1KT9A

Crystal structure of c. elegans ap4a hydrolase
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
136
structure length
132
Chain Sequence
MVVKAAGLVIYRKLAGKIEFLLLQAYPPHHWTPPKGHVDPGEDEWQAAIRETKEEANITKEQLTIHEDCHETLFYEAKGKPKSVKYWLAKLNNPDDVQLSHNWKWCELEDAIKIADYAEMGSLLRKFSAFLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diadenosine Tetraphosphate Hydrolase
publication title The crystal structure of diadenosine tetraphosphate hydrolase from Caenorhabditis elegans in free and binary complex forms
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase
total genus 30
structure length 132
sequence length 136
ec nomenclature ec 3.6.1.17: Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical).
pdb deposition date 2002-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 1kt9A00
3F13A 2O1CA 3L85A 3X0QA 4YPRA 3X0PA 1QVJA 5GHJA 5BONA 1V8RA 2B06A 4DYWA 3GG6A 4N1TA 3X0OA 4C9XA 3Q2TA 3BAPA 3A6TA 1MR2A 2ICKA 3BM4A 5ISYA 1NFSA 2VNQA 4IJXA 3I9XA 3ID9A 4K6EA 2G73A 2R5WA 3MCFA 1IRYA 1V8NA 3EESA 3A6VA 2FKBA 5IW4A 2XSQA 5ANSA 5C8LA 2YVPA 4KTBA 4HFQA 3ZR0A 3X0SA 5CFJA 2GT2A 2QJTA 4KG3A 5C7TA 2RRKA 3G0QA 1SOIA 4S2VA 1MK1A 5C7QA 2J8QA 1VCDA 3ZR1A 1G9QA 5FSOA 5LPGA 1G0SA 3GZ8A 1JKNA 2JVBA 5HZXA 1V8VA 1KHZA 4KG4A 5FSMA 2I8TA 4NFXA 2A6TA 3X0KA 1VC8A 3CNGA 3QSJA 1RRQA 1PPWA 1NQYA 1V8LA 5GHNA 2ICJA 1MUTA 4S2YA 1V8IA 4C9WA 3Q1PA 3X0NA 2VNPA 5DPKA 1Q33A 1V8TA 1U20A 1V8UA 1X51A 2A8QA 4N1UA 4S2XA 1SJYA 1V8SA 2W4EA 1X84A 2PQVA 2DHOA 2GT4A 2DUKA 3O8SA 3P5TA 3ACAA 3OGAA 5ANWA 3Q93A 3E57A 4JZTA 1HZTA 1PVFA 1MQEA 1R67A 2A8SA 2DSBA 4ZG0A 4HVYA 1OW2A 5FSIA 1X83A 3EEUA 1VIQA 3N77A 3J7Ye 2YYHA 1V8WA 3MGMA 2PNYA 1VC9A 3F6AA 3FJYA 3U53A 4JZVA 2YVOA 3FSPA 5ANUA 3KVHA 2YVNA 3N9UA 3MDIA 1JRKA 5FSLA 3SHDA 3I7UA 3FCMA 3O61A 1K26A 3X0LA 5GHQA 5FSKA 1XSAA 3H95A 3Q2SA 2A8RA 1PUNA 2GB5A 3A6SA 4YPHA 2QKMB 3WHWA 5GHIA 2DSCA 2KDVA 2AZWA 1RYAA 1I9AA 3O6ZA 4ILQA 5ANVA 5CFIA 1XSCA 2B0VA 1VIUA 1VHZA 1VRLA 5FSNA 3X0MA 1XSBA 1PPVA 1TUMA 1KT9A 2A8PA 1PPXA 4KYXA 5ANTA 3SMDA 1V8YA 1F3YA 4V14A 3EF5A 3FK9A 4MPOA 4NFWA 3GRNA 3SONA 5GHMA 2B2KA 3X0RA 3BHOA 3COUA 3GZ5A 1MQWA 2QJOA 1RRSA 1HX3A 1GA7A 1Q27A 3GWYA 2DSDA 1SU2A 3Q91A 5DEQA 5GHOA 2I6KA 3HYQA 3DKUA 4ICKA 3EXQA 4JZUA 3GZ6A 4S2WA 4JZSA 2I8UA 3FFUA 5DD4A 2Q9PA 4YOQA 3HHJA 5I8UA 1MP2A 5IW5A 1Q54A 2FMLA 3O69A 1VK6A 1VHGA 3I7VA 3X0IA 1V8MA 3DUPA 2G74A 1PUQA 2KDWA 3MDGA 1SZ3A 1NQZA 1K2EA 1NFZA 3X0JA 1KTGA 5DDGA 3O52A 2O5FA 1PUSA 2A8TA 2O5WA 3R03A 3AC9A 5GHPA 3RH7A 3A6UA 5BS6A 3P6YA 2FVVA 2YVMA 2CL3A 3Q4IA
chains in the Genus database with same CATH superfamily
3F13A 2O1CA 3L85A 3X0QA 4YPRA 3X0PA 1QVJA 5GHJA 5BONA 1V8RA 2B06A 4DYWA 3GG6A 4N1TA 3X0OA 4C9XA 3Q2TA 3BAPA 3A6TA 1MR2A 2ICKA 3BM4A 5ISYA 2CZRA 1NFSA 2VNQA 4IJXA 3I9XA 3ID9A 4K6EA 2G73A 2R5WA 3MCFA 1IRYA 1V8NA 3EESA 3A6VA 2FKBA 5IW4A 2XSQA 5ANSA 5C8LA 2YVPA 4KTBA 4HFQA 3ZR0A 3X0SA 5CFJA 2GT2A 2QJTA 4KG3A 5C7TA 2RRKA 3G0QA 1SOIA 4S2VA 1MK1A 5C7QA 2J8QA 1VCDA 3ZR1A 1G9QA 5FSOA 5LPGA 1G0SA 3GZ8A 1JKNA 2JVBA 5HZXA 1V8VA 1KHZA 4KG4A 5FSMA 2I8TA 4NFXA 2A6TA 3X0KA 1VC8A 3CNGA 3QSJA 1RRQA 1PPWA 1NQYA 1V8LA 5GHNA 2ICJA 1MUTA 4S2YA 1V8IA 4C9WA 3Q1PA 3X0NA 2VNPA 5DPKA 1Q33A 1V8TA 1U20A 1V8UA 1X51A 2A8QA 4N1UA 4S2XA 1SJYA 1V8SA 2W4EA 1X84A 2PQVA 2DHOA 2GT4A 2DUKA 3O8SA 3P5TA 3ACAA 3OGAA 5ANWA 3Q93A 3E57A 4JZTA 1HZTA 1PVFA 1MQEA 1R67A 2A8SA 2DSBA 4ZG0A 4HVYA 1OW2A 5FSIA 1X83A 3EEUA 1VIQA 3N77A 3J7Ye 2YYHA 1V8WA 3MGMA 2PNYA 1VC9A 3F6AA 3FJYA 3U53A 4JZVA 2YVOA 3FSPA 5ANUA 3KVHA 2YVNA 3N9UA 3MDIA 1JRKA 5FSLA 3SHDA 3I7UA 3FCMA 3O61A 4J7GA 1K26A 3X0LA 5GHQA 5FSKA 1XSAA 3H95A 3Q2SA 2A8RA 1PUNA 2GB5A 3A6SA 4YPHA 2QKMB 3WHWA 5GHIA 2DSCA 2KDVA 2AZWA 1RYAA 1I9AA 3O6ZA 4ILQA 5ANVA 5CFIA 1XSCA 2B0VA 1VIUA 1VHZA 1VRLA 5FSNA 3X0MA 1XSBA 1PPVA 1TUMA 1KT9A 2A8PA 1PPXA 4KYXA 5ANTA 3SMDA 1V8YA 1F3YA 4V14A 3EF5A 3FK9A 4MPOA 4NFWA 3GRNA 3SONA 5GHMA 2B2KA 3X0RA 3BHOA 3COUA 3GZ5A 1MQWA 2QJOA 1RRSA 1HX3A 1GA7A 1Q27A 3GWYA 2DSDA 1SU2A 3Q91A 5DEQA 5GHOA 2I6KA 3HYQA 3DKUA 4ICKA 3EXQA 4JZUA 3GZ6A 4S2WA 4JZSA 2I8UA 3FFUA 5DD4A 2Q9PA 4YOQA 3HHJA 5I8UA 1MP2A 5IW5A 1Q54A 2FMLA 3O69A 1VK6A 1VHGA 3I7VA 3X0IA 1V8MA 3DUPA 2G74A 1PUQA 2KDWA 3MDGA 1SZ3A 1NQZA 1K2EA 1NFZA 3X0JA 1KTGA 5DDGA 3O52A 2O5FA 1PUSA 2A8TA 2O5WA 3R03A 3AC9A 4J7HA 5GHPA 3A6UA 3RH7A 5BS6A 2FVVA 3P6YA 2YVMA 2CL3A 3Q4IA
chains in the Genus database with same CATH topology
3F13A 2O1CA 3L85A 3X0QA 4YPRA 3X0PA 1QVJA 5GHJA 5BONA 1V8RA 2B06A 4DYWA 3GG6A 4N1TA 3X0OA 4C9XA 3Q2TA 3BAPA 3A6TA 1MR2A 2ICKA 3BM4A 5ISYA 2CZRA 1NFSA 2VNQA 4IJXA 3I9XA 3ID9A 4K6EA 2G73A 2R5WA 3MCFA 1IRYA 1V8NA 3EESA 3A6VA 2FKBA 5IW4A 2XSQA 5ANSA 5C8LA 2YVPA 4KTBA 4HFQA 3ZR0A 3X0SA 5CFJA 2GT2A 2QJTA 4KG3A 5C7TA 2RRKA 3G0QA 1SOIA 4S2VA 1MK1A 5C7QA 2J8QA 1VCDA 3ZR1A 1G9QA 5FSOA 5LPGA 1G0SA 3GZ8A 1JKNA 2JVBA 5HZXA 1V8VA 1KHZA 4KG4A 5FSMA 2I8TA 4NFXA 2A6TA 3X0KA 1VC8A 3CNGA 3QSJA 1RRQA 1PPWA 1NQYA 1V8LA 5GHNA 2ICJA 1MUTA 4S2YA 1V8IA 4C9WA 3Q1PA 3X0NA 2VNPA 5DPKA 1Q33A 1V8TA 1U20A 1V8UA 1X51A 2A8QA 4N1UA 4S2XA 1SJYA 1V8SA 2W4EA 1X84A 2PQVA 2DHOA 2GT4A 2DUKA 3O8SA 3P5TA 3ACAA 3OGAA 5ANWA 3Q93A 3E57A 4JZTA 1HZTA 1PVFA 1MQEA 1R67A 2A8SA 2DSBA 4ZG0A 4HVYA 1OW2A 5FSIA 1X83A 3EEUA 1VIQA 3N77A 3J7Ye 2YYHA 1V8WA 3MGMA 2PNYA 1VC9A 3F6AA 3FJYA 3U53A 4JZVA 2YVOA 3FSPA 5ANUA 3KVHA 2YVNA 3N9UA 3MDIA 1JRKA 5FSLA 3SHDA 3I7UA 3FCMA 3O61A 4J7GA 1K26A 3X0LA 5GHQA 5FSKA 1XSAA 3H95A 3Q2SA 2A8RA 1PUNA 2GB5A 3A6SA 4YPHA 2QKMB 3WHWA 5GHIA 2DSCA 2KDVA 2AZWA 1RYAA 1I9AA 3O6ZA 4ILQA 5ANVA 5CFIA 1XSCA 2B0VA 1VIUA 1VHZA 1VRLA 5FSNA 3X0MA 1XSBA 1PPVA 1TUMA 1KT9A 2A8PA 1PPXA 4KYXA 5ANTA 3SMDA 1V8YA 1F3YA 4V14A 3EF5A 3FK9A 4MPOA 4NFWA 3GRNA 3SONA 5GHMA 2B2KA 3X0RA 3BHOA 3COUA 3GZ5A 1MQWA 2QJOA 1RRSA 1HX3A 1GA7A 1Q27A 3GWYA 2DSDA 1SU2A 3Q91A 5DEQA 5GHOA 2I6KA 3HYQA 3DKUA 4ICKA 3EXQA 4JZUA 3GZ6A 4S2WA 4JZSA 2I8UA 3FFUA 5DD4A 2Q9PA 4YOQA 3HHJA 5I8UA 1MP2A 5IW5A 1Q54A 2FMLA 3O69A 1VK6A 1VHGA 3I7VA 3X0IA 1V8MA 3DUPA 2G74A 1PUQA 2KDWA 3MDGA 1SZ3A 1NQZA 1K2EA 1NFZA 3X0JA 1KTGA 5DDGA 3O52A 2O5FA 1PUSA 2A8TA 2O5WA 3R03A 3AC9A 4J7HA 5GHPA 3A6UA 3RH7A 5BS6A 2FVVA 3P6YA 2YVMA 2CL3A 3Q4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F13 A;  2O1C A;  3L85 A;  3X0Q A;  4YPR A;  3X0P A;  1QVJ A;  5GHJ A;  5BON A;  1V8R A;  2B06 A;  4DYW A;  3GG6 A;  4N1T A;  3X0O A;  4C9X A;  3Q2T A;  3BAP A;  3A6T A;  1MR2 A;  2ICK A;  3BM4 A;  5ISY A;  1NFS A;  2VNQ A;  4IJX A;  3I9X A;  3ID9 A;  4K6E A;  2G73 A;  2R5W A;  3MCF A;  1IRY A;  1V8N A;  3EES A;  3A6V A;  2FKB A;  5IW4 A;  2XSQ A;  5ANS A;  5C8L A;  2YVP A;  4KTB A;  4HFQ A;  3ZR0 A;  3X0S A;  5CFJ A;  2GT2 A;  2QJT A;  4KG3 A;  5C7T A;  2RRK A;  3G0Q A;  1SOI A;  4S2V A;  1MK1 A;  5C7Q A;  2J8Q A;  1VCD A;  3ZR1 A;  1G9Q A;  5FSO A;  5LPG A;  1G0S A;  3GZ8 A;  1JKN A;  2JVB A;  5HZX A;  1V8V A;  1KHZ A;  4KG4 A;  5FSM A;  2I8T A;  4NFX A;  2A6T A;  3X0K A;  1VC8 A;  3CNG A;  3QSJ A;  1RRQ A;  1PPW A;  1NQY A;  1V8L A;  5GHN A;  2ICJ A;  1MUT A;  4S2Y A;  1V8I A;  4C9W A;  3Q1P A;  3X0N A;  2VNP A;  5DPK A;  1Q33 A;  1V8T A;  1U20 A;  1V8U A;  1X51 A;  2A8Q A;  4N1U A;  4S2X A;  1SJY A;  1V8S A;  2W4E A;  1X84 A;  2PQV A;  2DHO A;  2GT4 A;  2DUK A;  3O8S A;  3P5T A;  3ACA A;  3OGA A;  5ANW A;  3Q93 A;  3E57 A;  4JZT A;  1HZT A;  1PVF A;  1MQE A;  1R67 A;  2A8S A;  2DSB A;  4ZG0 A;  4HVY A;  1OW2 A;  5FSI A;  1X83 A;  3EEU A;  1VIQ A;  3N77 A;  3J7Y e;  2YYH A;  1V8W A;  3MGM A;  2PNY A;  1VC9 A;  3F6A A;  3FJY A;  3U53 A;  4JZV A;  2YVO A;  3FSP A;  5ANU A;  3KVH A;  2YVN A;  3N9U A;  3MDI A;  1JRK A;  5FSL A;  3SHD A;  3I7U A;  3FCM A;  3O61 A;  1K26 A;  3X0L A;  5GHQ A;  5FSK A;  1XSA A;  3H95 A;  3Q2S A;  2A8R A;  1PUN A;  2GB5 A;  3A6S A;  4YPH A;  2QKM B;  3WHW A;  5GHI A;  2DSC A;  2KDV A;  2AZW A;  1RYA A;  1I9A A;  3O6Z A;  4ILQ A;  5ANV A;  5CFI A;  1XSC A;  2B0V A;  1VIU A;  1VHZ A;  1VRL A;  5FSN A;  3X0M A;  1XSB A;  1PPV A;  1TUM A;  1KT9 A;  2A8P A;  1PPX A;  4KYX A;  5ANT A;  3SMD A;  1V8Y A;  1F3Y A;  4V14 A;  3EF5 A;  3FK9 A;  4MPO A;  4NFW A;  3GRN A;  3SON A;  5GHM A;  2B2K A;  3X0R A;  3BHO A;  3COU A;  3GZ5 A;  1MQW A;  2QJO A;  1RRS A;  1HX3 A;  1GA7 A;  1Q27 A;  3GWY A;  2DSD A;  1SU2 A;  3Q91 A;  5DEQ A;  5GHO A;  2I6K A;  3HYQ A;  3DKU A;  4ICK A;  3EXQ A;  4JZU A;  3GZ6 A;  4S2W A;  4JZS A;  2I8U A;  3FFU A;  5DD4 A;  2Q9P A;  4YOQ A;  3HHJ A;  5I8U A;  1MP2 A;  5IW5 A;  1Q54 A;  2FML A;  3O69 A;  1VK6 A;  1VHG A;  3I7V A;  3X0I A;  1V8M A;  3DUP A;  2G74 A;  1PUQ A;  2KDW A;  3MDG A;  1SZ3 A;  1NQZ A;  1K2E A;  1NFZ A;  3X0J A;  1KTG A;  5DDG A;  3O52 A;  2O5F A;  1PUS A;  2A8T A;  2O5W A;  3R03 A;  3AC9 A;  5GHP A;  3RH7 A;  3A6U A;  5BS6 A;  3P6Y A;  2FVV A;  2YVM A;  2CL3 A;  3Q4I A; 
#chains in the Genus database with same CATH topology
 3F13 A;  2O1C A;  3L85 A;  3X0Q A;  4YPR A;  3X0P A;  1QVJ A;  5GHJ A;  5BON A;  1V8R A;  2B06 A;  4DYW A;  3GG6 A;  4N1T A;  3X0O A;  4C9X A;  3Q2T A;  3BAP A;  3A6T A;  1MR2 A;  2ICK A;  3BM4 A;  5ISY A;  2CZR A;  1NFS A;  2VNQ A;  4IJX A;  3I9X A;  3ID9 A;  4K6E A;  2G73 A;  2R5W A;  3MCF A;  1IRY A;  1V8N A;  3EES A;  3A6V A;  2FKB A;  5IW4 A;  2XSQ A;  5ANS A;  5C8L A;  2YVP A;  4KTB A;  4HFQ A;  3ZR0 A;  3X0S A;  5CFJ A;  2GT2 A;  2QJT A;  4KG3 A;  5C7T A;  2RRK A;  3G0Q A;  1SOI A;  4S2V A;  1MK1 A;  5C7Q A;  2J8Q A;  1VCD A;  3ZR1 A;  1G9Q A;  5FSO A;  5LPG A;  1G0S A;  3GZ8 A;  1JKN A;  2JVB A;  5HZX A;  1V8V A;  1KHZ A;  4KG4 A;  5FSM A;  2I8T A;  4NFX A;  2A6T A;  3X0K A;  1VC8 A;  3CNG A;  3QSJ A;  1RRQ A;  1PPW A;  1NQY A;  1V8L A;  5GHN A;  2ICJ A;  1MUT A;  4S2Y A;  1V8I A;  4C9W A;  3Q1P A;  3X0N A;  2VNP A;  5DPK A;  1Q33 A;  1V8T A;  1U20 A;  1V8U A;  1X51 A;  2A8Q A;  4N1U A;  4S2X A;  1SJY A;  1V8S A;  2W4E A;  1X84 A;  2PQV A;  2DHO A;  2GT4 A;  2DUK A;  3O8S A;  3P5T A;  3ACA A;  3OGA A;  5ANW A;  3Q93 A;  3E57 A;  4JZT A;  1HZT A;  1PVF A;  1MQE A;  1R67 A;  2A8S A;  2DSB A;  4ZG0 A;  4HVY A;  1OW2 A;  5FSI A;  1X83 A;  3EEU A;  1VIQ A;  3N77 A;  3J7Y e;  2YYH A;  1V8W A;  3MGM A;  2PNY A;  1VC9 A;  3F6A A;  3FJY A;  3U53 A;  4JZV A;  2YVO A;  3FSP A;  5ANU A;  3KVH A;  2YVN A;  3N9U A;  3MDI A;  1JRK A;  5FSL A;  3SHD A;  3I7U A;  3FCM A;  3O61 A;  4J7G A;  1K26 A;  3X0L A;  5GHQ A;  5FSK A;  1XSA A;  3H95 A;  3Q2S A;  2A8R A;  1PUN A;  2GB5 A;  3A6S A;  4YPH A;  2QKM B;  3WHW A;  5GHI A;  2DSC A;  2KDV A;  2AZW A;  1RYA A;  1I9A A;  3O6Z A;  4ILQ A;  5ANV A;  5CFI A;  1XSC A;  2B0V A;  1VIU A;  1VHZ A;  1VRL A;  5FSN A;  3X0M A;  1XSB A;  1PPV A;  1TUM A;  1KT9 A;  2A8P A;  1PPX A;  4KYX A;  5ANT A;  3SMD A;  1V8Y A;  1F3Y A;  4V14 A;  3EF5 A;  3FK9 A;  4MPO A;  4NFW A;  3GRN A;  3SON A;  5GHM A;  2B2K A;  3X0R A;  3BHO A;  3COU A;  3GZ5 A;  1MQW A;  2QJO A;  1RRS A;  1HX3 A;  1GA7 A;  1Q27 A;  3GWY A;  2DSD A;  1SU2 A;  3Q91 A;  5DEQ A;  5GHO A;  2I6K A;  3HYQ A;  3DKU A;  4ICK A;  3EXQ A;  4JZU A;  3GZ6 A;  4S2W A;  4JZS A;  2I8U A;  3FFU A;  5DD4 A;  2Q9P A;  4YOQ A;  3HHJ A;  5I8U A;  1MP2 A;  5IW5 A;  1Q54 A;  2FML A;  3O69 A;  1VK6 A;  1VHG A;  3I7V A;  3X0I A;  1V8M A;  3DUP A;  2G74 A;  1PUQ A;  2KDW A;  3MDG A;  1SZ3 A;  1NQZ A;  1K2E A;  1NFZ A;  3X0J A;  1KTG A;  5DDG A;  3O52 A;  2O5F A;  1PUS A;  2A8T A;  2O5W A;  3R03 A;  3AC9 A;  4J7H A;  5GHP A;  3A6U A;  3RH7 A;  5BS6 A;  2FVV A;  3P6Y A;  2YVM A;  2CL3 A;  3Q4I A; 
#chains in the Genus database with same CATH homology
 3F13 A;  2O1C A;  3L85 A;  3X0Q A;  4YPR A;  3X0P A;  1QVJ A;  5GHJ A;  5BON A;  1V8R A;  2B06 A;  4DYW A;  3GG6 A;  4N1T A;  3X0O A;  4C9X A;  3Q2T A;  3BAP A;  3A6T A;  1MR2 A;  2ICK A;  3BM4 A;  5ISY A;  2CZR A;  1NFS A;  2VNQ A;  4IJX A;  3I9X A;  3ID9 A;  4K6E A;  2G73 A;  2R5W A;  3MCF A;  1IRY A;  1V8N A;  3EES A;  3A6V A;  2FKB A;  5IW4 A;  2XSQ A;  5ANS A;  5C8L A;  2YVP A;  4KTB A;  4HFQ A;  3ZR0 A;  3X0S A;  5CFJ A;  2GT2 A;  2QJT A;  4KG3 A;  5C7T A;  2RRK A;  3G0Q A;  1SOI A;  4S2V A;  1MK1 A;  5C7Q A;  2J8Q A;  1VCD A;  3ZR1 A;  1G9Q A;  5FSO A;  5LPG A;  1G0S A;  3GZ8 A;  1JKN A;  2JVB A;  5HZX A;  1V8V A;  1KHZ A;  4KG4 A;  5FSM A;  2I8T A;  4NFX A;  2A6T A;  3X0K A;  1VC8 A;  3CNG A;  3QSJ A;  1RRQ A;  1PPW A;  1NQY A;  1V8L A;  5GHN A;  2ICJ A;  1MUT A;  4S2Y A;  1V8I A;  4C9W A;  3Q1P A;  3X0N A;  2VNP A;  5DPK A;  1Q33 A;  1V8T A;  1U20 A;  1V8U A;  1X51 A;  2A8Q A;  4N1U A;  4S2X A;  1SJY A;  1V8S A;  2W4E A;  1X84 A;  2PQV A;  2DHO A;  2GT4 A;  2DUK A;  3O8S A;  3P5T A;  3ACA A;  3OGA A;  5ANW A;  3Q93 A;  3E57 A;  4JZT A;  1HZT A;  1PVF A;  1MQE A;  1R67 A;  2A8S A;  2DSB A;  4ZG0 A;  4HVY A;  1OW2 A;  5FSI A;  1X83 A;  3EEU A;  1VIQ A;  3N77 A;  3J7Y e;  2YYH A;  1V8W A;  3MGM A;  2PNY A;  1VC9 A;  3F6A A;  3FJY A;  3U53 A;  4JZV A;  2YVO A;  3FSP A;  5ANU A;  3KVH A;  2YVN A;  3N9U A;  3MDI A;  1JRK A;  5FSL A;  3SHD A;  3I7U A;  3FCM A;  3O61 A;  4J7G A;  1K26 A;  3X0L A;  5GHQ A;  5FSK A;  1XSA A;  3H95 A;  3Q2S A;  2A8R A;  1PUN A;  2GB5 A;  3A6S A;  4YPH A;  2QKM B;  3WHW A;  5GHI A;  2DSC A;  2KDV A;  2AZW A;  1RYA A;  1I9A A;  3O6Z A;  4ILQ A;  5ANV A;  5CFI A;  1XSC A;  2B0V A;  1VIU A;  1VHZ A;  1VRL A;  5FSN A;  3X0M A;  1XSB A;  1PPV A;  1TUM A;  1KT9 A;  2A8P A;  1PPX A;  4KYX A;  5ANT A;  3SMD A;  1V8Y A;  1F3Y A;  4V14 A;  3EF5 A;  3FK9 A;  4MPO A;  4NFW A;  3GRN A;  3SON A;  5GHM A;  2B2K A;  3X0R A;  3BHO A;  3COU A;  3GZ5 A;  1MQW A;  2QJO A;  1RRS A;  1HX3 A;  1GA7 A;  1Q27 A;  3GWY A;  2DSD A;  1SU2 A;  3Q91 A;  5DEQ A;  5GHO A;  2I6K A;  3HYQ A;  3DKU A;  4ICK A;  3EXQ A;  4JZU A;  3GZ6 A;  4S2W A;  4JZS A;  2I8U A;  3FFU A;  5DD4 A;  2Q9P A;  4YOQ A;  3HHJ A;  5I8U A;  1MP2 A;  5IW5 A;  1Q54 A;  2FML A;  3O69 A;  1VK6 A;  1VHG A;  3I7V A;  3X0I A;  1V8M A;  3DUP A;  2G74 A;  1PUQ A;  2KDW A;  3MDG A;  1SZ3 A;  1NQZ A;  1K2E A;  1NFZ A;  3X0J A;  1KTG A;  5DDG A;  3O52 A;  2O5F A;  1PUS A;  2A8T A;  2O5W A;  3R03 A;  3AC9 A;  4J7H A;  5GHP A;  3A6U A;  3RH7 A;  5BS6 A;  2FVV A;  3P6Y A;  2YVM A;  2CL3 A;  3Q4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...