 4AY6A 1HXVA 3BEEA 5DIUA 4TW7A 2RUCA 2DBAA 3QWPA 3O5PA 1D7IA 4YNDA 1J6YA 1YW5A 3KABA 4ODOA 2Y78A 4BF8A 4LEUA 2E2EA 2XCCA 3Q4AB 4RG9A 4G2PA 2ZQSA 2FKEA 5A7DB 2FO7A 5HW7A 2PBCA 3O5FA 4DT4A 2MF9A 3O5EA 2FAPA 1QZ2A 4H7YA 3TG5A 4GCNA 2VYIA 3MV2B 2XPIA 2PV1A 1ELWA 4AIFA 1QPFA 5HQ8A 1Q6UA 4ITZA 2ITKA 1A17A 3OXGA 3UI6A 4BWRA 2RQSA 2XP9A 4LAVA 1ROUA 2KR7A 2WQHA 2ZR4A 4U0ZA 4GZ6A 4GYYA 1KT0A 3RO3A 3VTXA 4FN2A 3MKRA 3VAWA 3ULQA 4U07A 5FZSA 5HKGA 2F21A 3Q15A 2VCDA 3WH0A 2NC9A 3CGNA 2HO1A 3ZHEA 2L6JA 4N3AA 2ZR6A 3IKDA 1W26A 1PBKA 3NI6A 4DRJA 2D9FA 1T11A 4ME2A 1FAPA 1FKKA 5DIVA 4IQ2A 3CV0A 2PPPA 1J4IA 3CKCA 4ODKA 4NNRA 4DRIA 1NZNA 5HTGA 2Y4UA 3U4TA 4GYWA 3RJVA 5FTPA 3O5OA 3KCEA 3RFWA 1FKDA 5I98A 1NMVA 2VSNA 2K8IA 4TW8A 4U85A 1ZK6A 5CCMA 4DRHA 5CCLA 1FKHA 3TAXA 4O2TA 3ZGQA 1HZ4A 3KAIA 4NQ0A 3JXVA 2XGOA 4GA0A 5HWBA 2XP5A 4QIBA 4ODLA 4J8FA 4N5CA 3TGOA 3Q49B 4XI0A 1FKIA 4GZ3A 4U86A 5JJ7A 3UI5A 4UQXA 3B7XA 4EQFA 3CVLA 3AS8A 3VTYA 1NA0A 2GW1A 1P5QA 4BT9A 3PDNA 3O5JA 5DIZA 3GPKA 3OXFA 4DRPA 4FAPA 2I6HA 3KD7A 4KBQA 5C1DA 2KFWA 1ZCNA 2YHCA 2PL2A 4GZ5A 4DZ2A 1ZBPA 3I6CA 4U0SA 5HUAA 3TC5A 2LJ4A 4I17A 1ZU2A 4N3BA 2RUQA 4U0UA 4CGVA 5CHEE 4WUYA 5EKQD 2Q7FA 2MLYA 3CK7A 3IEGA 4I2ZA 3SF4A 2PQNA 3AS5A 3O5MA 1NA3A 3IHZA 1WAO1 3O5DA 3O5GA 2MLZA 4UI9J 2VGXB 4Y6WA 2MPHA 2OOEA 4YVOA 4HOSA 3OXLA 2IF4A 4W9QA 3ASHA 4JL0A 4YVQC 1IHGA 3IK8A 4MSPA 3FAPA 2BUGA 3UI4A 1BL4A 3UPVA 1D7HA 2XGSA 3LYAA 3CEQA 5G05J 5ARGA 1Y0OA 3KAFA 3CVNA 2DG9A 1J4HA 2Y4TA 3QDNA 2PZIA 4JA7A 1J4RA 1FKTA 3ASFA 4N2SA 3JYSA 5HT1A 5KJLA 3EDTB 1C9HA 3MV3B 3LY7A 3KAEA 4RG6A 4I1AA 3JYJA 2LNIA 2VSYA 3S7DA 3ZN3A 4WNEA 4TX0A 2C0LA 2PQRA 3NRKA 1A7XA 4G23A 4ODNA 3R9AB 2XPBA 2KATA 4KXKB 4F3VA 4JFLA 4N3CA 2KGJA 2VGXA 3NTPA 3GW4A 4LAXA 1FD9A
chains in the Genus database with same CATH superfamily
3AU5A 3CHMA 2RFMA 2EILE 4PS8A 3RKVA 5AYWD 1N11A 2XHEA 1FKGA 4GCOA 1D6OA 4A3TA 3EY6A 1JWFA 4LG6A 2KE0A 2ZR5A 3G2WA 4DUIA 3C5RA 2P9KG 4I6GA 5EYLA 2QFCA 3O5LA 3PR9A 4ANVA 4FC8A 4DIPA 1OY3D 1OGBA 3HVEA 1Q6HA 2FDMA 3ASDA 2FEZA 1KT1A 4EHMA 2H6IA 3C3RA 2AVPA 3CVQA 4I9CA 3DXKG 1HE8A 1HKKA 2QYUA 3UUXA 4K0RA 4BY6A 3DSWA 3X2QE 4XAKA 1Z3XA 3AG3E 3LUOA 4JFMA 5FQ8A 4BT8A 3LS8A 2Y3AA 5FIOA 3BXWA 5E76A 4GMJA 4AP2A 4HOTA 3RMEA 2MRIA 4EPZA 5D0QD 5B8IC 5H7PA 2PPOA 3H9RB 2VSXE 2V5FA 4N19A 3HXBA 4DX7D 3ZKJA 2QC9A 1TNYA 4UQZA 3HXDA 2P2CP 4TYOA 1W1VA 4WWPA 2XS1A 3ARWA 4EBAA 1WG0A 3KADA 5KJKA 1LTXA 4HB5A 2M2AA 1PC2A 3GZ1A 4P8VA 4AV7A 3ARUA 1HX8A 4BSZB 1EYMA 1ROTA 4HOQA 2H6GA 2P9LG 2WXKA 4WAFA 1FKLA 2FF4A 1KPSB 4JYSA 3AS2A 4F53A 4IYPA 4AM9A 3HRAA 2M63A 3SY2A 1DC2A 2VN1A 4LCTA 4TV3A 3EIQC 3FUNA 2ONDA 1E44A 4WNGA 4D10C 3CK9A 2IEJA 4C02B 2J9QA 3WD4A 4OVVA 1KLXA 3IKOB 4WNDA 1TNUA 4G24A 3RRUA 5FINA 3LVQE 4H7XA 3VLDA 1DCEA 2J09A 2ZXWE 2LPVA 1H6KA 2P4VA 4IT6A 4ODPA 1H6PA 1EF1C 4B89A 1BD8A 4J4OA 4Q69A 3IKGA 2R05A 2A5UA 5HWCA 4DWSC 3ABKE 2F23A 5BXJA 2CHWA 5CBOA 3PA7A 2A5EA 3LVRE 3QKYA 4JHRA 1N4PA 4QZVB 4I6EA 4S3JA 3FH7A 3AS0A 4TRQA 2GGFA 1QQEA 4N39A 5FT9A 3ZVVA 5CBNA 5G05C 5D0OD 2MNTA 2UY1B 3UINC 4BEPA 3RRMB 5JJ6A 3FUFA 1BKFA 4QT2A 4O60A 4G8KA 4QT3A 4DX1A 1GW6A 1FPPA 3CHPA 5EIBE 2CHXA 3UIPC 2YBUA 3Q78A 3ENEA 1TJCA 2GRNB 3KSQA 3ZHEB 4I2WA 1D2KA 3D9MA 5ENRD 3ULEG 3FP3A 3E30A 1FKFA 2XENA 3FDHA 3MYVA 2X6FA 3R7QA 2R2LA 3ASOE 5BV1A 3GYZA 1PY1A 2BEDA 1QNFA 2JABA 4J4NA 3RM9A 1IYGA 3ASNE 4Q96A 2EINE 1O6IA 3MJWA 3VLEA 3ARPA 4U8HA 1FFQA 2UZ5A 4KT6B 2XP6A 4GTRA 4NSBA 1ZBKA 3ONLA 1CTNA 4AVXA 3CZ8A 4CGWA 2B31A 3L08A 3O5RA 3BEEA 4HRMB 3G2TA 2DBAA 3RSEG 4JW1A 1YW5A 3CVYA 2X6KA 4EECA 3Q4AB 2WLYA 4BERA 4HLEA 1E90A 2G41A 4YDYA 5A7DB 4RLYA 5FWQA 4L9PA 1JNDA 1E15A 2FAPA 1MX4A 5CRUA 2XPIA 4KZCA 1UW4B 2PV1A 1ELWA 1QPFA 3PREA 5T4YA 5HBFA 1Q6UA 5AJLA 3QARA 3AAAC 5A23A 2B0OE 2RQSA 4DWSB 3EU5A 4LAVA 1ROUA 2KR7A 2BF0X 2WQHA 4U0ZA 1OXJA 2LAHA 1HG5A 1H0IA 1LL6A 3L6AA 1ZB5A 4ATZD 3SHFA 3Q15A 3WH0A 3D9OA 1IKND 4U96D 4AY1A 3SFXA 2VTBA 3UT8A 1PBKA 4B93B 4U7EB 4DRJA 2D9FA 2PNNA 2WXGA 4BX8A 4Z68A 5DEZA 1FKKA 5DIVA 4IQ2A 1J4IA 4GMLA 4PUCA 4P29A 1H2TC 5CMWA 4WKAA 3L54A 1O1RA 3EJNA 4JEHA 3DPYA 5FTPA 1N4QA 2R02A 3TWQA 5B1AE 2DSZA 1NMVA 3IHVA 4TW8A 4UUCA 1ZK6A 5CCMA 4P8WA 5CCLA 3TAXA 5ANRA 4WIWA 3JXVA 3RK6A 4F1PA 1E8ZA 1EDUA 1TJFA 3OAWA 2XP5A 2HM8A 2WXHA 2KM4A 1E6RA 4J8FA 1Z5SC 3HDXA 3Q73A 4XI0A 2AW6A 4O1PA 3HHMA 1ITXA 1VF8A 4XKCA 1NA0A 3PDNA 5DIZA 3GPKA 3UM1A 3PZ4A 4NZCA 3PUJA 2YNQA 4KBQA 4JVSA 4LNBA 3PS6A 5D66A 1L5JA 2I1JA 2PL2A 4CT4A 3B9DA 4P8XA 2YBTA 4DZ2A 5J08A 3MKQB 1OCCE 4I17A 2Y1LE 1ZU2A 4M3OA 2WXOA 1H2VC 3ZNGA 2Q7FA 3IEGA 3AG4E 4UWFA 2PQNA 1WAO1 4J8SA 3JCKC 4UI9J 4GTQA 4Y6WA 3SFZA 1QBQA 2MPHA 3D9KA 4DX2A 2WXIA 2BUGA 1BL4A 3RM8A 3LYAA 3CEQA 3NAWA 4HRNA 2ILRA 2CFUA 3QDNA 4JA7A 4N2SA 1WDYA 4GZCA 4BFRA 1OCOE 1N52A 2ZGGA 2WM9A 1N4RA 3FY4A 2PQRA 3L17A 3JUEA 1A7XA 4GU5A 3C98A 3QJZA 4ODNA 3R9AB 4C48B 1HJWA 4ACKA 4ILHB 3B9AA 4KXKB 3AJIA 3PEUB 5LOZA 1YMPA 2XS8A 4N3CA 3NTPA 1W1TA 1FD9A 2KZTB 3RGCA 1V55E 5FQ4A 1XRVA 4GA2A 4MGVA 2DIWA 2KBXA 3GU0A 2QY7A 3D9JA 5T8IA 3FEXA 2ZQVA 3ESKA 3NBNB 2DT3A 4WWOA 1F40A 2NXPA 4WJXA 2KCKA 4DZ3A 1GRJA 3S7BA 4N5QA 2X38A 5LFAA 1E8YA 4ZPWR 3WQWA 3CVPA 3FTYA 1H19A 4ATGA 2XRYA 4N2QA 4EZKA 4XI9A 1NI1A 4TXPA 4UQYA 4IT4A 4EZJA 1NWTA 1IXVA 3JQ0A 3O48A 1X6NA 4ODRA 2WMOA 4ZHBA 5LCWJ 3PH0C 1RD6A 3AROA 1JWGA 4DRKA 1ELRA 3S7FA 4HQDA 2ESCA 1PINA 1MX2A 1FJDA 4MNLA 4LNUD 3D9PA 3QOKA 2DG4A 2PV3A 3KZ7A 1MJ0A 3ARXA 5AARA 1MHQA 2P9NG 5LX8A 3CHRA 2V0PA 3EIPA 1XGWA 3HVEB 4CEMA 5ITZF 5J90A 1GUVA 2R17C 3TWSA 2HE0A 3E34A 2GRRB 4HARA 2WXNA 5DBKA 2OFNA 3T8MA 4UWLA 2CFZA 2KI3A 2XEHA 4CT0A 5G04C 5ARFA 1KZPA 2J8SD 4U8VD 3SZ7A 4HBEA 1FKJA 3HXFA 3JXIA 2WPVA 2PM7A 5HS0A 1QYMA 4I1OB 5JH8A 3RO2A 3IHYA 3DEOA 5C2YA 3D9IA 3MDYB 4HBOA 5BW8C 3SNXA 3CHQA 5FZQA 2JLBA 2J49A 3FH8A 5HW6A 4AJWA 4A1SA 4R7LA 4TNSA 2DG3A 4DH0A 3O5KA 3NB2A 4QQIA 4B94A 2OCCE 3QB2A 3PRBA 2ZIRA 1W9UA 2GRQB 1UJKA 2MHKA 1E7VA 4ANUA 4GAAA 3CQCB 2CG3A 1S63A 3UQ3A 3PZDA 3MX3A 2MYOA 3CGHA 4JEUA 1Q2ZA 5KNHD 4Z2LA 4WWNA 5HRYA 4GGQA 4HI8A 3UTMA 4JFIA 1H2UA 1FVFA 3G2UA 4AOFA 1E96B 3CHCA 2F2DA 1N94A 2XZTG 5FZRA 5ENQD 2EIME 3HYMB 4GYOA 4BX9A 4W9OA 3MA5A 1MX6A 2LKNA 5EX0A 1IQRA 1TCOC 5HW8A 2O92A 5HI7A 2Y0BG 5CRVA 5M72A 4DROA 4FLBA 3AQUA 5AQBA 2YQ8A 1NWRA 4DI3A 3CK8A 1N1AA 2X3MA 1FKSA 3UI2A 2WXQA 2PV2A 4LGXA 3ZYMA 2OVBA 5BNWA 4O1OA 1XNFA 1KZOA 1NFIE 3KS2A 3LJ3A 1M5YA 4C9BB 1FKRA 3BMBA 3EHRA 1TEZA 3CQGB 3P1UA 3TCZA 1HKIA 1HS6A 3URZA 3J5PA 2IJGX 2IQCA 4HOUA 1AWCB 2A3AA 4TW7A 1X6LA 2RUCA 1HXVA 3QWPA 2DSWA 4DK5A 2V5QC 3UM2A 2NYJA 3W9FA 1SVXA 2ZQSA 2FKEA 5EYPF 2PN0A 3FUDA 2FO7A 3J5QB 2V4LA 2H6HA 2LAIA 4R5EA 3O5FA 3WL0A 2YINA 2MF9A 3BG1B 2AWIA 4L23A 4RSYA 3CVVA 1TFVA 4JHJA 3ABLE 3FU3A 3EHMA 4Z2GA 1BLXB 2KZTA 4ITZA 1SR0A 1A17A 3OXGA 4BWRA 3RO3A 3T5XA 1BU9A 3ULQA 1BI7B 5ANLA 3CGNA 2HO1A 3ZHEA 4L2YA 1JCSA 1W26A 1OWMA 2V4HC 4X8QA 1TNZA 1O5MA 3V30A 3WL1A 5ENOD 3TL5A 3CV0A 3EUVA 2PPPA 1NL4A 3CKCA 1E8WA 4ODKA 1EPUA 4DRIA 3WKZA 1NZNA 3FUEA 5HTGA 3DWLG 4GYWA 3JUIA 3RJVA 4I43A 3ARRA 4TUUA 3RFWA 2VSNA 3ZEFA 4U85A 3B7SA 2DT1A 4DRHA 3QNKA 2XPYA 1FKHA 4W5UA 1HZ4A 3PNTB 4NQ0A 1HU3A 5JA4D 2L9BA 3FUIA 3TXNA 3APFA 3C72A 3G6LA 2AXUA 1TN7A 4N5CA 5CECB 4WKHA 3TGOA 2ETBA 4U95D 3VLFA 1FKIA 4U86A 3O4ZA 4GMRA 5JJ7A 5G55A 3SD5A 3D9NA 4EQFA 3CVLA 1A5EA 4HXIA 3VTYA 1U3CA 3S2AA 3ULYA 1AP7A 2RD0A 1HJXA 5CERB 3FTVA 3B7RL 3FEYA 3OXFA 2DZNA 1ZCNA 2YHCA 3KEZA 2A4ZA 4GZ5A 3F6QA 4MAVA 1ZBPA 3I6CA 4JC8A 4U0SA 5HUAA 2MOWA 2WK2A 3TC5A 4DLOA 2LJ4A 2RUQA 4U0UA 3Q9NC 5CHEE 4WUYA 5EKQD 5T3RA 4I2ZA 3SF4A 4URKA 4GTSA 1UN9A 3B13A 1NA3A 3IHZA 4GTPA 4L72B 2MLZA 3IBEA 2E0IA 1G3NB 1WY6A 2JEKA 3OXLA 3ASHA 2AOSA 3IV0A 2R59A 1TN6A 3LJNA 4RQIA 4FHJA 3EHQA 2BKKB 2B5UB 3FTZA 4F6RD 5ARGA 2H6FA 4Q7NA 2Y4TA 3PVLA 3W4RA 5KJLA 3FUHA 4E6HA 3UM0A 1C9HA 1ELKA 3LEWA 1TN8A 2ETNA 2WM0A 3JYJA 1NP7A 2VSYA 2I9CA 2C0LA 1OWOA 3I3NA 2QF8A 4NACA 2XPBA 4Z2JA 2KATA 4DX6D 4A63B 3SBSA 3D9LA 2RKKA 2VGXA 4LAXA 3UI4A 4ML4A 1EQ3A 2DSUA 4DX5D 1W1PA 4P8UA 4Z2IA 1X5BA 3PZ3A 4KVOA 1NWUA 3UM3A 3CVWA 1UN8A 1W9PA 2X6HA 1NH6A 5AQAA 3L13A 3FU5A 2XP8A 3OOBA 4J8EA 1OWQA 3R9MA 1QPLA 4O6FA 1Z3YA 2DYSE 4ZFHA 3U3WA 3DSSA 3UX4A 2C0MA 3O5QA 5E75A 1FT1A 4PTMA 3APCA 4FLHA 1VDYA 3G2VA 1JNEA 1Q6IA 1FFRA 5AQ7A 2N87A 3NF1A 3L82A 2ZGDA 2R03A 3FH5A 1JNTA 1B89A 1FT2A 4K03A 2XEEA 4U8YD 4A1GA 1TR4A 1ZB1A 1OUVA 1S64A 3QOUA 1HO8A 3DRAA 2A3CA 5EX3A 4BTAA 3WG7E 3DBSA 2LSUA 3TWWA 2EULA 3E4BA 4J0UA 3FWVA 3G6MA 3Q75A 4BSXA 1JNSA 1FKBA 1HKJA 3L16A 4BTBA 1HJVA 2DSVA 4MLPA 2PM6A 4YDEA 5G04J 1H6OA 3D3MA 2EQXA 3CR3A 5KJNA 2LGOA 3I4RB 4GPMA 1FVHA 2RFAA 2GRPB 3B95A 2RURA 2IY0C 3RM4A 1UOHA 1F8AB 2QZAA 3TWRA 4MNJA 4DRXE 2F8XK 3KACA 4Z2HA 3TG4A 5A6CA 1ZBCA 3ARZA 3Q47B 3HG0D 3PNLB 4XZ4A 4JA9A 2OEWA 4LUNU 5IY5E 3FTXA 4MTVA 1LG2A 3BG0B 3AS4A 2F8YA 4JB8P 1K8KG 3WD3A 3ABME 4B8AA 2XCBA 4HBDA 4MKTA 1NSGA 3ZW3A 5LCWC 4I6JA 2J08A 4MS6A 5FQ7A 2WXJA 2J4BA 5EIDA 2LXMA 4A55A 3MZLB 4ANWA 4G1TA 3PRAA 3ZYLA 2XPAA 5FJYA 4IN3B 4J8DA 3CVUA 1N9AA 3CHOA 2AWGA 3ZXSA 3LPZA 3I4GA 1HXIA 2EIKE 4Z2KA 3C3OA 3C3QA 3RIBA 5AIJA 4FU3A 4J6IA 3ODKA 4B8CB 5GPGA 5EN5D 5JJTA 3PE4A 2MLXA 4JFJA 3UQAA 2R5SA 4HORA 2RG8A 5DO2A 2DWZA 4HLLA 4CCAA 3W9GA 4U04A 5BPPA 2P9SG 3ARSA 3CGMA 2FI7A 4G50A 4KZ0A 1E9LA 1N54A 2WXLA 3WD0A 4KMOA 3ZPJA 2F4EA 5KJMA 2KC7A 4PH4B 1DCQA 5KNGA 5GQBA 1E7UA 2A3EA 2UWJG 2KXPC 4FP7A 2HYZA 4ZPTR 4UWHA 1OWNA 1HKMA 1OWPA 2HR2A 4UDMA 4L2LA 4LAWA 4U84A 3LY9A 3PZ1A 1U79A 3AS3A 3DSUA 5CEAA 2WQ6A 3TWUA 4NRHB 1W3BA 1RW2A 3UQIA 4KVMA 1OGGA 1OT8A 5B1BE 3HIZA 4YNDA 4FJZA 3ARVA 1OCZE 1LG1A 4ODOA 4BF8A 4LEUA 2EIJE 2E2EA 2XCCA 4RG9A 2F37A 4PS3A 3T8KA 2P9UG 4MRUA 3SFYA 3APDA 2L0IA 3CSTA 1BPOA 2PBCA 4DT4A 4H7YA 3TG5A 4JHKA 2VYIA 5KCMA 4L7TA 5HQ8A 4MPKA 3V79K 5ENTD 2GRMA 4K5BA 2ETAA 2ITKA 3IXEA 2VSOE 2XP9A 3RAUA 4ANXA 1SA4A 4DLQA 4PS7A 4GZ6A 4EZLA 4GYYA 1K1AA 2DYRE 2Y69E 3MKRA 3DXMG 2ZU6B 1BI8B 2VCDA 2NC9A 2L6JA 5EILA 4N3AA 5BXUA 3IKDA 1UG3A 3NI6A 4F7AA 1T11A 1SZAA 3CSFA 2DT0A 1SW6A 4A3VA 3ONKA 3CHSA 1GOIA 1JCHB 2XZDG 4F1SA 4NNRA 1DNPA 4GTTA 4DI4A 3TWTA 1N0QA 3Q7AA 4XX5A 3WQVA 3U4TA 4MBGA 3U9WA 3O5OA 3KCEA 2AXVA 1O1SA 2K8IA 4DPRA 1K1BA 5JMND 5KWDA 2OV8A 2WVIA 3KAIA 4HRLA 3FULA 1ZU8A 3FUMA 4AXHA 4GA0A 5HWBA 1JCQA 4S3KA 4OVUA 3Q49B 3LDZA 2PI6A 1LD8A 4GZ3A 3UXGA 4NURA 2BTDA 4JD2G 3UI5A 4MNMA 3B7XA 1TNBA 3AS8A 3ARTA 5AENA 3FU0A 2J07A 4BT9A 1RZ4A 3O5JA 2VGEA 3SBTB 4DRPA 4FAPA 3FU6A 4CRWA 4TXQA 3UIOC 2DZOA 1S0PA 3ZYQA 3CVXA 5C1DA 1UR8A 2IOSA 3SO8A 3P2BA 1Z6TA 4CGVA 2MLYA 3AS5A 3L9TA 2AJAA 1PAQA 2XPZA 5FQ6A 3O5DA 2VGXB 3NZSA 2OOEA 3FTUA 4YVOA 4DJAA 4W9QA 2IF4A 4JL0A 4YVQC 1IHGA 3IK8A 4MSPA 3FAPA 2XGSA 5G05J 1Y0OA 3KAFA 5EDSA 3SI5A 4CYMD 5JHBA 2DG9A 1J4RA 3FTSA 2GRLA 2IOLA 3JYSA 1WB0A 3V2XA 3B7BA 3ESLA 3U64A 3LY7A 4RG6A 1E6PA 1V54E 4MNKA 3NRKA 4WKFA 4AEZC 4G23A 4HNAD 3ML9A 4G8LA 4F3VA 3WIJA 4OYSA 3MKQA 2LO6A 3GW4A 3KSLA 4XEIG 1DVPA 3EU9A 1JVWA 4GTVA 3CKBA 2Q5AA 1D7JA 4J7WA 1E6NA 4IPXA 3JXJA 3NOCD 3ZFWA 3ISMC 2VJ8A 5ENNA 3QK0A 3B7UX 3JYMA 2IFUA 2OVFA 5D75A 4ODQA 3O5IA 2P58C 3L22A 3ASGA 2ZQTA 1IHBA 3E37A 3Q79A 3FXYA 4LNGA 4W9PA 2B6CA 4WNFA 4ACLA 3UKUG 2XEVA 1N95A 1NWSA 1L1PA 4DWSD 3ARQA 1MQSA 2XRZA 2QYJA 3R7RA 3QWVA 2XP4A 1IQUA 3E32A 3AS1A 4GA1A 2WB2A 3UMVA 2WXMA 1LF8A 1N4SA 2LSVA 4URIA 3PZ2A 3EIJA 4BESA 2XGMA 3S7JA 3LCAA 2P9IG 4I9EA 4G2VA 3FFLA 4UI9C 5BV0A 1KFWA 3HXCA 1Y8MA 3PEVB 4DRMA 1SA5A 2WXRA 4IQCA 4DWSA 1FCHA 2YHEA 1D8EA 1IX5A 4FHKA 3DSTA 3DSXA 3QWWA 3GZ2A 1B6CA 5JHAA 3B7TA 4HS2A 3TXMA 1NMWA 5AQ9A 2PPNA 2XP3A 2RSEA 4IRUA 4RVBA 4U63A 2VTBB 5AAOA 5CMYA 3I5PA 2DVWA 4W9RA 3SQVA 4ABNA 4AY5A 1TNOA 3FHEA 4DRQA 5LP0A 1WAWA 4YDOA 1SYTA 4APOA 4QFVA 1LJYA 4V3IA 4KR0B 2OEVA 4WK9A 2XQ0A 4FULA 4UWKA 3MEKA 1GPFA 4G26A 4XE0A 1U2VG 2FULA 1E6ZA 2IO2C 1HH8A 1ZBVA 5J6EA 3ALGA 3UT7A 1ZL1A 4L3NA 1YATA 2WXFA 1LD7A 4GZDA 2DCPA 4C0MA 4JZYA 2WXPA 4B0ZA 3ZIMA 5BT1A 3LY8A 3RU0A 2M08A 3KAHA 4KQZA 1E8XA 2WLZA 3HXEA 1O1TA 2DPEA 5KBAA 3PE3A 2I2OA 2ZISA 3UF8A 1JCRA 4C0EA 2RUDA 1EIBA 2FBNA 2IUZA 1XHGA 3OA5A 3BQOA 3DPDA 3Q5MA 2DT2A 1Q1CA 4YDWA 1WM5A 3LXUX 1W1YA 3ZXPA 3FUKA 2KCVA 3ZYKA 1K3ZD 2I1KA 3UKRG 4DRNA 3CHEA 4ODMA 4Y6CA 2L6BA 4G25A 1SQMA 1D9SA 2WQ7A 2KCLA 4UWGA 3WD1A 2M1IA 4FADA 4KYOB 5AJDA 3E33A 4TW6A 2J4DA 2NSZA 3UQBA 4CDNA 2C2LA 1LQ0A 3KAGA 1S70B 4JFKA 3PRDA 1R9HA 1H0GA 5DITA 3KEAA 4JXTA 4HI9A 4TXRA 4R0XA 4ZPVR 2IO3C 4GIVA 2L2SA 5GPRA 1OWLA 1HF8A 4CDRA 4EBAG 2VGYA 4K5CA 3K9IA 1LL7A 1WNOA 4OAVB 2WMNA 2JZVA 4GPKA 4XIFA 2UY1A 4I1MA 2P9PG 4J8YA 3CH9A 5BXOA 1MYOA 3PUKA 3AG1E 3PRZA 2VQ2A 2XP7A 2ZQUA 3LKUA 1UJJA 1H0AA 2KO7A 3FY1A 4LAYA 1INZA 5HKPA 4ILGA 3N71A 4UI9K 5G2NA 3WXXA 1LL4A 3TJPA 1HFAA 1YA0A 4AY6A 5DIUA 3O5PA 1D7IA 3Q9UC 5AN8A 1J6YA 2X6IA 3KABA 2Y78A 1MZCA 4G2PA 2CG2A 3CLJA 4JPSA 4LRZA 5HW7A 3O5EA 1EHNA 1OCRE 1QZ2A 4HFGA 4GCNA 4APFA 3MV2B 4AIFA 3CIAA 4HVBA 4XKBA 3DEPA 3NZUA 1EDQA 3RRNB 3ML8A 3FUJA 2LXLA 3UI6A 3ZU7B 3FTWA 3GZSA 1X81A 2ZR4A 5B3SE 1KT0A 5CEDB 2LUHA 3VTXA 4FN2A 3Q7FA 2G8ZA 3ZRHA 3VAWA 4U07A 4BETA 3NQPA 5FZSA 5HKGA 2F21A 3G2SA 1Y6IA 4FA6A 2ZR6A 4NIKA 3JQ1A 2OLHA 1YYHA 4Q22A 1ZBWA 4ME2A 3DSVA 2L0TB 1FAPA 3QC1A 1D8DA 3GTYX 5ENSD 3ALFA 2O9OA 2Y4UA 1FKDA 5I98A 1N0RA 3ARYA 4O2TA 3BU8A 3ZGQA 2XGOA 3BUAA 1YCSB 2V8SE 4LSZE 4L1BA 2A3BA 4QIBA 4TUMA 1JPLA 2X6JA 1EYHA 4ODLA 5D2MC 2CHZA 2FO1E 2AXZA 3B8SA 4UQXA 4ZS6A 4M7CA 4GTOA 2IU1A 4FJYA 1TYQG 2GW1A 1P5QA 1SZ9A 3WD2A 1JUQA 2I6HA 3KD7A 2KFWA 3MCXA 5ENPD 3T9KA 4G11A 4E85A 4N3BA 3D9HA 5DF0A 3B9EA 3SGHA 3AG2E 3CK7A 4ILIA 4GB9A 3OTNA 3QAQA 3O5MA 3UT4A 1U3DA 3O5GA 2BKGA 4HOSA 4LERA 4K5AB 4CZ2D 5BUZA 3V31A 3UPVA 1D7HA 3MGBA 2IONA 3NOGD 3CVNA 1J4HA 4PDXA 3TWVA 2PZIA 1FKTA 2GROB 3ASFA 5HT1A 4IULA 3EDTB 2ETCA 2F0YA 3MV3B 3KAEA 4I1AA 3U66A 3T5VA 2LNIA 3S7DA 3ZN3A 4WNEA 4GTMA 3EHNA 4TX0A 3ZUVB 1UR9A 1K9TA 4Q94A 1W9VA 3V2OA 3TWXA 4CDMA 4OAUC 1HG2A 3CHFA 4JFLA 2KGJA 3CHDA 3AU4A 3TDBA
chains in the Genus database with same CATH topology
3AU5A 3CHMA 4PS8A 3RKVA 5AYWD 2XHEA 1FKGA 4GCOA 1D6OA 4A3TA 3EY6A 1JWFA 2KE0A 2ZR5A 3G2WA 4I6GA 3PR9A 2QFCA 3O5LA 4ANVA 4FC8A 4DIPA 1Q6HA 1OGBA 3HVEA 2FDMA 3ASDA 2FEZA 1KT1A 2AVPA 3CVQA 4I9CA 1HE8A 1HKKA 3UUXA 4K0RA 4BY6A 4XAKA 1Z3XA 3LUOA 4JFMA 5FQ8A 4BT8A 3LS8A 2Y3AA 3BXWA 5E76A 4GMJA 4AP2A 4HOTA 3RMEA 2MRIA 4EPZA 5D0QD 5B8IC 2PPOA 3H9RB 2VSXE 2V5FA 4N19A 4UQZA 4TYOA 1W1VA 4WWPA 3ARWA 4EBAA 3KADA 5KJKA 2M2AA 1PC2A 3GZ1A 4P8VA 4AV7A 3ARUA 1HX8A 1EYMA 1ROTA 4HOQA 4WAFA 2WXKA 1FKLA 4JYSA 2FF4A 3AS2A 4F53A 4IYPA 4AM9A 2M63A 2VN1A 4LCTA 4TV3A 3EIQC 3FUNA 2ONDA 4WNGA 4D10C 3CK9A 4C02B 2J9QA 3WD4A 4OVVA 1KLXA 3IKOB 4WNDA 4G24A 3RRUA 3LVQE 4H7XA 3VLDA 2J09A 2LPVA 1H6KA 4IT6A 4ODPA 1EF1C 4B89A 4J4OA 4Q69A 3IKGA 2A5UA 5HWCA 4DWSC 5BXJA 2CHWA 3PA7A 3LVRE 3QKYA 4JHRA 4QZVB 4I6EA 4S3JA 3FH7A 3AS0A 4TRQA 2GGFA 1QQEA 4N39A 5FT9A 3ZVVA 5G05C 5D0OD 2MNTA 2UY1B 3RRMB 5JJ6A 3FUFA 1BKFA 4QT2A 4QT3A 1GW6A 3CHPA 2CHXA 2YBUA 3ENEA 1TJCA 3ZHEB 4I2WA 1D2KA 3D9MA 3FP3A 1FKFA 3FDHA 3MYVA 2X6FA 3R7QA 5BV1A 3GYZA 1PY1A 1QNFA 4J4NA 3RM9A 1IYGA 4Q96A 1O6IA 3MJWA 3VLEA 3ARPA 4U8HA 1FFQA 2UZ5A 4KT6B 2XP6A 4NSBA 1ZBKA 3ONLA 1CTNA 4AVXA 3CZ8A 4CGWA 2B31A 3L08A 3O5RA 3BEEA 3G2TA 2DBAA 4JW1A 1YW5A 3CVYA 2X6KA 4EECA 3Q4AB 2WLYA 4HLEA 1E90A 2G41A 5A7DB 5FWQA 1JNDA 1E15A 2FAPA 2XPIA 4KZCA 1UW4B 2PV1A 1ELWA 1QPFA 3PREA 5T4YA 5HBFA 1Q6UA 5AJLA 3QARA 5A23A 2RQSA 4DWSB 4LAVA 1ROUA 2KR7A 2BF0X 2WQHA 4U0ZA 2LAHA 1HG5A 1H0IA 1LL6A 3L6AA 1ZB5A 3SHFA 3Q15A 3WH0A 3D9OA 4AY1A 3UT8A 2VTBA 1PBKA 4DRJA 2D9FA 2WXGA 4BX8A 5DEZA 1FKKA 5DIVA 4IQ2A 1J4IA 4GMLA 4PUCA 4P29A 1H2TC 5CMWA 4WKAA 3L54A 3EJNA 4JEHA 5FTPA 2DSZA 1NMVA 3IHVA 4TW8A 1ZK6A 5CCMA 4P8WA 5CCLA 3TAXA 5ANRA 4WIWA 3JXVA 3RK6A 1E8ZA 1EDUA 1TJFA 3OAWA 2XP5A 2HM8A 2WXHA 2KM4A 1E6RA 4J8FA 3HDXA 4XI0A 2AW6A 3HHMA 1ITXA 1VF8A 4XKCA 1NA0A 3PDNA 5DIZA 3GPKA 4NZCA 3PUJA 2YNQA 4KBQA 4JVSA 3PS6A 1L5JA 2I1JA 2PL2A 4CT4A 3B9DA 4P8XA 2YBTA 4DZ2A 5J08A 3MKQB 4I17A 1ZU2A 4M3OA 2WXOA 1H2VC 2Q7FA 3IEGA 2PQNA 4UWFA 1WAO1 4J8SA 3JCKC 4UI9J 4Y6WA 2MPHA 3SFZA 3D9KA 2WXIA 2BUGA 1BL4A 3RM8A 3LYAA 3CEQA 2ILRA 2CFUA 3QDNA 4JA7A 4N2SA 4GZCA 4BFRA 1N52A 2WM9A 3FY4A 2PQRA 3L17A 1A7XA 4GU5A 3C98A 3QJZA 4ODNA 3R9AB 1HJWA 4ACKA 4ILHB 3B9AA 4KXKB 3PEUB 5LOZA 4N3CA 3NTPA 1W1TA 1FD9A 2KZTB 3RGCA 5FQ4A 1XRVA 4GA2A 4MGVA 2DIWA 2QY7A 3D9JA 5T8IA 3FEXA 2ZQVA 3ESKA 2DT3A 4WWOA 1F40A 2NXPA 4WJXA 2KCKA 4DZ3A 3S7BA 2X38A 5LFAA 1E8YA 4ZPWR 3WQWA 3CVPA 3FTYA 1H19A 4ATGA 2XRYA 4N2QA 4EZKA 4XI9A 4UQYA 4IT4A 4EZJA 1NWTA 3JQ0A 3O48A 1X6NA 4ODRA 2WMOA 5LCWJ 3PH0C 1RD6A 3AROA 1JWGA 4DRKA 1ELRA 3S7FA 2ESCA 1PINA 1FJDA 4MNLA 3D9PA 3QOKA 2DG4A 2PV3A 3KZ7A 3ARXA 1MHQA 5LX8A 3CHRA 2V0PA 1XGWA 3HVEB 4CEMA 5J90A 1GUVA 2R17C 4HARA 2WXNA 5DBKA 2OFNA 3T8MA 4UWLA 2CFZA 2KI3A 4CT0A 5G04C 5ARFA 3SZ7A 4HBEA 1FKJA 2WPVA 2PM7A 4I1OB 5JH8A 3RO2A 3IHYA 5C2YA 3D9IA 3MDYB 4HBOA 5BW8C 3SNXA 3CHQA 5FZQA 2JLBA 2J49A 3FH8A 5HW6A 4AJWA 4A1SA 4R7LA 4TNSA 2DG3A 4DH0A 3O5KA 4B94A 3QB2A 3PRBA 1W9UA 1UJKA 2MHKA 1E7VA 4ANUA 4GAAA 3CQCB 2CG3A 3UQ3A 3PZDA 3MX3A 3CGHA 4JEUA 4Z2LA 4WWNA 4GGQA 4JFIA 1H2UA 1FVFA 3G2UA 4AOFA 1E96B 3CHCA 2F2DA 5FZRA 3HYMB 4GYOA 4BX9A 4W9OA 3MA5A 2LKNA 5EX0A 1IQRA 1TCOC 5HW8A 2O92A 5HI7A 5M72A 4DROA 4FLBA 3AQUA 2YQ8A 1NWRA 4DI3A 3CK8A 1N1AA 2X3MA 1FKSA 2WXQA 2PV2A 4LGXA 3ZYMA 2OVBA 5BNWA 1XNFA 3KS2A 3LJ3A 1M5YA 4C9BB 1FKRA 1TEZA 3CQGB 3P1UA 3TCZA 1HKIA 1HS6A 3URZA 4HOUA 2IJGX 2IQCA 2A3AA 1HXVA 4TW7A 1X6LA 2RUCA 3QWPA 2DSWA 4DK5A 2ZQSA 2FKEA 3FUDA 2FO7A 2V4LA 2LAIA 4R5EA 3O5FA 3WL0A 2YINA 2MF9A 3BG1B 2AWIA 4L23A 4RSYA 3CVVA 1TFVA 4JHJA 3FU3A 3EHMA 4Z2GA 2KZTA 4ITZA 1SR0A 1A17A 3OXGA 4BWRA 3RO3A 3T5XA 3ULQA 5ANLA 3CGNA 2HO1A 3ZHEA 4L2YA 1W26A 1OWMA 3WL1A 3TL5A 3CV0A 2PPPA 3CKCA 1E8WA 4ODKA 1EPUA 4DRIA 3WKZA 1NZNA 3FUEA 5HTGA 4GYWA 3JUIA 3RJVA 4I43A 3ARRA 4TUUA 3RFWA 2VSNA 3ZEFA 4U85A 3B7SA 2DT1A 4DRHA 3QNKA 2XPYA 4W5UA 1FKHA 1HZ4A 3PNTB 4NQ0A 1HU3A 2L9BA 3FUIA 3TXNA 3APFA 3G6LA 2AXUA 4N5CA 4WKHA 3TGOA 3VLFA 1FKIA 4U86A 3O4ZA 5JJ7A 5G55A 3SD5A 3D9NA 4EQFA 3CVLA 4HXIA 3VTYA 1U3CA 3S2AA 2RD0A 1HJXA 3FTVA 3B7RL 3FEYA 3OXFA 1ZCNA 2YHCA 3KEZA 2A4ZA 4GZ5A 4MAVA 1ZBPA 3I6CA 4JC8A 4U0SA 5HUAA 2MOWA 2WK2A 3TC5A 4DLOA 2LJ4A 2RUQA 4U0UA 5CHEE 4WUYA 5EKQD 5T3RA 4I2ZA 3SF4A 4URKA 1UN9A 3B13A 1NA3A 3IHZA 4L72B 2MLZA 3IBEA 2E0IA 1WY6A 2JEKA 3OXLA 3ASHA 2AOSA 3IV0A 2R59A 4FHJA 3FTZA 5ARGA 4Q7NA 2Y4TA 3PVLA 3W4RA 5KJLA 3FUHA 4E6HA 1C9HA 1ELKA 3LEWA 2WM0A 3JYJA 1NP7A 2VSYA 2I9CA 2C0LA 1OWOA 3I3NA 2QF8A 4NACA 2XPBA 4Z2JA 2KATA 3SBSA 3D9LA 2VGXA 4LAXA 3UI4A 4ML4A 1EQ3A 2DSUA 1W1PA 4P8UA 4Z2IA 1X5BA 4KVOA 1NWUA 3CVWA 1UN8A 1W9PA 2X6HA 1NH6A 3L13A 3FU5A 2XP8A 3OOBA 4J8EA 1OWQA 1QPLA 4O6FA 1Z3YA 3U3WA 3UX4A 2C0MA 3O5QA 5E75A 4PTMA 3APCA 4FLHA 1VDYA 3G2VA 1JNEA 1Q6IA 1FFRA 2N87A 3NF1A 3FH5A 1JNTA 1B89A 4K03A 4A1GA 1OUVA 3QOUA 1HO8A 2A3CA 5EX3A 4BTAA 3DBSA 2LSUA 3E4BA 4J0UA 3FWVA 3G6MA 4BSXA 1JNSA 1FKBA 1HKJA 3L16A 4BTBA 1HJVA 2DSVA 4MLPA 2PM6A 5G04J 3D3MA 2EQXA 3CR3A 5KJNA 2LGOA 3I4RB 1FVHA 2RURA 3RM4A 1F8AB 4MNJA 3KACA 4Z2HA 3TG4A 5A6CA 1ZBCA 3ARZA 3Q47B 3PNLB 4XZ4A 4JA9A 4LUNU 3FTXA 4MTVA 1LG2A 3BG0B 3AS4A 3WD3A 4B8AA 2XCBA 4MKTA 1NSGA 3ZW3A 5LCWC 4I6JA 2J08A 4MS6A 5FQ7A 2WXJA 2J4BA 4A55A 3MZLB 4ANWA 4G1TA 3PRAA 3ZYLA 2XPAA 5FJYA 4IN3B 4J8DA 3CVUA 3CHOA 2AWGA 3ZXSA 3LPZA 3I4GA 1HXIA 4Z2KA 3RIBA 5AIJA 4FU3A 4J6IA 3ODKA 4B8CB 5GPGA 5JJTA 3PE4A 2MLXA 4JFJA 3UQAA 2R5SA 4HORA 2RG8A 5DO2A 4CCAA 4U04A 5BPPA 3ARSA 3CGMA 2FI7A 4G50A 4KZ0A 1E9LA 1N54A 2WXLA 3WD0A 4KMOA 3ZPJA 2F4EA 5KJMA 2KC7A 4PH4B 5GQBA 1E7UA 2A3EA 2UWJG 4FP7A 2HYZA 4ZPTR 4UWHA 1OWNA 1HKMA 1OWPA 2HR2A 4L2LA 4LAWA 4U84A 3LY9A 1U79A 3AS3A 2WQ6A 4NRHB 1W3BA 3UQIA 4KVMA 1OGGA 3HIZA 4YNDA 4FJZA 3ARVA 1LG1A 4ODOA 4BF8A 4LEUA 2E2EA 2XCCA 4RG9A 4PS3A 4MRUA 3APDA 2L0IA 3CSTA 1BPOA 2PBCA 4DT4A 4H7YA 3TG5A 4JHKA 2VYIA 5KCMA 4L7TA 5HQ8A 4MPKA 2GRMA 2ITKA 2VSOE 2XP9A 4ANXA 4DLQA 4PS7A 4GZ6A 4EZLA 4GYYA 3MKRA 2ZU6B 2VCDA 2NC9A 2L6JA 4N3AA 3IKDA 1UG3A 3NI6A 4F7AA 1T11A 1SZAA 3CSFA 2DT0A 4A3VA 3ONKA 3CHSA 1GOIA 4F1SA 4NNRA 1DNPA 4DI4A 4XX5A 3WQVA 3U4TA 3U9WA 3O5OA 3KCEA 2AXVA 2K8IA 4DPRA 2OV8A 2WVIA 3KAIA 3FULA 1ZU8A 3FUMA 4AXHA 4GA0A 5HWBA 4S3KA 4OVUA 3Q49B 3LDZA 2PI6A 4GZ3A 4NURA 2BTDA 3UI5A 4MNMA 3B7XA 3AS8A 3ARTA 5AENA 3FU0A 2J07A 4BT9A 3O5JA 3SBTB 4DRPA 4FAPA 3FU6A 4CRWA 1S0PA 3ZYQA 3CVXA 5C1DA 1UR8A 2IOSA 3P2BA 1Z6TA 4CGVA 2MLYA 3AS5A 5FQ6A 1PAQA 2XPZA 3O5DA 2VGXB 3NZSA 2OOEA 3FTUA 4YVOA 4DJAA 4W9QA 2IF4A 4JL0A 4YVQC 1IHGA 3IK8A 4MSPA 3FAPA 2XGSA 5G05J 1Y0OA 3KAFA 5EDSA 3SI5A 2DG9A 5JHBA 1J4RA 3FTSA 2GRLA 2IOLA 3JYSA 1WB0A 3ESLA 3LY7A 3U64A 4RG6A 1E6PA 4MNKA 3NRKA 4WKFA 4AEZC 4G23A 3ML9A 4F3VA 3WIJA 4OYSA 3MKQA 2LO6A 3GW4A 1DVPA 1JVWA 3CKBA 2Q5AA 1D7JA 1E6NA 4IPXA 3ZFWA 2VJ8A 5ENNA 3QK0A 3B7UX 3JYMA 2IFUA 2OVFA 5D75A 4ODQA 3O5IA 2P58C 3L22A 3ASGA 2ZQTA 3FXYA 4W9PA 4WNFA 4ACLA 2XEVA 1NWSA 1L1PA 4DWSD 3ARQA 1MQSA 2XRZA 3R7RA 3QWVA 2XP4A 1IQUA 3AS1A 4GA1A 2WB2A 3UMVA 2WXMA 1LF8A 2LSVA 4URIA 3EIJA 2XGMA 3S7JA 3LCAA 4I9EA 4G2VA 3FFLA 4UI9C 5BV0A 1KFWA 1Y8MA 3PEVB 4DRMA 2WXRA 4IQCA 4DWSA 1FCHA 2YHEA 1IX5A 4FHKA 3QWWA 3GZ2A 1B6CA 5JHAA 3B7TA 4HS2A 3TXMA 1NMWA 2PPNA 2XP3A 2RSEA 4IRUA 4RVBA 4U63A 2VTBB 5CMYA 3I5PA 4W9RA 4ABNA 4AY5A 3FHEA 4DRQA 5LP0A 1WAWA 1SYTA 4APOA 4QFVA 1LJYA 4V3IA 4KR0B 4WK9A 2XQ0A 4FULA 4UWKA 3MEKA 1GPFA 4G26A 4XE0A 2FULA 1E6ZA 1HH8A 1ZBVA 5J6EA 3ALGA 3UT7A 1ZL1A 4L3NA 1YATA 2WXFA 4GZDA 2DCPA 4C0MA 4JZYA 2WXPA 4B0ZA 3ZIMA 5BT1A 3LY8A 3RU0A 2M08A 3KAHA 4KQZA 1E8XA 2WLZA 2DPEA 3PE3A 2I2OA 3UF8A 4C0EA 2RUDA 1EIBA 2FBNA 2IUZA 1XHGA 3OA5A 3DPDA 3Q5MA 2DT2A 1Q1CA 1WM5A 3LXUX 1W1YA 3FUKA 2KCVA 3ZYKA 2I1KA 4DRNA 3CHEA 4ODMA 4Y6CA 4G25A 1SQMA 2WQ7A 2KCLA 4UWGA 3WD1A 2M1IA 4FADA 4KYOB 5AJDA 4TW6A 2J4DA 2NSZA 3UQBA 4CDNA 2C2LA 1LQ0A 3KAGA 4JFKA 3PRDA 1R9HA 1H0GA 5DITA 4JXTA 4R0XA 4ZPVR 4GIVA 2L2SA 5GPRA 1OWLA 1HF8A 4CDRA 4EBAG 2VGYA 3K9IA 1LL7A 1WNOA 2WMNA 2JZVA 4GPKA 4XIFA 2UY1A 4I1MA 3CH9A 3PUKA 3PRZA 2VQ2A 2XP7A 2ZQUA 3LKUA 1UJJA 1H0AA 2KO7A 3FY1A 4LAYA 1INZA 4ILGA 3N71A 4UI9K 5G2NA 3WXXA 1LL4A 3TJPA 1HFAA 1YA0A 4AY6A 5DIUA 3O5PA 1D7IA 1J6YA 2X6IA 3KABA 2Y78A 4G2PA 2CG2A 3CLJA 4JPSA 4LRZA 5HW7A 3O5EA 1EHNA 1QZ2A 4HFGA 4GCNA 4APFA 3MV2B 4AIFA 3CIAA 4HVBA 4XKBA 3NZUA 1EDQA 3RRNB 3ML8A 3FUJA 3UI6A 3FTWA 3GZSA 2ZR4A 1KT0A 3VTXA 4FN2A 2G8ZA 3ZRHA 3VAWA 4U07A 3NQPA 5FZSA 5HKGA 2F21A 3G2SA 1Y6IA 4FA6A 2ZR6A 3JQ1A 2OLHA 4Q22A 1ZBWA 4ME2A 1FAPA 2L0TB 3QC1A 3ALFA 2O9OA 2Y4UA 1FKDA 5I98A 3ARYA 4O2TA 3ZGQA 2XGOA 2V8SE 4L1BA 2A3BA 4QIBA 1JPLA 2X6JA 1EYHA 4ODLA 2CHZA 2AXZA 3B8SA 4UQXA 4ZS6A 2IU1A 4FJYA 2GW1A 1P5QA 1SZ9A 3WD2A 1JUQA 2I6HA 3KD7A 2KFWA 3MCXA 4G11A 4E85A 4N3BA 5DF0A 3B9EA 3SGHA 3CK7A 4ILIA 4GB9A 3OTNA 3O5MA 3QAQA 3UT4A 1U3DA 3O5GA 4HOSA 4LERA 5BUZA 3UPVA 1D7HA 3MGBA 2IONA 3CVNA 1J4HA 4PDXA 2PZIA 1FKTA 3ASFA 5HT1A 4IULA 3EDTB 3MV3B 3KAEA 4I1AA 3U66A 3T5VA 2LNIA 3S7DA 3ZN3A 4WNEA 4TX0A 3EHNA 1UR9A 1K9TA 4Q94A 1W9VA 4CDMA 1HG2A 4JFLA 3CHFA 2KGJA 3CHDA 3AU4A 3TDBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JVW A;  3CKB A;  3RGC A;  2Q5A A;  1D7J A;  3RKV A;  4IPX A;  5AYW D;  4GA2 A;  3ZFW A;  4MGV A;  1FKG A;  3JYM A;  2XP8 A;  4GCO A;  1D6O A;  2IFU A;  3OOB A;  5D75 A;  4J8E A;  4ODQ A;  2ZQV A;  1QPL A;  4O6F A;  3ESK A;  3EY6 A;  3O5I A;  2P58 C;  2KE0 A;  2ZR5 A;  3ASG A;  2ZQT A;  1EQ3 A;  1F40 A;  3U3W A;  2KCK A;  2QFC A;  3O5L A;  2C0M A;  4W9P A;  4WNF A;  4DIP A;  3O5Q A;  1Q6H A;  4DZ3 A;  2XEV A;  3S7B A;  1L1P A;  3ASD A;  1Q6I A;  2FEZ A;  2N87 A;  1KT1 A;  3NF1 A;  2AVP A;  3CVQ A;  3QWV A;  4I9C A;  2XP4 A;  1JNT A;  3UUX A;  3CVP A;  4GA1 A;  1B89 A;  4N2Q A;  4XI9 A;  2LSV A;  1OUV A;  4UQY A;  3QOU A;  3LUO A;  4JFM A;  4BT8 A;  3O48 A;  2XGM A;  3S7J A;  3LCA A;  5EX3 A;  4BTA A;  4I9E A;  4G2V A;  3FFL A;  4UI9 C;  4ODR A;  4HOT A;  2LSU A;  5D0Q D;  1Y8M A;  5LCW J;  5B8I C;  3E4B A;  4J0U A;  4DRM A;  3FWV A;  2PPO A;  3H9R B;  4IQC A;  4DRK A;  1FCH A;  1ELR A;  3S7F A;  1JNS A;  2V5F A;  1FKB A;  1PIN A;  1FJD A;  3QWW A;  4N19 A;  3GZ2 A;  1B6C A;  2DG4 A;  4BTB A;  2PV3 A;  3KZ7 A;  1NMW A;  4UQZ A;  4TYO A;  2PPN A;  2XP3 A;  2RSE A;  5G04 J;  3KAD A;  5KJK A;  4W9R A;  5KJN A;  4ABN A;  4AY5 A;  2LGO A;  2M2A A;  1PC2 A;  4DRQ A;  3GZ1 A;  2RUR A;  1F8A B;  5DBK A;  2OFN A;  4APO A;  1EYM A;  3KAC A;  2KI3 A;  1ROT A;  5G04 C;  4HOQ A;  5ARF A;  5A6C A;  3TG4 A;  3MEK A;  3SZ7 A;  4G26 A;  1FKL A;  4JYS A;  2FF4 A;  4AM9 A;  1FKJ A;  3Q47 B;  2WPV A;  2VN1 A;  4JA9 A;  3RO2 A;  2OND A;  3MDY B;  5BW8 C;  4WNG A;  3AS4 A;  3CK9 A;  1HH8 A;  5J6E A;  4C02 B;  2J9Q A;  5FZQ A;  1YAT A;  2JLB A;  1KLX A;  2XCB A;  5HW6 A;  4WND A;  4G24 A;  1NSG A;  4A1S A;  5LCW C;  4H7X A;  4TNS A;  2DG3 A;  4DH0 A;  3O5K A;  2LPV A;  4ODP A;  5BT1 A;  3LY8 A;  3RU0 A;  2M08 A;  3KAH A;  4B94 A;  4J4O A;  3PRB A;  3IKG A;  5HWC A;  4G1T A;  2MHK A;  2XPA A;  5FJY A;  4IN3 B;  4J8D A;  3PE3 A;  3UF8 A;  2RUD A;  5BXJ A;  2AWG A;  3LPZ A;  2FBN A;  3UQ3 A;  1HXI A;  3PA7 A;  3QKY A;  4JHR A;  3Q5M A;  4GGQ A;  3RIB A;  1Q1C A;  4JFI A;  1WM5 A;  1E96 B;  1QQE A;  4N39 A;  2F2D A;  5FT9 A;  2KCV A;  3ODK A;  5FZR A;  5GPG A;  3HYM B;  4GYO A;  5G05 C;  5D0O D;  5JJT A;  2UY1 B;  2MNT A;  4DRN A;  3PE4 A;  2MLX A;  4W9O A;  3MA5 A;  4ODM A;  4JFJ A;  4Y6C A;  3UQA A;  4G25 A;  2LKN A;  5EX0 A;  2R5S A;  5JJ6 A;  1TCO C;  4HOR A;  5HW8 A;  1BKF A;  2KCL A;  5HI7 A;  4QT2 A;  5M72 A;  2M1I A;  4KYO B;  4DRO A;  4TW6 A;  3UQB A;  2C2L A;  3KAG A;  4U04 A;  4JFK A;  4QT3 A;  3PRD A;  1R9H A;  3CGM A;  5DIT A;  2YQ8 A;  3CK8 A;  2FI7 A;  4G50 A;  1N1A A;  4R0X A;  4GIV A;  2L2S A;  1TJC A;  1FKS A;  3ZHE B;  4CDR A;  4I2W A;  2VGY A;  3K9I A;  3FP3 A;  3ZPJ A;  2F4E A;  5KJM A;  2KC7 A;  2PV2 A;  1FKF A;  3TDB A;  2JZV A;  2UWJ G;  5BNW A;  1XNF A;  4GPK A;  4XIF A;  3GYZ A;  2UY1 A;  2HYZ A;  4J4N A;  3KS2 A;  1IYG A;  2HR2 A;  1M5Y A;  4LAW A;  4U84 A;  1FKR A;  3LY9 A;  2VQ2 A;  1U79 A;  2XP7 A;  2ZQU A;  3LKU A;  2KO7 A;  2UZ5 A;  2XP6 A;  4LAY A;  3N71 A;  4UI9 K;  3WXX A;  4NRH B;  1W3B A;  3TCZ A;  3UQI A;  3URZ A;  1YA0 A;  4CGW A;  3O5R A;  4HOU A;  4AY6 A;  1HXV A;  3BEE A;  5DIU A;  4TW7 A;  2RUC A;  2DBA A;  3QWP A;  3O5P A;  1D7I A;  4YND A;  1J6Y A;  1YW5 A;  3KAB A;  4ODO A;  2Y78 A;  4BF8 A;  4LEU A;  2E2E A;  2XCC A;  3Q4A B;  4RG9 A;  4G2P A;  2ZQS A;  2FKE A;  5A7D B;  2FO7 A;  5HW7 A;  2PBC A;  3O5F A;  4DT4 A;  2MF9 A;  3O5E A;  2FAP A;  1QZ2 A;  4H7Y A;  3TG5 A;  4GCN A;  2VYI A;  3MV2 B;  2XPI A;  2PV1 A;  1ELW A;  4AIF A;  1QPF A;  5HQ8 A;  1Q6U A;  4ITZ A;  2ITK A;  1A17 A;  3OXG A;  3UI6 A;  4BWR A;  2RQS A;  2XP9 A;  4LAV A;  1ROU A;  2KR7 A;  2WQH A;  2ZR4 A;  4U0Z A;  4GZ6 A;  4GYY A;  1KT0 A;  3RO3 A;  3VTX A;  4FN2 A;  3MKR A;  3VAW A;  3ULQ A;  4U07 A;  5FZS A;  5HKG A;  2F21 A;  3Q15 A;  2VCD A;  3WH0 A;  2NC9 A;  3CGN A;  2HO1 A;  3ZHE A;  2L6J A;  4N3A A;  2ZR6 A;  3IKD A;  1W26 A;  1PBK A;  3NI6 A;  4DRJ A;  2D9F A;  1T11 A;  4ME2 A;  1FAP A;  1FKK A;  5DIV A;  4IQ2 A;  3CV0 A;  2PPP A;  1J4I A;  3CKC A;  4ODK A;  4NNR A;  4DRI A;  1NZN A;  5HTG A;  2Y4U A;  3U4T A;  4GYW A;  3RJV A;  5FTP A;  3O5O A;  3KCE A;  3RFW A;  1FKD A;  5I98 A;  1NMV A;  2VSN A;  2K8I A;  4TW8 A;  4U85 A;  1ZK6 A;  5CCM A;  4DRH A;  5CCL A;  1FKH A;  3TAX A;  4O2T A;  3ZGQ A;  1HZ4 A;  3KAI A;  4NQ0 A;  3JXV A;  2XGO A;  4GA0 A;  5HWB A;  2XP5 A;  4QIB A;  4ODL A;  4J8F A;  4N5C A;  3TGO A;  3Q49 B;  4XI0 A;  1FKI A;  4GZ3 A;  4U86 A;  5JJ7 A;  3UI5 A;  4UQX A;  3B7X A;  4EQF A;  3CVL A;  3AS8 A;  3VTY A;  1NA0 A;  2GW1 A;  1P5Q A;  4BT9 A;  3PDN A;  3O5J A;  5DIZ A;  3GPK A;  3OXF A;  4DRP A;  4FAP A;  2I6H A;  3KD7 A;  4KBQ A;  5C1D A;  2KFW A;  1ZCN A;  2YHC A;  2PL2 A;  4GZ5 A;  4DZ2 A;  1ZBP A;  3I6C A;  4U0S A;  5HUA A;  3TC5 A;  2LJ4 A;  4I17 A;  1ZU2 A;  4N3B A;  2RUQ A;  4U0U A;  4CGV A;  5CHE E;  4WUY A;  5EKQ D;  2Q7F A;  2MLY A;  3CK7 A;  3IEG A;  4I2Z A;  3SF4 A;  2PQN A;  3AS5 A;  3O5M A;  1NA3 A;  3IHZ A;  1WAO 1;  3O5D A;  3O5G A;  2MLZ A;  4UI9 J;  2VGX B;  4Y6W A;  2MPH A;  2OOE A;  4YVO A;  4HOS A;  3OXL A;  2IF4 A;  4W9Q A;  3ASH A;  4JL0 A;  4YVQ C;  1IHG A;  3IK8 A;  4MSP A;  3FAP A;  2BUG A;  3UI4 A;  1BL4 A;  3UPV A;  1D7H A;  2XGS A;  3LYA A;  3CEQ A;  5G05 J;  5ARG A;  1Y0O A;  3KAF A;  3CVN A;  2DG9 A;  1J4H A;  2Y4T A;  3QDN A;  2PZI A;  4JA7 A;  1J4R A;  1FKT A;  3ASF A;  4N2S A;  3JYS A;  5HT1 A;  5KJL A;  3EDT B;  1C9H A;  3MV3 B;  3LY7 A;  3KAE A;  4RG6 A;  4I1A A;  3JYJ A;  2LNI A;  2VSY A;  3S7D A;  3ZN3 A;  4WNE A;  4TX0 A;  2C0L A;  2PQR A;  3NRK A;  1A7X A;  4G23 A;  4ODN A;  3R9A B;  2XPB A;  2KAT A;  4KXK B;  4F3V A;  4JFL A;  4N3C A;  2KGJ A;  2VGX A;  3NTP A;  3GW4 A;  4LAX A;  1FD9 A; 
#chains in the Genus database with same CATH topology
 3AU5 A;  3CHM A;  2RFM A;  2EIL E;  4PS8 A;  3RKV A;  5AYW D;  1N11 A;  2XHE A;  1FKG A;  4GCO A;  1D6O A;  4A3T A;  3EY6 A;  1JWF A;  4LG6 A;  2KE0 A;  2ZR5 A;  3G2W A;  4DUI A;  3C5R A;  2P9K G;  4I6G A;  5EYL A;  2QFC A;  3O5L A;  3PR9 A;  4ANV A;  4FC8 A;  4DIP A;  1OY3 D;  1OGB A;  3HVE A;  1Q6H A;  2FDM A;  3ASD A;  2FEZ A;  1KT1 A;  4EHM A;  2H6I A;  3C3R A;  2AVP A;  3CVQ A;  4I9C A;  3DXK G;  1HE8 A;  1HKK A;  2QYU A;  3UUX A;  4K0R A;  4BY6 A;  3DSW A;  3X2Q E;  4XAK A;  1Z3X A;  3AG3 E;  3LUO A;  4JFM A;  5FQ8 A;  4BT8 A;  3LS8 A;  2Y3A A;  5FIO A;  3BXW A;  5E76 A;  4GMJ A;  4AP2 A;  4HOT A;  3RME A;  2MRI A;  4EPZ A;  5D0Q D;  5B8I C;  5H7P A;  2PPO A;  3H9R B;  2VSX E;  2V5F A;  4N19 A;  3HXB A;  4DX7 D;  3ZKJ A;  2QC9 A;  1TNY A;  4UQZ A;  3HXD A;  2P2C P;  4TYO A;  1W1V A;  4WWP A;  2XS1 A;  3ARW A;  4EBA A;  1WG0 A;  3KAD A;  5KJK A;  1LTX A;  4HB5 A;  2M2A A;  1PC2 A;  3GZ1 A;  4P8V A;  4AV7 A;  3ARU A;  1HX8 A;  4BSZ B;  1EYM A;  1ROT A;  4HOQ A;  2H6G A;  2P9L G;  2WXK A;  4WAF A;  1FKL A;  2FF4 A;  1KPS B;  4JYS A;  3AS2 A;  4F53 A;  4IYP A;  4AM9 A;  3HRA A;  2M63 A;  3SY2 A;  1DC2 A;  2VN1 A;  4LCT A;  4TV3 A;  3EIQ C;  3FUN A;  2OND A;  1E44 A;  4WNG A;  4D10 C;  3CK9 A;  2IEJ A;  4C02 B;  2J9Q A;  3WD4 A;  4OVV A;  1KLX A;  3IKO B;  4WND A;  1TNU A;  4G24 A;  3RRU A;  5FIN A;  3LVQ E;  4H7X A;  3VLD A;  1DCE A;  2J09 A;  2ZXW E;  2LPV A;  1H6K A;  2P4V A;  4IT6 A;  4ODP A;  1H6P A;  1EF1 C;  4B89 A;  1BD8 A;  4J4O A;  4Q69 A;  3IKG A;  2R05 A;  2A5U A;  5HWC A;  4DWS C;  3ABK E;  2F23 A;  5BXJ A;  2CHW A;  5CBO A;  3PA7 A;  2A5E A;  3LVR E;  3QKY A;  4JHR A;  1N4P A;  4QZV B;  4I6E A;  4S3J A;  3FH7 A;  3AS0 A;  4TRQ A;  2GGF A;  1QQE A;  4N39 A;  5FT9 A;  3ZVV A;  5CBN A;  5G05 C;  5D0O D;  2MNT A;  2UY1 B;  3UIN C;  4BEP A;  3RRM B;  5JJ6 A;  3FUF A;  1BKF A;  4QT2 A;  4O60 A;  4G8K A;  4QT3 A;  4DX1 A;  1GW6 A;  1FPP A;  3CHP A;  5EIB E;  2CHX A;  3UIP C;  2YBU A;  3Q78 A;  3ENE A;  1TJC A;  2GRN B;  3KSQ A;  3ZHE B;  4I2W A;  1D2K A;  3D9M A;  5ENR D;  3ULE G;  3FP3 A;  3E30 A;  1FKF A;  2XEN A;  3FDH A;  3MYV A;  2X6F A;  3R7Q A;  2R2L A;  3ASO E;  5BV1 A;  3GYZ A;  1PY1 A;  2BED A;  1QNF A;  2JAB A;  4J4N A;  3RM9 A;  1IYG A;  3ASN E;  4Q96 A;  2EIN E;  1O6I A;  3MJW A;  3VLE A;  3ARP A;  4U8H A;  1FFQ A;  2UZ5 A;  4KT6 B;  2XP6 A;  4GTR A;  4NSB A;  1ZBK A;  3ONL A;  1CTN A;  4AVX A;  3CZ8 A;  4CGW A;  2B31 A;  3L08 A;  3O5R A;  3BEE A;  4HRM B;  3G2T A;  2DBA A;  3RSE G;  4JW1 A;  1YW5 A;  3CVY A;  2X6K A;  4EEC A;  3Q4A B;  2WLY A;  4BER A;  4HLE A;  1E90 A;  2G41 A;  4YDY A;  5A7D B;  4RLY A;  5FWQ A;  4L9P A;  1JND A;  1E15 A;  2FAP A;  1MX4 A;  5CRU A;  2XPI A;  4KZC A;  1UW4 B;  2PV1 A;  1ELW A;  1QPF A;  3PRE A;  5T4Y A;  5HBF A;  1Q6U A;  5AJL A;  3QAR A;  3AAA C;  5A23 A;  2B0O E;  2RQS A;  4DWS B;  3EU5 A;  4LAV A;  1ROU A;  2KR7 A;  2BF0 X;  2WQH A;  4U0Z A;  1OXJ A;  2LAH A;  1HG5 A;  1H0I A;  1LL6 A;  3L6A A;  1ZB5 A;  4ATZ D;  3SHF A;  3Q15 A;  3WH0 A;  3D9O A;  1IKN D;  4U96 D;  4AY1 A;  3SFX A;  2VTB A;  3UT8 A;  1PBK A;  4B93 B;  4U7E B;  4DRJ A;  2D9F A;  2PNN A;  2WXG A;  4BX8 A;  4Z68 A;  5DEZ A;  1FKK A;  5DIV A;  4IQ2 A;  1J4I A;  4GML A;  4PUC A;  4P29 A;  1H2T C;  5CMW A;  4WKA A;  3L54 A;  1O1R A;  3EJN A;  4JEH A;  3DPY A;  5FTP A;  1N4Q A;  2R02 A;  3TWQ A;  5B1A E;  2DSZ A;  1NMV A;  3IHV A;  4TW8 A;  4UUC A;  1ZK6 A;  5CCM A;  4P8W A;  5CCL A;  3TAX A;  5ANR A;  4WIW A;  3JXV A;  3RK6 A;  4F1P A;  1E8Z A;  1EDU A;  1TJF A;  3OAW A;  2XP5 A;  2HM8 A;  2WXH A;  2KM4 A;  1E6R A;  4J8F A;  1Z5S C;  3HDX A;  3Q73 A;  4XI0 A;  2AW6 A;  4O1P A;  3HHM A;  1ITX A;  1VF8 A;  4XKC A;  1NA0 A;  3PDN A;  5DIZ A;  3GPK A;  3UM1 A;  3PZ4 A;  4NZC A;  3PUJ A;  2YNQ A;  4KBQ A;  4JVS A;  4LNB A;  3PS6 A;  5D66 A;  1L5J A;  2I1J A;  2PL2 A;  4CT4 A;  3B9D A;  4P8X A;  2YBT A;  4DZ2 A;  5J08 A;  3MKQ B;  1OCC E;  4I17 A;  2Y1L E;  1ZU2 A;  4M3O A;  2WXO A;  1H2V C;  3ZNG A;  2Q7F A;  3IEG A;  3AG4 E;  4UWF A;  2PQN A;  1WAO 1;  4J8S A;  3JCK C;  4UI9 J;  4GTQ A;  4Y6W A;  3SFZ A;  1QBQ A;  2MPH A;  3D9K A;  4DX2 A;  2WXI A;  2BUG A;  1BL4 A;  3RM8 A;  3LYA A;  3CEQ A;  3NAW A;  4HRN A;  2ILR A;  2CFU A;  3QDN A;  4JA7 A;  4N2S A;  1WDY A;  4GZC A;  4BFR A;  1OCO E;  1N52 A;  2ZGG A;  2WM9 A;  1N4R A;  3FY4 A;  2PQR A;  3L17 A;  3JUE A;  1A7X A;  4GU5 A;  3C98 A;  3QJZ A;  4ODN A;  3R9A B;  4C48 B;  1HJW A;  4ACK A;  4ILH B;  3B9A A;  4KXK B;  3AJI A;  3PEU B;  5LOZ A;  1YMP A;  2XS8 A;  4N3C A;  3NTP A;  1W1T A;  1FD9 A;  2KZT B;  3RGC A;  1V55 E;  5FQ4 A;  1XRV A;  4GA2 A;  4MGV A;  2DIW A;  2KBX A;  3GU0 A;  2QY7 A;  3D9J A;  5T8I A;  3FEX A;  2ZQV A;  3ESK A;  3NBN B;  2DT3 A;  4WWO A;  1F40 A;  2NXP A;  4WJX A;  2KCK A;  4DZ3 A;  1GRJ A;  3S7B A;  4N5Q A;  2X38 A;  5LFA A;  1E8Y A;  4ZPW R;  3WQW A;  3CVP A;  3FTY A;  1H19 A;  4ATG A;  2XRY A;  4N2Q A;  4EZK A;  4XI9 A;  1NI1 A;  4TXP A;  4UQY A;  4IT4 A;  4EZJ A;  1NWT A;  1IXV A;  3JQ0 A;  3O48 A;  1X6N A;  4ODR A;  2WMO A;  4ZHB A;  5LCW J;  3PH0 C;  1RD6 A;  3ARO A;  1JWG A;  4DRK A;  1ELR A;  3S7F A;  4HQD A;  2ESC A;  1PIN A;  1MX2 A;  1FJD A;  4MNL A;  4LNU D;  3D9P A;  3QOK A;  2DG4 A;  2PV3 A;  3KZ7 A;  1MJ0 A;  3ARX A;  5AAR A;  1MHQ A;  2P9N G;  5LX8 A;  3CHR A;  2V0P A;  3EIP A;  1XGW A;  3HVE B;  4CEM A;  5ITZ F;  5J90 A;  1GUV A;  2R17 C;  3TWS A;  2HE0 A;  3E34 A;  2GRR B;  4HAR A;  2WXN A;  5DBK A;  2OFN A;  3T8M A;  4UWL A;  2CFZ A;  2KI3 A;  2XEH A;  4CT0 A;  5G04 C;  5ARF A;  1KZP A;  2J8S D;  4U8V D;  3SZ7 A;  4HBE A;  1FKJ A;  3HXF A;  3JXI A;  2WPV A;  2PM7 A;  5HS0 A;  1QYM A;  4I1O B;  5JH8 A;  3RO2 A;  3IHY A;  3DEO A;  5C2Y A;  3D9I A;  3MDY B;  4HBO A;  5BW8 C;  3SNX A;  3CHQ A;  5FZQ A;  2JLB A;  2J49 A;  3FH8 A;  5HW6 A;  4AJW A;  4A1S A;  4R7L A;  4TNS A;  2DG3 A;  4DH0 A;  3O5K A;  3NB2 A;  4QQI A;  4B94 A;  2OCC E;  3QB2 A;  3PRB A;  2ZIR A;  1W9U A;  2GRQ B;  1UJK A;  2MHK A;  1E7V A;  4ANU A;  4GAA A;  3CQC B;  2CG3 A;  1S63 A;  3UQ3 A;  3PZD A;  3MX3 A;  2MYO A;  3CGH A;  4JEU A;  1Q2Z A;  5KNH D;  4Z2L A;  4WWN A;  5HRY A;  4GGQ A;  4HI8 A;  3UTM A;  4JFI A;  1H2U A;  1FVF A;  3G2U A;  4AOF A;  1E96 B;  3CHC A;  2F2D A;  1N94 A;  2XZT G;  5FZR A;  5ENQ D;  2EIM E;  3HYM B;  4GYO A;  4BX9 A;  4W9O A;  3MA5 A;  1MX6 A;  2LKN A;  5EX0 A;  1IQR A;  1TCO C;  5HW8 A;  2O92 A;  5HI7 A;  2Y0B G;  5CRV A;  5M72 A;  4DRO A;  4FLB A;  3AQU A;  5AQB A;  2YQ8 A;  1NWR A;  4DI3 A;  3CK8 A;  1N1A A;  2X3M A;  1FKS A;  3UI2 A;  2WXQ A;  2PV2 A;  4LGX A;  3ZYM A;  2OVB A;  5BNW A;  4O1O A;  1XNF A;  1KZO A;  1NFI E;  3KS2 A;  3LJ3 A;  1M5Y A;  4C9B B;  1FKR A;  3BMB A;  3EHR A;  1TEZ A;  3CQG B;  3P1U A;  3TCZ A;  1HKI A;  1HS6 A;  3URZ A;  3J5P A;  2IJG X;  2IQC A;  4HOU A;  1AWC B;  2A3A A;  4TW7 A;  1X6L A;  2RUC A;  1HXV A;  3QWP A;  2DSW A;  4DK5 A;  2V5Q C;  3UM2 A;  2NYJ A;  3W9F A;  1SVX A;  2ZQS A;  2FKE A;  5EYP F;  2PN0 A;  3FUD A;  2FO7 A;  3J5Q B;  2V4L A;  2H6H A;  2LAI A;  4R5E A;  3O5F A;  3WL0 A;  2YIN A;  2MF9 A;  3BG1 B;  2AWI A;  4L23 A;  4RSY A;  3CVV A;  1TFV A;  4JHJ A;  3ABL E;  3FU3 A;  3EHM A;  4Z2G A;  1BLX B;  2KZT A;  4ITZ A;  1SR0 A;  1A17 A;  3OXG A;  4BWR A;  3RO3 A;  3T5X A;  1BU9 A;  3ULQ A;  1BI7 B;  5ANL A;  3CGN A;  2HO1 A;  3ZHE A;  4L2Y A;  1JCS A;  1W26 A;  1OWM A;  2V4H C;  4X8Q A;  1TNZ A;  1O5M A;  3V30 A;  3WL1 A;  5ENO D;  3TL5 A;  3CV0 A;  3EUV A;  2PPP A;  1NL4 A;  3CKC A;  1E8W A;  4ODK A;  1EPU A;  4DRI A;  3WKZ A;  1NZN A;  3FUE A;  5HTG A;  3DWL G;  4GYW A;  3JUI A;  3RJV A;  4I43 A;  3ARR A;  4TUU A;  3RFW A;  2VSN A;  3ZEF A;  4U85 A;  3B7S A;  2DT1 A;  4DRH A;  3QNK A;  2XPY A;  1FKH A;  4W5U A;  1HZ4 A;  3PNT B;  4NQ0 A;  1HU3 A;  5JA4 D;  2L9B A;  3FUI A;  3TXN A;  3APF A;  3C72 A;  3G6L A;  2AXU A;  1TN7 A;  4N5C A;  5CEC B;  4WKH A;  3TGO A;  2ETB A;  4U95 D;  3VLF A;  1FKI A;  4U86 A;  3O4Z A;  4GMR A;  5JJ7 A;  5G55 A;  3SD5 A;  3D9N A;  4EQF A;  3CVL A;  1A5E A;  4HXI A;  3VTY A;  1U3C A;  3S2A A;  3ULY A;  1AP7 A;  2RD0 A;  1HJX A;  5CER B;  3FTV A;  3B7R L;  3FEY A;  3OXF A;  2DZN A;  1ZCN A;  2YHC A;  3KEZ A;  2A4Z A;  4GZ5 A;  3F6Q A;  4MAV A;  1ZBP A;  3I6C A;  4JC8 A;  4U0S A;  5HUA A;  2MOW A;  2WK2 A;  3TC5 A;  4DLO A;  2LJ4 A;  2RUQ A;  4U0U A;  3Q9N C;  5CHE E;  4WUY A;  5EKQ D;  5T3R A;  4I2Z A;  3SF4 A;  4URK A;  4GTS A;  1UN9 A;  3B13 A;  1NA3 A;  3IHZ A;  4GTP A;  4L72 B;  2MLZ A;  3IBE A;  2E0I A;  1G3N B;  1WY6 A;  2JEK A;  3OXL A;  3ASH A;  2AOS A;  3IV0 A;  2R59 A;  1TN6 A;  3LJN A;  4RQI A;  4FHJ A;  3EHQ A;  2BKK B;  2B5U B;  3FTZ A;  4F6R D;  5ARG A;  2H6F A;  4Q7N A;  2Y4T A;  3PVL A;  3W4R A;  5KJL A;  3FUH A;  4E6H A;  3UM0 A;  1C9H A;  1ELK A;  3LEW A;  1TN8 A;  2ETN A;  2WM0 A;  3JYJ A;  1NP7 A;  2VSY A;  2I9C A;  2C0L A;  1OWO A;  3I3N A;  2QF8 A;  4NAC A;  2XPB A;  4Z2J A;  2KAT A;  4DX6 D;  4A63 B;  3SBS A;  3D9L A;  2RKK A;  2VGX A;  4LAX A;  3UI4 A;  4ML4 A;  1EQ3 A;  2DSU A;  4DX5 D;  1W1P A;  4P8U A;  4Z2I A;  1X5B A;  3PZ3 A;  4KVO A;  1NWU A;  3UM3 A;  3CVW A;  1UN8 A;  1W9P A;  2X6H A;  1NH6 A;  5AQA A;  3L13 A;  3FU5 A;  2XP8 A;  3OOB A;  4J8E A;  1OWQ A;  3R9M A;  1QPL A;  4O6F A;  1Z3Y A;  2DYS E;  4ZFH A;  3U3W A;  3DSS A;  3UX4 A;  2C0M A;  3O5Q A;  5E75 A;  1FT1 A;  4PTM A;  3APC A;  4FLH A;  1VDY A;  3G2V A;  1JNE A;  1Q6I A;  1FFR A;  5AQ7 A;  2N87 A;  3NF1 A;  3L82 A;  2ZGD A;  2R03 A;  3FH5 A;  1JNT A;  1B89 A;  1FT2 A;  4K03 A;  2XEE A;  4U8Y D;  4A1G A;  1TR4 A;  1ZB1 A;  1OUV A;  1S64 A;  3QOU A;  1HO8 A;  3DRA A;  2A3C A;  5EX3 A;  4BTA A;  3WG7 E;  3DBS A;  2LSU A;  3TWW A;  2EUL A;  3E4B A;  4J0U A;  3FWV A;  3G6M A;  3Q75 A;  4BSX A;  1JNS A;  1FKB A;  1HKJ A;  3L16 A;  4BTB A;  1HJV A;  2DSV A;  4MLP A;  2PM6 A;  4YDE A;  5G04 J;  1H6O A;  3D3M A;  2EQX A;  3CR3 A;  5KJN A;  2LGO A;  3I4R B;  4GPM A;  1FVH A;  2RFA A;  2GRP B;  3B95 A;  2RUR A;  2IY0 C;  3RM4 A;  1UOH A;  1F8A B;  2QZA A;  3TWR A;  4MNJ A;  4DRX E;  2F8X K;  3KAC A;  4Z2H A;  3TG4 A;  5A6C A;  1ZBC A;  3ARZ A;  3Q47 B;  3HG0 D;  3PNL B;  4XZ4 A;  4JA9 A;  2OEW A;  4LUN U;  5IY5 E;  3FTX A;  4MTV A;  1LG2 A;  3BG0 B;  3AS4 A;  2F8Y A;  4JB8 P;  1K8K G;  3WD3 A;  3ABM E;  4B8A A;  2XCB A;  4HBD A;  4MKT A;  1NSG A;  3ZW3 A;  5LCW C;  4I6J A;  2J08 A;  4MS6 A;  5FQ7 A;  2WXJ A;  2J4B A;  5EID A;  2LXM A;  4A55 A;  3MZL B;  4ANW A;  4G1T A;  3PRA A;  3ZYL A;  2XPA A;  5FJY A;  4IN3 B;  4J8D A;  3CVU A;  1N9A A;  3CHO A;  2AWG A;  3ZXS A;  3LPZ A;  3I4G A;  1HXI A;  2EIK E;  4Z2K A;  3C3O A;  3C3Q A;  3RIB A;  5AIJ A;  4FU3 A;  4J6I A;  3ODK A;  4B8C B;  5GPG A;  5EN5 D;  5JJT A;  3PE4 A;  2MLX A;  4JFJ A;  3UQA A;  2R5S A;  4HOR A;  2RG8 A;  5DO2 A;  2DWZ A;  4HLL A;  4CCA A;  3W9G A;  4U04 A;  5BPP A;  2P9S G;  3ARS A;  3CGM A;  2FI7 A;  4G50 A;  4KZ0 A;  1E9L A;  1N54 A;  2WXL A;  3WD0 A;  4KMO A;  3ZPJ A;  2F4E A;  5KJM A;  2KC7 A;  4PH4 B;  1DCQ A;  5KNG A;  5GQB A;  1E7U A;  2A3E A;  2UWJ G;  2KXP C;  4FP7 A;  2HYZ A;  4ZPT R;  4UWH A;  1OWN A;  1HKM A;  1OWP A;  2HR2 A;  4UDM A;  4L2L A;  4LAW A;  4U84 A;  3LY9 A;  3PZ1 A;  1U79 A;  3AS3 A;  3DSU A;  5CEA A;  2WQ6 A;  3TWU A;  4NRH B;  1W3B A;  1RW2 A;  3UQI A;  4KVM A;  1OGG A;  1OT8 A;  5B1B E;  3HIZ A;  4YND A;  4FJZ A;  3ARV A;  1OCZ E;  1LG1 A;  4ODO A;  4BF8 A;  4LEU A;  2EIJ E;  2E2E A;  2XCC A;  4RG9 A;  2F37 A;  4PS3 A;  3T8K A;  2P9U G;  4MRU A;  3SFY A;  3APD A;  2L0I A;  3CST A;  1BPO A;  2PBC A;  4DT4 A;  4H7Y A;  3TG5 A;  4JHK A;  2VYI A;  5KCM A;  4L7T A;  5HQ8 A;  4MPK A;  3V79 K;  5ENT D;  2GRM A;  4K5B A;  2ETA A;  2ITK A;  3IXE A;  2VSO E;  2XP9 A;  3RAU A;  4ANX A;  1SA4 A;  4DLQ A;  4PS7 A;  4GZ6 A;  4EZL A;  4GYY A;  1K1A A;  2DYR E;  2Y69 E;  3MKR A;  3DXM G;  2ZU6 B;  1BI8 B;  2VCD A;  2NC9 A;  2L6J A;  5EIL A;  4N3A A;  5BXU A;  3IKD A;  1UG3 A;  3NI6 A;  4F7A A;  1T11 A;  1SZA A;  3CSF A;  2DT0 A;  1SW6 A;  4A3V A;  3ONK A;  3CHS A;  1GOI A;  1JCH B;  2XZD G;  4F1S A;  4NNR A;  1DNP A;  4GTT A;  4DI4 A;  3TWT A;  1N0Q A;  3Q7A A;  4XX5 A;  3WQV A;  3U4T A;  4MBG A;  3U9W A;  3O5O A;  3KCE A;  2AXV A;  1O1S A;  2K8I A;  4DPR A;  1K1B A;  5JMN D;  5KWD A;  2OV8 A;  2WVI A;  3KAI A;  4HRL A;  3FUL A;  1ZU8 A;  3FUM A;  4AXH A;  4GA0 A;  5HWB A;  1JCQ A;  4S3K A;  4OVU A;  3Q49 B;  3LDZ A;  2PI6 A;  1LD8 A;  4GZ3 A;  3UXG A;  4NUR A;  2BTD A;  4JD2 G;  3UI5 A;  4MNM A;  3B7X A;  1TNB A;  3AS8 A;  3ART A;  5AEN A;  3FU0 A;  2J07 A;  4BT9 A;  1RZ4 A;  3O5J A;  2VGE A;  3SBT B;  4DRP A;  4FAP A;  3FU6 A;  4CRW A;  4TXQ A;  3UIO C;  2DZO A;  1S0P A;  3ZYQ A;  3CVX A;  5C1D A;  1UR8 A;  2IOS A;  3SO8 A;  3P2B A;  1Z6T A;  4CGV A;  2MLY A;  3AS5 A;  3L9T A;  2AJA A;  1PAQ A;  2XPZ A;  5FQ6 A;  3O5D A;  2VGX B;  3NZS A;  2OOE A;  3FTU A;  4YVO A;  4DJA A;  4W9Q A;  2IF4 A;  4JL0 A;  4YVQ C;  1IHG A;  3IK8 A;  4MSP A;  3FAP A;  2XGS A;  5G05 J;  1Y0O A;  3KAF A;  5EDS A;  3SI5 A;  4CYM D;  5JHB A;  2DG9 A;  1J4R A;  3FTS A;  2GRL A;  2IOL A;  3JYS A;  1WB0 A;  3V2X A;  3B7B A;  3ESL A;  3U64 A;  3LY7 A;  4RG6 A;  1E6P A;  1V54 E;  4MNK A;  3NRK A;  4WKF A;  4AEZ C;  4G23 A;  4HNA D;  3ML9 A;  4G8L A;  4F3V A;  3WIJ A;  4OYS A;  3MKQ A;  2LO6 A;  3GW4 A;  3KSL A;  4XEI G;  1DVP A;  3EU9 A;  1JVW A;  4GTV A;  3CKB A;  2Q5A A;  1D7J A;  4J7W A;  1E6N A;  4IPX A;  3JXJ A;  3NOC D;  3ZFW A;  3ISM C;  2VJ8 A;  5ENN A;  3QK0 A;  3B7U X;  3JYM A;  2IFU A;  2OVF A;  5D75 A;  4ODQ A;  3O5I A;  2P58 C;  3L22 A;  3ASG A;  2ZQT A;  1IHB A;  3E37 A;  3Q79 A;  3FXY A;  4LNG A;  4W9P A;  2B6C A;  4WNF A;  4ACL A;  3UKU G;  2XEV A;  1N95 A;  1NWS A;  1L1P A;  4DWS D;  3ARQ A;  1MQS A;  2XRZ A;  2QYJ A;  3R7R A;  3QWV A;  2XP4 A;  1IQU A;  3E32 A;  3AS1 A;  4GA1 A;  2WB2 A;  3UMV A;  2WXM A;  1LF8 A;  1N4S A;  2LSV A;  4URI A;  3PZ2 A;  3EIJ A;  4BES A;  2XGM A;  3S7J A;  3LCA A;  2P9I G;  4I9E A;  4G2V A;  3FFL A;  4UI9 C;  5BV0 A;  1KFW A;  3HXC A;  1Y8M A;  3PEV B;  4DRM A;  1SA5 A;  2WXR A;  4IQC A;  4DWS A;  1FCH A;  2YHE A;  1D8E A;  1IX5 A;  4FHK A;  3DST A;  3DSX A;  3QWW A;  3GZ2 A;  1B6C A;  5JHA A;  3B7T A;  4HS2 A;  3TXM A;  1NMW A;  5AQ9 A;  2PPN A;  2XP3 A;  2RSE A;  4IRU A;  4RVB A;  4U63 A;  2VTB B;  5AAO A;  5CMY A;  3I5P A;  2DVW A;  4W9R A;  3SQV A;  4ABN A;  4AY5 A;  1TNO A;  3FHE A;  4DRQ A;  5LP0 A;  1WAW A;  4YDO A;  1SYT A;  4APO A;  4QFV A;  1LJY A;  4V3I A;  4KR0 B;  2OEV A;  4WK9 A;  2XQ0 A;  4FUL A;  4UWK A;  3MEK A;  1GPF A;  4G26 A;  4XE0 A;  1U2V G;  2FUL A;  1E6Z A;  2IO2 C;  1HH8 A;  1ZBV A;  5J6E A;  3ALG A;  3UT7 A;  1ZL1 A;  4L3N A;  1YAT A;  2WXF A;  1LD7 A;  4GZD A;  2DCP A;  4C0M A;  4JZY A;  2WXP A;  4B0Z A;  3ZIM A;  5BT1 A;  3LY8 A;  3RU0 A;  2M08 A;  3KAH A;  4KQZ A;  1E8X A;  2WLZ A;  3HXE A;  1O1T A;  2DPE A;  5KBA A;  3PE3 A;  2I2O A;  2ZIS A;  3UF8 A;  1JCR A;  4C0E A;  2RUD A;  1EIB A;  2FBN A;  2IUZ A;  1XHG A;  3OA5 A;  3BQO A;  3DPD A;  3Q5M A;  2DT2 A;  1Q1C A;  4YDW A;  1WM5 A;  3LXU X;  1W1Y A;  3ZXP A;  3FUK A;  2KCV A;  3ZYK A;  1K3Z D;  2I1K A;  3UKR G;  4DRN A;  3CHE A;  4ODM A;  4Y6C A;  2L6B A;  4G25 A;  1SQM A;  1D9S A;  2WQ7 A;  2KCL A;  4UWG A;  3WD1 A;  2M1I A;  4FAD A;  4KYO B;  5AJD A;  3E33 A;  4TW6 A;  2J4D A;  2NSZ A;  3UQB A;  4CDN A;  2C2L A;  1LQ0 A;  3KAG A;  1S70 B;  4JFK A;  3PRD A;  1R9H A;  1H0G A;  5DIT A;  3KEA A;  4JXT A;  4HI9 A;  4TXR A;  4R0X A;  4ZPV R;  2IO3 C;  4GIV A;  2L2S A;  5GPR A;  1OWL A;  1HF8 A;  4CDR A;  4EBA G;  2VGY A;  4K5C A;  3K9I A;  1LL7 A;  1WNO A;  4OAV B;  2WMN A;  2JZV A;  4GPK A;  4XIF A;  2UY1 A;  4I1M A;  2P9P G;  4J8Y A;  3CH9 A;  5BXO A;  1MYO A;  3PUK A;  3AG1 E;  3PRZ A;  2VQ2 A;  2XP7 A;  2ZQU A;  3LKU A;  1UJJ A;  1H0A A;  2KO7 A;  3FY1 A;  4LAY A;  1INZ A;  5HKP A;  4ILG A;  3N71 A;  4UI9 K;  5G2N A;  3WXX A;  1LL4 A;  3TJP A;  1HFA A;  1YA0 A;  4AY6 A;  5DIU A;  3O5P A;  1D7I A;  3Q9U C;  5AN8 A;  1J6Y A;  2X6I A;  3KAB A;  2Y78 A;  1MZC A;  4G2P A;  2CG2 A;  3CLJ A;  4JPS A;  4LRZ A;  5HW7 A;  3O5E A;  1EHN A;  1OCR E;  1QZ2 A;  4HFG A;  4GCN A;  4APF A;  3MV2 B;  4AIF A;  3CIA A;  4HVB A;  4XKB A;  3DEP A;  3NZU A;  1EDQ A;  3RRN B;  3ML8 A;  3FUJ A;  2LXL A;  3UI6 A;  3ZU7 B;  3FTW A;  3GZS A;  1X81 A;  2ZR4 A;  5B3S E;  1KT0 A;  5CED B;  2LUH A;  3VTX A;  4FN2 A;  3Q7F A;  2G8Z A;  3ZRH A;  3VAW A;  4U07 A;  4BET A;  3NQP A;  5FZS A;  5HKG A;  2F21 A;  3G2S A;  1Y6I A;  4FA6 A;  2ZR6 A;  4NIK A;  3JQ1 A;  2OLH A;  1YYH A;  4Q22 A;  1ZBW A;  4ME2 A;  3DSV A;  2L0T B;  1FAP A;  3QC1 A;  1D8D A;  3GTY X;  5ENS D;  3ALF A;  2O9O A;  2Y4U A;  1FKD A;  5I98 A;  1N0R A;  3ARY A;  4O2T A;  3BU8 A;  3ZGQ A;  2XGO A;  3BUA A;  1YCS B;  2V8S E;  4LSZ E;  4L1B A;  2A3B A;  4QIB A;  4TUM A;  1JPL A;  2X6J A;  1EYH A;  4ODL A;  5D2M C;  2CHZ A;  2FO1 E;  2AXZ A;  3B8S A;  4UQX A;  4ZS6 A;  4M7C A;  4GTO A;  2IU1 A;  4FJY A;  1TYQ G;  2GW1 A;  1P5Q A;  1SZ9 A;  3WD2 A;  1JUQ A;  2I6H A;  3KD7 A;  2KFW A;  3MCX A;  5ENP D;  3T9K A;  4G11 A;  4E85 A;  4N3B A;  3D9H A;  5DF0 A;  3B9E A;  3SGH A;  3AG2 E;  3CK7 A;  4ILI A;  4GB9 A;  3OTN A;  3QAQ A;  3O5M A;  3UT4 A;  1U3D A;  3O5G A;  2BKG A;  4HOS A;  4LER A;  4K5A B;  4CZ2 D;  5BUZ A;  3V31 A;  3UPV A;  1D7H A;  3MGB A;  2ION A;  3NOG D;  3CVN A;  1J4H A;  4PDX A;  3TWV A;  2PZI A;  1FKT A;  2GRO B;  3ASF A;  5HT1 A;  4IUL A;  3EDT B;  2ETC A;  2F0Y A;  3MV3 B;  3KAE A;  4I1A A;  3U66 A;  3T5V A;  2LNI A;  3S7D A;  3ZN3 A;  4WNE A;  4GTM A;  3EHN A;  4TX0 A;  3ZUV B;  1UR9 A;  1K9T A;  4Q94 A;  1W9V A;  3V2O A;  3TWX A;  4CDM A;  4OAU C;  1HG2 A;  3CHF A;  4JFL A;  2KGJ A;  3CHD A;  3AU4 A;  3TDB A; 
#chains in the Genus database with same CATH homology
 3AU5 A;  3CHM A;  4PS8 A;  3RKV A;  5AYW D;  2XHE A;  1FKG A;  4GCO A;  1D6O A;  4A3T A;  3EY6 A;  1JWF A;  2KE0 A;  2ZR5 A;  3G2W A;  4I6G A;  3PR9 A;  2QFC A;  3O5L A;  4ANV A;  4FC8 A;  4DIP A;  1Q6H A;  1OGB A;  3HVE A;  2FDM A;  3ASD A;  2FEZ A;  1KT1 A;  2AVP A;  3CVQ A;  4I9C A;  1HE8 A;  1HKK A;  3UUX A;  4K0R A;  4BY6 A;  4XAK A;  1Z3X A;  3LUO A;  4JFM A;  5FQ8 A;  4BT8 A;  3LS8 A;  2Y3A A;  3BXW A;  5E76 A;  4GMJ A;  4AP2 A;  4HOT A;  3RME A;  2MRI A;  4EPZ A;  5D0Q D;  5B8I C;  2PPO A;  3H9R B;  2VSX E;  2V5F A;  4N19 A;  4UQZ A;  4TYO A;  1W1V A;  4WWP A;  3ARW A;  4EBA A;  3KAD A;  5KJK A;  2M2A A;  1PC2 A;  3GZ1 A;  4P8V A;  4AV7 A;  3ARU A;  1HX8 A;  1EYM A;  1ROT A;  4HOQ A;  4WAF A;  2WXK A;  1FKL A;  4JYS A;  2FF4 A;  3AS2 A;  4F53 A;  4IYP A;  4AM9 A;  2M63 A;  2VN1 A;  4LCT A;  4TV3 A;  3EIQ C;  3FUN A;  2OND A;  4WNG A;  4D10 C;  3CK9 A;  4C02 B;  2J9Q A;  3WD4 A;  4OVV A;  1KLX A;  3IKO B;  4WND A;  4G24 A;  3RRU A;  3LVQ E;  4H7X A;  3VLD A;  2J09 A;  2LPV A;  1H6K A;  4IT6 A;  4ODP A;  1EF1 C;  4B89 A;  4J4O A;  4Q69 A;  3IKG A;  2A5U A;  5HWC A;  4DWS C;  5BXJ A;  2CHW A;  3PA7 A;  3LVR E;  3QKY A;  4JHR A;  4QZV B;  4I6E A;  4S3J A;  3FH7 A;  3AS0 A;  4TRQ A;  2GGF A;  1QQE A;  4N39 A;  5FT9 A;  3ZVV A;  5G05 C;  5D0O D;  2MNT A;  2UY1 B;  3RRM B;  5JJ6 A;  3FUF A;  1BKF A;  4QT2 A;  4QT3 A;  1GW6 A;  3CHP A;  2CHX A;  2YBU A;  3ENE A;  1TJC A;  3ZHE B;  4I2W A;  1D2K A;  3D9M A;  3FP3 A;  1FKF A;  3FDH A;  3MYV A;  2X6F A;  3R7Q A;  5BV1 A;  3GYZ A;  1PY1 A;  1QNF A;  4J4N A;  3RM9 A;  1IYG A;  4Q96 A;  1O6I A;  3MJW A;  3VLE A;  3ARP A;  4U8H A;  1FFQ A;  2UZ5 A;  4KT6 B;  2XP6 A;  4NSB A;  1ZBK A;  3ONL A;  1CTN A;  4AVX A;  3CZ8 A;  4CGW A;  2B31 A;  3L08 A;  3O5R A;  3BEE A;  3G2T A;  2DBA A;  4JW1 A;  1YW5 A;  3CVY A;  2X6K A;  4EEC A;  3Q4A B;  2WLY A;  4HLE A;  1E90 A;  2G41 A;  5A7D B;  5FWQ A;  1JND A;  1E15 A;  2FAP A;  2XPI A;  4KZC A;  1UW4 B;  2PV1 A;  1ELW A;  1QPF A;  3PRE A;  5T4Y A;  5HBF A;  1Q6U A;  5AJL A;  3QAR A;  5A23 A;  2RQS A;  4DWS B;  4LAV A;  1ROU A;  2KR7 A;  2BF0 X;  2WQH A;  4U0Z A;  2LAH A;  1HG5 A;  1H0I A;  1LL6 A;  3L6A A;  1ZB5 A;  3SHF A;  3Q15 A;  3WH0 A;  3D9O A;  4AY1 A;  3UT8 A;  2VTB A;  1PBK A;  4DRJ A;  2D9F A;  2WXG A;  4BX8 A;  5DEZ A;  1FKK A;  5DIV A;  4IQ2 A;  1J4I A;  4GML A;  4PUC A;  4P29 A;  1H2T C;  5CMW A;  4WKA A;  3L54 A;  3EJN A;  4JEH A;  5FTP A;  2DSZ A;  1NMV A;  3IHV A;  4TW8 A;  1ZK6 A;  5CCM A;  4P8W A;  5CCL A;  3TAX A;  5ANR A;  4WIW A;  3JXV A;  3RK6 A;  1E8Z A;  1EDU A;  1TJF A;  3OAW A;  2XP5 A;  2HM8 A;  2WXH A;  2KM4 A;  1E6R A;  4J8F A;  3HDX A;  4XI0 A;  2AW6 A;  3HHM A;  1ITX A;  1VF8 A;  4XKC A;  1NA0 A;  3PDN A;  5DIZ A;  3GPK A;  4NZC A;  3PUJ A;  2YNQ A;  4KBQ A;  4JVS A;  3PS6 A;  1L5J A;  2I1J A;  2PL2 A;  4CT4 A;  3B9D A;  4P8X A;  2YBT A;  4DZ2 A;  5J08 A;  3MKQ B;  4I17 A;  1ZU2 A;  4M3O A;  2WXO A;  1H2V C;  2Q7F A;  3IEG A;  2PQN A;  4UWF A;  1WAO 1;  4J8S A;  3JCK C;  4UI9 J;  4Y6W A;  2MPH A;  3SFZ A;  3D9K A;  2WXI A;  2BUG A;  1BL4 A;  3RM8 A;  3LYA A;  3CEQ A;  2ILR A;  2CFU A;  3QDN A;  4JA7 A;  4N2S A;  4GZC A;  4BFR A;  1N52 A;  2WM9 A;  3FY4 A;  2PQR A;  3L17 A;  1A7X A;  4GU5 A;  3C98 A;  3QJZ A;  4ODN A;  3R9A B;  1HJW A;  4ACK A;  4ILH B;  3B9A A;  4KXK B;  3PEU B;  5LOZ A;  4N3C A;  3NTP A;  1W1T A;  1FD9 A;  2KZT B;  3RGC A;  5FQ4 A;  1XRV A;  4GA2 A;  4MGV A;  2DIW A;  2QY7 A;  3D9J A;  5T8I A;  3FEX A;  2ZQV A;  3ESK A;  2DT3 A;  4WWO A;  1F40 A;  2NXP A;  4WJX A;  2KCK A;  4DZ3 A;  3S7B A;  2X38 A;  5LFA A;  1E8Y A;  4ZPW R;  3WQW A;  3CVP A;  3FTY A;  1H19 A;  4ATG A;  2XRY A;  4N2Q A;  4EZK A;  4XI9 A;  4UQY A;  4IT4 A;  4EZJ A;  1NWT A;  3JQ0 A;  3O48 A;  1X6N A;  4ODR A;  2WMO A;  5LCW J;  3PH0 C;  1RD6 A;  3ARO A;  1JWG A;  4DRK A;  1ELR A;  3S7F A;  2ESC A;  1PIN A;  1FJD A;  4MNL A;  3D9P A;  3QOK A;  2DG4 A;  2PV3 A;  3KZ7 A;  3ARX A;  1MHQ A;  5LX8 A;  3CHR A;  2V0P A;  1XGW A;  3HVE B;  4CEM A;  5J90 A;  1GUV A;  2R17 C;  4HAR A;  2WXN A;  5DBK A;  2OFN A;  3T8M A;  4UWL A;  2CFZ A;  2KI3 A;  4CT0 A;  5G04 C;  5ARF A;  3SZ7 A;  4HBE A;  1FKJ A;  2WPV A;  2PM7 A;  4I1O B;  5JH8 A;  3RO2 A;  3IHY A;  5C2Y A;  3D9I A;  3MDY B;  4HBO A;  5BW8 C;  3SNX A;  3CHQ A;  5FZQ A;  2JLB A;  2J49 A;  3FH8 A;  5HW6 A;  4AJW A;  4A1S A;  4R7L A;  4TNS A;  2DG3 A;  4DH0 A;  3O5K A;  4B94 A;  3QB2 A;  3PRB A;  1W9U A;  1UJK A;  2MHK A;  1E7V A;  4ANU A;  4GAA A;  3CQC B;  2CG3 A;  3UQ3 A;  3PZD A;  3MX3 A;  3CGH A;  4JEU A;  4Z2L A;  4WWN A;  4GGQ A;  4JFI A;  1H2U A;  1FVF A;  3G2U A;  4AOF A;  1E96 B;  3CHC A;  2F2D A;  5FZR A;  3HYM B;  4GYO A;  4BX9 A;  4W9O A;  3MA5 A;  2LKN A;  5EX0 A;  1IQR A;  1TCO C;  5HW8 A;  2O92 A;  5HI7 A;  5M72 A;  4DRO A;  4FLB A;  3AQU A;  2YQ8 A;  1NWR A;  4DI3 A;  3CK8 A;  1N1A A;  2X3M A;  1FKS A;  2WXQ A;  2PV2 A;  4LGX A;  3ZYM A;  2OVB A;  5BNW A;  1XNF A;  3KS2 A;  3LJ3 A;  1M5Y A;  4C9B B;  1FKR A;  1TEZ A;  3CQG B;  3P1U A;  3TCZ A;  1HKI A;  1HS6 A;  3URZ A;  4HOU A;  2IJG X;  2IQC A;  2A3A A;  1HXV A;  4TW7 A;  1X6L A;  2RUC A;  3QWP A;  2DSW A;  4DK5 A;  2ZQS A;  2FKE A;  3FUD A;  2FO7 A;  2V4L A;  2LAI A;  4R5E A;  3O5F A;  3WL0 A;  2YIN A;  2MF9 A;  3BG1 B;  2AWI A;  4L23 A;  4RSY A;  3CVV A;  1TFV A;  4JHJ A;  3FU3 A;  3EHM A;  4Z2G A;  2KZT A;  4ITZ A;  1SR0 A;  1A17 A;  3OXG A;  4BWR A;  3RO3 A;  3T5X A;  3ULQ A;  5ANL A;  3CGN A;  2HO1 A;  3ZHE A;  4L2Y A;  1W26 A;  1OWM A;  3WL1 A;  3TL5 A;  3CV0 A;  2PPP A;  3CKC A;  1E8W A;  4ODK A;  1EPU A;  4DRI A;  3WKZ A;  1NZN A;  3FUE A;  5HTG A;  4GYW A;  3JUI A;  3RJV A;  4I43 A;  3ARR A;  4TUU A;  3RFW A;  2VSN A;  3ZEF A;  4U85 A;  3B7S A;  2DT1 A;  4DRH A;  3QNK A;  2XPY A;  4W5U A;  1FKH A;  1HZ4 A;  3PNT B;  4NQ0 A;  1HU3 A;  2L9B A;  3FUI A;  3TXN A;  3APF A;  3G6L A;  2AXU A;  4N5C A;  4WKH A;  3TGO A;  3VLF A;  1FKI A;  4U86 A;  3O4Z A;  5JJ7 A;  5G55 A;  3SD5 A;  3D9N A;  4EQF A;  3CVL A;  4HXI A;  3VTY A;  1U3C A;  3S2A A;  2RD0 A;  1HJX A;  3FTV A;  3B7R L;  3FEY A;  3OXF A;  1ZCN A;  2YHC A;  3KEZ A;  2A4Z A;  4GZ5 A;  4MAV A;  1ZBP A;  3I6C A;  4JC8 A;  4U0S A;  5HUA A;  2MOW A;  2WK2 A;  3TC5 A;  4DLO A;  2LJ4 A;  2RUQ A;  4U0U A;  5CHE E;  4WUY A;  5EKQ D;  5T3R A;  4I2Z A;  3SF4 A;  4URK A;  1UN9 A;  3B13 A;  1NA3 A;  3IHZ A;  4L72 B;  2MLZ A;  3IBE A;  2E0I A;  1WY6 A;  2JEK A;  3OXL A;  3ASH A;  2AOS A;  3IV0 A;  2R59 A;  4FHJ A;  3FTZ A;  5ARG A;  4Q7N A;  2Y4T A;  3PVL A;  3W4R A;  5KJL A;  3FUH A;  4E6H A;  1C9H A;  1ELK A;  3LEW A;  2WM0 A;  3JYJ A;  1NP7 A;  2VSY A;  2I9C A;  2C0L A;  1OWO A;  3I3N A;  2QF8 A;  4NAC A;  2XPB A;  4Z2J A;  2KAT A;  3SBS A;  3D9L A;  2VGX A;  4LAX A;  3UI4 A;  4ML4 A;  1EQ3 A;  2DSU A;  1W1P A;  4P8U A;  4Z2I A;  1X5B A;  4KVO A;  1NWU A;  3CVW A;  1UN8 A;  1W9P A;  2X6H A;  1NH6 A;  3L13 A;  3FU5 A;  2XP8 A;  3OOB A;  4J8E A;  1OWQ A;  1QPL A;  4O6F A;  1Z3Y A;  3U3W A;  3UX4 A;  2C0M A;  3O5Q A;  5E75 A;  4PTM A;  3APC A;  4FLH A;  1VDY A;  3G2V A;  1JNE A;  1Q6I A;  1FFR A;  2N87 A;  3NF1 A;  3FH5 A;  1JNT A;  1B89 A;  4K03 A;  4A1G A;  1OUV A;  3QOU A;  1HO8 A;  2A3C A;  5EX3 A;  4BTA A;  3DBS A;  2LSU A;  3E4B A;  4J0U A;  3FWV A;  3G6M A;  4BSX A;  1JNS A;  1FKB A;  1HKJ A;  3L16 A;  4BTB A;  1HJV A;  2DSV A;  4MLP A;  2PM6 A;  5G04 J;  3D3M A;  2EQX A;  3CR3 A;  5KJN A;  2LGO A;  3I4R B;  1FVH A;  2RUR A;  3RM4 A;  1F8A B;  4MNJ A;  3KAC A;  4Z2H A;  3TG4 A;  5A6C A;  1ZBC A;  3ARZ A;  3Q47 B;  3PNL B;  4XZ4 A;  4JA9 A;  4LUN U;  3FTX A;  4MTV A;  1LG2 A;  3BG0 B;  3AS4 A;  3WD3 A;  4B8A A;  2XCB A;  4MKT A;  1NSG A;  3ZW3 A;  5LCW C;  4I6J A;  2J08 A;  4MS6 A;  5FQ7 A;  2WXJ A;  2J4B A;  4A55 A;  3MZL B;  4ANW A;  4G1T A;  3PRA A;  3ZYL A;  2XPA A;  5FJY A;  4IN3 B;  4J8D A;  3CVU A;  3CHO A;  2AWG A;  3ZXS A;  3LPZ A;  3I4G A;  1HXI A;  4Z2K A;  3RIB A;  5AIJ A;  4FU3 A;  4J6I A;  3ODK A;  4B8C B;  5GPG A;  5JJT A;  3PE4 A;  2MLX A;  4JFJ A;  3UQA A;  2R5S A;  4HOR A;  2RG8 A;  5DO2 A;  4CCA A;  4U04 A;  5BPP A;  3ARS A;  3CGM A;  2FI7 A;  4G50 A;  4KZ0 A;  1E9L A;  1N54 A;  2WXL A;  3WD0 A;  4KMO A;  3ZPJ A;  2F4E A;  5KJM A;  2KC7 A;  4PH4 B;  5GQB A;  1E7U A;  2A3E A;  2UWJ G;  4FP7 A;  2HYZ A;  4ZPT R;  4UWH A;  1OWN A;  1HKM A;  1OWP A;  2HR2 A;  4L2L A;  4LAW A;  4U84 A;  3LY9 A;  1U79 A;  3AS3 A;  2WQ6 A;  4NRH B;  1W3B A;  3UQI A;  4KVM A;  1OGG A;  3HIZ A;  4YND A;  4FJZ A;  3ARV A;  1LG1 A;  4ODO A;  4BF8 A;  4LEU A;  2E2E A;  2XCC A;  4RG9 A;  4PS3 A;  4MRU A;  3APD A;  2L0I A;  3CST A;  1BPO A;  2PBC A;  4DT4 A;  4H7Y A;  3TG5 A;  4JHK A;  2VYI A;  5KCM A;  4L7T A;  5HQ8 A;  4MPK A;  2GRM A;  2ITK A;  2VSO E;  2XP9 A;  4ANX A;  4DLQ A;  4PS7 A;  4GZ6 A;  4EZL A;  4GYY A;  3MKR A;  2ZU6 B;  2VCD A;  2NC9 A;  2L6J A;  4N3A A;  3IKD A;  1UG3 A;  3NI6 A;  4F7A A;  1T11 A;  1SZA A;  3CSF A;  2DT0 A;  4A3V A;  3ONK A;  3CHS A;  1GOI A;  4F1S A;  4NNR A;  1DNP A;  4DI4 A;  4XX5 A;  3WQV A;  3U4T A;  3U9W A;  3O5O A;  3KCE A;  2AXV A;  2K8I A;  4DPR A;  2OV8 A;  2WVI A;  3KAI A;  3FUL A;  1ZU8 A;  3FUM A;  4AXH A;  4GA0 A;  5HWB A;  4S3K A;  4OVU A;  3Q49 B;  3LDZ A;  2PI6 A;  4GZ3 A;  4NUR A;  2BTD A;  3UI5 A;  4MNM A;  3B7X A;  3AS8 A;  3ART A;  5AEN A;  3FU0 A;  2J07 A;  4BT9 A;  3O5J A;  3SBT B;  4DRP A;  4FAP A;  3FU6 A;  4CRW A;  1S0P A;  3ZYQ A;  3CVX A;  5C1D A;  1UR8 A;  2IOS A;  3P2B A;  1Z6T A;  4CGV A;  2MLY A;  3AS5 A;  5FQ6 A;  1PAQ A;  2XPZ A;  3O5D A;  2VGX B;  3NZS A;  2OOE A;  3FTU A;  4YVO A;  4DJA A;  4W9Q A;  2IF4 A;  4JL0 A;  4YVQ C;  1IHG A;  3IK8 A;  4MSP A;  3FAP A;  2XGS A;  5G05 J;  1Y0O A;  3KAF A;  5EDS A;  3SI5 A;  2DG9 A;  5JHB A;  1J4R A;  3FTS A;  2GRL A;  2IOL A;  3JYS A;  1WB0 A;  3ESL A;  3LY7 A;  3U64 A;  4RG6 A;  1E6P A;  4MNK A;  3NRK A;  4WKF A;  4AEZ C;  4G23 A;  3ML9 A;  4F3V A;  3WIJ A;  4OYS A;  3MKQ A;  2LO6 A;  3GW4 A;  1DVP A;  1JVW A;  3CKB A;  2Q5A A;  1D7J A;  1E6N A;  4IPX A;  3ZFW A;  2VJ8 A;  5ENN A;  3QK0 A;  3B7U X;  3JYM A;  2IFU A;  2OVF A;  5D75 A;  4ODQ A;  3O5I A;  2P58 C;  3L22 A;  3ASG A;  2ZQT A;  3FXY A;  4W9P A;  4WNF A;  4ACL A;  2XEV A;  1NWS A;  1L1P A;  4DWS D;  3ARQ A;  1MQS A;  2XRZ A;  3R7R A;  3QWV A;  2XP4 A;  1IQU A;  3AS1 A;  4GA1 A;  2WB2 A;  3UMV A;  2WXM A;  1LF8 A;  2LSV A;  4URI A;  3EIJ A;  2XGM A;  3S7J A;  3LCA A;  4I9E A;  4G2V A;  3FFL A;  4UI9 C;  5BV0 A;  1KFW A;  1Y8M A;  3PEV B;  4DRM A;  2WXR A;  4IQC A;  4DWS A;  1FCH A;  2YHE A;  1IX5 A;  4FHK A;  3QWW A;  3GZ2 A;  1B6C A;  5JHA A;  3B7T A;  4HS2 A;  3TXM A;  1NMW A;  2PPN A;  2XP3 A;  2RSE A;  4IRU A;  4RVB A;  4U63 A;  2VTB B;  5CMY A;  3I5P A;  4W9R A;  4ABN A;  4AY5 A;  3FHE A;  4DRQ A;  5LP0 A;  1WAW A;  1SYT A;  4APO A;  4QFV A;  1LJY A;  4V3I A;  4KR0 B;  4WK9 A;  2XQ0 A;  4FUL A;  4UWK A;  3MEK A;  1GPF A;  4G26 A;  4XE0 A;  2FUL A;  1E6Z A;  1HH8 A;  1ZBV A;  5J6E A;  3ALG A;  3UT7 A;  1ZL1 A;  4L3N A;  1YAT A;  2WXF A;  4GZD A;  2DCP A;  4C0M A;  4JZY A;  2WXP A;  4B0Z A;  3ZIM A;  5BT1 A;  3LY8 A;  3RU0 A;  2M08 A;  3KAH A;  4KQZ A;  1E8X A;  2WLZ A;  2DPE A;  3PE3 A;  2I2O A;  3UF8 A;  4C0E A;  2RUD A;  1EIB A;  2FBN A;  2IUZ A;  1XHG A;  3OA5 A;  3DPD A;  3Q5M A;  2DT2 A;  1Q1C A;  1WM5 A;  3LXU X;  1W1Y A;  3FUK A;  2KCV A;  3ZYK A;  2I1K A;  4DRN A;  3CHE A;  4ODM A;  4Y6C A;  4G25 A;  1SQM A;  2WQ7 A;  2KCL A;  4UWG A;  3WD1 A;  2M1I A;  4FAD A;  4KYO B;  5AJD A;  4TW6 A;  2J4D A;  2NSZ A;  3UQB A;  4CDN A;  2C2L A;  1LQ0 A;  3KAG A;  4JFK A;  3PRD A;  1R9H A;  1H0G A;  5DIT A;  4JXT A;  4R0X A;  4ZPV R;  4GIV A;  2L2S A;  5GPR A;  1OWL A;  1HF8 A;  4CDR A;  4EBA G;  2VGY A;  3K9I A;  1LL7 A;  1WNO A;  2WMN A;  2JZV A;  4GPK A;  4XIF A;  2UY1 A;  4I1M A;  3CH9 A;  3PUK A;  3PRZ A;  2VQ2 A;  2XP7 A;  2ZQU A;  3LKU A;  1UJJ A;  1H0A A;  2KO7 A;  3FY1 A;  4LAY A;  1INZ A;  4ILG A;  3N71 A;  4UI9 K;  5G2N A;  3WXX A;  1LL4 A;  3TJP A;  1HFA A;  1YA0 A;  4AY6 A;  5DIU A;  3O5P A;  1D7I A;  1J6Y A;  2X6I A;  3KAB A;  2Y78 A;  4G2P A;  2CG2 A;  3CLJ A;  4JPS A;  4LRZ A;  5HW7 A;  3O5E A;  1EHN A;  1QZ2 A;  4HFG A;  4GCN A;  4APF A;  3MV2 B;  4AIF A;  3CIA A;  4HVB A;  4XKB A;  3NZU A;  1EDQ A;  3RRN B;  3ML8 A;  3FUJ A;  3UI6 A;  3FTW A;  3GZS A;  2ZR4 A;  1KT0 A;  3VTX A;  4FN2 A;  2G8Z A;  3ZRH A;  3VAW A;  4U07 A;  3NQP A;  5FZS A;  5HKG A;  2F21 A;  3G2S A;  1Y6I A;  4FA6 A;  2ZR6 A;  3JQ1 A;  2OLH A;  4Q22 A;  1ZBW A;  4ME2 A;  1FAP A;  2L0T B;  3QC1 A;  3ALF A;  2O9O A;  2Y4U A;  1FKD A;  5I98 A;  3ARY A;  4O2T A;  3ZGQ A;  2XGO A;  2V8S E;  4L1B A;  2A3B A;  4QIB A;  1JPL A;  2X6J A;  1EYH A;  4ODL A;  2CHZ A;  2AXZ A;  3B8S A;  4UQX A;  4ZS6 A;  2IU1 A;  4FJY A;  2GW1 A;  1P5Q A;  1SZ9 A;  3WD2 A;  1JUQ A;  2I6H A;  3KD7 A;  2KFW A;  3MCX A;  4G11 A;  4E85 A;  4N3B A;  5DF0 A;  3B9E A;  3SGH A;  3CK7 A;  4ILI A;  4GB9 A;  3OTN A;  3O5M A;  3QAQ A;  3UT4 A;  1U3D A;  3O5G A;  4HOS A;  4LER A;  5BUZ A;  3UPV A;  1D7H A;  3MGB A;  2ION A;  3CVN A;  1J4H A;  4PDX A;  2PZI A;  1FKT A;  3ASF A;  5HT1 A;  4IUL A;  3EDT B;  3MV3 B;  3KAE A;  4I1A A;  3U66 A;  3T5V A;  2LNI A;  3S7D A;  3ZN3 A;  4WNE A;  4TX0 A;  3EHN A;  1UR9 A;  1K9T A;  4Q94 A;  1W9V A;  4CDM A;  1HG2 A;  4JFL A;  3CHF A;  2KGJ A;  3CHD A;  3AU4 A;  3TDB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...