1KT1A

Structure of the large fkbp-like protein, fkbp51, involved in steroid receptor complexes
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
394
structure length
374
Chain Sequence
KKDRGVLKIVHGEETPMIGDRVYVHYNGKLANPFVFSIGKGQVIKAWDIGVATMKKGEICHLLCAYGATGSLPKIPSNATLFFEVELLDFKGEDLLEDGGIIRRTKRRGEGYSNPNEGARVQIHLEGRCGGRVFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILHLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYVQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQIFMCQKKAKEHNERDRRTYANMFKKFAEQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title STRUCTURE OF THE LARGE FK506-BINDING PROTEIN FKBP51, AN HSP90-BINDING PROTEIN AND A COMPONENT OF STEROID RECEPTOR COMPLEXES
pubmed doi rcsb
source organism Saimiri boliviensis
molecule tags Isomerase
molecule keywords FK506-binding protein FKBP51
total genus 108
structure length 374
sequence length 394
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2002-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF00515 TPR_1 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1kt1A03
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1kt1A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1kt1A02
3EY6A 4JYSA 5A7DB 4WNGA 3FAPA 4JFKA 3CK9A 3PRBA 2PPOA 3K9IA 3TGOA 1FKTA 3PE4A 3EDTB 1W3BA 2XGOA 5BT1A 3ZFWA 3PA7A 4GCNA 3ZHEB 4N2QA 2DG3A 2P58C 4J8FA 3RO3A 2RSEA 5HWBA 4GCOA 2PQRA 4ODKA 4U84A 4N3AA 3LY7A 1TJCA 4GA0A 1J4IA 2PV3A 3IHZA 4LEUA 3KADA 4DRNA 4XIFA 2V5FA 4YNDA 5BNWA 3CVQA 4BWRA 3PE3A 5DITA 2D9FA 2LNIA 1ZCNA 1B6CA 1NMWA 5FZQA 3WH0A 4UQXA 4U0ZA 5LCWC 4LAYA 5JJTA 3GZ2A 3KS2A 4N5CA 2ITKA 4AY6A 2VSYA 3UQIA 5JJ7A 4DROA 4U04A 3NI6A 4W9PA 1NA3A 5LCWJ 3IEGA 4GGQA 3RJVA 3QOUA 2PQNA 3VTXA 2KI3A 2VN1A 4XI0A 5ARFA 3UUXA 1QPFA 4WUYA 3IKDA 2L6JA 2XP8A 2JLBA 3AS5A 4WNEA 4F3VA 4U86A 3CK7A 4TX0A 2R5SA 3MV2B 2FAPA 4TNSA 3SZ7A 2LJ4A 2MNTA 5CHEE 1NSGA 1PINA 1ZK6A 3CKBA 3AS8A 3CKCA 3GZ1A 1T11A 2Y4TA 5HI7A 2XP9A 3OXFA 2KATA 2HR2A 2ZR6A 5DBKA 2LSUA 2LSVA 3I6CA 3O5PA 4G2PA 2ONDA 3O5QA 3CGNA 4ODOA 1J4HA 2WQHA 5DIVA 4HOSA 2PZIA 4H7XA 4GYOA 4I9EA 4JFJA 5ARGA 2KGJA 2K8IA 4GA2A 2F2DA 4B94A 5HTGA 2KC7A 2XCCA 4UI9C 1EYMA 1D7JA 3O5LA 4ODRA 5HKGA 3ULQA 5J6EA 2NC9A 3UQAA 5BXJA 5HT1A 4DZ2A 4EQFA 4JFMA 4I2WA 3RKVA 3JYSA 4ME2A 1JNSA 3R9AB 2DG9A 3JYJA 2XCBA 1FD9A 4I9CA 3FWVA 2XPBA 4GIVA 3KCEA 4ODPA 2FF4A 3CEQA 1YW5A 4QT2A 4DH0A 1QZ2A 4I1AA 3UI5A 3UI4A 4QIBA 2RQSA 2FI7A 1Q6UA 1NMVA 3CVLA 2XGMA 2Q5AA 3KAIA 3TDBA 3AS4A 3IK8A 4DRIA 3TC5A 1EQ3A 4WNDA 3UPVA 5C1DA 4UQZA 3UF8A 3Q4AB 2KCLA 2XP7A 1ZU2A 2OFNA 3ZGQA 3MEKA 4HOUA 1FKLA 5FZRA 3RFWA 2FEZA 2IFUA 5AYWD 5FZSA 3QKYA 1F40A 4KXKB 2MLYA 5B8IC 4JHRA 4CGVA 4N19A 4GYWA 2E2EA 2ZQSA 1P5QA 1R9HA 2N87A 3O5IA 4N3BA 2LPVA 2LKNA 3MV3B 1HH8A 4J4NA 4IPXA 1FKRA 1HZ4A 3ASHA 4AY5A 3KD7A 4XI9A 1FJDA 1J6YA 2IF4A 5G05J 5D75A 2HO1A 2KCVA 2LGOA 2PPNA 5G04J 4TYOA 1JNTA 2XP6A 5G05C 2XEVA 4DIPA 2C0MA 3PDNA 4UQYA 4DRKA 5FT9A 3LYAA 4APOA 1FKSA 3O5GA 4DRHA 3S7FA 2PBCA 1Y8MA 2UZ5A 3TG4A 1W26A 3ESKA 1ROTA 1U79A 4G25A 3Q5MA 3KAEA 3KAGA 3NF1A 4IN3B 4C02B 5HW6A 5D0OD 4GA1A 2YQ8A 1FKGA 2I6HA 2ZQTA 4TW6A 3RIBA 3CVNA 3JXVA 4J4OA 3UQBA 3TCZA 2XGSA 1FKHA 4RG9A 4JL0A 4KYOB 4RG6A 2F21A 2XPAA 3GYZA 1IYGA 2DBAA 2VGYA 1L1PA 4J8EA 2FO7A 3RO2A 2MPHA 1D7HA 2JZVA 4H7YA 1PC2A 3WXXA 3CV0A 3S7DA 5G04C 4DRPA 3N71A 5EKQD 3OXGA 3Q15A 4GPKA 1WAO1 2ZR4A 3H9RB 1FAPA 2BUGA 3CK8A 4ITZA 5D0QD 2KR7A 3IKGA 3HYMB 3O5EA 4JFIA 4TW7A 4HOQA 1E96B 1FCHA 4GZ6A 3B7XA 4LAWA 2XP3A 4G2VA 3ZPJA 2ZR5A 3UI6A 3O5OA 4DRMA 1C9HA 2PV2A 4G23A 3KAHA 5M72A 2C2LA 1XNFA 3FP3A 3U3WA 1OUVA 3RGCA 2Q7FA 4AM9A 2L2SA 2XP5A 1ZBPA 1B89A 1IHGA 3QWVA 2Y78A 4UI9K 1N1AA 3O5KA 4NNRA 3ODKA 2AWGA 4MGVA 4N3CA 3O5JA 1FKJA 3OOBA 3BEEA 2PPPA 4DT4A 1FKDA 1ELRA 4J0UA 2QFCA 1Y0OA 2XP4A 1KLXA 3LCAA 2FBNA 1BKFA 3PRDA 4CGWA 2RUCA 2M08A 2OOEA 4MSPA 3KABA 4ABNA 1ELWA 2KCKA 4JA9A 1QPLA 4A1SA 4YVOA 4G1TA 4U0SA 1D6OA 4DRQA 3O5FA 4JA7A 2MLZA 3O48A 3LY8A 4ODQA 4TW8A 2UY1A 5HW8A 2C0LA 4YVQC 4U85A 3KZ7A 2WPVA 5EX3A 4W9QA 5I98A 4G26A 4KBQA 2VSNA 2AVPA 4U0UA 4G50A 2J9QA 1YA0A 3S7JA 4Y6WA 5DIUA 2VYIA 3CGMA 4GZ5A 4BT8A 1FKBA 4W9OA 1JVWA 3LY9A 3S7BA 5A6CA 3CVPA 4JFLA 4ODMA 1FKKA 2M1IA 5KJKA 4GYYA 3O5DA 2PL2A 4DRJA 4BT9A 3E4BA 4NRHB 3LPZA 4N2SA 3KACA 4BTAA 5EX0A 3QWWA 1HXIA 4GZ3A 5KJLA 2F4EA 4IQ2A 3U4TA 4ODLA 5HWCA 2MLXA 3OXLA 2HYZA 4BTBA 2MHKA 4U07A 2ZQVA 3O5RA 4O6FA 1KT1A 5HQ8A 1FKIA 3SF4A 3ASFA 4AIFA 1Q6HA 4G24A 3QWPA 4Y6CA 3TG5A 3GW4A 3TAXA 2PV1A 4BF8A 1FKFA 2UWJG 5BW8C 2FKEA 3JYMA 4N39A 1HXVA 1KT0A 1YATA 4FN2A 2XPIA 1J4RA 2M2AA 3KAFA 1Q1CA 4O2TA 4UI9J 1ROUA 1NZNA 1NA0A 2RUQA 3MA5A 4LAVA 3UQ3A 3LUOA 2VCDA 4I2ZA 1WM5A 2GW1A 4HORA 2Y4UA 3VAWA 4I17A 5FJYA 3RU0A 1F8AB 4CDRA 3MKRA 2KFWA 4ODNA 2VGXA 2RUDA 4R0XA 3URZA 2DG4A 3ZN3A 4IQCA 5GPGA 2MF9A 5HUAA 1QQEA 5DIZA 5JJ6A 3GPKA 5KJNA 3QDNA 3NTPA 4NQ0A 5HW7A 4DZ3A 2RURA 2VQ2A 2YHCA 3O5MA 5CCLA 5FTPA 4J8DA 4QT3A 5KJMA 4FAPA 1A17A 3Q47B 3ZHEA 3LKUA 4LAXA 2VGXB 3MDYB 2ZQUA 3FFLA 4W9RA 3NRKA 3ASGA 3Q49B 1A7XA 5CCMA 2UY1B 3ASDA 2KO7A 4WNFA 2KE0A 1Q6IA 1M5YA 1PBKA 1TCOC 4HOTA 1D7IA 3VTYA 1BL4A
chains in the Genus database with same CATH superfamily
2X6IA 4JYSA 4WNGA 4YDEA 1FKTA 3PE4A 3R7RA 1LL4A 3ZFWA 3AS3A 3PA7A 3B9DA 2DG3A 2XENA 3SD5A 3EIQC 5BV1A 2EULA 4FLHA 1J4IA 3FUJA 4U8VD 4PS8A 4MNLA 4XIFA 5BNWA 2LNIA 2P9UG 3UX4A 1NMWA 3PZ2A 3AU4A 4UQXA 4RLYA 4U0ZA 3CHSA 2WK2A 2YBUA 2VSYA 1LG1A 3PR9A 4ZFHA 4U04A 3NI6A 4W9PA 4Z68A 4C0MA 4DWSA 4L9PA 3VTXA 5T4YA 2KI3A 2VN1A 3V2XA 1LL6A 1QPFA 4LNGA 1TNBA 2PM6A 1HJVA 2JLBA 4GTRA 4F3VA 3ULEG 2R5SA 4XX5A 1EIBA 1E90A 3G2WA 4OVUA 2LJ4A 1NSGA 1PINA 1E44A 1ZK6A 3CKCA 4U63A 2B31A 2XP9A 4K03A 5CEAA 2YHEA 2LSVA 3I6CA 3O5PA 4G2PA 2A5UA 5BUZA 4HNAD 5LP0A 4ODOA 5DIVA 2ZU6B 4I9EA 4JFJA 4ZPVR 5BXOA 2K8IA 4GA2A 4Z2IA 4DX1A 1W1VA 3DSVA 2XCCA 5HKGA 1WAWA 2QF8A 2DCPA 5BXJA 5FWQA 5HT1A 5EIDA 3T8KA 4EQFA 3TWXA 4L7TA 3R9AB 5A23A 1DVPA 3L13A 2XCBA 2I2OA 4BETA 4I9CA 4GIVA 1X81A 2Y3AA 4ODPA 3CEQA 4KVOA 5T3RA 3UI5A 4IT6A 2H6FA 2CHXA 3DBSA 3CVLA 3B7UX 2A4ZA 2XGMA 3KAIA 2XZDG 4W5UA 3SHFA 2WMNA 4ATGA 4UQZA 3Q4AB 2XP7A 5LFAA 3BG0B 1LL7A 4ANWA 3ZGQA 1WNOA 1FKLA 3FUHA 4A3TA 3RFWA 4Z2GA 4OAVB 1KZOA 2IFUA 1EPUA 3UKRG 5AYWD 5FZSA 4QZVB 2L0TB 1KPSB 4CEMA 1TNYA 1DC2A 4GMLA 2ETCA 3NOGD 5CERB 3LJNA 1N95A 3EIPA 3HXCA 4GYWA 2IONA 3TWTA 1R9HA 3RM4A 2GRPB 2LPVA 2LKNA 1HH8A 4L23A 4AY5A 3KD7A 3JQ0A 2VGEA 4JXTA 2IF4A 1IHBA 1XRVA 2WLYA 1J6YA 4B8AA 1RD6A 2LGOA 2WXHA 4WJXA 4YDWA 4HI8A 3CHOA 5G05C 1S64A 2C0MA 3PDNA 3DSWA 4F6RD 5FT9A 3S7FA 4GTSA 3ZNGA 3ESKA 1U79A 4M3OA 4ILIA 3QK0A 4G8LA 1UJKA 1H19A 1H6KA 2DIWA 5KBAA 2VSOE 2L0IA 4M7CA 4RG6A 1IYGA 4QFVA 1JUQA 3ARTA 3LVQE 3CV0A 3FUIA 3ZYQA 2F8YA 3ARPA 2I9CA 3KEZA 3WL1A 2WXFA 3AJIA 3D9IA 3L9TA 1Z6TA 1WAO1 4AXHA 1FAPA 2BUGA 3CK8A 4ZPTR 3O5EA 4JFIA 3IKGA 3HYMB 1H6PA 1FCHA 3CHMA 1OCZE 4DI3A 2NXPA 2XP3A 2ZR5A 4Q7NA 1TN6A 3UINC 4DRMA 4QQIA 1DCQA 3AAAC 4WWPA 4HRMB 2WLZA 3D9LA 2Q7FA 3CQCB 3G6LA 2A3AA 3B7TA 3DPYA 4Q94A 3FDHA 4JZYA 2Y78A 4J7WA 1N1AA 1EDUA 4MGVA 4XAKA 3O5JA 5EYLA 3UT7A 4HRLA 2PPPA 1FKDA 4MRUA 2WXKA 2J4DA 3ZYMA 1LQ0A 1QPLA 4G1TA 1OCCE 4C9BB 3O5FA 2QYJA 3APFA 4UWFA 4K5AB 4BX9A 3RM9A 5AARA 5HW8A 4NIKA 1K1AA 2DZOA 1U3CA 1WG0A 2WPVA 4IT4A 4TUMA 1SA5A 4G26A 4DRXE 3D9NA 3ARXA 1YA0A 4S3KA 2IO2C 2O92A 5AQAA 4DLQA 4GZ5A 2XPZA 3ULYA 1O6IA 4W9OA 5B3SE 3S7BA 5A6CA 2FO1E 4IULA 1TNOA 3CVPA 1N4RA 1OT8A 3O5DA 3WKZA 3C5RA 3W4RA 1JPLA 4DRJA 2MRIA 3LPZA 4F53A 4BTAA 5EDSA 2Y0BG 5JHAA 4OVVA 4CRWA 3FU6A 4BTBA 2MHKA 4S3JA 1NWUA 5HQ8A 3Q75A 2RG8A 3AU5A 4UWLA 3UM0A 4EHMA 4G24A 3QWPA 4Y6CA 4MLPA 2WXGA 3CVYA 3TAXA 2X3MA 4RVBA 3APDA 2PV1A 1HO8A 2OCCE 3HXFA 4N39A 5ANLA 3G2UA 1YATA 3CLJA 2CFZA 4RSYA 2MOWA 4CZ2D 3ASOE 4UI9J 1ITXA 1NP7A 3B9AA 1NZNA 2RUQA 3LUOA 1E7UA 2VCDA 1WM5A 4HORA 4MPKA 3VAWA 4I17A 5CBOA 1F8AB 2KFWA 5GQBA 3Q9UC 4WWOA 4TXRA 1FVHA 2OV8A 1QQEA 4BESA 3HHMA 4GPMA 4FULA 4L2YA 3TXNA 4GTMA 1EF1C 3DSTA 1HF8A 3KSQA 3AROA 3CQGB 1JCSA 1X6NA 3DEOA 4J8YA 3RMEA 3FULA 5CRVA 1SQMA 3FTYA 2IY0C 3ZKJA 3MDYB 4B0ZA 3FFLA 3IHVA 3FH8A 4GTQA 4F1PA 3E30A 3FH5A 2WXIA 3FEXA 3ASGA 3Q49B 4CDMA 2EINE 2WQ6A 2DSZA 2BF0X 5AQBA 1M5YA 1JNDA 4EECA 4HB5A 4JEUA 2EIME 2YBTA 1BL4A 3FAPA 1O1TA 3KSLA 3K9IA 3ONLA 2E0IA 4FU3A 2XGOA 5BT1A 2BTDA 1GW6A 4GCNA 3ZHEB 4N2QA 2PN0A 2BEDA 2P58C 5DF0A 3QB2A 2RSEA 2RFAA 2IQCA 2PQRA 3AS2A 4U84A 2P4VA 3AG4E 4N3AA 1NFIE 4I1MA 1NWSA 4LEUA 1UR8A 1D9SA 2V5FA 3JCKC 3ZW3A 1YCSB 3CVQA 4MNKA 3VLDA 1ZCNA 1B6CA 2XZTG 4L72B 2GGFA 3WH0A 5EILA 3CVUA 5LCWC 2Y1LE 5ENPD 2ITKA 4AY6A 5JJ7A 4KR0B 4DROA 1NA3A 5LCWJ 3NZUA 3CHPA 3U64A 4GGQA 3RJVA 1TN7A 3FUKA 1HFAA 3WD2A 2V4HC 4P8WA 3QNKA 3UUXA 2IEJA 4WUYA 1BI8B 4U86A 4YDOA 2AOSA 2B6CA 3CK7A 3TWVA 4TX0A 3EHRA 2X6KA 1LF8A 3PS6A 4TNSA 1OY3D 3D9JA 3CKBA 3AS8A 3EU5A 4CT4A 1T11A 2Y4TA 5HI7A 2DZNA 3DXMG 1HX8A 2F8XK 2WQHA 4AEZC 4GYOA 3ZXPA 1U2VG 1UG3A 4B94A 5HTGA 2AXZA 3W9FA 3SI5A 2XRYA 3B7SA 1V54E 3L16A 1OXJA 3IBEA 3J5PA 3CZ8A 4G8KA 3TWRA 3I4RB 4JFMA 4I2WA 1ZBVA 3X2QE 3SO8A 3UMVA 1O5MA 1FD9A 4GZDA 3MYVA 4QT2A 4I1AA 3UI4A 5FQ4A 3Q7AA 3JXIA 1Q6UA 3E33A 4FP7A 3SFZA 3S2AA 4DRIA 3TC5A 1EQ3A 2OEVA 3CHEA 4HQDA 3MKQA 1HKKA 1QBQA 4AY1A 3ML8A 4XKCA 2OFNA 4U7EB 3JQ1A 4UWGA 3RM8A 3UT4A 3ZU7B 2P9IG 4A63B 3QKYA 5JHBA 4LRZA 3WL0A 3OA5A 4BEPA 2RD0A 5BV0A 2DT3A 1TNZA 1INZA 4JHRA 1JCHB 1OWQA 5FQ8A 5KNGA 3I5PA 4LG6A 3DSSA 4Z2KA 1SYTA 4MS6A 4J4NA 1FKRA 3ISMC 1HZ4A 1MJ0A 3ASHA 3PEVB 2XEEA 4XI9A 1ZB5A 5D75A 3IHYA 2LAIA 5CMWA 5GPRA 2PPNA 1JNTA 5HKPA 2XEVA 3VLEA 3V79K 1FKSA 3BG1B 1MZCA 1ROTA 3G2SA 5H7PA 3NF1A 4IN3B 1LTXA 5D0OD 4U96D 2F23A 2X6JA 3EU9A 3FTZA 1ZU8A 2V4LA 4LNBA 2GRLA 3AG3E 3TCZA 1MX2A 3B8SA 2PNNA 2VGYA 4J8EA 2FO7A 3BUAA 3MGBA 4JW1A 1PC2A 3WXXA 4R5EA 3S7DA 2WVIA 4IRUA 1NWTA 4DRPA 3NOCD 3IXEA 3OXGA 5FINA 4JPSA 3SNXA 4HRNA 3WD0A 4GTVA 5CECB 3DEPA 2CHWA 4HOQA 3B7XA 4G2VA 3FEYA 5KCMA 3ZPJA 3G6MA 4P29A 1C9HA 5HS0A 1BLXB 2C2LA 4GMJA 2RKKA 4LGXA 3FP3A 4HLLA 1OWLA 4IYPA 1GPFA 2L2SA 1IHGA 3QWVA 4PH4B 3B9EA 3BEEA 2R02A 3L82A 1YMPA 2GRQB 5AQ9A 3PZ1A 2QFCA 1Y0OA 2XP4A 3EJNA 4Q96A 1KLXA 3LCAA 2FBNA 2WXJA 2M08A 2OOEA 1DNPA 4U8HA 3KABA 3PVLA 4ABNA 1MHQA 2P9KG 4YVOA 3RRMB 1D6OA 5J90A 3CR3A 5B1BE 4HARA 2C0LA 3ARSA 3QOKA 4W9QA 5I98A 2H6IA 2WMOA 4WWNA 3UTMA 3I4GA 4U0UA 1S70B 2DWZA 5DIUA 3LS8A 3FTVA 1TEZA 4BT8A 1FKBA 1W1TA 2BKGA 1JVWA 5T8IA 3R9MA 5CMYA 1RZ4A 1FT2A 4P8XA 1FKKA 2J09A 1N4SA 4GB9A 4BT9A 3CVWA 3E4BA 5BPPA 4NRHB 3CSFA 1D8EA 3QWWA 3SFXA 5KJLA 2F4EA 3G2TA 1JWFA 4ML4A 5HWCA 3LDZA 2HYZA 3OXLA 3PZ3A 4LSZE 4U07A 4YDYA 5EIBE 2V5QC 1FKIA 4FHKA 3Q73A 2QZAA 3ABME 4TRQA 2ZIRA 3PUKA 3B7BA 2J49A 1FKFA 3UT8A 5BW8C 3JYMA 2DVWA 1E7VA 4X8QA 3FU0A 2XHEA 1HXVA 4DX2A 5B1AE 2WXRA 3TL5A 4L3NA 4FN2A 1AP7A 3RAUA 3ARZA 2R59A 3ASNE 2NYJA 1ROUA 3ESLA 4C0EA 2XRZA 3WG7E 3LJ3A 1NA0A 3T5VA 3U66A 3UQ3A 4I2ZA 3ZUVB 2EQXA 3OTNA 2Y4UA 2P2CP 5DEZA 3RU0A 4CT0A 3TWSA 4ODNA 4FJYA 2VGXA 3URZA 1JNEA 3ARYA 2MF9A 5GPGA 2H6HA 3TWQA 3JUEA 5JJ6A 2KM4A 3QDNA 3NTPA 3FUNA 3BQOA 3AQUA 3B13A 4FA6A 5C2YA 5CCLA 1H2VC 2X6HA 4FAPA 3Q47B 3MJWA 3ZHEA 3LKUA 4LAXA 1E9LA 2ZQUA 4O1OA 1K1BA 3DPDA 3ASDA 4WNFA 4JC8A 2KE0A 3PNTB 4K0RA 3E34A 1TCOC 4HOTA 4XE0A 1D7IA 3EY6A 4AJWA 4GU5A 4JFKA 4JVSA 2PPOA 3ARVA 3EHMA 1W3BA 3EHNA 4PDXA 4BSZB 3SQVA 3C98A 1ZL1A 3SBTB 3UM3A 4J8FA 2XS8A 2FDMA 4GCOA 5HWBA 4ZS6A 2GRMA 1HJWA 4ODKA 3IV0A 1W1YA 4LUNU 2A5EA 1TJCA 1Y6IA 2PV3A 3IHZA 1V55E 3UI2A 4YNDA 3FUFA 5DITA 2D9FA 4DPRA 2YINA 2VSXE 1GUVA 2J08A 1SR0A 4LAYA 5JJTA 3GZ2A 3KS2A 3UQIA 2LUHA 4TV3A 3SBSA 1H2UA 3ENEA 3QOUA 2AW6A 2PQNA 5ARFA 3WQVA 4BERA 3BXWA 2R05A 3IKDA 2XP8A 3AS1A 3AS5A 4DLOA 3FU5A 4JHKA 4UWHA 3RRUA 1O1SA 1EDQA 3MV2B 5E75A 4MKTA 3L6AA 5CHEE 5CRUA 4O60A 2VTBB 4B8CB 1N0RA 5AENA 3OXFA 2KATA 3Q79A 4UWKA 2HR2A 2F0YA 5DBKA 2OVBA 3FY4A 3O5QA 3ARUA 4MNMA 4HOSA 1N0QA 1LJYA 4BSXA 3C3QA 2F2DA 4HBEA 4UI9C 4ODRA 4L1BA 4APFA 3ULQA 2NC9A 2IJGX 3RKVA 5J08A 4ME2A 1JNSA 2OLHA 3FUEA 3JYJA 4FC8A 2XPBA 1HG5A 4DH0A 1QZ2A 4QIBA 1E8YA 2I1KA 2FI7A 1NMVA 2JEKA 2Q5AA 3ZYKA 3L54A 5JH8A 3P2BA 3IK8A 3D9HA 4Q22A 2ETNA 3DSUA 1OGBA 4WNDA 3UPVA 4GMRA 2AWIA 3CIAA 4KZCA 3VLFA 5C1DA 3UF8A 1ZU2A 1Q2ZA 3JXJA 1CTNA 1K9TA 2WXQA 3MEKA 3D3MA 2EIJE 5D66A 2FEZA 3ABLE 4JB8P 5ENOD 4AV7A 4XEIG 3V31A 4LCTA 4EZJA 2CHZA 4NSBA 1G3NB 2WB2A 5AN8A 5B8IC 4CGVA 4V3IA 4N19A 3ZEFA 2ZQSA 4J8SA 1N54A 4GTPA 4N3BA 2WM0A 3MKQB 3MV3B 1E6ZA 1MX4A 3ZRHA 3CHDA 4R7LA 2WXPA 5AAOA 1FJDA 2PI6A 1WB0A 3F6QA 1ZBWA 4E85A 5EYPF 4BX8A 4L2LA 4Q69A 4DRKA 3O5GA 4DRHA 2WXOA 3PEUB 1Y8MA 2XEHA 3SGHA 4DX7D 3Q5MA 3KAEA 3Q78A 3FU3A 4C02B 5HW6A 2ZQTA 1HG2A 4FADA 2OEWA 1SA4A 3RIBA 1DCEA 3CVNA 3SY2A 3JXVA 3UQBA 4WKFA 3DRAA 4RG9A 3J5QB 4KYOB 2F21A 2XPAA 5ENQD 3L22A 3KEAA 1HE8A 2DBAA 2MPHA 2JZVA 4H7YA 2LO6A 3SFYA 5G04C 2DPEA 2KBXA 3N71A 3MCXA 4MAVA 5EKQD 3Q15A 5ENRD 2ZR4A 3NQPA 2ETAA 1RW2A 3H9RB 3PZDA 4NZCA 4ITZA 4NURA 1E96B 2FULA 3W9GA 4LAWA 3WD4A 3UI6A 3V2OA 1JCRA 2PV2A 3MZLB 1KZPA 4JD2G 2DT0A 1H2TC 3D9KA 4AM9A 1B89A 3NBNB 2JABA 3DSXA 4GTTA 1FKJA 2QY7A 1ELRA 4J0UA 2VTBA 2HM8A 1FFQA 2IU1A 4MSPA 3UXGA 1ELWA 4A55A 2A3BA 4DUIA 4KT6B 4A1SA 1OCRE 3AG2E 4U0SA 4JA7A 3LY8A 4HBOA 4ODQA 1W9PA 3KZ7A 1SZAA 1E15A 2G8ZA 2VSNA 3CHCA 2AVPA 1K3ZD 4G50A 1HS6A 2J9QA 2LXLA 3S7JA 2WXLA 2VYIA 3CGMA 1N94A 4MTVA 3T5XA 2V0PA 4DI4A 4BY6A 2KZTB 3Q7FA 5AIJA 4ODMA 5KJKA 2PL2A 2J8SD 3KACA 4JEHA 5EX0A 4DK5A 1VF8A 1HXIA 4GZ3A 3PUJA 4K5BA 3TXMA 2MLXA 2DYSE 3O5RA 4O6FA 1KT1A 2ESCA 4DJAA 4AIFA 1Q6HA 2H6GA 4FJZA 3GW4A 3E32A 2UWJG 1N4QA 2DSVA 3D9MA 4PS3A 2XQ0A 3CVVA 1J4RA 1Q1CA 4O2TA 2AXVA 2ZXWE 3CHFA 1D8DA 1UW4B 2AJAA 2G41A 4G11A 2GROB 4KMOA 3UM2A 4LAVA 3UIOC 3PH0C 1GOIA 4ANVA 2GW1A 2R03A 4CDRA 1XHGA 4HFGA 1A5EA 4R0XA 1GRJA 2DG4A 4DX6D 2B5UB 4WK9A 1FPPA 1LD8A 4IQCA 5HUAA 1BI7B 3BU8A 4HS2A 5FQ7A 5DIZA 1WDYA 3AS0A 1JWGA 3L17A 5ENTD 3BMBA 4NQ0A 4CDNA 4DZ3A 3LEWA 2VQ2A 2YHCA 1W9VA 3O5MA 1LD7A 5FTPA 1OWOA 1TN8A 1OGGA 3B95A 4ILHB 4F1SA 4DWSB 4QT3A 5KJMA 4NACA 1A17A 3QC1A 3PRAA 4W9RA 1HU3A 4OYSA 1E6NA 3RK6A 4O1PA 1HKJA 2GRRB 3HDXA 3RRNB 1NI1A 3UKUG 2RFMA 2J4BA 3PNLB 3UIPC 4A1GA 1PBKA 4Z2HA 4MNJA 2X38A 3VTYA 3EIJA 2EILE 5A7DB 1H0AA 3CK9A 3PRBA 3TGOA 2WQ7A 3EDTB 5JMND 3HXEA 5ENSD 4XZ4A 2P9LG 3C3OA 3RO3A 4I1OB 2BKKB 2CFUA 3ARWA 3OAWA 3LY7A 4N5QA 3HXBA 4C48B 1ZBKA 4GA0A 4EBAA 3KADA 4DRNA 1IXVA 4BWRA 5HRYA 3PE3A 5FZQA 4GZCA 3JUIA 4N5CA 5G55A 3TJPA 4HVBA 3IEGA 2DSUA 2IOSA 4F7AA 1S63A 1IKND 3IKOB 4ZHBA 4XI0A 3NB2A 3FXYA 2L6JA 4LNUD 3FTUA 4WNEA 1W1PA 2DYRE 4GAAA 1E8WA 1N4PA 3EHQA 3MX3A 5FQ6A 2FAPA 2L6BA 3SZ7A 2MNTA 3U9WA 2VJ8A 3GZ1A 4URKA 2WXMA 2V8SE 3FTSA 2ZR6A 2LSUA 2ONDA 4I6GA 3CGNA 1J4HA 4B93B 4U95D 2PZIA 4H7XA 4UDMA 5ARGA 2KGJA 3PRZA 5IY5E 5AJLA 4I6JA 2KC7A 3GTYX 2ETBA 1X5BA 1EYMA 1D7JA 3O5LA 3HXDA 5J6EA 2QYUA 4ANXA 1TR4A 3UQAA 2XPYA 1U3DA 2LAHA 4DZ2A 1AWCB 4ANUA 3JYSA 5KNHD 2DG9A 2ZGGA 3FWVA 3V30A 3C72A 3KCEA 1VDYA 3UM1A 2FF4A 3HVEA 1YW5A 4AOFA 4ZPWR 4EPZA 2RQSA 2ILRA 3B7RL 3TDBA 3AS4A 4ILGA 1N52A 1BD8A 1H6OA 2KXPC 5KWDA 1MQSA 5G2NA 1Z3XA 3RSEG 2KCLA 4B89A 1S0PA 4HLEA 1NH6A 4HOUA 5FZRA 4DWSD 1QNFA 3HIZA 4P8UA 2NSZA 1IQRA 1F40A 2ZGDA 3ALFA 3CHQA 3O4ZA 1HJXA 1W9UA 2GRNB 1OWPA 4HBDA 4KXKB 4FLBA 2MLYA 5ENNA 4BFRA 4TUUA 2E2EA 3ONKA 5LOZA 1LG2A 1P5QA 2N87A 3O5IA 1L5JA 5LX8A 1UR9A 2I1JA 4IPXA 5CBNA 3QAQA 2ZISA 3C3RA 4WIWA 4HXIA 1H0GA 4KZ0A 5G05J 2HO1A 2KCVA 4E6HA 4EZLA 5G04J 4TYOA 3T8MA 2XP6A 4DIPA 4A3VA 4LERA 2R2LA 1OWMA 4UQYA 3LYAA 4APOA 1XGWA 2DSWA 2PBCA 2UZ5A 2CG3A 3TG4A 4PS7A 3CHRA 1W26A 4D10C 1EYHA 1QYMA 1TYQG 4G25A 1UN8A 3KAGA 2WXNA 4ACLA 3NAWA 4ATZD 1FKGA 4GA1A 2YQ8A 3ZVVA 4EZKA 3P1UA 2I6HA 4TW6A 3GU0A 4J4OA 2XGSA 1FKHA 4JL0A 1PY1A 3FUMA 3GYZA 4U8YD 1L1PA 1E8ZA 3RO2A 1D7HA 2XS1A 1D2KA 3EUVA 3FUDA 4FHJA 1H0IA 4ACKA 4TXPA 1E8XA 4I43A 5ANRA 4GPKA 1ZB1A 1N11A 4I6EA 1SVXA 5D0QD 2KR7A 4TW7A 5AQ7A 5AJDA 4DWSC 4GZ6A 3DXKG 3CVXA 2X6FA 1ELKA 2A3CA 4HI9A 3O5OA 1N9AA 2LXMA 4G23A 3KAHA 5M72A 1XNFA 3U3WA 1OUVA 3RGCA 2XP5A 3FY1A 1ZBPA 3CSTA 4AP2A 3NZSA 3FTWA 2EIKE 4UI9K 3O5KA 4NNRA 1E6RA 3ODKA 2AWGA 5JA4D 4N3CA 1FFRA 2IOLA 3OOBA 1E6PA 5EN5D 4DT4A 1KFWA 4Z2JA 3T9KA 4OAUC 1BKFA 3PRDA 4CGWA 2RUCA 4CYMD 4UUCA 2KZTA 4XKBA 2KCKA 4JA9A 1TNUA 3CGHA 2IUZA 3ALGA 1UJJA 4DRQA 2MLZA 3O48A 2B0OE 5FIOA 4TW8A 2UY1A 3FH7A 4YVQC 4U85A 2WM9A 5EX3A 3D9OA 3L08A 1FVFA 1MYOA 4KBQA 2IO3C 1NL4A 4AVXA 4Y6WA 4URIA 1BU9A 2CG2A 3LY9A 4EBAG 4GTOA 4JFLA 4WAFA 1HKMA 3WQWA 2DT1A 2M1IA 4GYYA 1OCOE 4N2SA 4WKAA 5BXUA 3GZSA 5D2MC 3TWWA 2O9OA 4IQ2A 3U4TA 1HKIA 3E37A 4ODLA 1IQUA 3DWLG 4TXQA 4PTMA 3WD3A 2ZQVA 3SF4A 2P9NG 2Y69E 3ASFA 4KVMA 1TJFA 1BPOA 5CEDB 4J6IA 3ARRA 4Z2LA 3TG5A 3LXUX 1FT1A 4BF8A 2FKEA 1KT0A 1SZ9A 2XPIA 4KQZA 1YYHA 1IX5A 1NWRA 2M2AA 3KAFA 4RQIA 3PZ4A 1OWNA 2DT2A 1ZBCA 4WKHA 3APCA 3ZYLA 2MYOA 3QJZA 3LVRE 3HG0D 3MA5A 1K8KG 3R7QA 2M63A 5FJYA 3ZXSA 2QC9A 2F37A 3MKRA 3ARQA 1Z5SC 1Z3YA 3HRAA 3FTXA 2RUDA 3I3NA 3ZN3A 3FHEA 3WIJA 1WY6A 1SW6A 1UN9A 2J07A 3GPKA 1PAQA 1UOHA 3G2VA 1X6LA 5KJNA 2YNQA 3AG1E 3WD1A 4PUCA 5HW7A 1EHNA 1O1RA 2HE0A 4JHJA 2RURA 1TFVA 3CH9A 1JCQA 2P9PG 4K5CA 4J8DA 2PM7A 2R17C 2OVFA 2VGXB 3D9PA 3TWUA 3NRKA 4CCAA 2L9BA 5E76A 3ZIMA 1MX6A 1A7XA 5CCMA 2UY1B 3HVEB 4P8VA 2KO7A 3Q9NC 3PREA 1Q6IA 3QARA 3ABKE 3ML9A 4DX5D 2AXUA 2P9SG 2A3EA 5HBFA 4MBGA 5DO2A 5ITZF
chains in the Genus database with same CATH topology
2X6IA 4JYSA 4WNGA 1FKTA 3PE4A 3R7RA 1LL4A 3ZFWA 3AS3A 3PA7A 3B9DA 2DG3A 3SD5A 3EIQC 5BV1A 4FLHA 1J4IA 3FUJA 4PS8A 4MNLA 4XIFA 5BNWA 2LNIA 3UX4A 1NMWA 3AU4A 4UQXA 4U0ZA 3CHSA 2WK2A 2YBUA 2VSYA 1LG1A 3PR9A 4U04A 3NI6A 4W9PA 4C0MA 4DWSA 3VTXA 5T4YA 2KI3A 2VN1A 1LL6A 1QPFA 2PM6A 1HJVA 2JLBA 4F3VA 2R5SA 4XX5A 1EIBA 1E90A 3G2WA 4OVUA 2LJ4A 1NSGA 1PINA 1ZK6A 3CKCA 4U63A 2B31A 2XP9A 4K03A 2YHEA 2LSVA 3I6CA 3O5PA 4G2PA 2A5UA 5BUZA 5LP0A 4ODOA 5DIVA 2ZU6B 4I9EA 4JFJA 4ZPVR 2K8IA 4GA2A 4Z2IA 1W1VA 2XCCA 5HKGA 1WAWA 2QF8A 2DCPA 5BXJA 5FWQA 5HT1A 4EQFA 4L7TA 3R9AB 5A23A 1DVPA 3L13A 2XCBA 2I2OA 4I9CA 4GIVA 2Y3AA 4ODPA 3CEQA 4KVOA 5T3RA 3UI5A 4IT6A 2CHXA 3DBSA 3CVLA 3B7UX 2A4ZA 2XGMA 3KAIA 4W5UA 3SHFA 2WMNA 4ATGA 4UQZA 3Q4AB 2XP7A 5LFAA 3BG0B 1LL7A 4ANWA 3ZGQA 1WNOA 1FKLA 3FUHA 4A3TA 3RFWA 4Z2GA 2IFUA 1EPUA 5AYWD 5FZSA 4QZVB 2L0TB 4CEMA 4GMLA 4GYWA 2IONA 1R9HA 3RM4A 2LPVA 2LKNA 1HH8A 4L23A 4AY5A 3KD7A 3JQ0A 4JXTA 2WLYA 2IF4A 1J6YA 1XRVA 4B8AA 1RD6A 2LGOA 2WXHA 4WJXA 3CHOA 5G05C 2C0MA 3PDNA 5FT9A 3S7FA 3ESKA 1U79A 4M3OA 4ILIA 3QK0A 1UJKA 1H19A 1H6KA 2DIWA 2VSOE 2L0IA 4RG6A 1IYGA 4QFVA 1JUQA 3ARTA 3LVQE 3CV0A 3FUIA 3ZYQA 3ARPA 2I9CA 3KEZA 3WL1A 2WXFA 3D9IA 1Z6TA 1WAO1 4AXHA 1FAPA 4ZPTR 2BUGA 3CK8A 3O5EA 4JFIA 3IKGA 3HYMB 1FCHA 3CHMA 4DI3A 2NXPA 2XP3A 2ZR5A 4Q7NA 4DRMA 4WWPA 2WLZA 3D9LA 2Q7FA 3CQCB 3G6LA 2A3AA 3B7TA 4Q94A 3FDHA 4JZYA 2Y78A 1N1AA 1EDUA 4MGVA 4XAKA 3O5JA 3UT7A 2PPPA 1FKDA 4MRUA 2WXKA 2J4DA 3ZYMA 1LQ0A 1QPLA 4G1TA 4C9BB 3O5FA 3APFA 4UWFA 4BX9A 3RM9A 5HW8A 1U3CA 2WPVA 4IT4A 4G26A 3D9NA 3ARXA 1YA0A 4S3KA 2O92A 4DLQA 4GZ5A 2XPZA 1O6IA 4W9OA 3S7BA 5A6CA 4IULA 3CVPA 3O5DA 3WKZA 3W4RA 1JPLA 4DRJA 2MRIA 3LPZA 4F53A 4BTAA 5EDSA 5JHAA 4OVVA 4CRWA 3FU6A 4BTBA 2MHKA 4S3JA 1NWUA 5HQ8A 2RG8A 3AU5A 4UWLA 4G24A 3QWPA 4Y6CA 4MLPA 2WXGA 3CVYA 3TAXA 2X3MA 4RVBA 3APDA 2PV1A 1HO8A 4N39A 5ANLA 3G2UA 1YATA 3CLJA 2CFZA 4RSYA 2MOWA 4UI9J 1ITXA 1NP7A 3B9AA 1NZNA 2RUQA 3LUOA 2VCDA 1E7UA 1WM5A 4HORA 4MPKA 3VAWA 4I17A 1F8AB 2KFWA 5GQBA 4WWOA 1FVHA 2OV8A 1QQEA 3HHMA 4FULA 4L2YA 3TXNA 1EF1C 1HF8A 3AROA 3CQGB 1X6NA 3RMEA 3FULA 1SQMA 3FTYA 3MDYB 4B0ZA 3FFLA 3IHVA 3FH8A 3FH5A 2WXIA 3FEXA 3ASGA 3Q49B 4CDMA 2WQ6A 2DSZA 2BF0X 1M5YA 1JNDA 4EECA 4JEUA 2YBTA 1BL4A 3FAPA 3K9IA 3ONLA 2E0IA 4FU3A 2XGOA 5BT1A 2BTDA 1GW6A 4GCNA 3ZHEB 4N2QA 2P58C 5DF0A 3QB2A 2RSEA 2IQCA 2PQRA 3AS2A 4U84A 4N3AA 4I1MA 1NWSA 4LEUA 1UR8A 2V5FA 3JCKC 3ZW3A 4MNKA 3CVQA 3VLDA 1ZCNA 1B6CA 4L72B 2GGFA 3WH0A 3CVUA 5LCWC 2ITKA 4AY6A 5JJ7A 4KR0B 4DROA 1NA3A 5LCWJ 3NZUA 3CHPA 3U64A 4GGQA 3RJVA 3FUKA 1HFAA 3WD2A 4P8WA 3QNKA 3UUXA 4WUYA 4U86A 2AOSA 3CK7A 4TX0A 2X6KA 1LF8A 3PS6A 4TNSA 3D9JA 3CKBA 3AS8A 4CT4A 1T11A 2Y4TA 5HI7A 1HX8A 2WQHA 4AEZC 4GYOA 1UG3A 4B94A 5HTGA 2AXZA 3SI5A 2XRYA 3B7SA 3L16A 3IBEA 3CZ8A 3I4RB 4JFMA 4I2WA 1ZBVA 3UMVA 1FD9A 4GZDA 3MYVA 4QT2A 4I1AA 3UI4A 5FQ4A 1Q6UA 4FP7A 3SFZA 3S2AA 4DRIA 3TC5A 1EQ3A 3CHEA 3MKQA 1HKKA 4AY1A 3ML8A 4XKCA 2OFNA 3JQ1A 4UWGA 3RM8A 3UT4A 3QKYA 5JHBA 4LRZA 3WL0A 3OA5A 2RD0A 5BV0A 2DT3A 1INZA 4JHRA 1OWQA 5FQ8A 3I5PA 4Z2KA 1SYTA 4MS6A 4J4NA 1FKRA 1HZ4A 3ASHA 3PEVB 4XI9A 5D75A 1ZB5A 3IHYA 2LAIA 5CMWA 5GPRA 2PPNA 1JNTA 2XEVA 3VLEA 1FKSA 3BG1B 1ROTA 3G2SA 3NF1A 4IN3B 5D0OD 2X6JA 3FTZA 1ZU8A 2V4LA 2GRLA 3TCZA 3B8SA 2VGYA 4J8EA 2FO7A 3MGBA 4JW1A 1PC2A 3WXXA 4R5EA 3S7DA 2WVIA 4IRUA 1NWTA 4DRPA 3OXGA 4JPSA 3SNXA 3WD0A 2CHWA 4HOQA 3B7XA 4G2VA 3FEYA 5KCMA 3ZPJA 3G6MA 4P29A 1C9HA 2C2LA 4GMJA 4LGXA 3FP3A 1OWLA 4IYPA 1GPFA 2L2SA 1IHGA 3QWVA 4PH4B 3B9EA 3BEEA 2QFCA 1Y0OA 2XP4A 3EJNA 4Q96A 1KLXA 3LCAA 2FBNA 2WXJA 2M08A 2OOEA 1DNPA 4U8HA 3KABA 3PVLA 4ABNA 1MHQA 4YVOA 3RRMB 1D6OA 5J90A 3CR3A 4HARA 2C0LA 3ARSA 3QOKA 4W9QA 5I98A 2WMOA 4WWNA 3I4GA 4U0UA 5DIUA 3LS8A 3FTVA 1TEZA 4BT8A 1FKBA 1W1TA 1JVWA 5T8IA 5CMYA 4P8XA 1FKKA 2J09A 4GB9A 4BT9A 3CVWA 3E4BA 5BPPA 4NRHB 3CSFA 3QWWA 5KJLA 2F4EA 3G2TA 1JWFA 4ML4A 5HWCA 3LDZA 2HYZA 3OXLA 4U07A 1FKIA 4FHKA 4TRQA 3PUKA 2J49A 1FKFA 3UT8A 5BW8C 3JYMA 1E7VA 3FU0A 2XHEA 1HXVA 2WXRA 3TL5A 4L3NA 4FN2A 3ARZA 2R59A 1ROUA 3ESLA 4C0EA 2XRZA 3LJ3A 1NA0A 3T5VA 3U66A 3UQ3A 4I2ZA 2EQXA 3OTNA 2Y4UA 5DEZA 3RU0A 4CT0A 4ODNA 4FJYA 2VGXA 3URZA 1JNEA 3ARYA 2MF9A 5GPGA 5JJ6A 2KM4A 3QDNA 3NTPA 3FUNA 3AQUA 3B13A 4FA6A 5C2YA 1H2VC 5CCLA 2X6HA 4FAPA 3Q47B 3MJWA 3ZHEA 3LKUA 4LAXA 1E9LA 2ZQUA 3DPDA 3ASDA 4WNFA 4JC8A 2KE0A 3PNTB 4K0RA 1TCOC 4HOTA 4XE0A 1D7IA 3EY6A 4AJWA 4GU5A 4JFKA 4JVSA 2PPOA 3ARVA 3EHMA 1W3BA 3EHNA 4PDXA 3C98A 1ZL1A 3SBTB 4J8FA 2FDMA 4GCOA 5HWBA 4ZS6A 2GRMA 1HJWA 4ODKA 3IV0A 1W1YA 4LUNU 1TJCA 1Y6IA 2PV3A 3IHZA 4YNDA 3FUFA 5DITA 2D9FA 4DPRA 2YINA 2VSXE 1GUVA 2J08A 1SR0A 4LAYA 5JJTA 3GZ2A 3KS2A 3UQIA 4TV3A 3SBSA 1H2UA 3ENEA 3QOUA 2AW6A 2PQNA 5ARFA 3WQVA 3BXWA 3IKDA 2XP8A 3AS1A 3AS5A 4DLOA 3FU5A 4JHKA 4UWHA 3RRUA 1EDQA 3MV2B 5E75A 4MKTA 3L6AA 5CHEE 2VTBB 4B8CB 5AENA 3OXFA 2KATA 4UWKA 2HR2A 5DBKA 2OVBA 3FY4A 3O5QA 3ARUA 4MNMA 4HOSA 1LJYA 4BSXA 2F2DA 4HBEA 4UI9C 4ODRA 4L1BA 4APFA 3ULQA 2NC9A 2IJGX 3RKVA 5J08A 4ME2A 1JNSA 2OLHA 3FUEA 3JYJA 4FC8A 2XPBA 1HG5A 4DH0A 1QZ2A 4QIBA 1E8YA 2I1KA 2FI7A 1NMVA 2JEKA 2Q5AA 3ZYKA 3L54A 5JH8A 3P2BA 3IK8A 4Q22A 1OGBA 4WNDA 3UPVA 2AWIA 3CIAA 4KZCA 3VLFA 5C1DA 3UF8A 1ZU2A 1CTNA 1K9TA 2WXQA 3MEKA 3D3MA 2FEZA 4AV7A 4LCTA 4EZJA 2CHZA 4NSBA 2WB2A 5B8IC 4CGVA 4V3IA 4N19A 3ZEFA 2ZQSA 4J8SA 1N54A 4N3BA 2WM0A 3MKQB 3MV3B 1E6ZA 3ZRHA 3CHDA 2WXPA 4R7LA 1FJDA 2PI6A 1WB0A 1ZBWA 4E85A 4BX8A 4L2LA 4Q69A 4DRKA 3O5GA 4DRHA 2WXOA 3PEUB 1Y8MA 3SGHA 3Q5MA 3KAEA 3FU3A 4C02B 5HW6A 2ZQTA 1HG2A 4FADA 3RIBA 3CVNA 3JXVA 3UQBA 4WKFA 4RG9A 4KYOB 2F21A 2XPAA 3L22A 1HE8A 2DBAA 2MPHA 2JZVA 4H7YA 2LO6A 5G04C 2DPEA 3N71A 3MCXA 4MAVA 5EKQD 3Q15A 2ZR4A 3NQPA 3H9RB 3PZDA 4NZCA 4ITZA 4NURA 1E96B 2FULA 4LAWA 3WD4A 3UI6A 2PV2A 3MZLB 2DT0A 1H2TC 3D9KA 4AM9A 1B89A 1FKJA 2QY7A 1ELRA 4J0UA 2VTBA 2HM8A 1FFQA 2IU1A 4MSPA 1ELWA 4A55A 2A3BA 4KT6B 4A1SA 4U0SA 4JA7A 3LY8A 4HBOA 4ODQA 1W9PA 3KZ7A 1SZAA 1E15A 2G8ZA 2VSNA 3CHCA 2AVPA 4G50A 1HS6A 2J9QA 3S7JA 2WXLA 2VYIA 3CGMA 4MTVA 3T5XA 2V0PA 4DI4A 4BY6A 2KZTB 5AIJA 4ODMA 5KJKA 2PL2A 3KACA 4JEHA 5EX0A 4DK5A 1VF8A 1HXIA 4GZ3A 3PUJA 3TXMA 2MLXA 3O5RA 4O6FA 1KT1A 2ESCA 4DJAA 4AIFA 1Q6HA 4FJZA 3GW4A 2UWJG 2DSVA 3D9MA 4PS3A 2XQ0A 3CVVA 1J4RA 1Q1CA 4O2TA 2AXVA 3CHFA 1UW4B 2G41A 4G11A 4KMOA 4LAVA 3PH0C 1GOIA 4ANVA 2GW1A 4CDRA 1XHGA 4HFGA 4R0XA 2DG4A 4WK9A 4IQCA 5HUAA 4HS2A 5FQ7A 5DIZA 3AS0A 1JWGA 3L17A 4NQ0A 4CDNA 4DZ3A 3LEWA 2VQ2A 2YHCA 1W9VA 3O5MA 5FTPA 1OWOA 1OGGA 4ILHB 4F1SA 4DWSB 4QT3A 5KJMA 4NACA 1A17A 3QC1A 3PRAA 4W9RA 1HU3A 4OYSA 1E6NA 3RK6A 1HKJA 3HDXA 3RRNB 1PBKA 2J4BA 3PNLB 4A1GA 4Z2HA 4MNJA 2X38A 3VTYA 3EIJA 5A7DB 1H0AA 3CK9A 3PRBA 3TGOA 2WQ7A 3EDTB 4XZ4A 3RO3A 4I1OB 2CFUA 3ARWA 3OAWA 3LY7A 1ZBKA 4GA0A 4EBAA 3KADA 4DRNA 4BWRA 3PE3A 5FZQA 4GZCA 3JUIA 4N5CA 5G55A 3TJPA 4HVBA 3IEGA 2DSUA 2IOSA 4F7AA 3IKOB 4XI0A 3FXYA 2L6JA 3FTUA 4WNEA 1W1PA 4GAAA 1E8WA 3MX3A 5FQ6A 2FAPA 3SZ7A 2MNTA 3U9WA 2VJ8A 3GZ1A 4URKA 2WXMA 2V8SE 3FTSA 2ZR6A 2LSUA 2ONDA 4I6GA 3CGNA 1J4HA 2PZIA 4H7XA 5ARGA 2KGJA 3PRZA 5AJLA 4I6JA 2KC7A 1X5BA 1EYMA 1D7JA 3O5LA 5J6EA 4ANXA 3UQAA 2XPYA 1U3DA 2LAHA 4DZ2A 4ANUA 3JYSA 2DG9A 3FWVA 3KCEA 1VDYA 2FF4A 3HVEA 1YW5A 4AOFA 4ZPWR 4EPZA 2RQSA 2ILRA 3B7RL 3TDBA 3AS4A 4ILGA 1N52A 1MQSA 5G2NA 1Z3XA 2KCLA 4B89A 1S0PA 4HLEA 1NH6A 4HOUA 5FZRA 4DWSD 1QNFA 3HIZA 4P8UA 2NSZA 1IQRA 1F40A 3ALFA 3CHQA 3O4ZA 1HJXA 1W9UA 1OWPA 4KXKB 4FLBA 2MLYA 5ENNA 4BFRA 4TUUA 2E2EA 3ONKA 5LOZA 1LG2A 1P5QA 2N87A 3O5IA 1L5JA 5LX8A 1UR9A 2I1JA 4IPXA 3QAQA 4WIWA 4HXIA 1H0GA 4KZ0A 5G05J 2HO1A 2KCVA 4E6HA 4EZLA 5G04J 4TYOA 3T8MA 2XP6A 4DIPA 4A3VA 4LERA 1OWMA 4UQYA 3LYAA 4APOA 1XGWA 2PBCA 2DSWA 2UZ5A 2CG3A 3TG4A 4PS7A 3CHRA 1W26A 4D10C 1EYHA 4G25A 1UN8A 3KAGA 2WXNA 4ACLA 1FKGA 4GA1A 2YQ8A 2I6HA 3P1UA 3ZVVA 4EZKA 4TW6A 4J4OA 2XGSA 1FKHA 4JL0A 1PY1A 3FUMA 3GYZA 1L1PA 1E8ZA 3RO2A 1D7HA 1D2KA 3FUDA 4FHJA 1H0IA 4ACKA 1E8XA 4I43A 5ANRA 4GPKA 4I6EA 5D0QD 2KR7A 4TW7A 5AJDA 4DWSC 4GZ6A 3CVXA 2X6FA 1ELKA 2A3CA 3O5OA 4G23A 3KAHA 5M72A 1XNFA 3U3WA 1OUVA 3RGCA 2XP5A 3FY1A 1ZBPA 3CSTA 4AP2A 3NZSA 3FTWA 4UI9K 3O5KA 4NNRA 1E6RA 3ODKA 2AWGA 4N3CA 1FFRA 2IOLA 3OOBA 1E6PA 4DT4A 1KFWA 4Z2JA 1BKFA 3PRDA 4CGWA 2RUCA 2KZTA 4XKBA 2KCKA 4JA9A 3CGHA 2IUZA 3ALGA 1UJJA 4DRQA 2MLZA 3O48A 4TW8A 2UY1A 3FH7A 4YVQC 4U85A 2WM9A 5EX3A 3D9OA 3L08A 1FVFA 4KBQA 4AVXA 4Y6WA 4URIA 2CG2A 3LY9A 4EBAG 4JFLA 4WAFA 1HKMA 3WQWA 2DT1A 2M1IA 4GYYA 4N2SA 4WKAA 3GZSA 2O9OA 4IQ2A 3U4TA 1HKIA 4ODLA 1IQUA 4PTMA 3WD3A 2ZQVA 3SF4A 3ASFA 4KVMA 1TJFA 1BPOA 4J6IA 3ARRA 4Z2LA 3TG5A 3LXUX 4BF8A 2FKEA 1KT0A 1SZ9A 2XPIA 4KQZA 1IX5A 1NWRA 2M2AA 3KAFA 1OWNA 2DT2A 1ZBCA 4WKHA 3APCA 3ZYLA 3QJZA 3LVRE 3MA5A 3R7QA 2M63A 5FJYA 3ZXSA 3MKRA 3ARQA 1Z3YA 3FTXA 2RUDA 3I3NA 3ZN3A 3FHEA 3WIJA 1WY6A 1UN9A 2J07A 3GPKA 1PAQA 3G2VA 1X6LA 5KJNA 2YNQA 3WD1A 4PUCA 5HW7A 1EHNA 4JHJA 3CH9A 1TFVA 2RURA 4J8DA 2PM7A 2R17C 2OVFA 2VGXB 3D9PA 3NRKA 4CCAA 2L9BA 5E76A 3ZIMA 1A7XA 5CCMA 2UY1B 3HVEB 4P8VA 2KO7A 3PREA 1Q6IA 3QARA 3ML9A 2AXUA 2A3EA 5HBFA 5DO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EY6 A;  4JYS A;  5A7D B;  4WNG A;  3FAP A;  4JFK A;  3CK9 A;  3PRB A;  2PPO A;  3K9I A;  3TGO A;  1FKT A;  3PE4 A;  3EDT B;  1W3B A;  2XGO A;  5BT1 A;  3ZFW A;  3PA7 A;  4GCN A;  3ZHE B;  4N2Q A;  2DG3 A;  2P58 C;  4J8F A;  3RO3 A;  2RSE A;  5HWB A;  4GCO A;  2PQR A;  4ODK A;  4U84 A;  4N3A A;  3LY7 A;  1TJC A;  4GA0 A;  1J4I A;  2PV3 A;  3IHZ A;  4LEU A;  3KAD A;  4DRN A;  4XIF A;  2V5F A;  4YND A;  5BNW A;  3CVQ A;  4BWR A;  3PE3 A;  5DIT A;  2D9F A;  2LNI A;  1ZCN A;  1B6C A;  1NMW A;  5FZQ A;  3WH0 A;  4UQX A;  4U0Z A;  5LCW C;  4LAY A;  5JJT A;  3GZ2 A;  3KS2 A;  4N5C A;  2ITK A;  4AY6 A;  2VSY A;  3UQI A;  5JJ7 A;  4DRO A;  4U04 A;  3NI6 A;  4W9P A;  1NA3 A;  5LCW J;  3IEG A;  4GGQ A;  3RJV A;  3QOU A;  2PQN A;  3VTX A;  2KI3 A;  2VN1 A;  4XI0 A;  5ARF A;  3UUX A;  1QPF A;  4WUY A;  3IKD A;  2L6J A;  2XP8 A;  2JLB A;  3AS5 A;  4WNE A;  4F3V A;  4U86 A;  3CK7 A;  4TX0 A;  2R5S A;  3MV2 B;  2FAP A;  4TNS A;  3SZ7 A;  2LJ4 A;  2MNT A;  5CHE E;  1NSG A;  1PIN A;  1ZK6 A;  3CKB A;  3AS8 A;  3CKC A;  3GZ1 A;  1T11 A;  2Y4T A;  5HI7 A;  2XP9 A;  3OXF A;  2KAT A;  2HR2 A;  2ZR6 A;  5DBK A;  2LSU A;  2LSV A;  3I6C A;  3O5P A;  4G2P A;  2OND A;  3O5Q A;  3CGN A;  4ODO A;  1J4H A;  2WQH A;  5DIV A;  4HOS A;  2PZI A;  4H7X A;  4GYO A;  4I9E A;  4JFJ A;  5ARG A;  2KGJ A;  2K8I A;  4GA2 A;  2F2D A;  4B94 A;  5HTG A;  2KC7 A;  2XCC A;  4UI9 C;  1EYM A;  1D7J A;  3O5L A;  4ODR A;  5HKG A;  3ULQ A;  5J6E A;  2NC9 A;  3UQA A;  5BXJ A;  5HT1 A;  4DZ2 A;  4EQF A;  4JFM A;  4I2W A;  3RKV A;  3JYS A;  4ME2 A;  1JNS A;  3R9A B;  2DG9 A;  3JYJ A;  2XCB A;  1FD9 A;  4I9C A;  3FWV A;  2XPB A;  4GIV A;  3KCE A;  4ODP A;  2FF4 A;  3CEQ A;  1YW5 A;  4QT2 A;  4DH0 A;  1QZ2 A;  4I1A A;  3UI5 A;  3UI4 A;  4QIB A;  2RQS A;  2FI7 A;  1Q6U A;  1NMV A;  3CVL A;  2XGM A;  2Q5A A;  3KAI A;  3TDB A;  3AS4 A;  3IK8 A;  4DRI A;  3TC5 A;  1EQ3 A;  4WND A;  3UPV A;  5C1D A;  4UQZ A;  3UF8 A;  3Q4A B;  2KCL A;  2XP7 A;  1ZU2 A;  2OFN A;  3ZGQ A;  3MEK A;  4HOU A;  1FKL A;  5FZR A;  3RFW A;  2FEZ A;  2IFU A;  5AYW D;  5FZS A;  3QKY A;  1F40 A;  4KXK B;  2MLY A;  5B8I C;  4JHR A;  4CGV A;  4N19 A;  4GYW A;  2E2E A;  2ZQS A;  1P5Q A;  1R9H A;  2N87 A;  3O5I A;  4N3B A;  2LPV A;  2LKN A;  3MV3 B;  1HH8 A;  4J4N A;  4IPX A;  1FKR A;  1HZ4 A;  3ASH A;  4AY5 A;  3KD7 A;  4XI9 A;  1FJD A;  1J6Y A;  2IF4 A;  5G05 J;  5D75 A;  2HO1 A;  2KCV A;  2LGO A;  2PPN A;  5G04 J;  4TYO A;  1JNT A;  2XP6 A;  5G05 C;  2XEV A;  4DIP A;  2C0M A;  3PDN A;  4UQY A;  4DRK A;  5FT9 A;  3LYA A;  4APO A;  1FKS A;  3O5G A;  4DRH A;  3S7F A;  2PBC A;  1Y8M A;  2UZ5 A;  3TG4 A;  1W26 A;  3ESK A;  1ROT A;  1U79 A;  4G25 A;  3Q5M A;  3KAE A;  3KAG A;  3NF1 A;  4IN3 B;  4C02 B;  5HW6 A;  5D0O D;  4GA1 A;  2YQ8 A;  1FKG A;  2I6H A;  2ZQT A;  4TW6 A;  3RIB A;  3CVN A;  3JXV A;  4J4O A;  3UQB A;  3TCZ A;  2XGS A;  1FKH A;  4RG9 A;  4JL0 A;  4KYO B;  4RG6 A;  2F21 A;  2XPA A;  3GYZ A;  1IYG A;  2DBA A;  2VGY A;  1L1P A;  4J8E A;  2FO7 A;  3RO2 A;  2MPH A;  1D7H A;  2JZV A;  4H7Y A;  1PC2 A;  3WXX A;  3CV0 A;  3S7D A;  5G04 C;  4DRP A;  3N71 A;  5EKQ D;  3OXG A;  3Q15 A;  4GPK A;  1WAO 1;  2ZR4 A;  3H9R B;  1FAP A;  2BUG A;  3CK8 A;  4ITZ A;  5D0Q D;  2KR7 A;  3IKG A;  3HYM B;  3O5E A;  4JFI A;  4TW7 A;  4HOQ A;  1E96 B;  1FCH A;  4GZ6 A;  3B7X A;  4LAW A;  2XP3 A;  4G2V A;  3ZPJ A;  2ZR5 A;  3UI6 A;  3O5O A;  4DRM A;  1C9H A;  2PV2 A;  4G23 A;  3KAH A;  5M72 A;  2C2L A;  1XNF A;  3FP3 A;  3U3W A;  1OUV A;  3RGC A;  2Q7F A;  4AM9 A;  2L2S A;  2XP5 A;  1ZBP A;  1B89 A;  1IHG A;  3QWV A;  2Y78 A;  4UI9 K;  1N1A A;  3O5K A;  4NNR A;  3ODK A;  2AWG A;  4MGV A;  4N3C A;  3O5J A;  1FKJ A;  3OOB A;  3BEE A;  2PPP A;  4DT4 A;  1FKD A;  1ELR A;  4J0U A;  2QFC A;  1Y0O A;  2XP4 A;  1KLX A;  3LCA A;  2FBN A;  1BKF A;  3PRD A;  4CGW A;  2RUC A;  2M08 A;  2OOE A;  4MSP A;  3KAB A;  4ABN A;  1ELW A;  2KCK A;  4JA9 A;  1QPL A;  4A1S A;  4YVO A;  4G1T A;  4U0S A;  1D6O A;  4DRQ A;  3O5F A;  4JA7 A;  2MLZ A;  3O48 A;  3LY8 A;  4ODQ A;  4TW8 A;  2UY1 A;  5HW8 A;  2C0L A;  4YVQ C;  4U85 A;  3KZ7 A;  2WPV A;  5EX3 A;  4W9Q A;  5I98 A;  4G26 A;  4KBQ A;  2VSN A;  2AVP A;  4U0U A;  4G50 A;  2J9Q A;  1YA0 A;  3S7J A;  4Y6W A;  5DIU A;  2VYI A;  3CGM A;  4GZ5 A;  4BT8 A;  1FKB A;  4W9O A;  1JVW A;  3LY9 A;  3S7B A;  5A6C A;  3CVP A;  4JFL A;  4ODM A;  1FKK A;  2M1I A;  5KJK A;  4GYY A;  3O5D A;  2PL2 A;  4DRJ A;  4BT9 A;  3E4B A;  4NRH B;  3LPZ A;  4N2S A;  3KAC A;  4BTA A;  5EX0 A;  3QWW A;  1HXI A;  4GZ3 A;  5KJL A;  2F4E A;  4IQ2 A;  3U4T A;  4ODL A;  5HWC A;  2MLX A;  3OXL A;  2HYZ A;  4BTB A;  2MHK A;  4U07 A;  2ZQV A;  3O5R A;  4O6F A;  1KT1 A;  5HQ8 A;  1FKI A;  3SF4 A;  3ASF A;  4AIF A;  1Q6H A;  4G24 A;  3QWP A;  4Y6C A;  3TG5 A;  3GW4 A;  3TAX A;  2PV1 A;  4BF8 A;  1FKF A;  2UWJ G;  5BW8 C;  2FKE A;  3JYM A;  4N39 A;  1HXV A;  1KT0 A;  1YAT A;  4FN2 A;  2XPI A;  1J4R A;  2M2A A;  3KAF A;  1Q1C A;  4O2T A;  4UI9 J;  1ROU A;  1NZN A;  1NA0 A;  2RUQ A;  3MA5 A;  4LAV A;  3UQ3 A;  3LUO A;  2VCD A;  4I2Z A;  1WM5 A;  2GW1 A;  4HOR A;  2Y4U A;  3VAW A;  4I17 A;  5FJY A;  3RU0 A;  1F8A B;  4CDR A;  3MKR A;  2KFW A;  4ODN A;  2VGX A;  2RUD A;  4R0X A;  3URZ A;  2DG4 A;  3ZN3 A;  4IQC A;  5GPG A;  2MF9 A;  5HUA A;  1QQE A;  5DIZ A;  5JJ6 A;  3GPK A;  5KJN A;  3QDN A;  3NTP A;  4NQ0 A;  5HW7 A;  4DZ3 A;  2RUR A;  2VQ2 A;  2YHC A;  3O5M A;  5CCL A;  5FTP A;  4J8D A;  4QT3 A;  5KJM A;  4FAP A;  1A17 A;  3Q47 B;  3ZHE A;  3LKU A;  4LAX A;  2VGX B;  3MDY B;  2ZQU A;  3FFL A;  4W9R A;  3NRK A;  3ASG A;  3Q49 B;  1A7X A;  5CCM A;  2UY1 B;  3ASD A;  2KO7 A;  4WNF A;  2KE0 A;  1Q6I A;  1M5Y A;  1PBK A;  1TCO C;  4HOT A;  1D7I A;  3VTY A;  1BL4 A; 
#chains in the Genus database with same CATH topology
 2X6I A;  4JYS A;  4WNG A;  4YDE A;  1FKT A;  3PE4 A;  3R7R A;  1LL4 A;  3ZFW A;  3AS3 A;  3PA7 A;  3B9D A;  2DG3 A;  2XEN A;  3SD5 A;  3EIQ C;  5BV1 A;  2EUL A;  4FLH A;  1J4I A;  3FUJ A;  4U8V D;  4PS8 A;  4MNL A;  4XIF A;  5BNW A;  2LNI A;  2P9U G;  3UX4 A;  1NMW A;  3PZ2 A;  3AU4 A;  4UQX A;  4RLY A;  4U0Z A;  3CHS A;  2WK2 A;  2YBU A;  2VSY A;  1LG1 A;  3PR9 A;  4ZFH A;  4U04 A;  3NI6 A;  4W9P A;  4Z68 A;  4C0M A;  4DWS A;  4L9P A;  3VTX A;  5T4Y A;  2KI3 A;  2VN1 A;  3V2X A;  1LL6 A;  1QPF A;  4LNG A;  1TNB A;  2PM6 A;  1HJV A;  2JLB A;  4GTR A;  4F3V A;  3ULE G;  2R5S A;  4XX5 A;  1EIB A;  1E90 A;  3G2W A;  4OVU A;  2LJ4 A;  1NSG A;  1PIN A;  1E44 A;  1ZK6 A;  3CKC A;  4U63 A;  2B31 A;  2XP9 A;  4K03 A;  5CEA A;  2YHE A;  2LSV A;  3I6C A;  3O5P A;  4G2P A;  2A5U A;  5BUZ A;  4HNA D;  5LP0 A;  4ODO A;  5DIV A;  2ZU6 B;  4I9E A;  4JFJ A;  4ZPV R;  5BXO A;  2K8I A;  4GA2 A;  4Z2I A;  4DX1 A;  1W1V A;  3DSV A;  2XCC A;  5HKG A;  1WAW A;  2QF8 A;  2DCP A;  5BXJ A;  5FWQ A;  5HT1 A;  5EID A;  3T8K A;  4EQF A;  3TWX A;  4L7T A;  3R9A B;  5A23 A;  1DVP A;  3L13 A;  2XCB A;  2I2O A;  4BET A;  4I9C A;  4GIV A;  1X81 A;  2Y3A A;  4ODP A;  3CEQ A;  4KVO A;  5T3R A;  3UI5 A;  4IT6 A;  2H6F A;  2CHX A;  3DBS A;  3CVL A;  3B7U X;  2A4Z A;  2XGM A;  3KAI A;  2XZD G;  4W5U A;  3SHF A;  2WMN A;  4ATG A;  4UQZ A;  3Q4A B;  2XP7 A;  5LFA A;  3BG0 B;  1LL7 A;  4ANW A;  3ZGQ A;  1WNO A;  1FKL A;  3FUH A;  4A3T A;  3RFW A;  4Z2G A;  4OAV B;  1KZO A;  2IFU A;  1EPU A;  3UKR G;  5AYW D;  5FZS A;  4QZV B;  2L0T B;  1KPS B;  4CEM A;  1TNY A;  1DC2 A;  4GML A;  2ETC A;  3NOG D;  5CER B;  3LJN A;  1N95 A;  3EIP A;  3HXC A;  4GYW A;  2ION A;  3TWT A;  1R9H A;  3RM4 A;  2GRP B;  2LPV A;  2LKN A;  1HH8 A;  4L23 A;  4AY5 A;  3KD7 A;  3JQ0 A;  2VGE A;  4JXT A;  2IF4 A;  1IHB A;  1XRV A;  2WLY A;  1J6Y A;  4B8A A;  1RD6 A;  2LGO A;  2WXH A;  4WJX A;  4YDW A;  4HI8 A;  3CHO A;  5G05 C;  1S64 A;  2C0M A;  3PDN A;  3DSW A;  4F6R D;  5FT9 A;  3S7F A;  4GTS A;  3ZNG A;  3ESK A;  1U79 A;  4M3O A;  4ILI A;  3QK0 A;  4G8L A;  1UJK A;  1H19 A;  1H6K A;  2DIW A;  5KBA A;  2VSO E;  2L0I A;  4M7C A;  4RG6 A;  1IYG A;  4QFV A;  1JUQ A;  3ART A;  3LVQ E;  3CV0 A;  3FUI A;  3ZYQ A;  2F8Y A;  3ARP A;  2I9C A;  3KEZ A;  3WL1 A;  2WXF A;  3AJI A;  3D9I A;  3L9T A;  1Z6T A;  1WAO 1;  4AXH A;  1FAP A;  2BUG A;  3CK8 A;  4ZPT R;  3O5E A;  4JFI A;  3IKG A;  3HYM B;  1H6P A;  1FCH A;  3CHM A;  1OCZ E;  4DI3 A;  2NXP A;  2XP3 A;  2ZR5 A;  4Q7N A;  1TN6 A;  3UIN C;  4DRM A;  4QQI A;  1DCQ A;  3AAA C;  4WWP A;  4HRM B;  2WLZ A;  3D9L A;  2Q7F A;  3CQC B;  3G6L A;  2A3A A;  3B7T A;  3DPY A;  4Q94 A;  3FDH A;  4JZY A;  2Y78 A;  4J7W A;  1N1A A;  1EDU A;  4MGV A;  4XAK A;  3O5J A;  5EYL A;  3UT7 A;  4HRL A;  2PPP A;  1FKD A;  4MRU A;  2WXK A;  2J4D A;  3ZYM A;  1LQ0 A;  1QPL A;  4G1T A;  1OCC E;  4C9B B;  3O5F A;  2QYJ A;  3APF A;  4UWF A;  4K5A B;  4BX9 A;  3RM9 A;  5AAR A;  5HW8 A;  4NIK A;  1K1A A;  2DZO A;  1U3C A;  1WG0 A;  2WPV A;  4IT4 A;  4TUM A;  1SA5 A;  4G26 A;  4DRX E;  3D9N A;  3ARX A;  1YA0 A;  4S3K A;  2IO2 C;  2O92 A;  5AQA A;  4DLQ A;  4GZ5 A;  2XPZ A;  3ULY A;  1O6I A;  4W9O A;  5B3S E;  3S7B A;  5A6C A;  2FO1 E;  4IUL A;  1TNO A;  3CVP A;  1N4R A;  1OT8 A;  3O5D A;  3WKZ A;  3C5R A;  3W4R A;  1JPL A;  4DRJ A;  2MRI A;  3LPZ A;  4F53 A;  4BTA A;  5EDS A;  2Y0B G;  5JHA A;  4OVV A;  4CRW A;  3FU6 A;  4BTB A;  2MHK A;  4S3J A;  1NWU A;  5HQ8 A;  3Q75 A;  2RG8 A;  3AU5 A;  4UWL A;  3UM0 A;  4EHM A;  4G24 A;  3QWP A;  4Y6C A;  4MLP A;  2WXG A;  3CVY A;  3TAX A;  2X3M A;  4RVB A;  3APD A;  2PV1 A;  1HO8 A;  2OCC E;  3HXF A;  4N39 A;  5ANL A;  3G2U A;  1YAT A;  3CLJ A;  2CFZ A;  4RSY A;  2MOW A;  4CZ2 D;  3ASO E;  4UI9 J;  1ITX A;  1NP7 A;  3B9A A;  1NZN A;  2RUQ A;  3LUO A;  1E7U A;  2VCD A;  1WM5 A;  4HOR A;  4MPK A;  3VAW A;  4I17 A;  5CBO A;  1F8A B;  2KFW A;  5GQB A;  3Q9U C;  4WWO A;  4TXR A;  1FVH A;  2OV8 A;  1QQE A;  4BES A;  3HHM A;  4GPM A;  4FUL A;  4L2Y A;  3TXN A;  4GTM A;  1EF1 C;  3DST A;  1HF8 A;  3KSQ A;  3ARO A;  3CQG B;  1JCS A;  1X6N A;  3DEO A;  4J8Y A;  3RME A;  3FUL A;  5CRV A;  1SQM A;  3FTY A;  2IY0 C;  3ZKJ A;  3MDY B;  4B0Z A;  3FFL A;  3IHV A;  3FH8 A;  4GTQ A;  4F1P A;  3E30 A;  3FH5 A;  2WXI A;  3FEX A;  3ASG A;  3Q49 B;  4CDM A;  2EIN E;  2WQ6 A;  2DSZ A;  2BF0 X;  5AQB A;  1M5Y A;  1JND A;  4EEC A;  4HB5 A;  4JEU A;  2EIM E;  2YBT A;  1BL4 A;  3FAP A;  1O1T A;  3KSL A;  3K9I A;  3ONL A;  2E0I A;  4FU3 A;  2XGO A;  5BT1 A;  2BTD A;  1GW6 A;  4GCN A;  3ZHE B;  4N2Q A;  2PN0 A;  2BED A;  2P58 C;  5DF0 A;  3QB2 A;  2RSE A;  2RFA A;  2IQC A;  2PQR A;  3AS2 A;  4U84 A;  2P4V A;  3AG4 E;  4N3A A;  1NFI E;  4I1M A;  1NWS A;  4LEU A;  1UR8 A;  1D9S A;  2V5F A;  3JCK C;  3ZW3 A;  1YCS B;  3CVQ A;  4MNK A;  3VLD A;  1ZCN A;  1B6C A;  2XZT G;  4L72 B;  2GGF A;  3WH0 A;  5EIL A;  3CVU A;  5LCW C;  2Y1L E;  5ENP D;  2ITK A;  4AY6 A;  5JJ7 A;  4KR0 B;  4DRO A;  1NA3 A;  5LCW J;  3NZU A;  3CHP A;  3U64 A;  4GGQ A;  3RJV A;  1TN7 A;  3FUK A;  1HFA A;  3WD2 A;  2V4H C;  4P8W A;  3QNK A;  3UUX A;  2IEJ A;  4WUY A;  1BI8 B;  4U86 A;  4YDO A;  2AOS A;  2B6C A;  3CK7 A;  3TWV A;  4TX0 A;  3EHR A;  2X6K A;  1LF8 A;  3PS6 A;  4TNS A;  1OY3 D;  3D9J A;  3CKB A;  3AS8 A;  3EU5 A;  4CT4 A;  1T11 A;  2Y4T A;  5HI7 A;  2DZN A;  3DXM G;  1HX8 A;  2F8X K;  2WQH A;  4AEZ C;  4GYO A;  3ZXP A;  1U2V G;  1UG3 A;  4B94 A;  5HTG A;  2AXZ A;  3W9F A;  3SI5 A;  2XRY A;  3B7S A;  1V54 E;  3L16 A;  1OXJ A;  3IBE A;  3J5P A;  3CZ8 A;  4G8K A;  3TWR A;  3I4R B;  4JFM A;  4I2W A;  1ZBV A;  3X2Q E;  3SO8 A;  3UMV A;  1O5M A;  1FD9 A;  4GZD A;  3MYV A;  4QT2 A;  4I1A A;  3UI4 A;  5FQ4 A;  3Q7A A;  3JXI A;  1Q6U A;  3E33 A;  4FP7 A;  3SFZ A;  3S2A A;  4DRI A;  3TC5 A;  1EQ3 A;  2OEV A;  3CHE A;  4HQD A;  3MKQ A;  1HKK A;  1QBQ A;  4AY1 A;  3ML8 A;  4XKC A;  2OFN A;  4U7E B;  3JQ1 A;  4UWG A;  3RM8 A;  3UT4 A;  3ZU7 B;  2P9I G;  4A63 B;  3QKY A;  5JHB A;  4LRZ A;  3WL0 A;  3OA5 A;  4BEP A;  2RD0 A;  5BV0 A;  2DT3 A;  1TNZ A;  1INZ A;  4JHR A;  1JCH B;  1OWQ A;  5FQ8 A;  5KNG A;  3I5P A;  4LG6 A;  3DSS A;  4Z2K A;  1SYT A;  4MS6 A;  4J4N A;  1FKR A;  3ISM C;  1HZ4 A;  1MJ0 A;  3ASH A;  3PEV B;  2XEE A;  4XI9 A;  1ZB5 A;  5D75 A;  3IHY A;  2LAI A;  5CMW A;  5GPR A;  2PPN A;  1JNT A;  5HKP A;  2XEV A;  3VLE A;  3V79 K;  1FKS A;  3BG1 B;  1MZC A;  1ROT A;  3G2S A;  5H7P A;  3NF1 A;  4IN3 B;  1LTX A;  5D0O D;  4U96 D;  2F23 A;  2X6J A;  3EU9 A;  3FTZ A;  1ZU8 A;  2V4L A;  4LNB A;  2GRL A;  3AG3 E;  3TCZ A;  1MX2 A;  3B8S A;  2PNN A;  2VGY A;  4J8E A;  2FO7 A;  3BUA A;  3MGB A;  4JW1 A;  1PC2 A;  3WXX A;  4R5E A;  3S7D A;  2WVI A;  4IRU A;  1NWT A;  4DRP A;  3NOC D;  3IXE A;  3OXG A;  5FIN A;  4JPS A;  3SNX A;  4HRN A;  3WD0 A;  4GTV A;  5CEC B;  3DEP A;  2CHW A;  4HOQ A;  3B7X A;  4G2V A;  3FEY A;  5KCM A;  3ZPJ A;  3G6M A;  4P29 A;  1C9H A;  5HS0 A;  1BLX B;  2C2L A;  4GMJ A;  2RKK A;  4LGX A;  3FP3 A;  4HLL A;  1OWL A;  4IYP A;  1GPF A;  2L2S A;  1IHG A;  3QWV A;  4PH4 B;  3B9E A;  3BEE A;  2R02 A;  3L82 A;  1YMP A;  2GRQ B;  5AQ9 A;  3PZ1 A;  2QFC A;  1Y0O A;  2XP4 A;  3EJN A;  4Q96 A;  1KLX A;  3LCA A;  2FBN A;  2WXJ A;  2M08 A;  2OOE A;  1DNP A;  4U8H A;  3KAB A;  3PVL A;  4ABN A;  1MHQ A;  2P9K G;  4YVO A;  3RRM B;  1D6O A;  5J90 A;  3CR3 A;  5B1B E;  4HAR A;  2C0L A;  3ARS A;  3QOK A;  4W9Q A;  5I98 A;  2H6I A;  2WMO A;  4WWN A;  3UTM A;  3I4G A;  4U0U A;  1S70 B;  2DWZ A;  5DIU A;  3LS8 A;  3FTV A;  1TEZ A;  4BT8 A;  1FKB A;  1W1T A;  2BKG A;  1JVW A;  5T8I A;  3R9M A;  5CMY A;  1RZ4 A;  1FT2 A;  4P8X A;  1FKK A;  2J09 A;  1N4S A;  4GB9 A;  4BT9 A;  3CVW A;  3E4B A;  5BPP A;  4NRH B;  3CSF A;  1D8E A;  3QWW A;  3SFX A;  5KJL A;  2F4E A;  3G2T A;  1JWF A;  4ML4 A;  5HWC A;  3LDZ A;  2HYZ A;  3OXL A;  3PZ3 A;  4LSZ E;  4U07 A;  4YDY A;  5EIB E;  2V5Q C;  1FKI A;  4FHK A;  3Q73 A;  2QZA A;  3ABM E;  4TRQ A;  2ZIR A;  3PUK A;  3B7B A;  2J49 A;  1FKF A;  3UT8 A;  5BW8 C;  3JYM A;  2DVW A;  1E7V A;  4X8Q A;  3FU0 A;  2XHE A;  1HXV A;  4DX2 A;  5B1A E;  2WXR A;  3TL5 A;  4L3N A;  4FN2 A;  1AP7 A;  3RAU A;  3ARZ A;  2R59 A;  3ASN E;  2NYJ A;  1ROU A;  3ESL A;  4C0E A;  2XRZ A;  3WG7 E;  3LJ3 A;  1NA0 A;  3T5V A;  3U66 A;  3UQ3 A;  4I2Z A;  3ZUV B;  2EQX A;  3OTN A;  2Y4U A;  2P2C P;  5DEZ A;  3RU0 A;  4CT0 A;  3TWS A;  4ODN A;  4FJY A;  2VGX A;  3URZ A;  1JNE A;  3ARY A;  2MF9 A;  5GPG A;  2H6H A;  3TWQ A;  3JUE A;  5JJ6 A;  2KM4 A;  3QDN A;  3NTP A;  3FUN A;  3BQO A;  3AQU A;  3B13 A;  4FA6 A;  5C2Y A;  5CCL A;  1H2V C;  2X6H A;  4FAP A;  3Q47 B;  3MJW A;  3ZHE A;  3LKU A;  4LAX A;  1E9L A;  2ZQU A;  4O1O A;  1K1B A;  3DPD A;  3ASD A;  4WNF A;  4JC8 A;  2KE0 A;  3PNT B;  4K0R A;  3E34 A;  1TCO C;  4HOT A;  4XE0 A;  1D7I A;  3EY6 A;  4AJW A;  4GU5 A;  4JFK A;  4JVS A;  2PPO A;  3ARV A;  3EHM A;  1W3B A;  3EHN A;  4PDX A;  4BSZ B;  3SQV A;  3C98 A;  1ZL1 A;  3SBT B;  3UM3 A;  4J8F A;  2XS8 A;  2FDM A;  4GCO A;  5HWB A;  4ZS6 A;  2GRM A;  1HJW A;  4ODK A;  3IV0 A;  1W1Y A;  4LUN U;  2A5E A;  1TJC A;  1Y6I A;  2PV3 A;  3IHZ A;  1V55 E;  3UI2 A;  4YND A;  3FUF A;  5DIT A;  2D9F A;  4DPR A;  2YIN A;  2VSX E;  1GUV A;  2J08 A;  1SR0 A;  4LAY A;  5JJT A;  3GZ2 A;  3KS2 A;  3UQI A;  2LUH A;  4TV3 A;  3SBS A;  1H2U A;  3ENE A;  3QOU A;  2AW6 A;  2PQN A;  5ARF A;  3WQV A;  4BER A;  3BXW A;  2R05 A;  3IKD A;  2XP8 A;  3AS1 A;  3AS5 A;  4DLO A;  3FU5 A;  4JHK A;  4UWH A;  3RRU A;  1O1S A;  1EDQ A;  3MV2 B;  5E75 A;  4MKT A;  3L6A A;  5CHE E;  5CRU A;  4O60 A;  2VTB B;  4B8C B;  1N0R A;  5AEN A;  3OXF A;  2KAT A;  3Q79 A;  4UWK A;  2HR2 A;  2F0Y A;  5DBK A;  2OVB A;  3FY4 A;  3O5Q A;  3ARU A;  4MNM A;  4HOS A;  1N0Q A;  1LJY A;  4BSX A;  3C3Q A;  2F2D A;  4HBE A;  4UI9 C;  4ODR A;  4L1B A;  4APF A;  3ULQ A;  2NC9 A;  2IJG X;  3RKV A;  5J08 A;  4ME2 A;  1JNS A;  2OLH A;  3FUE A;  3JYJ A;  4FC8 A;  2XPB A;  1HG5 A;  4DH0 A;  1QZ2 A;  4QIB A;  1E8Y A;  2I1K A;  2FI7 A;  1NMV A;  2JEK A;  2Q5A A;  3ZYK A;  3L54 A;  5JH8 A;  3P2B A;  3IK8 A;  3D9H A;  4Q22 A;  2ETN A;  3DSU A;  1OGB A;  4WND A;  3UPV A;  4GMR A;  2AWI A;  3CIA A;  4KZC A;  3VLF A;  5C1D A;  3UF8 A;  1ZU2 A;  1Q2Z A;  3JXJ A;  1CTN A;  1K9T A;  2WXQ A;  3MEK A;  3D3M A;  2EIJ E;  5D66 A;  2FEZ A;  3ABL E;  4JB8 P;  5ENO D;  4AV7 A;  4XEI G;  3V31 A;  4LCT A;  4EZJ A;  2CHZ A;  4NSB A;  1G3N B;  2WB2 A;  5AN8 A;  5B8I C;  4CGV A;  4V3I A;  4N19 A;  3ZEF A;  2ZQS A;  4J8S A;  1N54 A;  4GTP A;  4N3B A;  2WM0 A;  3MKQ B;  3MV3 B;  1E6Z A;  1MX4 A;  3ZRH A;  3CHD A;  4R7L A;  2WXP A;  5AAO A;  1FJD A;  2PI6 A;  1WB0 A;  3F6Q A;  1ZBW A;  4E85 A;  5EYP F;  4BX8 A;  4L2L A;  4Q69 A;  4DRK A;  3O5G A;  4DRH A;  2WXO A;  3PEU B;  1Y8M A;  2XEH A;  3SGH A;  4DX7 D;  3Q5M A;  3KAE A;  3Q78 A;  3FU3 A;  4C02 B;  5HW6 A;  2ZQT A;  1HG2 A;  4FAD A;  2OEW A;  1SA4 A;  3RIB A;  1DCE A;  3CVN A;  3SY2 A;  3JXV A;  3UQB A;  4WKF A;  3DRA A;  4RG9 A;  3J5Q B;  4KYO B;  2F21 A;  2XPA A;  5ENQ D;  3L22 A;  3KEA A;  1HE8 A;  2DBA A;  2MPH A;  2JZV A;  4H7Y A;  2LO6 A;  3SFY A;  5G04 C;  2DPE A;  2KBX A;  3N71 A;  3MCX A;  4MAV A;  5EKQ D;  3Q15 A;  5ENR D;  2ZR4 A;  3NQP A;  2ETA A;  1RW2 A;  3H9R B;  3PZD A;  4NZC A;  4ITZ A;  4NUR A;  1E96 B;  2FUL A;  3W9G A;  4LAW A;  3WD4 A;  3UI6 A;  3V2O A;  1JCR A;  2PV2 A;  3MZL B;  1KZP A;  4JD2 G;  2DT0 A;  1H2T C;  3D9K A;  4AM9 A;  1B89 A;  3NBN B;  2JAB A;  3DSX A;  4GTT A;  1FKJ A;  2QY7 A;  1ELR A;  4J0U A;  2VTB A;  2HM8 A;  1FFQ A;  2IU1 A;  4MSP A;  3UXG A;  1ELW A;  4A55 A;  2A3B A;  4DUI A;  4KT6 B;  4A1S A;  1OCR E;  3AG2 E;  4U0S A;  4JA7 A;  3LY8 A;  4HBO A;  4ODQ A;  1W9P A;  3KZ7 A;  1SZA A;  1E15 A;  2G8Z A;  2VSN A;  3CHC A;  2AVP A;  1K3Z D;  4G50 A;  1HS6 A;  2J9Q A;  2LXL A;  3S7J A;  2WXL A;  2VYI A;  3CGM A;  1N94 A;  4MTV A;  3T5X A;  2V0P A;  4DI4 A;  4BY6 A;  2KZT B;  3Q7F A;  5AIJ A;  4ODM A;  5KJK A;  2PL2 A;  2J8S D;  3KAC A;  4JEH A;  5EX0 A;  4DK5 A;  1VF8 A;  1HXI A;  4GZ3 A;  3PUJ A;  4K5B A;  3TXM A;  2MLX A;  2DYS E;  3O5R A;  4O6F A;  1KT1 A;  2ESC A;  4DJA A;  4AIF A;  1Q6H A;  2H6G A;  4FJZ A;  3GW4 A;  3E32 A;  2UWJ G;  1N4Q A;  2DSV A;  3D9M A;  4PS3 A;  2XQ0 A;  3CVV A;  1J4R A;  1Q1C A;  4O2T A;  2AXV A;  2ZXW E;  3CHF A;  1D8D A;  1UW4 B;  2AJA A;  2G41 A;  4G11 A;  2GRO B;  4KMO A;  3UM2 A;  4LAV A;  3UIO C;  3PH0 C;  1GOI A;  4ANV A;  2GW1 A;  2R03 A;  4CDR A;  1XHG A;  4HFG A;  1A5E A;  4R0X A;  1GRJ A;  2DG4 A;  4DX6 D;  2B5U B;  4WK9 A;  1FPP A;  1LD8 A;  4IQC A;  5HUA A;  1BI7 B;  3BU8 A;  4HS2 A;  5FQ7 A;  5DIZ A;  1WDY A;  3AS0 A;  1JWG A;  3L17 A;  5ENT D;  3BMB A;  4NQ0 A;  4CDN A;  4DZ3 A;  3LEW A;  2VQ2 A;  2YHC A;  1W9V A;  3O5M A;  1LD7 A;  5FTP A;  1OWO A;  1TN8 A;  1OGG A;  3B95 A;  4ILH B;  4F1S A;  4DWS B;  4QT3 A;  5KJM A;  4NAC A;  1A17 A;  3QC1 A;  3PRA A;  4W9R A;  1HU3 A;  4OYS A;  1E6N A;  3RK6 A;  4O1P A;  1HKJ A;  2GRR B;  3HDX A;  3RRN B;  1NI1 A;  3UKU G;  2RFM A;  2J4B A;  3PNL B;  3UIP C;  4A1G A;  1PBK A;  4Z2H A;  4MNJ A;  2X38 A;  3VTY A;  3EIJ A;  2EIL E;  5A7D B;  1H0A A;  3CK9 A;  3PRB A;  3TGO A;  2WQ7 A;  3EDT B;  5JMN D;  3HXE A;  5ENS D;  4XZ4 A;  2P9L G;  3C3O A;  3RO3 A;  4I1O B;  2BKK B;  2CFU A;  3ARW A;  3OAW A;  3LY7 A;  4N5Q A;  3HXB A;  4C48 B;  1ZBK A;  4GA0 A;  4EBA A;  3KAD A;  4DRN A;  1IXV A;  4BWR A;  5HRY A;  3PE3 A;  5FZQ A;  4GZC A;  3JUI A;  4N5C A;  5G55 A;  3TJP A;  4HVB A;  3IEG A;  2DSU A;  2IOS A;  4F7A A;  1S63 A;  1IKN D;  3IKO B;  4ZHB A;  4XI0 A;  3NB2 A;  3FXY A;  2L6J A;  4LNU D;  3FTU A;  4WNE A;  1W1P A;  2DYR E;  4GAA A;  1E8W A;  1N4P A;  3EHQ A;  3MX3 A;  5FQ6 A;  2FAP A;  2L6B A;  3SZ7 A;  2MNT A;  3U9W A;  2VJ8 A;  3GZ1 A;  4URK A;  2WXM A;  2V8S E;  3FTS A;  2ZR6 A;  2LSU A;  2OND A;  4I6G A;  3CGN A;  1J4H A;  4B93 B;  4U95 D;  2PZI A;  4H7X A;  4UDM A;  5ARG A;  2KGJ A;  3PRZ A;  5IY5 E;  5AJL A;  4I6J A;  2KC7 A;  3GTY X;  2ETB A;  1X5B A;  1EYM A;  1D7J A;  3O5L A;  3HXD A;  5J6E A;  2QYU A;  4ANX A;  1TR4 A;  3UQA A;  2XPY A;  1U3D A;  2LAH A;  4DZ2 A;  1AWC B;  4ANU A;  3JYS A;  5KNH D;  2DG9 A;  2ZGG A;  3FWV A;  3V30 A;  3C72 A;  3KCE A;  1VDY A;  3UM1 A;  2FF4 A;  3HVE A;  1YW5 A;  4AOF A;  4ZPW R;  4EPZ A;  2RQS A;  2ILR A;  3B7R L;  3TDB A;  3AS4 A;  4ILG A;  1N52 A;  1BD8 A;  1H6O A;  2KXP C;  5KWD A;  1MQS A;  5G2N A;  1Z3X A;  3RSE G;  2KCL A;  4B89 A;  1S0P A;  4HLE A;  1NH6 A;  4HOU A;  5FZR A;  4DWS D;  1QNF A;  3HIZ A;  4P8U A;  2NSZ A;  1IQR A;  1F40 A;  2ZGD A;  3ALF A;  3CHQ A;  3O4Z A;  1HJX A;  1W9U A;  2GRN B;  1OWP A;  4HBD A;  4KXK B;  4FLB A;  2MLY A;  5ENN A;  4BFR A;  4TUU A;  2E2E A;  3ONK A;  5LOZ A;  1LG2 A;  1P5Q A;  2N87 A;  3O5I A;  1L5J A;  5LX8 A;  1UR9 A;  2I1J A;  4IPX A;  5CBN A;  3QAQ A;  2ZIS A;  3C3R A;  4WIW A;  4HXI A;  1H0G A;  4KZ0 A;  5G05 J;  2HO1 A;  2KCV A;  4E6H A;  4EZL A;  5G04 J;  4TYO A;  3T8M A;  2XP6 A;  4DIP A;  4A3V A;  4LER A;  2R2L A;  1OWM A;  4UQY A;  3LYA A;  4APO A;  1XGW A;  2DSW A;  2PBC A;  2UZ5 A;  2CG3 A;  3TG4 A;  4PS7 A;  3CHR A;  1W26 A;  4D10 C;  1EYH A;  1QYM A;  1TYQ G;  4G25 A;  1UN8 A;  3KAG A;  2WXN A;  4ACL A;  3NAW A;  4ATZ D;  1FKG A;  4GA1 A;  2YQ8 A;  3ZVV A;  4EZK A;  3P1U A;  2I6H A;  4TW6 A;  3GU0 A;  4J4O A;  2XGS A;  1FKH A;  4JL0 A;  1PY1 A;  3FUM A;  3GYZ A;  4U8Y D;  1L1P A;  1E8Z A;  3RO2 A;  1D7H A;  2XS1 A;  1D2K A;  3EUV A;  3FUD A;  4FHJ A;  1H0I A;  4ACK A;  4TXP A;  1E8X A;  4I43 A;  5ANR A;  4GPK A;  1ZB1 A;  1N11 A;  4I6E A;  1SVX A;  5D0Q D;  2KR7 A;  4TW7 A;  5AQ7 A;  5AJD A;  4DWS C;  4GZ6 A;  3DXK G;  3CVX A;  2X6F A;  1ELK A;  2A3C A;  4HI9 A;  3O5O A;  1N9A A;  2LXM A;  4G23 A;  3KAH A;  5M72 A;  1XNF A;  3U3W A;  1OUV A;  3RGC A;  2XP5 A;  3FY1 A;  1ZBP A;  3CST A;  4AP2 A;  3NZS A;  3FTW A;  2EIK E;  4UI9 K;  3O5K A;  4NNR A;  1E6R A;  3ODK A;  2AWG A;  5JA4 D;  4N3C A;  1FFR A;  2IOL A;  3OOB A;  1E6P A;  5EN5 D;  4DT4 A;  1KFW A;  4Z2J A;  3T9K A;  4OAU C;  1BKF A;  3PRD A;  4CGW A;  2RUC A;  4CYM D;  4UUC A;  2KZT A;  4XKB A;  2KCK A;  4JA9 A;  1TNU A;  3CGH A;  2IUZ A;  3ALG A;  1UJJ A;  4DRQ A;  2MLZ A;  3O48 A;  2B0O E;  5FIO A;  4TW8 A;  2UY1 A;  3FH7 A;  4YVQ C;  4U85 A;  2WM9 A;  5EX3 A;  3D9O A;  3L08 A;  1FVF A;  1MYO A;  4KBQ A;  2IO3 C;  1NL4 A;  4AVX A;  4Y6W A;  4URI A;  1BU9 A;  2CG2 A;  3LY9 A;  4EBA G;  4GTO A;  4JFL A;  4WAF A;  1HKM A;  3WQW A;  2DT1 A;  2M1I A;  4GYY A;  1OCO E;  4N2S A;  4WKA A;  5BXU A;  3GZS A;  5D2M C;  3TWW A;  2O9O A;  4IQ2 A;  3U4T A;  1HKI A;  3E37 A;  4ODL A;  1IQU A;  3DWL G;  4TXQ A;  4PTM A;  3WD3 A;  2ZQV A;  3SF4 A;  2P9N G;  2Y69 E;  3ASF A;  4KVM A;  1TJF A;  1BPO A;  5CED B;  4J6I A;  3ARR A;  4Z2L A;  3TG5 A;  3LXU X;  1FT1 A;  4BF8 A;  2FKE A;  1KT0 A;  1SZ9 A;  2XPI A;  4KQZ A;  1YYH A;  1IX5 A;  1NWR A;  2M2A A;  3KAF A;  4RQI A;  3PZ4 A;  1OWN A;  2DT2 A;  1ZBC A;  4WKH A;  3APC A;  3ZYL A;  2MYO A;  3QJZ A;  3LVR E;  3HG0 D;  3MA5 A;  1K8K G;  3R7Q A;  2M63 A;  5FJY A;  3ZXS A;  2QC9 A;  2F37 A;  3MKR A;  3ARQ A;  1Z5S C;  1Z3Y A;  3HRA A;  3FTX A;  2RUD A;  3I3N A;  3ZN3 A;  3FHE A;  3WIJ A;  1WY6 A;  1SW6 A;  1UN9 A;  2J07 A;  3GPK A;  1PAQ A;  1UOH A;  3G2V A;  1X6L A;  5KJN A;  2YNQ A;  3AG1 E;  3WD1 A;  4PUC A;  5HW7 A;  1EHN A;  1O1R A;  2HE0 A;  4JHJ A;  2RUR A;  1TFV A;  3CH9 A;  1JCQ A;  2P9P G;  4K5C A;  4J8D A;  2PM7 A;  2R17 C;  2OVF A;  2VGX B;  3D9P A;  3TWU A;  3NRK A;  4CCA A;  2L9B A;  5E76 A;  3ZIM A;  1MX6 A;  1A7X A;  5CCM A;  2UY1 B;  3HVE B;  4P8V A;  2KO7 A;  3Q9N C;  3PRE A;  1Q6I A;  3QAR A;  3ABK E;  3ML9 A;  4DX5 D;  2AXU A;  2P9S G;  2A3E A;  5HBF A;  4MBG A;  5DO2 A;  5ITZ F; 
#chains in the Genus database with same CATH homology
 2X6I A;  4JYS A;  4WNG A;  1FKT A;  3PE4 A;  3R7R A;  1LL4 A;  3ZFW A;  3AS3 A;  3PA7 A;  3B9D A;  2DG3 A;  3SD5 A;  3EIQ C;  5BV1 A;  4FLH A;  1J4I A;  3FUJ A;  4PS8 A;  4MNL A;  4XIF A;  5BNW A;  2LNI A;  3UX4 A;  1NMW A;  3AU4 A;  4UQX A;  4U0Z A;  3CHS A;  2WK2 A;  2YBU A;  2VSY A;  1LG1 A;  3PR9 A;  4U04 A;  3NI6 A;  4W9P A;  4C0M A;  4DWS A;  3VTX A;  5T4Y A;  2KI3 A;  2VN1 A;  1LL6 A;  1QPF A;  2PM6 A;  1HJV A;  2JLB A;  4F3V A;  2R5S A;  4XX5 A;  1EIB A;  1E90 A;  3G2W A;  4OVU A;  2LJ4 A;  1NSG A;  1PIN A;  1ZK6 A;  3CKC A;  4U63 A;  2B31 A;  2XP9 A;  4K03 A;  2YHE A;  2LSV A;  3I6C A;  3O5P A;  4G2P A;  2A5U A;  5BUZ A;  5LP0 A;  4ODO A;  5DIV A;  2ZU6 B;  4I9E A;  4JFJ A;  4ZPV R;  2K8I A;  4GA2 A;  4Z2I A;  1W1V A;  2XCC A;  5HKG A;  1WAW A;  2QF8 A;  2DCP A;  5BXJ A;  5FWQ A;  5HT1 A;  4EQF A;  4L7T A;  3R9A B;  5A23 A;  1DVP A;  3L13 A;  2XCB A;  2I2O A;  4I9C A;  4GIV A;  2Y3A A;  4ODP A;  3CEQ A;  4KVO A;  5T3R A;  3UI5 A;  4IT6 A;  2CHX A;  3DBS A;  3CVL A;  3B7U X;  2A4Z A;  2XGM A;  3KAI A;  4W5U A;  3SHF A;  2WMN A;  4ATG A;  4UQZ A;  3Q4A B;  2XP7 A;  5LFA A;  3BG0 B;  1LL7 A;  4ANW A;  3ZGQ A;  1WNO A;  1FKL A;  3FUH A;  4A3T A;  3RFW A;  4Z2G A;  2IFU A;  1EPU A;  5AYW D;  5FZS A;  4QZV B;  2L0T B;  4CEM A;  4GML A;  4GYW A;  2ION A;  1R9H A;  3RM4 A;  2LPV A;  2LKN A;  1HH8 A;  4L23 A;  4AY5 A;  3KD7 A;  3JQ0 A;  4JXT A;  2WLY A;  2IF4 A;  1J6Y A;  1XRV A;  4B8A A;  1RD6 A;  2LGO A;  2WXH A;  4WJX A;  3CHO A;  5G05 C;  2C0M A;  3PDN A;  5FT9 A;  3S7F A;  3ESK A;  1U79 A;  4M3O A;  4ILI A;  3QK0 A;  1UJK A;  1H19 A;  1H6K A;  2DIW A;  2VSO E;  2L0I A;  4RG6 A;  1IYG A;  4QFV A;  1JUQ A;  3ART A;  3LVQ E;  3CV0 A;  3FUI A;  3ZYQ A;  3ARP A;  2I9C A;  3KEZ A;  3WL1 A;  2WXF A;  3D9I A;  1Z6T A;  1WAO 1;  4AXH A;  1FAP A;  4ZPT R;  2BUG A;  3CK8 A;  3O5E A;  4JFI A;  3IKG A;  3HYM B;  1FCH A;  3CHM A;  4DI3 A;  2NXP A;  2XP3 A;  2ZR5 A;  4Q7N A;  4DRM A;  4WWP A;  2WLZ A;  3D9L A;  2Q7F A;  3CQC B;  3G6L A;  2A3A A;  3B7T A;  4Q94 A;  3FDH A;  4JZY A;  2Y78 A;  1N1A A;  1EDU A;  4MGV A;  4XAK A;  3O5J A;  3UT7 A;  2PPP A;  1FKD A;  4MRU A;  2WXK A;  2J4D A;  3ZYM A;  1LQ0 A;  1QPL A;  4G1T A;  4C9B B;  3O5F A;  3APF A;  4UWF A;  4BX9 A;  3RM9 A;  5HW8 A;  1U3C A;  2WPV A;  4IT4 A;  4G26 A;  3D9N A;  3ARX A;  1YA0 A;  4S3K A;  2O92 A;  4DLQ A;  4GZ5 A;  2XPZ A;  1O6I A;  4W9O A;  3S7B A;  5A6C A;  4IUL A;  3CVP A;  3O5D A;  3WKZ A;  3W4R A;  1JPL A;  4DRJ A;  2MRI A;  3LPZ A;  4F53 A;  4BTA A;  5EDS A;  5JHA A;  4OVV A;  4CRW A;  3FU6 A;  4BTB A;  2MHK A;  4S3J A;  1NWU A;  5HQ8 A;  2RG8 A;  3AU5 A;  4UWL A;  4G24 A;  3QWP A;  4Y6C A;  4MLP A;  2WXG A;  3CVY A;  3TAX A;  2X3M A;  4RVB A;  3APD A;  2PV1 A;  1HO8 A;  4N39 A;  5ANL A;  3G2U A;  1YAT A;  3CLJ A;  2CFZ A;  4RSY A;  2MOW A;  4UI9 J;  1ITX A;  1NP7 A;  3B9A A;  1NZN A;  2RUQ A;  3LUO A;  2VCD A;  1E7U A;  1WM5 A;  4HOR A;  4MPK A;  3VAW A;  4I17 A;  1F8A B;  2KFW A;  5GQB A;  4WWO A;  1FVH A;  2OV8 A;  1QQE A;  3HHM A;  4FUL A;  4L2Y A;  3TXN A;  1EF1 C;  1HF8 A;  3ARO A;  3CQG B;  1X6N A;  3RME A;  3FUL A;  1SQM A;  3FTY A;  3MDY B;  4B0Z A;  3FFL A;  3IHV A;  3FH8 A;  3FH5 A;  2WXI A;  3FEX A;  3ASG A;  3Q49 B;  4CDM A;  2WQ6 A;  2DSZ A;  2BF0 X;  1M5Y A;  1JND A;  4EEC A;  4JEU A;  2YBT A;  1BL4 A;  3FAP A;  3K9I A;  3ONL A;  2E0I A;  4FU3 A;  2XGO A;  5BT1 A;  2BTD A;  1GW6 A;  4GCN A;  3ZHE B;  4N2Q A;  2P58 C;  5DF0 A;  3QB2 A;  2RSE A;  2IQC A;  2PQR A;  3AS2 A;  4U84 A;  4N3A A;  4I1M A;  1NWS A;  4LEU A;  1UR8 A;  2V5F A;  3JCK C;  3ZW3 A;  4MNK A;  3CVQ A;  3VLD A;  1ZCN A;  1B6C A;  4L72 B;  2GGF A;  3WH0 A;  3CVU A;  5LCW C;  2ITK A;  4AY6 A;  5JJ7 A;  4KR0 B;  4DRO A;  1NA3 A;  5LCW J;  3NZU A;  3CHP A;  3U64 A;  4GGQ A;  3RJV A;  3FUK A;  1HFA A;  3WD2 A;  4P8W A;  3QNK A;  3UUX A;  4WUY A;  4U86 A;  2AOS A;  3CK7 A;  4TX0 A;  2X6K A;  1LF8 A;  3PS6 A;  4TNS A;  3D9J A;  3CKB A;  3AS8 A;  4CT4 A;  1T11 A;  2Y4T A;  5HI7 A;  1HX8 A;  2WQH A;  4AEZ C;  4GYO A;  1UG3 A;  4B94 A;  5HTG A;  2AXZ A;  3SI5 A;  2XRY A;  3B7S A;  3L16 A;  3IBE A;  3CZ8 A;  3I4R B;  4JFM A;  4I2W A;  1ZBV A;  3UMV A;  1FD9 A;  4GZD A;  3MYV A;  4QT2 A;  4I1A A;  3UI4 A;  5FQ4 A;  1Q6U A;  4FP7 A;  3SFZ A;  3S2A A;  4DRI A;  3TC5 A;  1EQ3 A;  3CHE A;  3MKQ A;  1HKK A;  4AY1 A;  3ML8 A;  4XKC A;  2OFN A;  3JQ1 A;  4UWG A;  3RM8 A;  3UT4 A;  3QKY A;  5JHB A;  4LRZ A;  3WL0 A;  3OA5 A;  2RD0 A;  5BV0 A;  2DT3 A;  1INZ A;  4JHR A;  1OWQ A;  5FQ8 A;  3I5P A;  4Z2K A;  1SYT A;  4MS6 A;  4J4N A;  1FKR A;  1HZ4 A;  3ASH A;  3PEV B;  4XI9 A;  5D75 A;  1ZB5 A;  3IHY A;  2LAI A;  5CMW A;  5GPR A;  2PPN A;  1JNT A;  2XEV A;  3VLE A;  1FKS A;  3BG1 B;  1ROT A;  3G2S A;  3NF1 A;  4IN3 B;  5D0O D;  2X6J A;  3FTZ A;  1ZU8 A;  2V4L A;  2GRL A;  3TCZ A;  3B8S A;  2VGY A;  4J8E A;  2FO7 A;  3MGB A;  4JW1 A;  1PC2 A;  3WXX A;  4R5E A;  3S7D A;  2WVI A;  4IRU A;  1NWT A;  4DRP A;  3OXG A;  4JPS A;  3SNX A;  3WD0 A;  2CHW A;  4HOQ A;  3B7X A;  4G2V A;  3FEY A;  5KCM A;  3ZPJ A;  3G6M A;  4P29 A;  1C9H A;  2C2L A;  4GMJ A;  4LGX A;  3FP3 A;  1OWL A;  4IYP A;  1GPF A;  2L2S A;  1IHG A;  3QWV A;  4PH4 B;  3B9E A;  3BEE A;  2QFC A;  1Y0O A;  2XP4 A;  3EJN A;  4Q96 A;  1KLX A;  3LCA A;  2FBN A;  2WXJ A;  2M08 A;  2OOE A;  1DNP A;  4U8H A;  3KAB A;  3PVL A;  4ABN A;  1MHQ A;  4YVO A;  3RRM B;  1D6O A;  5J90 A;  3CR3 A;  4HAR A;  2C0L A;  3ARS A;  3QOK A;  4W9Q A;  5I98 A;  2WMO A;  4WWN A;  3I4G A;  4U0U A;  5DIU A;  3LS8 A;  3FTV A;  1TEZ A;  4BT8 A;  1FKB A;  1W1T A;  1JVW A;  5T8I A;  5CMY A;  4P8X A;  1FKK A;  2J09 A;  4GB9 A;  4BT9 A;  3CVW A;  3E4B A;  5BPP A;  4NRH B;  3CSF A;  3QWW A;  5KJL A;  2F4E A;  3G2T A;  1JWF A;  4ML4 A;  5HWC A;  3LDZ A;  2HYZ A;  3OXL A;  4U07 A;  1FKI A;  4FHK A;  4TRQ A;  3PUK A;  2J49 A;  1FKF A;  3UT8 A;  5BW8 C;  3JYM A;  1E7V A;  3FU0 A;  2XHE A;  1HXV A;  2WXR A;  3TL5 A;  4L3N A;  4FN2 A;  3ARZ A;  2R59 A;  1ROU A;  3ESL A;  4C0E A;  2XRZ A;  3LJ3 A;  1NA0 A;  3T5V A;  3U66 A;  3UQ3 A;  4I2Z A;  2EQX A;  3OTN A;  2Y4U A;  5DEZ A;  3RU0 A;  4CT0 A;  4ODN A;  4FJY A;  2VGX A;  3URZ A;  1JNE A;  3ARY A;  2MF9 A;  5GPG A;  5JJ6 A;  2KM4 A;  3QDN A;  3NTP A;  3FUN A;  3AQU A;  3B13 A;  4FA6 A;  5C2Y A;  1H2V C;  5CCL A;  2X6H A;  4FAP A;  3Q47 B;  3MJW A;  3ZHE A;  3LKU A;  4LAX A;  1E9L A;  2ZQU A;  3DPD A;  3ASD A;  4WNF A;  4JC8 A;  2KE0 A;  3PNT B;  4K0R A;  1TCO C;  4HOT A;  4XE0 A;  1D7I A;  3EY6 A;  4AJW A;  4GU5 A;  4JFK A;  4JVS A;  2PPO A;  3ARV A;  3EHM A;  1W3B A;  3EHN A;  4PDX A;  3C98 A;  1ZL1 A;  3SBT B;  4J8F A;  2FDM A;  4GCO A;  5HWB A;  4ZS6 A;  2GRM A;  1HJW A;  4ODK A;  3IV0 A;  1W1Y A;  4LUN U;  1TJC A;  1Y6I A;  2PV3 A;  3IHZ A;  4YND A;  3FUF A;  5DIT A;  2D9F A;  4DPR A;  2YIN A;  2VSX E;  1GUV A;  2J08 A;  1SR0 A;  4LAY A;  5JJT A;  3GZ2 A;  3KS2 A;  3UQI A;  4TV3 A;  3SBS A;  1H2U A;  3ENE A;  3QOU A;  2AW6 A;  2PQN A;  5ARF A;  3WQV A;  3BXW A;  3IKD A;  2XP8 A;  3AS1 A;  3AS5 A;  4DLO A;  3FU5 A;  4JHK A;  4UWH A;  3RRU A;  1EDQ A;  3MV2 B;  5E75 A;  4MKT A;  3L6A A;  5CHE E;  2VTB B;  4B8C B;  5AEN A;  3OXF A;  2KAT A;  4UWK A;  2HR2 A;  5DBK A;  2OVB A;  3FY4 A;  3O5Q A;  3ARU A;  4MNM A;  4HOS A;  1LJY A;  4BSX A;  2F2D A;  4HBE A;  4UI9 C;  4ODR A;  4L1B A;  4APF A;  3ULQ A;  2NC9 A;  2IJG X;  3RKV A;  5J08 A;  4ME2 A;  1JNS A;  2OLH A;  3FUE A;  3JYJ A;  4FC8 A;  2XPB A;  1HG5 A;  4DH0 A;  1QZ2 A;  4QIB A;  1E8Y A;  2I1K A;  2FI7 A;  1NMV A;  2JEK A;  2Q5A A;  3ZYK A;  3L54 A;  5JH8 A;  3P2B A;  3IK8 A;  4Q22 A;  1OGB A;  4WND A;  3UPV A;  2AWI A;  3CIA A;  4KZC A;  3VLF A;  5C1D A;  3UF8 A;  1ZU2 A;  1CTN A;  1K9T A;  2WXQ A;  3MEK A;  3D3M A;  2FEZ A;  4AV7 A;  4LCT A;  4EZJ A;  2CHZ A;  4NSB A;  2WB2 A;  5B8I C;  4CGV A;  4V3I A;  4N19 A;  3ZEF A;  2ZQS A;  4J8S A;  1N54 A;  4N3B A;  2WM0 A;  3MKQ B;  3MV3 B;  1E6Z A;  3ZRH A;  3CHD A;  2WXP A;  4R7L A;  1FJD A;  2PI6 A;  1WB0 A;  1ZBW A;  4E85 A;  4BX8 A;  4L2L A;  4Q69 A;  4DRK A;  3O5G A;  4DRH A;  2WXO A;  3PEU B;  1Y8M A;  3SGH A;  3Q5M A;  3KAE A;  3FU3 A;  4C02 B;  5HW6 A;  2ZQT A;  1HG2 A;  4FAD A;  3RIB A;  3CVN A;  3JXV A;  3UQB A;  4WKF A;  4RG9 A;  4KYO B;  2F21 A;  2XPA A;  3L22 A;  1HE8 A;  2DBA A;  2MPH A;  2JZV A;  4H7Y A;  2LO6 A;  5G04 C;  2DPE A;  3N71 A;  3MCX A;  4MAV A;  5EKQ D;  3Q15 A;  2ZR4 A;  3NQP A;  3H9R B;  3PZD A;  4NZC A;  4ITZ A;  4NUR A;  1E96 B;  2FUL A;  4LAW A;  3WD4 A;  3UI6 A;  2PV2 A;  3MZL B;  2DT0 A;  1H2T C;  3D9K A;  4AM9 A;  1B89 A;  1FKJ A;  2QY7 A;  1ELR A;  4J0U A;  2VTB A;  2HM8 A;  1FFQ A;  2IU1 A;  4MSP A;  1ELW A;  4A55 A;  2A3B A;  4KT6 B;  4A1S A;  4U0S A;  4JA7 A;  3LY8 A;  4HBO A;  4ODQ A;  1W9P A;  3KZ7 A;  1SZA A;  1E15 A;  2G8Z A;  2VSN A;  3CHC A;  2AVP A;  4G50 A;  1HS6 A;  2J9Q A;  3S7J A;  2WXL A;  2VYI A;  3CGM A;  4MTV A;  3T5X A;  2V0P A;  4DI4 A;  4BY6 A;  2KZT B;  5AIJ A;  4ODM A;  5KJK A;  2PL2 A;  3KAC A;  4JEH A;  5EX0 A;  4DK5 A;  1VF8 A;  1HXI A;  4GZ3 A;  3PUJ A;  3TXM A;  2MLX A;  3O5R A;  4O6F A;  1KT1 A;  2ESC A;  4DJA A;  4AIF A;  1Q6H A;  4FJZ A;  3GW4 A;  2UWJ G;  2DSV A;  3D9M A;  4PS3 A;  2XQ0 A;  3CVV A;  1J4R A;  1Q1C A;  4O2T A;  2AXV A;  3CHF A;  1UW4 B;  2G41 A;  4G11 A;  4KMO A;  4LAV A;  3PH0 C;  1GOI A;  4ANV A;  2GW1 A;  4CDR A;  1XHG A;  4HFG A;  4R0X A;  2DG4 A;  4WK9 A;  4IQC A;  5HUA A;  4HS2 A;  5FQ7 A;  5DIZ A;  3AS0 A;  1JWG A;  3L17 A;  4NQ0 A;  4CDN A;  4DZ3 A;  3LEW A;  2VQ2 A;  2YHC A;  1W9V A;  3O5M A;  5FTP A;  1OWO A;  1OGG A;  4ILH B;  4F1S A;  4DWS B;  4QT3 A;  5KJM A;  4NAC A;  1A17 A;  3QC1 A;  3PRA A;  4W9R A;  1HU3 A;  4OYS A;  1E6N A;  3RK6 A;  1HKJ A;  3HDX A;  3RRN B;  1PBK A;  2J4B A;  3PNL B;  4A1G A;  4Z2H A;  4MNJ A;  2X38 A;  3VTY A;  3EIJ A;  5A7D B;  1H0A A;  3CK9 A;  3PRB A;  3TGO A;  2WQ7 A;  3EDT B;  4XZ4 A;  3RO3 A;  4I1O B;  2CFU A;  3ARW A;  3OAW A;  3LY7 A;  1ZBK A;  4GA0 A;  4EBA A;  3KAD A;  4DRN A;  4BWR A;  3PE3 A;  5FZQ A;  4GZC A;  3JUI A;  4N5C A;  5G55 A;  3TJP A;  4HVB A;  3IEG A;  2DSU A;  2IOS A;  4F7A A;  3IKO B;  4XI0 A;  3FXY A;  2L6J A;  3FTU A;  4WNE A;  1W1P A;  4GAA A;  1E8W A;  3MX3 A;  5FQ6 A;  2FAP A;  3SZ7 A;  2MNT A;  3U9W A;  2VJ8 A;  3GZ1 A;  4URK A;  2WXM A;  2V8S E;  3FTS A;  2ZR6 A;  2LSU A;  2OND A;  4I6G A;  3CGN A;  1J4H A;  2PZI A;  4H7X A;  5ARG A;  2KGJ A;  3PRZ A;  5AJL A;  4I6J A;  2KC7 A;  1X5B A;  1EYM A;  1D7J A;  3O5L A;  5J6E A;  4ANX A;  3UQA A;  2XPY A;  1U3D A;  2LAH A;  4DZ2 A;  4ANU A;  3JYS A;  2DG9 A;  3FWV A;  3KCE A;  1VDY A;  2FF4 A;  3HVE A;  1YW5 A;  4AOF A;  4ZPW R;  4EPZ A;  2RQS A;  2ILR A;  3B7R L;  3TDB A;  3AS4 A;  4ILG A;  1N52 A;  1MQS A;  5G2N A;  1Z3X A;  2KCL A;  4B89 A;  1S0P A;  4HLE A;  1NH6 A;  4HOU A;  5FZR A;  4DWS D;  1QNF A;  3HIZ A;  4P8U A;  2NSZ A;  1IQR A;  1F40 A;  3ALF A;  3CHQ A;  3O4Z A;  1HJX A;  1W9U A;  1OWP A;  4KXK B;  4FLB A;  2MLY A;  5ENN A;  4BFR A;  4TUU A;  2E2E A;  3ONK A;  5LOZ A;  1LG2 A;  1P5Q A;  2N87 A;  3O5I A;  1L5J A;  5LX8 A;  1UR9 A;  2I1J A;  4IPX A;  3QAQ A;  4WIW A;  4HXI A;  1H0G A;  4KZ0 A;  5G05 J;  2HO1 A;  2KCV A;  4E6H A;  4EZL A;  5G04 J;  4TYO A;  3T8M A;  2XP6 A;  4DIP A;  4A3V A;  4LER A;  1OWM A;  4UQY A;  3LYA A;  4APO A;  1XGW A;  2PBC A;  2DSW A;  2UZ5 A;  2CG3 A;  3TG4 A;  4PS7 A;  3CHR A;  1W26 A;  4D10 C;  1EYH A;  4G25 A;  1UN8 A;  3KAG A;  2WXN A;  4ACL A;  1FKG A;  4GA1 A;  2YQ8 A;  2I6H A;  3P1U A;  3ZVV A;  4EZK A;  4TW6 A;  4J4O A;  2XGS A;  1FKH A;  4JL0 A;  1PY1 A;  3FUM A;  3GYZ A;  1L1P A;  1E8Z A;  3RO2 A;  1D7H A;  1D2K A;  3FUD A;  4FHJ A;  1H0I A;  4ACK A;  1E8X A;  4I43 A;  5ANR A;  4GPK A;  4I6E A;  5D0Q D;  2KR7 A;  4TW7 A;  5AJD A;  4DWS C;  4GZ6 A;  3CVX A;  2X6F A;  1ELK A;  2A3C A;  3O5O A;  4G23 A;  3KAH A;  5M72 A;  1XNF A;  3U3W A;  1OUV A;  3RGC A;  2XP5 A;  3FY1 A;  1ZBP A;  3CST A;  4AP2 A;  3NZS A;  3FTW A;  4UI9 K;  3O5K A;  4NNR A;  1E6R A;  3ODK A;  2AWG A;  4N3C A;  1FFR A;  2IOL A;  3OOB A;  1E6P A;  4DT4 A;  1KFW A;  4Z2J A;  1BKF A;  3PRD A;  4CGW A;  2RUC A;  2KZT A;  4XKB A;  2KCK A;  4JA9 A;  3CGH A;  2IUZ A;  3ALG A;  1UJJ A;  4DRQ A;  2MLZ A;  3O48 A;  4TW8 A;  2UY1 A;  3FH7 A;  4YVQ C;  4U85 A;  2WM9 A;  5EX3 A;  3D9O A;  3L08 A;  1FVF A;  4KBQ A;  4AVX A;  4Y6W A;  4URI A;  2CG2 A;  3LY9 A;  4EBA G;  4JFL A;  4WAF A;  1HKM A;  3WQW A;  2DT1 A;  2M1I A;  4GYY A;  4N2S A;  4WKA A;  3GZS A;  2O9O A;  4IQ2 A;  3U4T A;  1HKI A;  4ODL A;  1IQU A;  4PTM A;  3WD3 A;  2ZQV A;  3SF4 A;  3ASF A;  4KVM A;  1TJF A;  1BPO A;  4J6I A;  3ARR A;  4Z2L A;  3TG5 A;  3LXU X;  4BF8 A;  2FKE A;  1KT0 A;  1SZ9 A;  2XPI A;  4KQZ A;  1IX5 A;  1NWR A;  2M2A A;  3KAF A;  1OWN A;  2DT2 A;  1ZBC A;  4WKH A;  3APC A;  3ZYL A;  3QJZ A;  3LVR E;  3MA5 A;  3R7Q A;  2M63 A;  5FJY A;  3ZXS A;  3MKR A;  3ARQ A;  1Z3Y A;  3FTX A;  2RUD A;  3I3N A;  3ZN3 A;  3FHE A;  3WIJ A;  1WY6 A;  1UN9 A;  2J07 A;  3GPK A;  1PAQ A;  3G2V A;  1X6L A;  5KJN A;  2YNQ A;  3WD1 A;  4PUC A;  5HW7 A;  1EHN A;  4JHJ A;  3CH9 A;  1TFV A;  2RUR A;  4J8D A;  2PM7 A;  2R17 C;  2OVF A;  2VGX B;  3D9P A;  3NRK A;  4CCA A;  2L9B A;  5E76 A;  3ZIM A;  1A7X A;  5CCM A;  2UY1 B;  3HVE B;  4P8V A;  2KO7 A;  3PRE A;  1Q6I A;  3QAR A;  3ML9 A;  2AXU A;  2A3E A;  5HBF A;  5DO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...