1KT1A

Structure of the large fkbp-like protein, fkbp51, involved in steroid receptor complexes
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
394
structure length
374
Chain Sequence
b'KKDRGVLKIVHGEETPMIGDRVYVHYNGKLANPFVFSIGKGQVIKAWDIGVATMKKGEICHLLCAYGATGSLPKIPSNATLFFEVELLDFKGEDLLEDGGIIRRTKRRGEGYSNPNEGARVQIHLEGRCGGRVFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILHLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYVQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQIFMCQKKAKEHNERDRRTYANMFKKFAEQDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein FKBP51
publication title STRUCTURE OF THE LARGE FK506-BINDING PROTEIN FKBP51, AN HSP90-BINDING PROTEIN AND A COMPONENT OF STEROID RECEPTOR COMPLEXES
pubmed doi rcsb
source organism Saimiri boliviensis
molecule tags Isomerase
total genus 108
structure length 374
sequence length 394
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2002-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF00515 TPR_1 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1kt1A03
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1kt1A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1kt1A02
2KE0A 1YW5A 2VGXA 2L6JA 1D6OA 3CV0A 5LCWJ 3WXXA 4HOSA 1FKBA 2KI3A 3IHZA 3LYAA 5EX3A 2RSEA 4BF8A 2VGXB 5GPGA 3OOBA 4WUYA 4JA7A 4GYWA 2XGMA 3Q5MA 3RO2A 4WNDA 2OOEA 1B6CA 4W9QA 3TG5A 3MEKA 4N3CA 4DIPA 2C0MA 2PV3A 1Q6IA 1ELRA 4IQ2A 2RUDA 1J6YA 4HORA 2YQ8A 4QT2A 3PRDA 2WQHA 4JFJA 2XP8A 3FFLA 4WNGA 4WNEA 2MLYA 2UWJG 3ASHA 4LEUA 4F3VA 1ZBPA 4LAXA 3LY8A 1FKFA 2FKEA 3LY9A 2FBNA 3LUOA 4DRHA 4MGVA 2ZQVA 1WM5A 5DIVA 2M08A 3ASGA 3Q47B 5G05J 3KACA 4DRIA 3EDTB 1EYMA 3HYMB 3UUXA 5DIZA 5FZQA 2PQNA 2I6HA 2PBCA 2XPAA 4U0UA 4ODMA 1NSGA 3H9RB 3MA5A 1FCHA 3ODKA 4U07A 3UQIA 4U0ZA 1ZCNA 1EQ3A 4J8EA 4G24A 5ARFA 4GZ5A 4ME2A 5HW7A 3MV2B 1B89A 2XPIA 1JVWA 2F4EA 4TW8A 2XPBA 4I2ZA 2GW1A 4NQ0A 3ZGQA 2JZVA 4W9OA 4I9EA 3TAXA 4G25A 3O5MA 1Y0OA 2DG4A 4GA1A 3O5RA 2ZR6A 4N19A 5FJYA 3PE4A 3JXVA 4AY5A 3CK8A 1JNTA 2IF4A 3O5KA 2BUGA 2FO7A 2XP3A 2M1IA 2P58C 2MLXA 4MSPA 2KC7A 2MNTA 1FKTA 4N2SA 3LY7A 4O2TA 4JL0A 3LCAA 4G50A 3JYJA 2ZQSA 4AIFA 4GPKA 1FKRA 3QWVA 1OUVA 1E96B 2MF9A 4GYOA 1Y8MA 3KAHA 1Q6HA 5BT1A 4BTAA 3MV3B 2XP4A 4DRPA 4O6FA 3QKYA 2LJ4A 3AS4A 3VTXA 2C2LA 4G2VA 4GIVA 4W9PA 1D7HA 2XP7A 3GZ2A 4APOA 4G23A 3UPVA 4BWRA 2UZ5A 1NA3A 2PV1A 3UF8A 3LPZA 4JHRA 3TCZA 4GCOA 1FKIA 5KJLA 4GA0A 5DBKA 1ROUA 5J6EA 4BT8A 3CKBA 4TX0A 3GZ1A 3PA7A 4ODKA 1HZ4A 3MKRA 2ZQTA 3SZ7A 4BT9A 2LSVA 5HW6A 2XP9A 5HI7A 4FAPA 2QFCA 3QOUA 2YHCA 1F40A 3U3WA 2ONDA 3SF4A 3VAWA 4UQYA 3R9AB 2LKNA 3S7JA 5B8IC 5BXJA 3TGOA 1HXIA 1PINA 3FWVA 4TW6A 5JJTA 4JFLA 5CHEE 4TW7A 2Q7FA 3GPKA 4GCNA 3PDNA 2KATA 4N5CA 3WH0A 2XGSA 4KBQA 2M2AA 2RURA 5HW8A 4GGQA 1TJCA 3KAFA 3OXLA 3S7FA 1R9HA 3U4TA 4U04A 3URZA 4TYOA 3O5QA 2UY1A 3CVLA 1F8AB 4FN2A 3RFWA 3CGMA 4TNSA 3NTPA 2UY1B 3KZ7A 4NRHB 3NF1A 3ULQA 2V5FA 1NZNA 3O5DA 5FZSA 1W3BA 4WNFA 4A1SA 5HTGA 3BEEA 4LAVA 4N3AA 2Q5AA 2PQRA 3TG4A 1KT1A 2E2EA 2LGOA 3CVPA 4JFKA 5A7DB 3PRBA 4LAYA 3KABA 4R0XA 4U84A 3CVNA 4I2WA 4N2QA 3AS5A 1QPLA 2VQ2A 3ZN3A 4XIFA 5HUAA 4ODLA 3ZHEA 4G1TA 2XCCA 5M72A 2XP5A 3UI5A 5FT9A 3RKVA 5BW8C 3KCEA 3QWWA 4IN3B 1ZU2A 4JFMA 3IKDA 2PPPA 5KJMA 3O5LA 1HH8A 5D0OD 2KO7A 5HKGA 1A7XA 3QWPA 3ESKA 2PV2A 5CCLA 3S7BA 1BKFA 4GZ6A 4U0SA 4I17A 1PC2A 4B94A 3ZFWA 4I9CA 3RU0A 2HR2A 2KCKA 3RO3A 2F2DA 2K8IA 4JA9A 2ZR5A 4N39A 1FKJA 2C0LA 1NMWA 1PBKA 4C02B 4DROA 4HOUA 4AY6A 4LAWA 3IKGA 4AM9A 2RQSA 4DRNA 1FKDA 4KYOB 4DRMA 4DZ3A 4ODPA 5C1DA 3S7DA 3IEGA 4J4NA 4DRKA 2PPNA 3LKUA 1KLXA 4J0UA 1TCOC 2DG9A 3FP3A 4J8DA 3O5JA 2MPHA 4U86A 4ABNA 3RGCA 5KJNA 3ASDA 3OXFA 4KXKB 1YA0A 1D7IA 4DH0A 3O48A 4BTBA 3NRKA 3RJVA 1NA0A 2RUCA 3Q4AB 5JJ6A 1C9HA 4GZ3A 2XEVA 5G04C 3E4BA 1QPFA 3K9IA 5BNWA 1M5YA 2XGOA 2FEZA 2D9FA 1T11A 4GYYA 2VSYA 1IHGA 3OXGA 2HYZA 4CGWA 5D75A 2Y4UA 4H7XA 4Y6WA 5HQ8A 4UI9C 1NMVA 1N1AA 2VYIA 3O5FA 2AVPA 4W9RA 4DRJA 5I98A 3VTYA 3Q49B 4QIBA 1FJDA 5G05C 2PPOA 4IPXA 3KS2A 1FKHA 3KAIA 4G2PA 3O5GA 5DIUA 2Y78A 4UI9K 5HWCA 3O5IA 1FKSA 4ODOA 2VCDA 3KAEA 3UI4A 5EX0A 4XI0A 2AWGA 1Q1CA 5G04J 3FAPA 1ZK6A 1W26A 4ITZA 1BL4A 4I1AA 3MDYB 2MLZA 4Y6CA 2L2SA 3EY6A 4UI9J 2N87A 2NC9A 4YNDA 4ODRA 1IYGA 2ITKA 5EKQD 4J4OA 3O5OA 1FAPA 5KJKA 2OFNA 5FZRA 4JFIA 4QT3A 4YVOA 2XP6A 2WPVA 2Y4TA 2LNIA 3O5EA 3CK7A 3KD7A 2KR7A 3UQAA 2DG3A 2LSUA 4JYSA 5HT1A 4RG9A 3NI6A 2HO1A 4N3BA 2FI7A 3CEQA 3JYSA 4UQXA 4CGVA 4DT4A 3QDNA 4RG6A 1FD9A 2VN1A 1JNSA 4H7YA 5DITA 2RUQA 4UQZA 4CDRA 5A6CA 2IFUA 3ZHEB 3UI6A 2FF4A 4G26A 1QQEA 2J9QA 2PL2A 3N71A 5HWBA 2JLBA 1A17A 4YVQC 2LPVA 4DZ2A 4EQFA 4DRQA 1Q6UA 5AYWD 3I6CA 4XI9A 2F21A 3GW4A 1WAO1 3TC5A 4HOTA 5ARGA 2VSNA 3UQBA 1YATA 5JJ7A 3ZPJA 1ELWA 2PZIA 2MHKA 3Q15A 3O5PA 4NNRA 3TDBA 4J8FA 3CVQA 3IK8A 2R5SA 2KCLA 3UQ3A 3GYZA 5CCMA 1QZ2A 4ODQA 5D0QD 1P5QA 2FAPA 4ODNA 3KAGA 3AS8A 3PE3A 3CK9A 5LCWC 3ASFA 3RIBA 1ROTA 1J4HA 2DBAA 2KFWA 1XNFA 1FKKA 4U85A 2ZR4A 2XCBA 1HXVA 1KT0A 1J4IA 1U79A 1FKGA 4GA2A 3KADA 3B7XA 3JYMA 3CKCA 1D7JA 2KCVA 1FKLA 5FTPA 2ZQUA 1J4RA 1L1PA 2VGYA 3CGNA 2KGJA 4IQCA 4HOQA
chains in the Genus database with same CATH superfamily
5AQBA 1YW5A 2ZISA 4FJYA 3MCXA 1EHNA 2L6JA 5LCWJ 1ZU8A 4UDMA 3IHZA 1W9PA 4LGXA 4FULA 5A23A 1LG2A 5JA4D 1N11A 5AIJA 2VGXB 2F8XK 4WUYA 4JA7A 5IY5E 2XGMA 3AG1E 5FQ8A 5GQBA 2H6HA 2IEJA 2IQCA 1GW6A 4JHKA 3WD3A 3PZ1A 4IQ2A 2XZDG 3QK0A 4QT2A 3CVVA 3EUVA 1JWGA 2WQHA 1LQ0A 1X6NA 2AXUA 2ETNA 4JFJA 4S3KA 1UJKA 3ASHA 4LEUA 5KCMA 3ZIMA 3MKQB 2GGFA 3CQCB 1ZB1A 3I3NA 3LY9A 1K8KG 4DRHA 3ZYLA 3L82A 1PY1A 3L54A 1GRJA 5DIVA 3DBSA 4AOFA 4DRIA 5HS0A 3B7TA 3HVEB 3C3RA 2I6HA 2LXMA 3PNTB 4WWOA 3MA5A 3VLFA 1FCHA 3CR3A 3ODKA 1D2KA 5EILA 2EQXA 3UQIA 1ZCNA 5BV0A 1KZOA 1HJXA 4ME2A 3SQVA 4KR0B 3CVUA 2XPIA 4L9PA 2BKGA 3V79K 3FY4A 3W9GA 2CHZA 2P9PG 1HKJA 2JZVA 3TAXA 3C5RA 1Y0OA 4GA1A 3O5RA 2LXLA 2ZR6A 4N19A 4AY5A 2WXRA 5B3SE 2QZAA 1BU9A 3OA5A 1TNZA 3WD1A 2CFUA 4U8YD 1GPFA 5BXOA 2P58C 3U9WA 4JL0A 3LCAA 4ATGA 3ZYKA 3JYJA 5ENOD 2ZQSA 4AIFA 4GPKA 2DSVA 3E37A 3SD5A 1FKRA 1H6PA 1OUVA 4PS7A 2V4HC 4AEZC 1E96B 4OVVA 1HS6A 4L7TA 1Y8MA 1SZ9A 4DX1A 1Q6HA 4GTTA 4O6FA 1GOIA 1E6RA 2C2LA 5J08A 3CIAA 5JHBA 4EPZA 5EYPF 3GZ2A 1VDYA 3FEXA 2A3CA 3FTSA 5KWDA 3B8SA 4JHRA 3CHCA 4MLPA 1FKIA 3ZU7B 1ROUA 3TWSA 5EDSA 4JXTA 2J09A 5D66A 4XZ4A 1HZ4A 4UWKA 4D10C 3MKRA 4GB9A 1INZA 5G55A 2LSVA 4XKCA 3B9EA 2XP9A 5HW6A 5HI7A 1MX2A 4FAPA 2QFCA 3QOUA 2GRPB 3W9FA 3U3WA 4E85A 2DT2A 1OY3D 3FWVA 4TW6A 2ZIRA 2WLYA 1N52A 4CYMD 4F7AA 3TWUA 4N5CA 1K1BA 2RURA 5HW8A 2IOLA 2CG2A 1KFWA 4GGQA 2NXPA 4EBAG 3U4TA 2M63A 4NACA 1IXVA 1F8AB 3RFWA 1NH6A 5E76A 4Z2JA 2A4ZA 3NTPA 4HXIA 3WQVA 1EDQA 5CMWA 4AJWA 1NZNA 3NOGD 3CHEA 4WNFA 2LUHA 3ABME 3BEEA 2Q5AA 3Q73A 3ARSA 3CQGB 1Z6TA 1SYTA 1RW2A 5A7DB 2EIJE 1X81A 4R0XA 3FTUA 3CVNA 4N2QA 1JNDA 2WM9A 4L3NA 2QC9A 1RD6A 3NAWA 4XIFA 4ODLA 3FXYA 5M72A 3UI5A 5FT9A 2EIME 4MBGA 5BW8C 3KCEA 2I1KA 4HBEA 2WXIA 1W1VA 2GRMA 3QOKA 2X6FA 4WIWA 4JFMA 1MX6A 4I6GA 2XZTG 1IHBA 3C3QA 4WWNA 1HH8A 3Q7AA 4EBAA 4BSZB 1TFVA 3ESKA 1FFRA 2ESCA 2PV2A 3S7BA 4DRXE 1NWTA 2E0IA 4GZ6A 1PC2A 3HHMA 3JXIA 2HR2A 2AWIA 5AQ7A 1PBKA 2C0LA 1NMWA 1NFIE 4LUNU 2WLZA 4LAWA 1U3DA 3U66A 3TWQA 4AM9A 4DRMA 5KNHD 1O1RA 5C1DA 3T5XA 4JVSA 4J4NA 4ZPTR 3VLDA 3ALFA 2WB2A 2DYRE 4UWFA 5ENQD 2MPHA 1N0RA 4ABNA 4TXPA 4ANWA 1K1AA 3JXJA 3OXFA 1S64A 4KXKB 1YA0A 2P2CP 3ZVVA 3O48A 4DLQA 3Q4AB 5ENPD 1C9HA 1QPFA 4MS6A 3K9IA 1OWQA 1M5YA 1DCQA 2VSYA 3SO8A 3GU0A 4CGWA 3NOCD 1E90A 4J6IA 4GMJA 1S0PA 1OXJA 4NZCA 4A3VA 5DEZA 4DI4A 4AXHA 2IJGX 2KBXA 5I98A 3VTYA 4HVBA 4W5UA 5LOZA 3KAIA 2DSUA 2R17C 5HWCA 3O5IA 4ODOA 3KAEA 4DJAA 4DWSA 1E15A 5EX0A 1L5JA 3ZYMA 2B5UB 2ETCA 4CRWA 5CEDB 3FAPA 2OEWA 4R7LA 1OWNA 1BL4A 1OT8A 2Y1LE 4I1AA 4YDOA 2XPYA 3EY6A 4KQZA 2NC9A 1VF8A 2WXGA 3SHFA 4CDNA 3CSTA 3DSVA 4YVOA 2IONA 2OLHA 2KR7A 1W9VA 1ZBCA 2DG3A 1SZAA 3ARRA 2OEVA 1OWLA 3NI6A 4N3BA 2P9UG 1ZBKA 1IX5A 5DITA 3UT4A 2BF0X 3FHEA 3ZHEB 3DSTA 3UI6A 2FF4A 4G26A 2AJAA 2JLBA 5CEAA 2LPVA 1DNPA 2X6HA 3I6CA 3ONLA 4E6HA 5LP0A 1TJFA 3PZDA 2F21A 5FQ7A 4HOTA 1ELWA 2PZIA 3O5PA 3G6LA 4P29A 4GTMA 1SR0A 2XEHA 4XEIG 2KCLA 2FAPA 1TEZA 3KAGA 3EHNA 3HG0D 4Z2HA 3D9OA 1ROTA 1JPLA 2B31A 3PRAA 3PS6A 1BLXB 2P9SG 1XNFA 1FKKA 2ZR4A 2XCBA 5FQ4A 3PH0C 5T4YA 4G8LA 1U79A 1FKGA 4GA2A 3ESLA 4Q69A 3JYMA 2KCVA 2KM4A 4JB8P 4U96D 1L1PA 1V54E 1EDUA 2YINA 5G2NA 3V31A 2KE0A 1FVFA 2WXHA 5AJDA 4CCAA 5FWQA 3TWVA 3EIPA 4K0RA 4HOSA 3WXXA 3FULA 1LL7A 3OOBA 3Q5MA 1HG5A 4GMRA 2A5EA 1MJ0A 2IOSA 4P8XA 1AP7A 2H6FA 3TG5A 4N3CA 2PV3A 2WMOA 2OVFA 1NWRA 1ELRA 1LG1A 1MX4A 3SI5A 3UMVA 4RSYA 4MNMA 5AJLA 1HF8A 2UWJG 4LAXA 3BXWA 2FBNA 1RZ4A 3SFYA 5DO2A 3SY2A 3HXEA 4DX7D 1X5BA 3AS2A 4N5QA 3C3OA 3ASGA 2BTDA 4G11A 3KACA 2X6KA 4WKFA 4DWSD 3HYMB 2DSZA 3UUXA 5FZQA 2XPAA 2PBCA 3AU5A 4WKAA 3H9RB 3BG0B 3W4RA 1QNFA 1EQ3A 4J8EA 1HFAA 5GPRA 3L9TA 3FEYA 4MTVA 1H2TC 1MHQA 4PS3A 1JVWA 4NQ0A 3DWLG 3ZGQA 4I9EA 3MX3A 1JCRA 3SBTB 5T8IA 2AOSA 3UIPC 4FLHA 2OCCE 1OGGA 5FJYA 3PE4A 4I1OB 1YYHA 3CVYA 3CK8A 3O5KA 2BUGA 3G2WA 4MSPA 1HJWA 1FKTA 4N2SA 4O1OA 4O2TA 1YMPA 3NZSA 5FIOA 2GRNB 1FFQA 2XS8A 4BFRA 2ETBA 3QWVA 1XHGA 4KVMA 4ZPWR 5CRUA 3FTWA 5ANRA 4EZLA 3ONKA 4YDWA 3VTXA 1ZB5A 2RD0A 4GPMA 2G8ZA 2HE0A 2DVWA 1D7HA 2XP7A 2V4LA 1NI1A 2XPZA 1O1TA 3JQ0A 3UPVA 4U95D 4ANXA 3UF8A 1HG2A 3ML9A 3TCZA 3PEUB 4LSZE 4WK9A 4GCOA 5KJLA 4I1MA 5DBKA 1Z3XA 2J4DA 3ZUVB 3D9LA 3CKBA 5D2MC 4ODKA 3E33A 4YDEA 1DCEA 3OAWA 4BT9A 1MQSA 2YHCA 1F40A 3QAQA 5AN8A 3SF4A 4UQYA 4OVUA 3UT7A 5JJTA 4JFLA 4TW7A 1EYHA 3QJZA 5ENTD 3GPKA 1OWMA 1UOHA 4RLYA 5EIDA 4KBQA 2M2AA 1TJCA 2KXPC 3E34A 3S7FA 4BSXA 4JC8A 4APFA 3UX4A 3G6MA 4U04A 5BXUA 3D9HA 3URZA 4JD2G 2DT1A 2UY1A 3HXFA 3TWTA 4FN2A 2GROB 4BX8A 3ENEA 3CGMA 4TNSA 2R03A 4NRHB 3NF1A 2WQ7A 2RFAA 4BERA 1W3BA 2XRYA 3DXMG 2GRQB 4N3AA 3CHSA 3TG4A 1KT1A 2E2EA 2GRLA 5JHAA 5ANLA 3TWWA 3HXDA 3LS8A 3KABA 4Q96A 4DX5D 3HRAA 3LXUX 4I2WA 1NL4A 2VQ2A 3ZN3A 5HUAA 5CBOA 2XCCA 2XP5A 1LD8A 3RKVA 3TXNA 4HNAD 1H0IA 2P9NG 3ALGA 4Z2LA 2FO1E 1OCOE 3FUFA 1E8WA 4P8VA 1A7XA 1LL6A 3QWPA 1CTNA 1IQUA 2CG3A 5CCLA 4F1SA 2DCPA 5EN5D 4J7WA 1BKFA 4U0SA 3ABLE 4B94A 4ZFHA 1N4SA 4I9CA 4C9BB 3RU0A 3RO3A 2F2DA 2P9LG 3KSQA 2K8IA 2ZR5A 3DXKG 1FKJA 3UXGA 3ARQA 3IKGA 4URKA 3HXBA 4DRNA 3L17A 2YHEA 3NB2A 3S7DA 2DIWA 2YNQA 3EU5A 4DRKA 5CECB 3ARTA 5CMYA 4HB5A 3SGHA 4U86A 2PI6A 4K5BA 3TJPA 3FTYA 3ZW3A 2BKKB 3ZXSA 4DH0A 4BTBA 4ML4A 1E8XA 4G8KA 3AS1A 1U2VG 1NA0A 3SFXA 5G04C 3Q9UC 2CHWA 2ILRA 3QARA 1T11A 3BUAA 3UTMA 3RRMB 3T9KA 4MKTA 4Y6WA 2EINE 4UI9C 1NMVA 1N1AA 3FY1A 3JCKC 5FINA 3O5FA 1ITXA 3BU8A 2PPOA 4IPXA 4WWPA 4G2PA 3EJNA 3CHQA 3O5GA 4UI9K 1XRVA 3FDHA 3FUNA 3UI4A 3CHRA 2AWGA 2XHEA 3FUMA 2F0YA 4A3TA 3LEWA 3UINC 4DWSB 3T5VA 3CHOA 3MKQA 2MLZA 3CHFA 1N95A 4BY6A 1W9UA 2N87A 4YNDA 1IYGA 4HI8A 3ARPA 1FAPA 2A3AA 2XP6A 4EHMA 2LNIA 5LFAA 4C0MA 3CK7A 2AW6A 4UQXA 4CGVA 2VN1A 1UW4B 3I5PA 5JH8A 2RUQA 2WXLA 2DZNA 2A3BA 1IQRA 2PL2A 1WG0A 1A17A 1NP7A 4IULA 1HJVA 4V3IA 1FVHA 4DZ2A 4DRQA 1Y6IA 1Q6UA 3EHRA 2WXQA 3FUJA 3D9IA 3TC5A 4Z2GA 2VTBB 3CHMA 5JJ7A 3E32A 3ZPJA 2VSOE 2DT3A 3Q15A 4NIKA 3P1UA 3TWXA 4AVXA 3UQ3A 3GYZA 5CCMA 4ODQA 5J90A 5D0QD 1P5QA 1UG3A 2AXZA 3AS8A 3PZ3A 5LCWC 4DX2A 3ASFA 4B0ZA 4HI9A 4M3OA 4IRUA 1LD7A 4U85A 3FUEA 5EIBE 4IT6A 1HXVA 1J4IA 4GAAA 1TN8A 4L2YA 3MZLB 3B7XA 1W1TA 3D9NA 1D7JA 3EIJA 3R7QA 1J4RA 4A55A 4BEPA 2NYJA 3ZNGA 3ZKJA 2AXVA 4LG6A 1N9AA 1D6OA 1DVPA 3PNLB 3DPYA 3CV0A 1FKBA 2IUZA 3AG3E 1TNBA 3TWRA 1U3CA 4ILHB 4MNLA 3CGHA 3F6QA 4JPSA 3G2UA 4DIPA 2G41A 1H2VC 1E6ZA 3FH5A 1SA4A 1J6YA 3D9PA 2YQ8A 2ZXWE 3PUKA 4XX5A 3PRDA 3ZEFA 3IHVA 4X8QA 2IO2C 4FJZA 4WNGA 4WNEA 1EIBA 1OCRE 1X6LA 1KPSB 4MNJA 1FKFA 2FKEA 5DF0A 4PUCA 2WXOA 4GMLA 3IV0A 4MGVA 2R02A 2ZQVA 1WM5A 2O9OA 3EHMA 2M08A 2O92A 4I43A 3EDTB 4BESA 4ODMA 1JUQA 4K5CA 5BUZA 2HM8A 3RMEA 4GZ5A 4NURA 1ZL1A 5HW7A 3MGBA 3Q7FA 4F53A 1B89A 2WXPA 2CFZA 4EZKA 4TW8A 2F37A 3CLJA 4I2ZA 2GW1A 3DEPA 2B0OE 2Y0BG 2YBUA 2P9KG 2ZGGA 3J5QB 4G25A 2P9IG 4GTPA 3WL1A 3O5MA 3JUEA 3V2OA 3RM4A 3GTYX 2LAHA 2J07A 2XP3A 2MLXA 1NWUA 1HE8A 3KEAA 1TNOA 3NQPA 3KAHA 5BT1A 2I1JA 3I4GA 3MV3B 4RVBA 4U7EB 1JCSA 4CZ2D 3QKYA 1N4QA 2WXKA 3FTXA 3AS4A 3PEVB 2DPEA 4RQIA 4GIVA 4NSBA 4W9PA 3FH8A 2RG8A 4G23A 4UWHA 3ULEG 1E8ZA 1NA3A 1XGWA 1MZCA 5BV1A 3FTZA 5KBAA 2QYJA 1Z5SC 5KNGA 3LJNA 4BT8A 2MRIA 3G2VA 1WAWA 4LNGA 2ZQTA 4CEMA 3FU6A 3SZ7A 1EF1C 3DSWA 1ELKA 3J5PA 3L08A 3WQWA 1V55E 1TN6A 1DC2A 3VAWA 3S7JA 5B8IC 5BXJA 4TRQA 5HKPA 3TGOA 4KZ0A 4WKHA 4S3JA 1SVXA 5AARA 3PZ4A 3S2AA 3CZ8A 2Q7FA 2EILE 4GCNA 5CRVA 2KATA 3FU0A 2XGSA 4L72B 4YDYA 4KMOA 3KAFA 3OXLA 3FUIA 4TYOA 2X3MA 3CVLA 1ZBVA 3DSXA 3RRUA 1OWPA 3QC1A 5CBNA 1E44A 4B8AA 1H6KA 2UY1B 3ABKE 3KZ7A 3ULQA 3O5DA 1EPUA 4ANVA 2KZTA 1NWSA 4LAVA 3APDA 2VJ8A 3UKUG 3B9DA 2LGOA 5ENRD 2WXJA 4XAKA 4JFKA 3PRBA 1BI7B 4Z68A 3FTVA 4LAYA 4U84A 2Y69E 1UJJA 3WIJA 3PRZA 4EZJA 3ZHEA 3APFA 1D8EA 3ASNE 3L13A 3QWWA 4IN3B 1IKND 4OYSA 3RK6A 1WDYA 3IKDA 3HDXA 2IO3C 3O5LA 2XENA 3Q75A 1K3ZD 2KO7A 2GRRB 3B13A 2WXNA 1H0AA 2Y3AA 3WL0A 4HS2A 4ZHBA 1H2UA 4LRZA 3AQUA 2A3EA 3IHYA 5T3RA 2L0TB 1S63A 3EU9A 3DRAA 4PDXA 4R5EA 3Q79A 1BI8B 2BEDA 4HOUA 4DK5A 2RQSA 1HX8A 4L1BA 2R59A 3SBSA 4Z2KA 2EULA 4ILGA 3UM0A 1KLXA 4J0UA 3L22A 4I6EA 2DG9A 4J8DA 4FLBA 5CERB 3ASDA 1D7IA 2L0IA 4I6JA 5H7PA 3NRKA 3RJVA 2RUCA 4GZ3A 4JEHA 3FU3A 4B8CB 5BNWA 2FEZA 4GYYA 3I4RB 1IHGA 3CVWA 3OXGA 3T8KA 1OCZE 5D75A 2Y4UA 3HXCA 4QFVA 4TUMA 4H7XA 5HQ8A 3RSEG 4WAFA 3DPDA 2VYIA 3TL5A 1QBQA 1N4PA 1LTXA 2AVPA 4W9RA 4DRJA 2VSXE 3ARWA 4QIBA 1O6IA 3KS2A 1FKHA 4TXRA 5DIUA 4CDMA 3EHQA 1UN9A 4XI0A 1Q1CA 5ENSD 3AROA 3EIQC 4UWGA 4UUCA 5FQ6A 4AY1A 4HARA 4ITZA 3MDYB 2L2SA 3UM1A 2A5UA 5EKQD 4P8WA 3O5OA 4AV7A 4BETA 5KJKA 4HLEA 3O5EA 4U63A 3UQAA 2XS1A 4JYSA 5HT1A 4RG9A 2HO1A 3CEQA 4HQDA 4C0EA 4HLLA 4TV3A 4RG6A 1JNSA 3D9JA 4H7YA 2R2LA 3V2XA 3MJWA 4UQZA 4CDRA 2IFUA 4AP2A 1JNEA 4WJXA 1QQEA 3BQOA 4JZYA 3N71A 5HWBA 4ATZD 4YVQC 2H6GA 4BX9A 5C2YA 1E7UA 5AYWD 5AQAA 3GW4A 1WAO1 3ZYQA 4J8SA 2VSNA 3UQBA 1YATA 4NNRA 2VGEA 1N0QA 1O5MA 4HBDA 3CVQA 5E75A 3IKOB 5LX8A 2R5SA 4HRLA 1A5EA 1QZ2A 2X38A 2I2OA 3IBEA 1YCSB 4O60A 4ODNA 3PE3A 4O1PA 1W1YA 3CK9A 2CHXA 2OVBA 2IY0C 1J4HA 2DBAA 1UR9A 4U8HA 2KFWA 1KT0A 3KADA 2L6BA 5AQ9A 1FKLA 4GTRA 3PR9A 4CT0A 3CGNA 2KGJA 4PS8A 2L9BA 4HOQA 2YBTA 2PN0A 3DSUA 1PAQA 2XRZA 4F1PA 2DSWA 3HIZA 2QY7A 2NSZA 2VGXA 3IXEA 4OAVB 4HRNA 2KI3A 3PZ2A 3APCA 1OCCE 1LJYA 1GUVA 3LYAA 5EX3A 2RSEA 4BF8A 5GPGA 1KZPA 4GYWA 3PVLA 1D9SA 3RO2A 4WNDA 2OOEA 4GTQA 4KT6B 1B6CA 4W9QA 2WVIA 3MEKA 2C0MA 3QB2A 1Q6IA 2RUDA 4HORA 4XKBA 1HU3A 2XP8A 3FFLA 3LVRE 2MLYA 2PNNA 4QZVB 1E6PA 4F3VA 1ZBPA 3ULYA 4JW1A 3B9AA 3LY8A 4TUUA 3D9KA 2XQ0A 4F6RD 2ZU6B 3V30A 3LUOA 3HVEA 3FUHA 4DPRA 3LVQE 3Q47B 5G05J 1EYMA 2IU1A 5DIZA 3DSSA 2PQNA 2RKKA 3R7RA 4U0UA 5BPPA 1NSGA 4C48B 1HO8A 4L23A 4U07A 4U0ZA 4PTMA 3C98A 3TXMA 3SFZA 4G24A 5ARFA 1AWCB 3MV2B 2F4EA 2OV8A 2XPBA 2B6CA 2LAIA 4W9OA 2I9CA 5HBFA 3G2TA 2DG4A 3Q78A 1HKMA 5AENA 3B95A 3KSLA 3ML8A 3JXVA 3KEZA 1JNTA 4DLOA 2IF4A 2FO7A 1SW6A 2M1IA 2KC7A 1WY6A 2MNTA 3DEOA 3LY7A 5ENNA 4G50A 3CH9A 1S70B 4CT4A 4UWLA 1FPPA 4QQIA 4GZDA 3C72A 1H6OA 2MF9A 4GYOA 3ARZA 3QNKA 4BTAA 5B1BE 3UIOC 2XP4A 4DRPA 4FHKA 3CHDA 3B7BA 2LJ4A 4FP7A 3CHPA 4ZPVR 4G2VA 4K03A 4APOA 4BWRA 4M7CA 4Z2IA 3L16A 2UZ5A 1HKKA 2PV1A 2MOWA 3LPZA 4IYPA 4DI3A 4MAVA 4J8YA 3CSFA 2WMNA 2LO6A 1N54A 4K5AB 4GA0A 5J6EA 2V0PA 4TX0A 3GZ1A 3PA7A 4FADA 4A1GA 3AJIA 4DX6D 3VLEA 3JQ1A 3BMBA 1JWFA 3E30A 3ARXA 2ONDA 5AAOA 3R9AB 2LKNA 1HXIA 1PINA 2QYUA 5CHEE 1G3NB 1TN7A 2WXMA 1QYMA 3AS3A 2QF8A 3OTNA 3PDNA 3ASOE 3WH0A 2J8SD 2ETAA 3P2BA 4LERA 3MYVA 1R9HA 3RAUA 3GZSA 4EECA 3O5QA 3UT8A 1D8DA 3AG2E 1E8YA 1SQMA 4MPKA 2V5FA 3BG1B 5FZSA 4XE0A 4A1SA 5HTGA 3WKZA 1TYQG 2PQRA 3CVXA 3CVPA 1Z3YA 2EIKE 4KVOA 2KZTB 4JHJA 2XEEA 1MYOA 3AS5A 1QPLA 3PUJA 4HBOA 4G1TA 3AU4A 5B1AE 3G2SA 2FDMA 4LNBA 2WQ6A 1ZU2A 3NZUA 2PPPA 2J08A 5KJMA 5D0OD 5HKGA 3B7UX 3RM8A 1JCQA 3ISMC 3UM3A 4GTVA 1JCHB 1WNOA 2VTBA 1WB0A 1O1SA 4I17A 2H6IA 2FULA 4Q94A 3ZFWA 3ZXPA 3AS0A 2KCKA 4Q22A 2PM6A 4JA9A 4N39A 4DROA 1TNYA 4C02B 4AY6A 1FKDA 4KYOB 4DZ3A 2DWZA 3D3MA 4ODPA 3IEGA 3T8MA 4FC8A 3UM2A 2PPNA 3LKUA 4HRMB 5JMND 4LNUD 4ZS6A 1TCOC 1BD8A 3D9MA 3FP3A 3O5JA 4ACKA 3RGCA 2P4VA 5KJNA 1LF8A 3FUKA 2MYOA 3WG7E 4ILIA 4P8UA 2RFMA 5JJ6A 3B7RL 3RRNB 4DUIA 4FA6A 2XEVA 4HFGA 4B89A 3E4BA 3FUDA 2XGOA 2D9FA 3LDZA 4URIA 2HYZA 3R9MA 4GTOA 4JEUA 3UI2A 3L6AA 1H19A 1OGBA 4KZCA 2DT0A 2F8YA 3X2QE 1UN8A 1Q2ZA 1UR8A 4GU5A 3FH7A 3ARUA 2JEKA 3WD0A 3Q49B 1FJDA 4LCTA 5G05C 3ARYA 2X6JA 4U8VD 1TNUA 2J49A 2Y78A 5EYLA 3ARVA 3LJ3A 1FKSA 2VCDA 4DWSC 4OAUC 1FT2A 4L2LA 5G04J 4A63B 3SNXA 4FHJA 1ZK6A 4MRUA 4IT4A 4TXQA 1W26A 2ZGDA 3AG4E 1HKIA 4Y6CA 2X6IA 1OWOA 4UI9J 2R05A 4ODRA 2ITKA 4J4OA 3RM9A 4JFIA 2OFNA 4PH4B 5FZRA 4QT3A 2WPVA 2Y4TA 3WD4A 3KD7A 2JABA 2WXFA 2LSUA 5HRYA 3JUIA 4Q7NA 4GTSA 2FI7A 1K9TA 3JYSA 4DT4A 3QDNA 1FD9A 5A6CA 2WK2A 2DZOA 2J9QA 1W1PA 2V8SE 3UKRG 4EQFA 4ACLA 4XI9A 2J4BA 3B7SA 5ARGA 2PM7A 1ZBWA 2MHKA 3TDBA 1E7VA 4J8FA 3NBNB 3IK8A 1H0GA 4MNKA 1E9LA 5ITZF 2V5QC 4B93B 4GZCA 1N4RA 1TR4A 3AAAC 1BPOA 3RIBA 1N94A 3PREA 1LL4A 1E6NA 1SA5A 3FU5A 4FU3A 3WD2A 2DYSE 3O4ZA 3CKCA 3Q9NC 3ZRHA 5FTPA 2ZQUA 2VGYA 4ANUA 3U64A 4IQCA 2F23A 2WM0A 1FT1A
chains in the Genus database with same CATH topology
1YW5A 4FJYA 3MCXA 1EHNA 2L6JA 5LCWJ 1ZU8A 3IHZA 1W9PA 4LGXA 4FULA 5A23A 1LG2A 5AIJA 2VGXB 4WUYA 4JA7A 2XGMA 5FQ8A 5GQBA 2IQCA 1GW6A 4JHKA 3WD3A 4IQ2A 3QK0A 4QT2A 3CVVA 1JWGA 2WQHA 1LQ0A 1X6NA 2AXUA 4JFJA 4S3KA 1UJKA 3ASHA 4LEUA 5KCMA 3ZIMA 3MKQB 2GGFA 3CQCB 3LY9A 3I3NA 4DRHA 3ZYLA 1PY1A 3L54A 5DIVA 3DBSA 4AOFA 4DRIA 3B7TA 3HVEB 2I6HA 3PNTB 4WWOA 3MA5A 3VLFA 1FCHA 3CR3A 3ODKA 1D2KA 2EQXA 3UQIA 1ZCNA 5BV0A 1HJXA 4ME2A 4KR0B 3CVUA 2XPIA 3FY4A 2CHZA 1HKJA 2JZVA 3TAXA 1Y0OA 3O5RA 4GA1A 2ZR6A 4N19A 4AY5A 2WXRA 3WD1A 3OA5A 2CFUA 1GPFA 2P58C 3U9WA 4JL0A 3LCAA 4ATGA 3ZYKA 3JYJA 2ZQSA 4AIFA 4GPKA 2DSVA 3SD5A 1FKRA 1OUVA 4PS7A 4AEZC 1E96B 4OVVA 1HS6A 4L7TA 1Y8MA 1SZ9A 1Q6HA 4O6FA 1GOIA 1E6RA 2C2LA 5J08A 3CIAA 5JHBA 4EPZA 3GZ2A 1VDYA 3FEXA 2A3CA 3FTSA 3B8SA 4JHRA 3CHCA 4MLPA 1FKIA 1ROUA 5EDSA 4JXTA 2J09A 4XZ4A 1HZ4A 4UWKA 4D10C 3MKRA 4GB9A 1INZA 5G55A 2LSVA 4XKCA 3B9EA 2XP9A 5HW6A 5HI7A 4FAPA 2QFCA 3QOUA 3U3WA 4E85A 2DT2A 3FWVA 4TW6A 2WLYA 1N52A 4F7AA 4N5CA 2RURA 5HW8A 2IOLA 2CG2A 1KFWA 4GGQA 2NXPA 4EBAG 3U4TA 2M63A 4NACA 1F8AB 3RFWA 1NH6A 5E76A 4Z2JA 2A4ZA 3NTPA 4HXIA 3WQVA 1EDQA 5CMWA 4AJWA 1NZNA 3CHEA 4WNFA 3BEEA 2Q5AA 3ARSA 3CQGB 1Z6TA 1SYTA 5A7DB 4R0XA 3FTUA 3CVNA 4N2QA 1JNDA 2WM9A 4L3NA 1RD6A 4XIFA 4ODLA 3FXYA 5M72A 3UI5A 5FT9A 5BW8C 3KCEA 2I1KA 4HBEA 2WXIA 1W1VA 2GRMA 3QOKA 2X6FA 4WIWA 4JFMA 4I6GA 4WWNA 1HH8A 4EBAA 1TFVA 3ESKA 1FFRA 2ESCA 2PV2A 3S7BA 1NWTA 2E0IA 4GZ6A 1PC2A 3HHMA 2HR2A 2AWIA 1PBKA 2C0LA 1NMWA 4LUNU 2WLZA 4LAWA 1U3DA 3U66A 4AM9A 4DRMA 5C1DA 3T5XA 4JVSA 4J4NA 4ZPTR 3VLDA 3ALFA 2WB2A 4UWFA 2MPHA 4ABNA 4ANWA 3OXFA 4KXKB 1YA0A 3ZVVA 3O48A 4DLQA 3Q4AB 1C9HA 1QPFA 4MS6A 3K9IA 1OWQA 1M5YA 2VSYA 4CGWA 1E90A 4J6IA 4GMJA 1S0PA 4NZCA 4A3VA 5DEZA 4DI4A 4AXHA 2IJGX 5I98A 3VTYA 4HVBA 4W5UA 5LOZA 3KAIA 2DSUA 2R17C 5HWCA 3O5IA 4ODOA 3KAEA 4DJAA 4DWSA 1E15A 5EX0A 1L5JA 3ZYMA 4CRWA 3FAPA 4R7LA 1OWNA 1BL4A 4I1AA 2XPYA 3EY6A 4KQZA 2NC9A 1VF8A 2WXGA 3SHFA 4CDNA 3CSTA 4YVOA 2IONA 2OLHA 2KR7A 1W9VA 1ZBCA 2DG3A 1SZAA 3ARRA 1OWLA 3NI6A 4N3BA 1ZBKA 1IX5A 5DITA 3UT4A 2BF0X 3FHEA 3ZHEB 3UI6A 2FF4A 4G26A 2JLBA 2LPVA 1DNPA 2X6HA 3I6CA 3ONLA 4E6HA 5LP0A 1TJFA 3PZDA 2F21A 5FQ7A 4HOTA 1ELWA 2PZIA 3O5PA 3G6LA 4P29A 1SR0A 2KCLA 2FAPA 1TEZA 3KAGA 3EHNA 4Z2HA 3D9OA 1ROTA 1JPLA 2B31A 3PRAA 3PS6A 1XNFA 1FKKA 2ZR4A 2XCBA 5FQ4A 3PH0C 5T4YA 1U79A 1FKGA 4GA2A 3ESLA 4Q69A 3JYMA 2KCVA 2KM4A 1L1PA 1EDUA 2YINA 5G2NA 2KE0A 1FVFA 2WXHA 5AJDA 4CCAA 5FWQA 4K0RA 4HOSA 3WXXA 3FULA 1LL7A 3OOBA 3Q5MA 1HG5A 2IOSA 4P8XA 3TG5A 4N3CA 2PV3A 2WMOA 2OVFA 1NWRA 1ELRA 1LG1A 3SI5A 3UMVA 4RSYA 4MNMA 5AJLA 1HF8A 2UWJG 4LAXA 3BXWA 2FBNA 5DO2A 1X5BA 3AS2A 3ASGA 2BTDA 4G11A 3KACA 2X6KA 4WKFA 4DWSD 3HYMB 2DSZA 3UUXA 5FZQA 2XPAA 2PBCA 3AU5A 4WKAA 3H9RB 3BG0B 3W4RA 1QNFA 1EQ3A 4J8EA 1HFAA 5GPRA 3FEYA 4MTVA 1H2TC 1MHQA 4PS3A 1JVWA 4NQ0A 3ZGQA 4I9EA 3MX3A 3SBTB 5T8IA 2AOSA 4FLHA 1OGGA 5FJYA 3PE4A 4I1OB 3CVYA 3CK8A 3O5KA 2BUGA 3G2WA 4MSPA 1HJWA 1FKTA 4N2SA 4O2TA 3NZSA 1FFQA 4BFRA 3QWVA 1XHGA 4KVMA 4ZPWR 3FTWA 5ANRA 4EZLA 3ONKA 3VTXA 1ZB5A 2RD0A 2G8ZA 1D7HA 2XP7A 2V4LA 2XPZA 3UPVA 3JQ0A 4ANXA 3UF8A 1HG2A 3ML9A 3TCZA 3PEUB 4WK9A 4GCOA 5KJLA 4I1MA 5DBKA 1Z3XA 2J4DA 3D9LA 3CKBA 4ODKA 3OAWA 4BT9A 1MQSA 2YHCA 1F40A 3QAQA 3SF4A 4UQYA 4OVUA 3UT7A 5JJTA 4JFLA 4TW7A 1EYHA 3QJZA 3GPKA 1OWMA 4KBQA 2M2AA 1TJCA 3S7FA 4BSXA 4JC8A 4APFA 3UX4A 3G6MA 4U04A 2DT1A 3URZA 2UY1A 4FN2A 4BX8A 3ENEA 3CGMA 4TNSA 4NRHB 3NF1A 2WQ7A 1W3BA 2XRYA 4N3AA 3CHSA 3TG4A 1KT1A 2E2EA 2GRLA 5JHAA 5ANLA 3LS8A 3KABA 4Q96A 3LXUX 4I2WA 2VQ2A 3ZN3A 5HUAA 2XCCA 2XP5A 3RKVA 3TXNA 1H0IA 3ALGA 4Z2LA 3FUFA 1E8WA 4P8VA 1A7XA 1LL6A 3QWPA 1CTNA 1IQUA 2CG3A 5CCLA 4F1SA 2DCPA 1BKFA 4U0SA 4B94A 4I9CA 4C9BB 3RU0A 3RO3A 2F2DA 2K8IA 2ZR5A 1FKJA 3ARQA 3IKGA 4URKA 4DRNA 3L17A 2YHEA 3S7DA 2DIWA 2YNQA 4DRKA 3ARTA 5CMYA 3SGHA 4U86A 2PI6A 3TJPA 3FTYA 3ZW3A 3ZXSA 4DH0A 4BTBA 4ML4A 1E8XA 3AS1A 1NA0A 5G04C 2CHWA 2ILRA 3QARA 1T11A 3RRMB 4MKTA 4Y6WA 4UI9C 1NMVA 1N1AA 3FY1A 3JCKC 3O5FA 1ITXA 2PPOA 4IPXA 4WWPA 4G2PA 3EJNA 3CHQA 3O5GA 4UI9K 1XRVA 3FDHA 3FUNA 3UI4A 3CHRA 2AWGA 2XHEA 3FUMA 4A3TA 3LEWA 4DWSB 3T5VA 3CHOA 3MKQA 2MLZA 3CHFA 4BY6A 1W9UA 2N87A 4YNDA 1IYGA 3ARPA 1FAPA 2A3AA 2XP6A 2LNIA 5LFAA 4C0MA 3CK7A 2AW6A 4UQXA 4CGVA 2VN1A 1UW4B 3I5PA 5JH8A 2RUQA 2WXLA 2A3BA 1IQRA 2PL2A 1A17A 1NP7A 4IULA 1HJVA 4V3IA 1FVHA 4DZ2A 4DRQA 1Y6IA 1Q6UA 2WXQA 3FUJA 3D9IA 3TC5A 4Z2GA 2VTBB 3CHMA 5JJ7A 3ZPJA 2VSOE 2DT3A 3Q15A 3P1UA 4AVXA 3UQ3A 3GYZA 5CCMA 4ODQA 5J90A 5D0QD 1P5QA 1UG3A 2AXZA 3AS8A 5LCWC 3ASFA 4B0ZA 4M3OA 4IRUA 4U85A 3FUEA 4IT6A 1HXVA 1J4IA 4GAAA 4L2YA 3MZLB 3B7XA 1W1TA 3D9NA 1D7JA 3EIJA 3R7QA 1J4RA 4A55A 2AXVA 1D6OA 1DVPA 3PNLB 3CV0A 1FKBA 2IUZA 1U3CA 4ILHB 4MNLA 3CGHA 4JPSA 3G2UA 4DIPA 2G41A 1H2VC 1E6ZA 3FH5A 1J6YA 3D9PA 2YQ8A 3PUKA 4XX5A 3PRDA 3ZEFA 3IHVA 4FJZA 4WNGA 4WNEA 1EIBA 1X6LA 4MNJA 1FKFA 2FKEA 5DF0A 4PUCA 2WXOA 4GMLA 3IV0A 4MGVA 2ZQVA 1WM5A 2O9OA 3EHMA 2M08A 2O92A 4I43A 3EDTB 4ODMA 1JUQA 5BUZA 2HM8A 3RMEA 4GZ5A 4NURA 1ZL1A 5HW7A 3MGBA 4F53A 1B89A 2WXPA 2CFZA 4EZKA 4TW8A 3CLJA 4I2ZA 2GW1A 2YBUA 4G25A 3WL1A 3O5MA 3RM4A 2LAHA 2J07A 2XP3A 2MLXA 1NWUA 1HE8A 3NQPA 3KAHA 5BT1A 2I1JA 3I4GA 3MV3B 4RVBA 3QKYA 2WXKA 3FTXA 3AS4A 3PEVB 2DPEA 4GIVA 4NSBA 4W9PA 3FH8A 2RG8A 4G23A 4UWHA 1E8ZA 1NA3A 1XGWA 5BV1A 3FTZA 4BT8A 2MRIA 3G2VA 1WAWA 2ZQTA 4CEMA 3FU6A 3SZ7A 1EF1C 1ELKA 3L08A 3WQWA 3VAWA 3S7JA 5B8IC 5BXJA 4TRQA 3TGOA 4KZ0A 4WKHA 4S3JA 3S2AA 3CZ8A 2Q7FA 4GCNA 2KATA 3FU0A 2XGSA 4L72B 4KMOA 3KAFA 3OXLA 3FUIA 4TYOA 2X3MA 3CVLA 1ZBVA 3RRUA 1OWPA 3QC1A 4B8AA 1H6KA 3KZ7A 2UY1B 3ULQA 3O5DA 1EPUA 4ANVA 2KZTA 1NWSA 4LAVA 3APDA 2VJ8A 3B9DA 2LGOA 2WXJA 4XAKA 4JFKA 3PRBA 3FTVA 4LAYA 4U84A 1UJJA 3WIJA 3PRZA 4EZJA 3ZHEA 3APFA 3L13A 3QWWA 4IN3B 4OYSA 3RK6A 3IKDA 3HDXA 3O5LA 2KO7A 3B13A 2WXNA 1H0AA 2Y3AA 3WL0A 4HS2A 1H2UA 4LRZA 3AQUA 2A3EA 3IHYA 5T3RA 2L0TB 4PDXA 4R5EA 4HOUA 4DK5A 2RQSA 1HX8A 4L1BA 2R59A 3SBSA 4Z2KA 4ILGA 1KLXA 4J0UA 3L22A 4I6EA 2DG9A 4J8DA 4FLBA 3ASDA 1D7IA 2L0IA 4I6JA 3NRKA 3RJVA 2RUCA 4GZ3A 4JEHA 3FU3A 4B8CB 5BNWA 2FEZA 4GYYA 3I4RB 1IHGA 3CVWA 3OXGA 5D75A 2Y4UA 4QFVA 4H7XA 5HQ8A 4WAFA 3DPDA 2VYIA 3TL5A 2AVPA 4W9RA 4DRJA 2VSXE 3ARWA 4QIBA 1O6IA 3KS2A 1FKHA 5DIUA 4CDMA 1UN9A 4XI0A 1Q1CA 3AROA 3EIQC 4UWGA 5FQ6A 4AY1A 4HARA 4ITZA 3MDYB 2L2SA 2A5UA 5EKQD 4P8WA 3O5OA 4AV7A 5KJKA 4HLEA 3O5EA 4U63A 3UQAA 4JYSA 5HT1A 4RG9A 2HO1A 3CEQA 4C0EA 4TV3A 4RG6A 1JNSA 3D9JA 4H7YA 3MJWA 4UQZA 4CDRA 2IFUA 4AP2A 1JNEA 4WJXA 1QQEA 4JZYA 3N71A 5HWBA 4YVQC 4BX9A 5C2YA 1E7UA 5AYWD 3GW4A 1WAO1 3ZYQA 4J8SA 2VSNA 3UQBA 1YATA 4NNRA 3CVQA 5E75A 3IKOB 5LX8A 2R5SA 1QZ2A 2X38A 2I2OA 3IBEA 4ODNA 3PE3A 1W1YA 3CK9A 2CHXA 2OVBA 1J4HA 2DBAA 1UR9A 4U8HA 2KFWA 1KT0A 3KADA 1FKLA 3PR9A 4CT0A 3CGNA 2KGJA 4PS8A 2L9BA 4HOQA 2YBTA 1PAQA 2XRZA 2DSWA 3HIZA 2QY7A 2NSZA 2VGXA 2KI3A 3APCA 1LJYA 1GUVA 3LYAA 5EX3A 2RSEA 4BF8A 5GPGA 4GYWA 3PVLA 3RO2A 4WNDA 2OOEA 4KT6B 1B6CA 4W9QA 2WVIA 3MEKA 2C0MA 3QB2A 1Q6IA 2RUDA 4HORA 4XKBA 1HU3A 2XP8A 3FFLA 3LVRE 2MLYA 4QZVB 1E6PA 4F3VA 1ZBPA 4JW1A 3B9AA 3LY8A 4TUUA 3D9KA 2XQ0A 2ZU6B 3LUOA 3HVEA 3FUHA 4DPRA 3LVQE 3Q47B 5G05J 1EYMA 2IU1A 5DIZA 2PQNA 3R7RA 4U0UA 5BPPA 1NSGA 1HO8A 4L23A 4U07A 4U0ZA 4PTMA 3C98A 3TXMA 3SFZA 4G24A 5ARFA 3MV2B 2F4EA 2OV8A 2XPBA 2LAIA 4W9OA 2I9CA 5HBFA 3G2TA 2DG4A 1HKMA 5AENA 3ML8A 3JXVA 3KEZA 1JNTA 4DLOA 2IF4A 2FO7A 2M1IA 2KC7A 1WY6A 2MNTA 3LY7A 5ENNA 4G50A 3CH9A 4CT4A 4UWLA 4GZDA 2MF9A 4GYOA 3ARZA 3QNKA 4BTAA 2XP4A 4DRPA 4FHKA 3CHDA 2LJ4A 4FP7A 3CHPA 4ZPVR 4G2VA 4K03A 4APOA 4BWRA 4Z2IA 3L16A 2UZ5A 1HKKA 2PV1A 2MOWA 3LPZA 4IYPA 4DI3A 4MAVA 3CSFA 2WMNA 2LO6A 1N54A 4GA0A 5J6EA 2V0PA 4TX0A 3GZ1A 3PA7A 4FADA 4A1GA 3VLEA 3JQ1A 1JWFA 3ARXA 2ONDA 3R9AB 2LKNA 1HXIA 1PINA 5CHEE 2WXMA 3AS3A 2QF8A 3OTNA 3PDNA 3WH0A 3P2BA 4LERA 3MYVA 1R9HA 3GZSA 4EECA 3O5QA 3UT8A 1E8YA 1SQMA 4MPKA 2V5FA 3BG1B 5FZSA 4XE0A 4A1SA 5HTGA 3WKZA 2PQRA 3CVXA 3CVPA 1Z3YA 4KVOA 2KZTB 4JHJA 3AS5A 1QPLA 3PUJA 4HBOA 4G1TA 3AU4A 3G2SA 2FDMA 2WQ6A 1ZU2A 3NZUA 2PPPA 2J08A 5KJMA 5D0OD 5HKGA 3B7UX 3RM8A 1WNOA 2VTBA 1WB0A 4I17A 2FULA 4Q94A 3ZFWA 3AS0A 2KCKA 4Q22A 2PM6A 4JA9A 4N39A 4DROA 4C02B 4AY6A 1FKDA 4KYOB 4DZ3A 3D3MA 4ODPA 3IEGA 3T8MA 4FC8A 2PPNA 3LKUA 4ZS6A 1TCOC 3D9MA 3FP3A 3O5JA 4ACKA 3RGCA 5KJNA 1LF8A 3FUKA 4ILIA 4P8UA 5JJ6A 3B7RL 3RRNB 4FA6A 2XEVA 4HFGA 4B89A 3E4BA 3FUDA 2D9FA 2XGOA 3LDZA 4URIA 2HYZA 4JEUA 3L6AA 1H19A 1OGBA 4KZCA 2DT0A 1UN8A 1UR8A 4GU5A 3FH7A 3ARUA 2JEKA 3WD0A 3Q49B 1FJDA 4LCTA 5G05C 3ARYA 2X6JA 2J49A 2Y78A 3ARVA 3LJ3A 1FKSA 2VCDA 4DWSC 4L2LA 5G04J 3SNXA 4FHJA 1ZK6A 4MRUA 4IT4A 1W26A 1HKIA 4Y6CA 2X6IA 1OWOA 4UI9J 4ODRA 2ITKA 4J4OA 3RM9A 4JFIA 2OFNA 4PH4B 5FZRA 4QT3A 2WPVA 2Y4TA 3WD4A 3KD7A 2WXFA 2LSUA 3JUIA 4Q7NA 2FI7A 1K9TA 3JYSA 4DT4A 3QDNA 1FD9A 5A6CA 2WK2A 2J9QA 1W1PA 2V8SE 4EQFA 4ACLA 4XI9A 2J4BA 3B7SA 5ARGA 2PM7A 1ZBWA 2MHKA 3TDBA 1E7VA 4J8FA 3IK8A 1H0GA 4MNKA 1E9LA 4GZCA 1BPOA 3RIBA 3PREA 1LL4A 1E6NA 3FU5A 4FU3A 3WD2A 3O4ZA 3CKCA 3ZRHA 5FTPA 2ZQUA 2VGYA 4ANUA 3U64A 4IQCA 2WM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KE0 A;  1YW5 A;  2VGX A;  2L6J A;  1D6O A;  3CV0 A;  5LCW J;  3WXX A;  4HOS A;  1FKB A;  2KI3 A;  3IHZ A;  3LYA A;  5EX3 A;  2RSE A;  4BF8 A;  2VGX B;  5GPG A;  3OOB A;  4WUY A;  4JA7 A;  4GYW A;  2XGM A;  3Q5M A;  3RO2 A;  4WND A;  2OOE A;  1B6C A;  4W9Q A;  3TG5 A;  3MEK A;  4N3C A;  4DIP A;  2C0M A;  2PV3 A;  1Q6I A;  1ELR A;  4IQ2 A;  2RUD A;  1J6Y A;  4HOR A;  2YQ8 A;  4QT2 A;  3PRD A;  2WQH A;  4JFJ A;  2XP8 A;  3FFL A;  4WNG A;  4WNE A;  2MLY A;  2UWJ G;  3ASH A;  4LEU A;  4F3V A;  1ZBP A;  4LAX A;  3LY8 A;  1FKF A;  2FKE A;  3LY9 A;  2FBN A;  3LUO A;  4DRH A;  4MGV A;  2ZQV A;  1WM5 A;  5DIV A;  2M08 A;  3ASG A;  3Q47 B;  5G05 J;  3KAC A;  4DRI A;  3EDT B;  1EYM A;  3HYM B;  3UUX A;  5DIZ A;  5FZQ A;  2PQN A;  2I6H A;  2PBC A;  2XPA A;  4U0U A;  4ODM A;  1NSG A;  3H9R B;  3MA5 A;  1FCH A;  3ODK A;  4U07 A;  3UQI A;  4U0Z A;  1ZCN A;  1EQ3 A;  4J8E A;  4G24 A;  5ARF A;  4GZ5 A;  4ME2 A;  5HW7 A;  3MV2 B;  1B89 A;  2XPI A;  1JVW A;  2F4E A;  4TW8 A;  2XPB A;  4I2Z A;  2GW1 A;  4NQ0 A;  3ZGQ A;  2JZV A;  4W9O A;  4I9E A;  3TAX A;  4G25 A;  3O5M A;  1Y0O A;  2DG4 A;  4GA1 A;  3O5R A;  2ZR6 A;  4N19 A;  5FJY A;  3PE4 A;  3JXV A;  4AY5 A;  3CK8 A;  1JNT A;  2IF4 A;  3O5K A;  2BUG A;  2FO7 A;  2XP3 A;  2M1I A;  2P58 C;  2MLX A;  4MSP A;  2KC7 A;  2MNT A;  1FKT A;  4N2S A;  3LY7 A;  4O2T A;  4JL0 A;  3LCA A;  4G50 A;  3JYJ A;  2ZQS A;  4AIF A;  4GPK A;  1FKR A;  3QWV A;  1OUV A;  1E96 B;  2MF9 A;  4GYO A;  1Y8M A;  3KAH A;  1Q6H A;  5BT1 A;  4BTA A;  3MV3 B;  2XP4 A;  4DRP A;  4O6F A;  3QKY A;  2LJ4 A;  3AS4 A;  3VTX A;  2C2L A;  4G2V A;  4GIV A;  4W9P A;  1D7H A;  2XP7 A;  3GZ2 A;  4APO A;  4G23 A;  3UPV A;  4BWR A;  2UZ5 A;  1NA3 A;  2PV1 A;  3UF8 A;  3LPZ A;  4JHR A;  3TCZ A;  4GCO A;  1FKI A;  5KJL A;  4GA0 A;  5DBK A;  1ROU A;  5J6E A;  4BT8 A;  3CKB A;  4TX0 A;  3GZ1 A;  3PA7 A;  4ODK A;  1HZ4 A;  3MKR A;  2ZQT A;  3SZ7 A;  4BT9 A;  2LSV A;  5HW6 A;  2XP9 A;  5HI7 A;  4FAP A;  2QFC A;  3QOU A;  2YHC A;  1F40 A;  3U3W A;  2OND A;  3SF4 A;  3VAW A;  4UQY A;  3R9A B;  2LKN A;  3S7J A;  5B8I C;  5BXJ A;  3TGO A;  1HXI A;  1PIN A;  3FWV A;  4TW6 A;  5JJT A;  4JFL A;  5CHE E;  4TW7 A;  2Q7F A;  3GPK A;  4GCN A;  3PDN A;  2KAT A;  4N5C A;  3WH0 A;  2XGS A;  4KBQ A;  2M2A A;  2RUR A;  5HW8 A;  4GGQ A;  1TJC A;  3KAF A;  3OXL A;  3S7F A;  1R9H A;  3U4T A;  4U04 A;  3URZ A;  4TYO A;  3O5Q A;  2UY1 A;  3CVL A;  1F8A B;  4FN2 A;  3RFW A;  3CGM A;  4TNS A;  3NTP A;  2UY1 B;  3KZ7 A;  4NRH B;  3NF1 A;  3ULQ A;  2V5F A;  1NZN A;  3O5D A;  5FZS A;  1W3B A;  4WNF A;  4A1S A;  5HTG A;  3BEE A;  4LAV A;  4N3A A;  2Q5A A;  2PQR A;  3TG4 A;  1KT1 A;  2E2E A;  2LGO A;  3CVP A;  4JFK A;  5A7D B;  3PRB A;  4LAY A;  3KAB A;  4R0X A;  4U84 A;  3CVN A;  4I2W A;  4N2Q A;  3AS5 A;  1QPL A;  2VQ2 A;  3ZN3 A;  4XIF A;  5HUA A;  4ODL A;  3ZHE A;  4G1T A;  2XCC A;  5M72 A;  2XP5 A;  3UI5 A;  5FT9 A;  3RKV A;  5BW8 C;  3KCE A;  3QWW A;  4IN3 B;  1ZU2 A;  4JFM A;  3IKD A;  2PPP A;  5KJM A;  3O5L A;  1HH8 A;  5D0O D;  2KO7 A;  5HKG A;  1A7X A;  3QWP A;  3ESK A;  2PV2 A;  5CCL A;  3S7B A;  1BKF A;  4GZ6 A;  4U0S A;  4I17 A;  1PC2 A;  4B94 A;  3ZFW A;  4I9C A;  3RU0 A;  2HR2 A;  2KCK A;  3RO3 A;  2F2D A;  2K8I A;  4JA9 A;  2ZR5 A;  4N39 A;  1FKJ A;  2C0L A;  1NMW A;  1PBK A;  4C02 B;  4DRO A;  4HOU A;  4AY6 A;  4LAW A;  3IKG A;  4AM9 A;  2RQS A;  4DRN A;  1FKD A;  4KYO B;  4DRM A;  4DZ3 A;  4ODP A;  5C1D A;  3S7D A;  3IEG A;  4J4N A;  4DRK A;  2PPN A;  3LKU A;  1KLX A;  4J0U A;  1TCO C;  2DG9 A;  3FP3 A;  4J8D A;  3O5J A;  2MPH A;  4U86 A;  4ABN A;  3RGC A;  5KJN A;  3ASD A;  3OXF A;  4KXK B;  1YA0 A;  1D7I A;  4DH0 A;  3O48 A;  4BTB A;  3NRK A;  3RJV A;  1NA0 A;  2RUC A;  3Q4A B;  5JJ6 A;  1C9H A;  4GZ3 A;  2XEV A;  5G04 C;  3E4B A;  1QPF A;  3K9I A;  5BNW A;  1M5Y A;  2XGO A;  2FEZ A;  2D9F A;  1T11 A;  4GYY A;  2VSY A;  1IHG A;  3OXG A;  2HYZ A;  4CGW A;  5D75 A;  2Y4U A;  4H7X A;  4Y6W A;  5HQ8 A;  4UI9 C;  1NMV A;  1N1A A;  2VYI A;  3O5F A;  2AVP A;  4W9R A;  4DRJ A;  5I98 A;  3VTY A;  3Q49 B;  4QIB A;  1FJD A;  5G05 C;  2PPO A;  4IPX A;  3KS2 A;  1FKH A;  3KAI A;  4G2P A;  3O5G A;  5DIU A;  2Y78 A;  4UI9 K;  5HWC A;  3O5I A;  1FKS A;  4ODO A;  2VCD A;  3KAE A;  3UI4 A;  5EX0 A;  4XI0 A;  2AWG A;  1Q1C A;  5G04 J;  3FAP A;  1ZK6 A;  1W26 A;  4ITZ A;  1BL4 A;  4I1A A;  3MDY B;  2MLZ A;  4Y6C A;  2L2S A;  3EY6 A;  4UI9 J;  2N87 A;  2NC9 A;  4YND A;  4ODR A;  1IYG A;  2ITK A;  5EKQ D;  4J4O A;  3O5O A;  1FAP A;  5KJK A;  2OFN A;  5FZR A;  4JFI A;  4QT3 A;  4YVO A;  2XP6 A;  2WPV A;  2Y4T A;  2LNI A;  3O5E A;  3CK7 A;  3KD7 A;  2KR7 A;  3UQA A;  2DG3 A;  2LSU A;  4JYS A;  5HT1 A;  4RG9 A;  3NI6 A;  2HO1 A;  4N3B A;  2FI7 A;  3CEQ A;  3JYS A;  4UQX A;  4CGV A;  4DT4 A;  3QDN A;  4RG6 A;  1FD9 A;  2VN1 A;  1JNS A;  4H7Y A;  5DIT A;  2RUQ A;  4UQZ A;  4CDR A;  5A6C A;  2IFU A;  3ZHE B;  3UI6 A;  2FF4 A;  4G26 A;  1QQE A;  2J9Q A;  2PL2 A;  3N71 A;  5HWB A;  2JLB A;  1A17 A;  4YVQ C;  2LPV A;  4DZ2 A;  4EQF A;  4DRQ A;  1Q6U A;  5AYW D;  3I6C A;  4XI9 A;  2F21 A;  3GW4 A;  1WAO 1;  3TC5 A;  4HOT A;  5ARG A;  2VSN A;  3UQB A;  1YAT A;  5JJ7 A;  3ZPJ A;  1ELW A;  2PZI A;  2MHK A;  3Q15 A;  3O5P A;  4NNR A;  3TDB A;  4J8F A;  3CVQ A;  3IK8 A;  2R5S A;  2KCL A;  3UQ3 A;  3GYZ A;  5CCM A;  1QZ2 A;  4ODQ A;  5D0Q D;  1P5Q A;  2FAP A;  4ODN A;  3KAG A;  3AS8 A;  3PE3 A;  3CK9 A;  5LCW C;  3ASF A;  3RIB A;  1ROT A;  1J4H A;  2DBA A;  2KFW A;  1XNF A;  1FKK A;  4U85 A;  2ZR4 A;  2XCB A;  1HXV A;  1KT0 A;  1J4I A;  1U79 A;  1FKG A;  4GA2 A;  3KAD A;  3B7X A;  3JYM A;  3CKC A;  1D7J A;  2KCV A;  1FKL A;  5FTP A;  2ZQU A;  1J4R A;  1L1P A;  2VGY A;  3CGN A;  2KGJ A;  4IQC A;  4HOQ A; 
#chains in the Genus database with same CATH topology
 5AQB A;  1YW5 A;  2ZIS A;  4FJY A;  3MCX A;  1EHN A;  2L6J A;  5LCW J;  1ZU8 A;  4UDM A;  3IHZ A;  1W9P A;  4LGX A;  4FUL A;  5A23 A;  1LG2 A;  5JA4 D;  1N11 A;  5AIJ A;  2VGX B;  2F8X K;  4WUY A;  4JA7 A;  5IY5 E;  2XGM A;  3AG1 E;  5FQ8 A;  5GQB A;  2H6H A;  2IEJ A;  2IQC A;  1GW6 A;  4JHK A;  3WD3 A;  3PZ1 A;  4IQ2 A;  2XZD G;  3QK0 A;  4QT2 A;  3CVV A;  3EUV A;  1JWG A;  2WQH A;  1LQ0 A;  1X6N A;  2AXU A;  2ETN A;  4JFJ A;  4S3K A;  1UJK A;  3ASH A;  4LEU A;  5KCM A;  3ZIM A;  3MKQ B;  2GGF A;  3CQC B;  1ZB1 A;  3I3N A;  3LY9 A;  1K8K G;  4DRH A;  3ZYL A;  3L82 A;  1PY1 A;  3L54 A;  1GRJ A;  5DIV A;  3DBS A;  4AOF A;  4DRI A;  5HS0 A;  3B7T A;  3HVE B;  3C3R A;  2I6H A;  2LXM A;  3PNT B;  4WWO A;  3MA5 A;  3VLF A;  1FCH A;  3CR3 A;  3ODK A;  1D2K A;  5EIL A;  2EQX A;  3UQI A;  1ZCN A;  5BV0 A;  1KZO A;  1HJX A;  4ME2 A;  3SQV A;  4KR0 B;  3CVU A;  2XPI A;  4L9P A;  2BKG A;  3V79 K;  3FY4 A;  3W9G A;  2CHZ A;  2P9P G;  1HKJ A;  2JZV A;  3TAX A;  3C5R A;  1Y0O A;  4GA1 A;  3O5R A;  2LXL A;  2ZR6 A;  4N19 A;  4AY5 A;  2WXR A;  5B3S E;  2QZA A;  1BU9 A;  3OA5 A;  1TNZ A;  3WD1 A;  2CFU A;  4U8Y D;  1GPF A;  5BXO A;  2P58 C;  3U9W A;  4JL0 A;  3LCA A;  4ATG A;  3ZYK A;  3JYJ A;  5ENO D;  2ZQS A;  4AIF A;  4GPK A;  2DSV A;  3E37 A;  3SD5 A;  1FKR A;  1H6P A;  1OUV A;  4PS7 A;  2V4H C;  4AEZ C;  1E96 B;  4OVV A;  1HS6 A;  4L7T A;  1Y8M A;  1SZ9 A;  4DX1 A;  1Q6H A;  4GTT A;  4O6F A;  1GOI A;  1E6R A;  2C2L A;  5J08 A;  3CIA A;  5JHB A;  4EPZ A;  5EYP F;  3GZ2 A;  1VDY A;  3FEX A;  2A3C A;  3FTS A;  5KWD A;  3B8S A;  4JHR A;  3CHC A;  4MLP A;  1FKI A;  3ZU7 B;  1ROU A;  3TWS A;  5EDS A;  4JXT A;  2J09 A;  5D66 A;  4XZ4 A;  1HZ4 A;  4UWK A;  4D10 C;  3MKR A;  4GB9 A;  1INZ A;  5G55 A;  2LSV A;  4XKC A;  3B9E A;  2XP9 A;  5HW6 A;  5HI7 A;  1MX2 A;  4FAP A;  2QFC A;  3QOU A;  2GRP B;  3W9F A;  3U3W A;  4E85 A;  2DT2 A;  1OY3 D;  3FWV A;  4TW6 A;  2ZIR A;  2WLY A;  1N52 A;  4CYM D;  4F7A A;  3TWU A;  4N5C A;  1K1B A;  2RUR A;  5HW8 A;  2IOL A;  2CG2 A;  1KFW A;  4GGQ A;  2NXP A;  4EBA G;  3U4T A;  2M63 A;  4NAC A;  1IXV A;  1F8A B;  3RFW A;  1NH6 A;  5E76 A;  4Z2J A;  2A4Z A;  3NTP A;  4HXI A;  3WQV A;  1EDQ A;  5CMW A;  4AJW A;  1NZN A;  3NOG D;  3CHE A;  4WNF A;  2LUH A;  3ABM E;  3BEE A;  2Q5A A;  3Q73 A;  3ARS A;  3CQG B;  1Z6T A;  1SYT A;  1RW2 A;  5A7D B;  2EIJ E;  1X81 A;  4R0X A;  3FTU A;  3CVN A;  4N2Q A;  1JND A;  2WM9 A;  4L3N A;  2QC9 A;  1RD6 A;  3NAW A;  4XIF A;  4ODL A;  3FXY A;  5M72 A;  3UI5 A;  5FT9 A;  2EIM E;  4MBG A;  5BW8 C;  3KCE A;  2I1K A;  4HBE A;  2WXI A;  1W1V A;  2GRM A;  3QOK A;  2X6F A;  4WIW A;  4JFM A;  1MX6 A;  4I6G A;  2XZT G;  1IHB A;  3C3Q A;  4WWN A;  1HH8 A;  3Q7A A;  4EBA A;  4BSZ B;  1TFV A;  3ESK A;  1FFR A;  2ESC A;  2PV2 A;  3S7B A;  4DRX E;  1NWT A;  2E0I A;  4GZ6 A;  1PC2 A;  3HHM A;  3JXI A;  2HR2 A;  2AWI A;  5AQ7 A;  1PBK A;  2C0L A;  1NMW A;  1NFI E;  4LUN U;  2WLZ A;  4LAW A;  1U3D A;  3U66 A;  3TWQ A;  4AM9 A;  4DRM A;  5KNH D;  1O1R A;  5C1D A;  3T5X A;  4JVS A;  4J4N A;  4ZPT R;  3VLD A;  3ALF A;  2WB2 A;  2DYR E;  4UWF A;  5ENQ D;  2MPH A;  1N0R A;  4ABN A;  4TXP A;  4ANW A;  1K1A A;  3JXJ A;  3OXF A;  1S64 A;  4KXK B;  1YA0 A;  2P2C P;  3ZVV A;  3O48 A;  4DLQ A;  3Q4A B;  5ENP D;  1C9H A;  1QPF A;  4MS6 A;  3K9I A;  1OWQ A;  1M5Y A;  1DCQ A;  2VSY A;  3SO8 A;  3GU0 A;  4CGW A;  3NOC D;  1E90 A;  4J6I A;  4GMJ A;  1S0P A;  1OXJ A;  4NZC A;  4A3V A;  5DEZ A;  4DI4 A;  4AXH A;  2IJG X;  2KBX A;  5I98 A;  3VTY A;  4HVB A;  4W5U A;  5LOZ A;  3KAI A;  2DSU A;  2R17 C;  5HWC A;  3O5I A;  4ODO A;  3KAE A;  4DJA A;  4DWS A;  1E15 A;  5EX0 A;  1L5J A;  3ZYM A;  2B5U B;  2ETC A;  4CRW A;  5CED B;  3FAP A;  2OEW A;  4R7L A;  1OWN A;  1BL4 A;  1OT8 A;  2Y1L E;  4I1A A;  4YDO A;  2XPY A;  3EY6 A;  4KQZ A;  2NC9 A;  1VF8 A;  2WXG A;  3SHF A;  4CDN A;  3CST A;  3DSV A;  4YVO A;  2ION A;  2OLH A;  2KR7 A;  1W9V A;  1ZBC A;  2DG3 A;  1SZA A;  3ARR A;  2OEV A;  1OWL A;  3NI6 A;  4N3B A;  2P9U G;  1ZBK A;  1IX5 A;  5DIT A;  3UT4 A;  2BF0 X;  3FHE A;  3ZHE B;  3DST A;  3UI6 A;  2FF4 A;  4G26 A;  2AJA A;  2JLB A;  5CEA A;  2LPV A;  1DNP A;  2X6H A;  3I6C A;  3ONL A;  4E6H A;  5LP0 A;  1TJF A;  3PZD A;  2F21 A;  5FQ7 A;  4HOT A;  1ELW A;  2PZI A;  3O5P A;  3G6L A;  4P29 A;  4GTM A;  1SR0 A;  2XEH A;  4XEI G;  2KCL A;  2FAP A;  1TEZ A;  3KAG A;  3EHN A;  3HG0 D;  4Z2H A;  3D9O A;  1ROT A;  1JPL A;  2B31 A;  3PRA A;  3PS6 A;  1BLX B;  2P9S G;  1XNF A;  1FKK A;  2ZR4 A;  2XCB A;  5FQ4 A;  3PH0 C;  5T4Y A;  4G8L A;  1U79 A;  1FKG A;  4GA2 A;  3ESL A;  4Q69 A;  3JYM A;  2KCV A;  2KM4 A;  4JB8 P;  4U96 D;  1L1P A;  1V54 E;  1EDU A;  2YIN A;  5G2N A;  3V31 A;  2KE0 A;  1FVF A;  2WXH A;  5AJD A;  4CCA A;  5FWQ A;  3TWV A;  3EIP A;  4K0R A;  4HOS A;  3WXX A;  3FUL A;  1LL7 A;  3OOB A;  3Q5M A;  1HG5 A;  4GMR A;  2A5E A;  1MJ0 A;  2IOS A;  4P8X A;  1AP7 A;  2H6F A;  3TG5 A;  4N3C A;  2PV3 A;  2WMO A;  2OVF A;  1NWR A;  1ELR A;  1LG1 A;  1MX4 A;  3SI5 A;  3UMV A;  4RSY A;  4MNM A;  5AJL A;  1HF8 A;  2UWJ G;  4LAX A;  3BXW A;  2FBN A;  1RZ4 A;  3SFY A;  5DO2 A;  3SY2 A;  3HXE A;  4DX7 D;  1X5B A;  3AS2 A;  4N5Q A;  3C3O A;  3ASG A;  2BTD A;  4G11 A;  3KAC A;  2X6K A;  4WKF A;  4DWS D;  3HYM B;  2DSZ A;  3UUX A;  5FZQ A;  2XPA A;  2PBC A;  3AU5 A;  4WKA A;  3H9R B;  3BG0 B;  3W4R A;  1QNF A;  1EQ3 A;  4J8E A;  1HFA A;  5GPR A;  3L9T A;  3FEY A;  4MTV A;  1H2T C;  1MHQ A;  4PS3 A;  1JVW A;  4NQ0 A;  3DWL G;  3ZGQ A;  4I9E A;  3MX3 A;  1JCR A;  3SBT B;  5T8I A;  2AOS A;  3UIP C;  4FLH A;  2OCC E;  1OGG A;  5FJY A;  3PE4 A;  4I1O B;  1YYH A;  3CVY A;  3CK8 A;  3O5K A;  2BUG A;  3G2W A;  4MSP A;  1HJW A;  1FKT A;  4N2S A;  4O1O A;  4O2T A;  1YMP A;  3NZS A;  5FIO A;  2GRN B;  1FFQ A;  2XS8 A;  4BFR A;  2ETB A;  3QWV A;  1XHG A;  4KVM A;  4ZPW R;  5CRU A;  3FTW A;  5ANR A;  4EZL A;  3ONK A;  4YDW A;  3VTX A;  1ZB5 A;  2RD0 A;  4GPM A;  2G8Z A;  2HE0 A;  2DVW A;  1D7H A;  2XP7 A;  2V4L A;  1NI1 A;  2XPZ A;  1O1T A;  3JQ0 A;  3UPV A;  4U95 D;  4ANX A;  3UF8 A;  1HG2 A;  3ML9 A;  3TCZ A;  3PEU B;  4LSZ E;  4WK9 A;  4GCO A;  5KJL A;  4I1M A;  5DBK A;  1Z3X A;  2J4D A;  3ZUV B;  3D9L A;  3CKB A;  5D2M C;  4ODK A;  3E33 A;  4YDE A;  1DCE A;  3OAW A;  4BT9 A;  1MQS A;  2YHC A;  1F40 A;  3QAQ A;  5AN8 A;  3SF4 A;  4UQY A;  4OVU A;  3UT7 A;  5JJT A;  4JFL A;  4TW7 A;  1EYH A;  3QJZ A;  5ENT D;  3GPK A;  1OWM A;  1UOH A;  4RLY A;  5EID A;  4KBQ A;  2M2A A;  1TJC A;  2KXP C;  3E34 A;  3S7F A;  4BSX A;  4JC8 A;  4APF A;  3UX4 A;  3G6M A;  4U04 A;  5BXU A;  3D9H A;  3URZ A;  4JD2 G;  2DT1 A;  2UY1 A;  3HXF A;  3TWT A;  4FN2 A;  2GRO B;  4BX8 A;  3ENE A;  3CGM A;  4TNS A;  2R03 A;  4NRH B;  3NF1 A;  2WQ7 A;  2RFA A;  4BER A;  1W3B A;  2XRY A;  3DXM G;  2GRQ B;  4N3A A;  3CHS A;  3TG4 A;  1KT1 A;  2E2E A;  2GRL A;  5JHA A;  5ANL A;  3TWW A;  3HXD A;  3LS8 A;  3KAB A;  4Q96 A;  4DX5 D;  3HRA A;  3LXU X;  4I2W A;  1NL4 A;  2VQ2 A;  3ZN3 A;  5HUA A;  5CBO A;  2XCC A;  2XP5 A;  1LD8 A;  3RKV A;  3TXN A;  4HNA D;  1H0I A;  2P9N G;  3ALG A;  4Z2L A;  2FO1 E;  1OCO E;  3FUF A;  1E8W A;  4P8V A;  1A7X A;  1LL6 A;  3QWP A;  1CTN A;  1IQU A;  2CG3 A;  5CCL A;  4F1S A;  2DCP A;  5EN5 D;  4J7W A;  1BKF A;  4U0S A;  3ABL E;  4B94 A;  4ZFH A;  1N4S A;  4I9C A;  4C9B B;  3RU0 A;  3RO3 A;  2F2D A;  2P9L G;  3KSQ A;  2K8I A;  2ZR5 A;  3DXK G;  1FKJ A;  3UXG A;  3ARQ A;  3IKG A;  4URK A;  3HXB A;  4DRN A;  3L17 A;  2YHE A;  3NB2 A;  3S7D A;  2DIW A;  2YNQ A;  3EU5 A;  4DRK A;  5CEC B;  3ART A;  5CMY A;  4HB5 A;  3SGH A;  4U86 A;  2PI6 A;  4K5B A;  3TJP A;  3FTY A;  3ZW3 A;  2BKK B;  3ZXS A;  4DH0 A;  4BTB A;  4ML4 A;  1E8X A;  4G8K A;  3AS1 A;  1U2V G;  1NA0 A;  3SFX A;  5G04 C;  3Q9U C;  2CHW A;  2ILR A;  3QAR A;  1T11 A;  3BUA A;  3UTM A;  3RRM B;  3T9K A;  4MKT A;  4Y6W A;  2EIN E;  4UI9 C;  1NMV A;  1N1A A;  3FY1 A;  3JCK C;  5FIN A;  3O5F A;  1ITX A;  3BU8 A;  2PPO A;  4IPX A;  4WWP A;  4G2P A;  3EJN A;  3CHQ A;  3O5G A;  4UI9 K;  1XRV A;  3FDH A;  3FUN A;  3UI4 A;  3CHR A;  2AWG A;  2XHE A;  3FUM A;  2F0Y A;  4A3T A;  3LEW A;  3UIN C;  4DWS B;  3T5V A;  3CHO A;  3MKQ A;  2MLZ A;  3CHF A;  1N95 A;  4BY6 A;  1W9U A;  2N87 A;  4YND A;  1IYG A;  4HI8 A;  3ARP A;  1FAP A;  2A3A A;  2XP6 A;  4EHM A;  2LNI A;  5LFA A;  4C0M A;  3CK7 A;  2AW6 A;  4UQX A;  4CGV A;  2VN1 A;  1UW4 B;  3I5P A;  5JH8 A;  2RUQ A;  2WXL A;  2DZN A;  2A3B A;  1IQR A;  2PL2 A;  1WG0 A;  1A17 A;  1NP7 A;  4IUL A;  1HJV A;  4V3I A;  1FVH A;  4DZ2 A;  4DRQ A;  1Y6I A;  1Q6U A;  3EHR A;  2WXQ A;  3FUJ A;  3D9I A;  3TC5 A;  4Z2G A;  2VTB B;  3CHM A;  5JJ7 A;  3E32 A;  3ZPJ A;  2VSO E;  2DT3 A;  3Q15 A;  4NIK A;  3P1U A;  3TWX A;  4AVX A;  3UQ3 A;  3GYZ A;  5CCM A;  4ODQ A;  5J90 A;  5D0Q D;  1P5Q A;  1UG3 A;  2AXZ A;  3AS8 A;  3PZ3 A;  5LCW C;  4DX2 A;  3ASF A;  4B0Z A;  4HI9 A;  4M3O A;  4IRU A;  1LD7 A;  4U85 A;  3FUE A;  5EIB E;  4IT6 A;  1HXV A;  1J4I A;  4GAA A;  1TN8 A;  4L2Y A;  3MZL B;  3B7X A;  1W1T A;  3D9N A;  1D7J A;  3EIJ A;  3R7Q A;  1J4R A;  4A55 A;  4BEP A;  2NYJ A;  3ZNG A;  3ZKJ A;  2AXV A;  4LG6 A;  1N9A A;  1D6O A;  1DVP A;  3PNL B;  3DPY A;  3CV0 A;  1FKB A;  2IUZ A;  3AG3 E;  1TNB A;  3TWR A;  1U3C A;  4ILH B;  4MNL A;  3CGH A;  3F6Q A;  4JPS A;  3G2U A;  4DIP A;  2G41 A;  1H2V C;  1E6Z A;  3FH5 A;  1SA4 A;  1J6Y A;  3D9P A;  2YQ8 A;  2ZXW E;  3PUK A;  4XX5 A;  3PRD A;  3ZEF A;  3IHV A;  4X8Q A;  2IO2 C;  4FJZ A;  4WNG A;  4WNE A;  1EIB A;  1OCR E;  1X6L A;  1KPS B;  4MNJ A;  1FKF A;  2FKE A;  5DF0 A;  4PUC A;  2WXO A;  4GML A;  3IV0 A;  4MGV A;  2R02 A;  2ZQV A;  1WM5 A;  2O9O A;  3EHM A;  2M08 A;  2O92 A;  4I43 A;  3EDT B;  4BES A;  4ODM A;  1JUQ A;  4K5C A;  5BUZ A;  2HM8 A;  3RME A;  4GZ5 A;  4NUR A;  1ZL1 A;  5HW7 A;  3MGB A;  3Q7F A;  4F53 A;  1B89 A;  2WXP A;  2CFZ A;  4EZK A;  4TW8 A;  2F37 A;  3CLJ A;  4I2Z A;  2GW1 A;  3DEP A;  2B0O E;  2Y0B G;  2YBU A;  2P9K G;  2ZGG A;  3J5Q B;  4G25 A;  2P9I G;  4GTP A;  3WL1 A;  3O5M A;  3JUE A;  3V2O A;  3RM4 A;  3GTY X;  2LAH A;  2J07 A;  2XP3 A;  2MLX A;  1NWU A;  1HE8 A;  3KEA A;  1TNO A;  3NQP A;  3KAH A;  5BT1 A;  2I1J A;  3I4G A;  3MV3 B;  4RVB A;  4U7E B;  1JCS A;  4CZ2 D;  3QKY A;  1N4Q A;  2WXK A;  3FTX A;  3AS4 A;  3PEV B;  2DPE A;  4RQI A;  4GIV A;  4NSB A;  4W9P A;  3FH8 A;  2RG8 A;  4G23 A;  4UWH A;  3ULE G;  1E8Z A;  1NA3 A;  1XGW A;  1MZC A;  5BV1 A;  3FTZ A;  5KBA A;  2QYJ A;  1Z5S C;  5KNG A;  3LJN A;  4BT8 A;  2MRI A;  3G2V A;  1WAW A;  4LNG A;  2ZQT A;  4CEM A;  3FU6 A;  3SZ7 A;  1EF1 C;  3DSW A;  1ELK A;  3J5P A;  3L08 A;  3WQW A;  1V55 E;  1TN6 A;  1DC2 A;  3VAW A;  3S7J A;  5B8I C;  5BXJ A;  4TRQ A;  5HKP A;  3TGO A;  4KZ0 A;  4WKH A;  4S3J A;  1SVX A;  5AAR A;  3PZ4 A;  3S2A A;  3CZ8 A;  2Q7F A;  2EIL E;  4GCN A;  5CRV A;  2KAT A;  3FU0 A;  2XGS A;  4L72 B;  4YDY A;  4KMO A;  3KAF A;  3OXL A;  3FUI A;  4TYO A;  2X3M A;  3CVL A;  1ZBV A;  3DSX A;  3RRU A;  1OWP A;  3QC1 A;  5CBN A;  1E44 A;  4B8A A;  1H6K A;  2UY1 B;  3ABK E;  3KZ7 A;  3ULQ A;  3O5D A;  1EPU A;  4ANV A;  2KZT A;  1NWS A;  4LAV A;  3APD A;  2VJ8 A;  3UKU G;  3B9D A;  2LGO A;  5ENR D;  2WXJ A;  4XAK A;  4JFK A;  3PRB A;  1BI7 B;  4Z68 A;  3FTV A;  4LAY A;  4U84 A;  2Y69 E;  1UJJ A;  3WIJ A;  3PRZ A;  4EZJ A;  3ZHE A;  3APF A;  1D8E A;  3ASN E;  3L13 A;  3QWW A;  4IN3 B;  1IKN D;  4OYS A;  3RK6 A;  1WDY A;  3IKD A;  3HDX A;  2IO3 C;  3O5L A;  2XEN A;  3Q75 A;  1K3Z D;  2KO7 A;  2GRR B;  3B13 A;  2WXN A;  1H0A A;  2Y3A A;  3WL0 A;  4HS2 A;  4ZHB A;  1H2U A;  4LRZ A;  3AQU A;  2A3E A;  3IHY A;  5T3R A;  2L0T B;  1S63 A;  3EU9 A;  3DRA A;  4PDX A;  4R5E A;  3Q79 A;  1BI8 B;  2BED A;  4HOU A;  4DK5 A;  2RQS A;  1HX8 A;  4L1B A;  2R59 A;  3SBS A;  4Z2K A;  2EUL A;  4ILG A;  3UM0 A;  1KLX A;  4J0U A;  3L22 A;  4I6E A;  2DG9 A;  4J8D A;  4FLB A;  5CER B;  3ASD A;  1D7I A;  2L0I A;  4I6J A;  5H7P A;  3NRK A;  3RJV A;  2RUC A;  4GZ3 A;  4JEH A;  3FU3 A;  4B8C B;  5BNW A;  2FEZ A;  4GYY A;  3I4R B;  1IHG A;  3CVW A;  3OXG A;  3T8K A;  1OCZ E;  5D75 A;  2Y4U A;  3HXC A;  4QFV A;  4TUM A;  4H7X A;  5HQ8 A;  3RSE G;  4WAF A;  3DPD A;  2VYI A;  3TL5 A;  1QBQ A;  1N4P A;  1LTX A;  2AVP A;  4W9R A;  4DRJ A;  2VSX E;  3ARW A;  4QIB A;  1O6I A;  3KS2 A;  1FKH A;  4TXR A;  5DIU A;  4CDM A;  3EHQ A;  1UN9 A;  4XI0 A;  1Q1C A;  5ENS D;  3ARO A;  3EIQ C;  4UWG A;  4UUC A;  5FQ6 A;  4AY1 A;  4HAR A;  4ITZ A;  3MDY B;  2L2S A;  3UM1 A;  2A5U A;  5EKQ D;  4P8W A;  3O5O A;  4AV7 A;  4BET A;  5KJK A;  4HLE A;  3O5E A;  4U63 A;  3UQA A;  2XS1 A;  4JYS A;  5HT1 A;  4RG9 A;  2HO1 A;  3CEQ A;  4HQD A;  4C0E A;  4HLL A;  4TV3 A;  4RG6 A;  1JNS A;  3D9J A;  4H7Y A;  2R2L A;  3V2X A;  3MJW A;  4UQZ A;  4CDR A;  2IFU A;  4AP2 A;  1JNE A;  4WJX A;  1QQE A;  3BQO A;  4JZY A;  3N71 A;  5HWB A;  4ATZ D;  4YVQ C;  2H6G A;  4BX9 A;  5C2Y A;  1E7U A;  5AYW D;  5AQA A;  3GW4 A;  1WAO 1;  3ZYQ A;  4J8S A;  2VSN A;  3UQB A;  1YAT A;  4NNR A;  2VGE A;  1N0Q A;  1O5M A;  4HBD A;  3CVQ A;  5E75 A;  3IKO B;  5LX8 A;  2R5S A;  4HRL A;  1A5E A;  1QZ2 A;  2X38 A;  2I2O A;  3IBE A;  1YCS B;  4O60 A;  4ODN A;  3PE3 A;  4O1P A;  1W1Y A;  3CK9 A;  2CHX A;  2OVB A;  2IY0 C;  1J4H A;  2DBA A;  1UR9 A;  4U8H A;  2KFW A;  1KT0 A;  3KAD A;  2L6B A;  5AQ9 A;  1FKL A;  4GTR A;  3PR9 A;  4CT0 A;  3CGN A;  2KGJ A;  4PS8 A;  2L9B A;  4HOQ A;  2YBT A;  2PN0 A;  3DSU A;  1PAQ A;  2XRZ A;  4F1P A;  2DSW A;  3HIZ A;  2QY7 A;  2NSZ A;  2VGX A;  3IXE A;  4OAV B;  4HRN A;  2KI3 A;  3PZ2 A;  3APC A;  1OCC E;  1LJY A;  1GUV A;  3LYA A;  5EX3 A;  2RSE A;  4BF8 A;  5GPG A;  1KZP A;  4GYW A;  3PVL A;  1D9S A;  3RO2 A;  4WND A;  2OOE A;  4GTQ A;  4KT6 B;  1B6C A;  4W9Q A;  2WVI A;  3MEK A;  2C0M A;  3QB2 A;  1Q6I A;  2RUD A;  4HOR A;  4XKB A;  1HU3 A;  2XP8 A;  3FFL A;  3LVR E;  2MLY A;  2PNN A;  4QZV B;  1E6P A;  4F3V A;  1ZBP A;  3ULY A;  4JW1 A;  3B9A A;  3LY8 A;  4TUU A;  3D9K A;  2XQ0 A;  4F6R D;  2ZU6 B;  3V30 A;  3LUO A;  3HVE A;  3FUH A;  4DPR A;  3LVQ E;  3Q47 B;  5G05 J;  1EYM A;  2IU1 A;  5DIZ A;  3DSS A;  2PQN A;  2RKK A;  3R7R A;  4U0U A;  5BPP A;  1NSG A;  4C48 B;  1HO8 A;  4L23 A;  4U07 A;  4U0Z A;  4PTM A;  3C98 A;  3TXM A;  3SFZ A;  4G24 A;  5ARF A;  1AWC B;  3MV2 B;  2F4E A;  2OV8 A;  2XPB A;  2B6C A;  2LAI A;  4W9O A;  2I9C A;  5HBF A;  3G2T A;  2DG4 A;  3Q78 A;  1HKM A;  5AEN A;  3B95 A;  3KSL A;  3ML8 A;  3JXV A;  3KEZ A;  1JNT A;  4DLO A;  2IF4 A;  2FO7 A;  1SW6 A;  2M1I A;  2KC7 A;  1WY6 A;  2MNT A;  3DEO A;  3LY7 A;  5ENN A;  4G50 A;  3CH9 A;  1S70 B;  4CT4 A;  4UWL A;  1FPP A;  4QQI A;  4GZD A;  3C72 A;  1H6O A;  2MF9 A;  4GYO A;  3ARZ A;  3QNK A;  4BTA A;  5B1B E;  3UIO C;  2XP4 A;  4DRP A;  4FHK A;  3CHD A;  3B7B A;  2LJ4 A;  4FP7 A;  3CHP A;  4ZPV R;  4G2V A;  4K03 A;  4APO A;  4BWR A;  4M7C A;  4Z2I A;  3L16 A;  2UZ5 A;  1HKK A;  2PV1 A;  2MOW A;  3LPZ A;  4IYP A;  4DI3 A;  4MAV A;  4J8Y A;  3CSF A;  2WMN A;  2LO6 A;  1N54 A;  4K5A B;  4GA0 A;  5J6E A;  2V0P A;  4TX0 A;  3GZ1 A;  3PA7 A;  4FAD A;  4A1G A;  3AJI A;  4DX6 D;  3VLE A;  3JQ1 A;  3BMB A;  1JWF A;  3E30 A;  3ARX A;  2OND A;  5AAO A;  3R9A B;  2LKN A;  1HXI A;  1PIN A;  2QYU A;  5CHE E;  1G3N B;  1TN7 A;  2WXM A;  1QYM A;  3AS3 A;  2QF8 A;  3OTN A;  3PDN A;  3ASO E;  3WH0 A;  2J8S D;  2ETA A;  3P2B A;  4LER A;  3MYV A;  1R9H A;  3RAU A;  3GZS A;  4EEC A;  3O5Q A;  3UT8 A;  1D8D A;  3AG2 E;  1E8Y A;  1SQM A;  4MPK A;  2V5F A;  3BG1 B;  5FZS A;  4XE0 A;  4A1S A;  5HTG A;  3WKZ A;  1TYQ G;  2PQR A;  3CVX A;  3CVP A;  1Z3Y A;  2EIK E;  4KVO A;  2KZT B;  4JHJ A;  2XEE A;  1MYO A;  3AS5 A;  1QPL A;  3PUJ A;  4HBO A;  4G1T A;  3AU4 A;  5B1A E;  3G2S A;  2FDM A;  4LNB A;  2WQ6 A;  1ZU2 A;  3NZU A;  2PPP A;  2J08 A;  5KJM A;  5D0O D;  5HKG A;  3B7U X;  3RM8 A;  1JCQ A;  3ISM C;  3UM3 A;  4GTV A;  1JCH B;  1WNO A;  2VTB A;  1WB0 A;  1O1S A;  4I17 A;  2H6I A;  2FUL A;  4Q94 A;  3ZFW A;  3ZXP A;  3AS0 A;  2KCK A;  4Q22 A;  2PM6 A;  4JA9 A;  4N39 A;  4DRO A;  1TNY A;  4C02 B;  4AY6 A;  1FKD A;  4KYO B;  4DZ3 A;  2DWZ A;  3D3M A;  4ODP A;  3IEG A;  3T8M A;  4FC8 A;  3UM2 A;  2PPN A;  3LKU A;  4HRM B;  5JMN D;  4LNU D;  4ZS6 A;  1TCO C;  1BD8 A;  3D9M A;  3FP3 A;  3O5J A;  4ACK A;  3RGC A;  2P4V A;  5KJN A;  1LF8 A;  3FUK A;  2MYO A;  3WG7 E;  4ILI A;  4P8U A;  2RFM A;  5JJ6 A;  3B7R L;  3RRN B;  4DUI A;  4FA6 A;  2XEV A;  4HFG A;  4B89 A;  3E4B A;  3FUD A;  2XGO A;  2D9F A;  3LDZ A;  4URI A;  2HYZ A;  3R9M A;  4GTO A;  4JEU A;  3UI2 A;  3L6A A;  1H19 A;  1OGB A;  4KZC A;  2DT0 A;  2F8Y A;  3X2Q E;  1UN8 A;  1Q2Z A;  1UR8 A;  4GU5 A;  3FH7 A;  3ARU A;  2JEK A;  3WD0 A;  3Q49 B;  1FJD A;  4LCT A;  5G05 C;  3ARY A;  2X6J A;  4U8V D;  1TNU A;  2J49 A;  2Y78 A;  5EYL A;  3ARV A;  3LJ3 A;  1FKS A;  2VCD A;  4DWS C;  4OAU C;  1FT2 A;  4L2L A;  5G04 J;  4A63 B;  3SNX A;  4FHJ A;  1ZK6 A;  4MRU A;  4IT4 A;  4TXQ A;  1W26 A;  2ZGD A;  3AG4 E;  1HKI A;  4Y6C A;  2X6I A;  1OWO A;  4UI9 J;  2R05 A;  4ODR A;  2ITK A;  4J4O A;  3RM9 A;  4JFI A;  2OFN A;  4PH4 B;  5FZR A;  4QT3 A;  2WPV A;  2Y4T A;  3WD4 A;  3KD7 A;  2JAB A;  2WXF A;  2LSU A;  5HRY A;  3JUI A;  4Q7N A;  4GTS A;  2FI7 A;  1K9T A;  3JYS A;  4DT4 A;  3QDN A;  1FD9 A;  5A6C A;  2WK2 A;  2DZO A;  2J9Q A;  1W1P A;  2V8S E;  3UKR G;  4EQF A;  4ACL A;  4XI9 A;  2J4B A;  3B7S A;  5ARG A;  2PM7 A;  1ZBW A;  2MHK A;  3TDB A;  1E7V A;  4J8F A;  3NBN B;  3IK8 A;  1H0G A;  4MNK A;  1E9L A;  5ITZ F;  2V5Q C;  4B93 B;  4GZC A;  1N4R A;  1TR4 A;  3AAA C;  1BPO A;  3RIB A;  1N94 A;  3PRE A;  1LL4 A;  1E6N A;  1SA5 A;  3FU5 A;  4FU3 A;  3WD2 A;  2DYS E;  3O4Z A;  3CKC A;  3Q9N C;  3ZRH A;  5FTP A;  2ZQU A;  2VGY A;  4ANU A;  3U64 A;  4IQC A;  2F23 A;  2WM0 A;  1FT1 A; 
#chains in the Genus database with same CATH homology
 1YW5 A;  4FJY A;  3MCX A;  1EHN A;  2L6J A;  5LCW J;  1ZU8 A;  3IHZ A;  1W9P A;  4LGX A;  4FUL A;  5A23 A;  1LG2 A;  5AIJ A;  2VGX B;  4WUY A;  4JA7 A;  2XGM A;  5FQ8 A;  5GQB A;  2IQC A;  1GW6 A;  4JHK A;  3WD3 A;  4IQ2 A;  3QK0 A;  4QT2 A;  3CVV A;  1JWG A;  2WQH A;  1LQ0 A;  1X6N A;  2AXU A;  4JFJ A;  4S3K A;  1UJK A;  3ASH A;  4LEU A;  5KCM A;  3ZIM A;  3MKQ B;  2GGF A;  3CQC B;  3LY9 A;  3I3N A;  4DRH A;  3ZYL A;  1PY1 A;  3L54 A;  5DIV A;  3DBS A;  4AOF A;  4DRI A;  3B7T A;  3HVE B;  2I6H A;  3PNT B;  4WWO A;  3MA5 A;  3VLF A;  1FCH A;  3CR3 A;  3ODK A;  1D2K A;  2EQX A;  3UQI A;  1ZCN A;  5BV0 A;  1HJX A;  4ME2 A;  4KR0 B;  3CVU A;  2XPI A;  3FY4 A;  2CHZ A;  1HKJ A;  2JZV A;  3TAX A;  1Y0O A;  3O5R A;  4GA1 A;  2ZR6 A;  4N19 A;  4AY5 A;  2WXR A;  3WD1 A;  3OA5 A;  2CFU A;  1GPF A;  2P58 C;  3U9W A;  4JL0 A;  3LCA A;  4ATG A;  3ZYK A;  3JYJ A;  2ZQS A;  4AIF A;  4GPK A;  2DSV A;  3SD5 A;  1FKR A;  1OUV A;  4PS7 A;  4AEZ C;  1E96 B;  4OVV A;  1HS6 A;  4L7T A;  1Y8M A;  1SZ9 A;  1Q6H A;  4O6F A;  1GOI A;  1E6R A;  2C2L A;  5J08 A;  3CIA A;  5JHB A;  4EPZ A;  3GZ2 A;  1VDY A;  3FEX A;  2A3C A;  3FTS A;  3B8S A;  4JHR A;  3CHC A;  4MLP A;  1FKI A;  1ROU A;  5EDS A;  4JXT A;  2J09 A;  4XZ4 A;  1HZ4 A;  4UWK A;  4D10 C;  3MKR A;  4GB9 A;  1INZ A;  5G55 A;  2LSV A;  4XKC A;  3B9E A;  2XP9 A;  5HW6 A;  5HI7 A;  4FAP A;  2QFC A;  3QOU A;  3U3W A;  4E85 A;  2DT2 A;  3FWV A;  4TW6 A;  2WLY A;  1N52 A;  4F7A A;  4N5C A;  2RUR A;  5HW8 A;  2IOL A;  2CG2 A;  1KFW A;  4GGQ A;  2NXP A;  4EBA G;  3U4T A;  2M63 A;  4NAC A;  1F8A B;  3RFW A;  1NH6 A;  5E76 A;  4Z2J A;  2A4Z A;  3NTP A;  4HXI A;  3WQV A;  1EDQ A;  5CMW A;  4AJW A;  1NZN A;  3CHE A;  4WNF A;  3BEE A;  2Q5A A;  3ARS A;  3CQG B;  1Z6T A;  1SYT A;  5A7D B;  4R0X A;  3FTU A;  3CVN A;  4N2Q A;  1JND A;  2WM9 A;  4L3N A;  1RD6 A;  4XIF A;  4ODL A;  3FXY A;  5M72 A;  3UI5 A;  5FT9 A;  5BW8 C;  3KCE A;  2I1K A;  4HBE A;  2WXI A;  1W1V A;  2GRM A;  3QOK A;  2X6F A;  4WIW A;  4JFM A;  4I6G A;  4WWN A;  1HH8 A;  4EBA A;  1TFV A;  3ESK A;  1FFR A;  2ESC A;  2PV2 A;  3S7B A;  1NWT A;  2E0I A;  4GZ6 A;  1PC2 A;  3HHM A;  2HR2 A;  2AWI A;  1PBK A;  2C0L A;  1NMW A;  4LUN U;  2WLZ A;  4LAW A;  1U3D A;  3U66 A;  4AM9 A;  4DRM A;  5C1D A;  3T5X A;  4JVS A;  4J4N A;  4ZPT R;  3VLD A;  3ALF A;  2WB2 A;  4UWF A;  2MPH A;  4ABN A;  4ANW A;  3OXF A;  4KXK B;  1YA0 A;  3ZVV A;  3O48 A;  4DLQ A;  3Q4A B;  1C9H A;  1QPF A;  4MS6 A;  3K9I A;  1OWQ A;  1M5Y A;  2VSY A;  4CGW A;  1E90 A;  4J6I A;  4GMJ A;  1S0P A;  4NZC A;  4A3V A;  5DEZ A;  4DI4 A;  4AXH A;  2IJG X;  5I98 A;  3VTY A;  4HVB A;  4W5U A;  5LOZ A;  3KAI A;  2DSU A;  2R17 C;  5HWC A;  3O5I A;  4ODO A;  3KAE A;  4DJA A;  4DWS A;  1E15 A;  5EX0 A;  1L5J A;  3ZYM A;  4CRW A;  3FAP A;  4R7L A;  1OWN A;  1BL4 A;  4I1A A;  2XPY A;  3EY6 A;  4KQZ A;  2NC9 A;  1VF8 A;  2WXG A;  3SHF A;  4CDN A;  3CST A;  4YVO A;  2ION A;  2OLH A;  2KR7 A;  1W9V A;  1ZBC A;  2DG3 A;  1SZA A;  3ARR A;  1OWL A;  3NI6 A;  4N3B A;  1ZBK A;  1IX5 A;  5DIT A;  3UT4 A;  2BF0 X;  3FHE A;  3ZHE B;  3UI6 A;  2FF4 A;  4G26 A;  2JLB A;  2LPV A;  1DNP A;  2X6H A;  3I6C A;  3ONL A;  4E6H A;  5LP0 A;  1TJF A;  3PZD A;  2F21 A;  5FQ7 A;  4HOT A;  1ELW A;  2PZI A;  3O5P A;  3G6L A;  4P29 A;  1SR0 A;  2KCL A;  2FAP A;  1TEZ A;  3KAG A;  3EHN A;  4Z2H A;  3D9O A;  1ROT A;  1JPL A;  2B31 A;  3PRA A;  3PS6 A;  1XNF A;  1FKK A;  2ZR4 A;  2XCB A;  5FQ4 A;  3PH0 C;  5T4Y A;  1U79 A;  1FKG A;  4GA2 A;  3ESL A;  4Q69 A;  3JYM A;  2KCV A;  2KM4 A;  1L1P A;  1EDU A;  2YIN A;  5G2N A;  2KE0 A;  1FVF A;  2WXH A;  5AJD A;  4CCA A;  5FWQ A;  4K0R A;  4HOS A;  3WXX A;  3FUL A;  1LL7 A;  3OOB A;  3Q5M A;  1HG5 A;  2IOS A;  4P8X A;  3TG5 A;  4N3C A;  2PV3 A;  2WMO A;  2OVF A;  1NWR A;  1ELR A;  1LG1 A;  3SI5 A;  3UMV A;  4RSY A;  4MNM A;  5AJL A;  1HF8 A;  2UWJ G;  4LAX A;  3BXW A;  2FBN A;  5DO2 A;  1X5B A;  3AS2 A;  3ASG A;  2BTD A;  4G11 A;  3KAC A;  2X6K A;  4WKF A;  4DWS D;  3HYM B;  2DSZ A;  3UUX A;  5FZQ A;  2XPA A;  2PBC A;  3AU5 A;  4WKA A;  3H9R B;  3BG0 B;  3W4R A;  1QNF A;  1EQ3 A;  4J8E A;  1HFA A;  5GPR A;  3FEY A;  4MTV A;  1H2T C;  1MHQ A;  4PS3 A;  1JVW A;  4NQ0 A;  3ZGQ A;  4I9E A;  3MX3 A;  3SBT B;  5T8I A;  2AOS A;  4FLH A;  1OGG A;  5FJY A;  3PE4 A;  4I1O B;  3CVY A;  3CK8 A;  3O5K A;  2BUG A;  3G2W A;  4MSP A;  1HJW A;  1FKT A;  4N2S A;  4O2T A;  3NZS A;  1FFQ A;  4BFR A;  3QWV A;  1XHG A;  4KVM A;  4ZPW R;  3FTW A;  5ANR A;  4EZL A;  3ONK A;  3VTX A;  1ZB5 A;  2RD0 A;  2G8Z A;  1D7H A;  2XP7 A;  2V4L A;  2XPZ A;  3UPV A;  3JQ0 A;  4ANX A;  3UF8 A;  1HG2 A;  3ML9 A;  3TCZ A;  3PEU B;  4WK9 A;  4GCO A;  5KJL A;  4I1M A;  5DBK A;  1Z3X A;  2J4D A;  3D9L A;  3CKB A;  4ODK A;  3OAW A;  4BT9 A;  1MQS A;  2YHC A;  1F40 A;  3QAQ A;  3SF4 A;  4UQY A;  4OVU A;  3UT7 A;  5JJT A;  4JFL A;  4TW7 A;  1EYH A;  3QJZ A;  3GPK A;  1OWM A;  4KBQ A;  2M2A A;  1TJC A;  3S7F A;  4BSX A;  4JC8 A;  4APF A;  3UX4 A;  3G6M A;  4U04 A;  2DT1 A;  3URZ A;  2UY1 A;  4FN2 A;  4BX8 A;  3ENE A;  3CGM A;  4TNS A;  4NRH B;  3NF1 A;  2WQ7 A;  1W3B A;  2XRY A;  4N3A A;  3CHS A;  3TG4 A;  1KT1 A;  2E2E A;  2GRL A;  5JHA A;  5ANL A;  3LS8 A;  3KAB A;  4Q96 A;  3LXU X;  4I2W A;  2VQ2 A;  3ZN3 A;  5HUA A;  2XCC A;  2XP5 A;  3RKV A;  3TXN A;  1H0I A;  3ALG A;  4Z2L A;  3FUF A;  1E8W A;  4P8V A;  1A7X A;  1LL6 A;  3QWP A;  1CTN A;  1IQU A;  2CG3 A;  5CCL A;  4F1S A;  2DCP A;  1BKF A;  4U0S A;  4B94 A;  4I9C A;  4C9B B;  3RU0 A;  3RO3 A;  2F2D A;  2K8I A;  2ZR5 A;  1FKJ A;  3ARQ A;  3IKG A;  4URK A;  4DRN A;  3L17 A;  2YHE A;  3S7D A;  2DIW A;  2YNQ A;  4DRK A;  3ART A;  5CMY A;  3SGH A;  4U86 A;  2PI6 A;  3TJP A;  3FTY A;  3ZW3 A;  3ZXS A;  4DH0 A;  4BTB A;  4ML4 A;  1E8X A;  3AS1 A;  1NA0 A;  5G04 C;  2CHW A;  2ILR A;  3QAR A;  1T11 A;  3RRM B;  4MKT A;  4Y6W A;  4UI9 C;  1NMV A;  1N1A A;  3FY1 A;  3JCK C;  3O5F A;  1ITX A;  2PPO A;  4IPX A;  4WWP A;  4G2P A;  3EJN A;  3CHQ A;  3O5G A;  4UI9 K;  1XRV A;  3FDH A;  3FUN A;  3UI4 A;  3CHR A;  2AWG A;  2XHE A;  3FUM A;  4A3T A;  3LEW A;  4DWS B;  3T5V A;  3CHO A;  3MKQ A;  2MLZ A;  3CHF A;  4BY6 A;  1W9U A;  2N87 A;  4YND A;  1IYG A;  3ARP A;  1FAP A;  2A3A A;  2XP6 A;  2LNI A;  5LFA A;  4C0M A;  3CK7 A;  2AW6 A;  4UQX A;  4CGV A;  2VN1 A;  1UW4 B;  3I5P A;  5JH8 A;  2RUQ A;  2WXL A;  2A3B A;  1IQR A;  2PL2 A;  1A17 A;  1NP7 A;  4IUL A;  1HJV A;  4V3I A;  1FVH A;  4DZ2 A;  4DRQ A;  1Y6I A;  1Q6U A;  2WXQ A;  3FUJ A;  3D9I A;  3TC5 A;  4Z2G A;  2VTB B;  3CHM A;  5JJ7 A;  3ZPJ A;  2VSO E;  2DT3 A;  3Q15 A;  3P1U A;  4AVX A;  3UQ3 A;  3GYZ A;  5CCM A;  4ODQ A;  5J90 A;  5D0Q D;  1P5Q A;  1UG3 A;  2AXZ A;  3AS8 A;  5LCW C;  3ASF A;  4B0Z A;  4M3O A;  4IRU A;  4U85 A;  3FUE A;  4IT6 A;  1HXV A;  1J4I A;  4GAA A;  4L2Y A;  3MZL B;  3B7X A;  1W1T A;  3D9N A;  1D7J A;  3EIJ A;  3R7Q A;  1J4R A;  4A55 A;  2AXV A;  1D6O A;  1DVP A;  3PNL B;  3CV0 A;  1FKB A;  2IUZ A;  1U3C A;  4ILH B;  4MNL A;  3CGH A;  4JPS A;  3G2U A;  4DIP A;  2G41 A;  1H2V C;  1E6Z A;  3FH5 A;  1J6Y A;  3D9P A;  2YQ8 A;  3PUK A;  4XX5 A;  3PRD A;  3ZEF A;  3IHV A;  4FJZ A;  4WNG A;  4WNE A;  1EIB A;  1X6L A;  4MNJ A;  1FKF A;  2FKE A;  5DF0 A;  4PUC A;  2WXO A;  4GML A;  3IV0 A;  4MGV A;  2ZQV A;  1WM5 A;  2O9O A;  3EHM A;  2M08 A;  2O92 A;  4I43 A;  3EDT B;  4ODM A;  1JUQ A;  5BUZ A;  2HM8 A;  3RME A;  4GZ5 A;  4NUR A;  1ZL1 A;  5HW7 A;  3MGB A;  4F53 A;  1B89 A;  2WXP A;  2CFZ A;  4EZK A;  4TW8 A;  3CLJ A;  4I2Z A;  2GW1 A;  2YBU A;  4G25 A;  3WL1 A;  3O5M A;  3RM4 A;  2LAH A;  2J07 A;  2XP3 A;  2MLX A;  1NWU A;  1HE8 A;  3NQP A;  3KAH A;  5BT1 A;  2I1J A;  3I4G A;  3MV3 B;  4RVB A;  3QKY A;  2WXK A;  3FTX A;  3AS4 A;  3PEV B;  2DPE A;  4GIV A;  4NSB A;  4W9P A;  3FH8 A;  2RG8 A;  4G23 A;  4UWH A;  1E8Z A;  1NA3 A;  1XGW A;  5BV1 A;  3FTZ A;  4BT8 A;  2MRI A;  3G2V A;  1WAW A;  2ZQT A;  4CEM A;  3FU6 A;  3SZ7 A;  1EF1 C;  1ELK A;  3L08 A;  3WQW A;  3VAW A;  3S7J A;  5B8I C;  5BXJ A;  4TRQ A;  3TGO A;  4KZ0 A;  4WKH A;  4S3J A;  3S2A A;  3CZ8 A;  2Q7F A;  4GCN A;  2KAT A;  3FU0 A;  2XGS A;  4L72 B;  4KMO A;  3KAF A;  3OXL A;  3FUI A;  4TYO A;  2X3M A;  3CVL A;  1ZBV A;  3RRU A;  1OWP A;  3QC1 A;  4B8A A;  1H6K A;  3KZ7 A;  2UY1 B;  3ULQ A;  3O5D A;  1EPU A;  4ANV A;  2KZT A;  1NWS A;  4LAV A;  3APD A;  2VJ8 A;  3B9D A;  2LGO A;  2WXJ A;  4XAK A;  4JFK A;  3PRB A;  3FTV A;  4LAY A;  4U84 A;  1UJJ A;  3WIJ A;  3PRZ A;  4EZJ A;  3ZHE A;  3APF A;  3L13 A;  3QWW A;  4IN3 B;  4OYS A;  3RK6 A;  3IKD A;  3HDX A;  3O5L A;  2KO7 A;  3B13 A;  2WXN A;  1H0A A;  2Y3A A;  3WL0 A;  4HS2 A;  1H2U A;  4LRZ A;  3AQU A;  2A3E A;  3IHY A;  5T3R A;  2L0T B;  4PDX A;  4R5E A;  4HOU A;  4DK5 A;  2RQS A;  1HX8 A;  4L1B A;  2R59 A;  3SBS A;  4Z2K A;  4ILG A;  1KLX A;  4J0U A;  3L22 A;  4I6E A;  2DG9 A;  4J8D A;  4FLB A;  3ASD A;  1D7I A;  2L0I A;  4I6J A;  3NRK A;  3RJV A;  2RUC A;  4GZ3 A;  4JEH A;  3FU3 A;  4B8C B;  5BNW A;  2FEZ A;  4GYY A;  3I4R B;  1IHG A;  3CVW A;  3OXG A;  5D75 A;  2Y4U A;  4QFV A;  4H7X A;  5HQ8 A;  4WAF A;  3DPD A;  2VYI A;  3TL5 A;  2AVP A;  4W9R A;  4DRJ A;  2VSX E;  3ARW A;  4QIB A;  1O6I A;  3KS2 A;  1FKH A;  5DIU A;  4CDM A;  1UN9 A;  4XI0 A;  1Q1C A;  3ARO A;  3EIQ C;  4UWG A;  5FQ6 A;  4AY1 A;  4HAR A;  4ITZ A;  3MDY B;  2L2S A;  2A5U A;  5EKQ D;  4P8W A;  3O5O A;  4AV7 A;  5KJK A;  4HLE A;  3O5E A;  4U63 A;  3UQA A;  4JYS A;  5HT1 A;  4RG9 A;  2HO1 A;  3CEQ A;  4C0E A;  4TV3 A;  4RG6 A;  1JNS A;  3D9J A;  4H7Y A;  3MJW A;  4UQZ A;  4CDR A;  2IFU A;  4AP2 A;  1JNE A;  4WJX A;  1QQE A;  4JZY A;  3N71 A;  5HWB A;  4YVQ C;  4BX9 A;  5C2Y A;  1E7U A;  5AYW D;  3GW4 A;  1WAO 1;  3ZYQ A;  4J8S A;  2VSN A;  3UQB A;  1YAT A;  4NNR A;  3CVQ A;  5E75 A;  3IKO B;  5LX8 A;  2R5S A;  1QZ2 A;  2X38 A;  2I2O A;  3IBE A;  4ODN A;  3PE3 A;  1W1Y A;  3CK9 A;  2CHX A;  2OVB A;  1J4H A;  2DBA A;  1UR9 A;  4U8H A;  2KFW A;  1KT0 A;  3KAD A;  1FKL A;  3PR9 A;  4CT0 A;  3CGN A;  2KGJ A;  4PS8 A;  2L9B A;  4HOQ A;  2YBT A;  1PAQ A;  2XRZ A;  2DSW A;  3HIZ A;  2QY7 A;  2NSZ A;  2VGX A;  2KI3 A;  3APC A;  1LJY A;  1GUV A;  3LYA A;  5EX3 A;  2RSE A;  4BF8 A;  5GPG A;  4GYW A;  3PVL A;  3RO2 A;  4WND A;  2OOE A;  4KT6 B;  1B6C A;  4W9Q A;  2WVI A;  3MEK A;  2C0M A;  3QB2 A;  1Q6I A;  2RUD A;  4HOR A;  4XKB A;  1HU3 A;  2XP8 A;  3FFL A;  3LVR E;  2MLY A;  4QZV B;  1E6P A;  4F3V A;  1ZBP A;  4JW1 A;  3B9A A;  3LY8 A;  4TUU A;  3D9K A;  2XQ0 A;  2ZU6 B;  3LUO A;  3HVE A;  3FUH A;  4DPR A;  3LVQ E;  3Q47 B;  5G05 J;  1EYM A;  2IU1 A;  5DIZ A;  2PQN A;  3R7R A;  4U0U A;  5BPP A;  1NSG A;  1HO8 A;  4L23 A;  4U07 A;  4U0Z A;  4PTM A;  3C98 A;  3TXM A;  3SFZ A;  4G24 A;  5ARF A;  3MV2 B;  2F4E A;  2OV8 A;  2XPB A;  2LAI A;  4W9O A;  2I9C A;  5HBF A;  3G2T A;  2DG4 A;  1HKM A;  5AEN A;  3ML8 A;  3JXV A;  3KEZ A;  1JNT A;  4DLO A;  2IF4 A;  2FO7 A;  2M1I A;  2KC7 A;  1WY6 A;  2MNT A;  3LY7 A;  5ENN A;  4G50 A;  3CH9 A;  4CT4 A;  4UWL A;  4GZD A;  2MF9 A;  4GYO A;  3ARZ A;  3QNK A;  4BTA A;  2XP4 A;  4DRP A;  4FHK A;  3CHD A;  2LJ4 A;  4FP7 A;  3CHP A;  4ZPV R;  4G2V A;  4K03 A;  4APO A;  4BWR A;  4Z2I A;  3L16 A;  2UZ5 A;  1HKK A;  2PV1 A;  2MOW A;  3LPZ A;  4IYP A;  4DI3 A;  4MAV A;  3CSF A;  2WMN A;  2LO6 A;  1N54 A;  4GA0 A;  5J6E A;  2V0P A;  4TX0 A;  3GZ1 A;  3PA7 A;  4FAD A;  4A1G A;  3VLE A;  3JQ1 A;  1JWF A;  3ARX A;  2OND A;  3R9A B;  2LKN A;  1HXI A;  1PIN A;  5CHE E;  2WXM A;  3AS3 A;  2QF8 A;  3OTN A;  3PDN A;  3WH0 A;  3P2B A;  4LER A;  3MYV A;  1R9H A;  3GZS A;  4EEC A;  3O5Q A;  3UT8 A;  1E8Y A;  1SQM A;  4MPK A;  2V5F A;  3BG1 B;  5FZS A;  4XE0 A;  4A1S A;  5HTG A;  3WKZ A;  2PQR A;  3CVX A;  3CVP A;  1Z3Y A;  4KVO A;  2KZT B;  4JHJ A;  3AS5 A;  1QPL A;  3PUJ A;  4HBO A;  4G1T A;  3AU4 A;  3G2S A;  2FDM A;  2WQ6 A;  1ZU2 A;  3NZU A;  2PPP A;  2J08 A;  5KJM A;  5D0O D;  5HKG A;  3B7U X;  3RM8 A;  1WNO A;  2VTB A;  1WB0 A;  4I17 A;  2FUL A;  4Q94 A;  3ZFW A;  3AS0 A;  2KCK A;  4Q22 A;  2PM6 A;  4JA9 A;  4N39 A;  4DRO A;  4C02 B;  4AY6 A;  1FKD A;  4KYO B;  4DZ3 A;  3D3M A;  4ODP A;  3IEG A;  3T8M A;  4FC8 A;  2PPN A;  3LKU A;  4ZS6 A;  1TCO C;  3D9M A;  3FP3 A;  3O5J A;  4ACK A;  3RGC A;  5KJN A;  1LF8 A;  3FUK A;  4ILI A;  4P8U A;  5JJ6 A;  3B7R L;  3RRN B;  4FA6 A;  2XEV A;  4HFG A;  4B89 A;  3E4B A;  3FUD A;  2D9F A;  2XGO A;  3LDZ A;  4URI A;  2HYZ A;  4JEU A;  3L6A A;  1H19 A;  1OGB A;  4KZC A;  2DT0 A;  1UN8 A;  1UR8 A;  4GU5 A;  3FH7 A;  3ARU A;  2JEK A;  3WD0 A;  3Q49 B;  1FJD A;  4LCT A;  5G05 C;  3ARY A;  2X6J A;  2J49 A;  2Y78 A;  3ARV A;  3LJ3 A;  1FKS A;  2VCD A;  4DWS C;  4L2L A;  5G04 J;  3SNX A;  4FHJ A;  1ZK6 A;  4MRU A;  4IT4 A;  1W26 A;  1HKI A;  4Y6C A;  2X6I A;  1OWO A;  4UI9 J;  4ODR A;  2ITK A;  4J4O A;  3RM9 A;  4JFI A;  2OFN A;  4PH4 B;  5FZR A;  4QT3 A;  2WPV A;  2Y4T A;  3WD4 A;  3KD7 A;  2WXF A;  2LSU A;  3JUI A;  4Q7N A;  2FI7 A;  1K9T A;  3JYS A;  4DT4 A;  3QDN A;  1FD9 A;  5A6C A;  2WK2 A;  2J9Q A;  1W1P A;  2V8S E;  4EQF A;  4ACL A;  4XI9 A;  2J4B A;  3B7S A;  5ARG A;  2PM7 A;  1ZBW A;  2MHK A;  3TDB A;  1E7V A;  4J8F A;  3IK8 A;  1H0G A;  4MNK A;  1E9L A;  4GZC A;  1BPO A;  3RIB A;  3PRE A;  1LL4 A;  1E6N A;  3FU5 A;  4FU3 A;  3WD2 A;  3O4Z A;  3CKC A;  3ZRH A;  5FTP A;  2ZQU A;  2VGY A;  4ANU A;  3U64 A;  4IQC A;  2WM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...