1KT9A

Crystal structure of c. elegans ap4a hydrolase
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
136
structure length
132
Chain Sequence
b'MVVKAAGLVIYRKLAGKIEFLLLQAYPPHHWTPPKGHVDPGEDEWQAAIRETKEEANITKEQLTIHEDCHETLFYEAKGKPKSVKYWLAKLNNPDDVQLSHNWKWCELEDAIKIADYAEMGSLLRKFSAFLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diadenosine Tetraphosphate Hydrolase
publication title The crystal structure of diadenosine tetraphosphate hydrolase from Caenorhabditis elegans in free and binary complex forms
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase
total genus 30
structure length 132
sequence length 136
ec nomenclature ec 3.6.1.17: Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical).
pdb deposition date 2002-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 1kt9A00
2B2KA 4S2XA 5BONA 2YVOA 1NQZA 1VIUA 3F6AA 4K6EA 5DPKA 2KDVA 3J7Ye 3FFUA 1KT9A 3EEUA 1JKNA 3MDGA 1NFSA 2I6KA 1JRKA 1NFZA 2YVNA 5FSMA 1X84A 2GT2A 4N1UA 3H95A 5C8LA 1QVJA 3X0OA 3ACAA 1VK6A 2DSDA 4IJXA 5ISYA 3HHJA 3SHDA 1VHGA 3I7UA 1IRYA 3GRNA 5FSNA 2YVMA 5DD4A 3R03A 1RYAA 3A6SA 2A8RA 3P5TA 3X0QA 5IW4A 3GZ6A 1SU2A 5ANSA 5FSIA 3EESA 4YPRA 2FMLA 1MUTA 5CFJA 4YOQA 3WHWA 3KVHA 5GHJA 1V8TA 4V14A 2QJTA 4KTBA 1V8NA 3I7VA 3X0PA 2FKBA 3ZR1A 3N9UA 1PUNA 3P6YA 3Q4IA 5GHPA 1MK1A 5C7QA 1Q33A 1X51A 3COUA 5FSOA 3X0IA 1TUMA 4KYXA 1PPXA 1V8LA 3GG6A 1PUSA 1OW2A 2A8TA 3EF5A 1R67A 1HX3A 1XSAA 3MDIA 5GHNA 2Q9PA 3A6VA 4MPOA 5BS6A 1X83A 1V8IA 2XSQA 4S2YA 3O52A 3BAPA 3HYQA 2FVVA 2PNYA 3OGAA 1MQEA 3X0SA 5GHMA 3GZ5A 3FSPA 5GHOA 2O5FA 3GZ8A 3A6TA 5DEQA 3BM4A 5ANTA 4HVYA 5LPGA 1RRQA 2YYHA 1NQYA 4NFWA 4S2VA 3Q2SA 5IW5A 4KG3A 2W4EA 1GA7A 3FJYA 5I8UA 1F3YA 1V8SA 1I9AA 3SMDA 3SONA 3ID9A 5ANUA 2R5WA 3RH7A 5ANVA 3Q93A 2GB5A 3E57A 3X0RA 1VIQA 1V8YA 2J8QA 3L85A 3Q91A 1V8UA 3A6UA 3F13A 3FCMA 3X0MA 1VRLA 1MR2A 3U53A 4N1TA 3Q1PA 2DSCA 4ZG0A 2QKMB 3DUPA 5HZXA 3EXQA 1MQWA 5CFIA 1KHZA 4JZUA 1VCDA 3N77A 1Q27A 1SZ3A 2B0VA 2DUKA 1XSCA 3QSJA 2DHOA 4KG4A 3X0NA 2GT4A 3X0LA 1G9QA 4NFXA 5C7TA 2VNPA 3CNGA 3O6ZA 1Q54A 4C9WA 4YPHA 3O61A 2A6TA 2AZWA 2DSBA 1V8MA 1VHZA 2B06A 2G74A 5GHIA 4C9XA 2CL3A 1U20A 1SOIA 3DKUA 2O5WA 2YVPA 3O69A 4ILQA 2O1CA 4ICKA 4DYWA 1V8RA 3Q2TA 1KTGA 5FSLA 3FK9A 4JZSA 2QJOA 2KDWA 3O8SA 1SJYA 2A8PA 2JVBA 3BHOA 2PQVA 1XSBA 5DDGA 1G0SA 2ICJA 4JZTA 3X0JA 1HZTA 3X0KA 2I8TA 1PVFA 1VC8A 3MGMA 3AC9A 2A8QA 1RRSA 2G73A 2I8UA 3MCFA 4HFQA 2VNQA 5FSKA 1VC9A 4S2WA 1V8WA 5GHQA 2ICKA 2RRKA 3I9XA 1K26A 5ANWA 1PPVA 1PUQA 3ZR0A 3G0QA 1K2EA 1MP2A 1V8VA 2A8SA 1PPWA 3GWYA 4JZVA
chains in the Genus database with same CATH superfamily
2B2KA 4S2XA 5BONA 2YVOA 1NQZA 1VIUA 3F6AA 4K6EA 5DPKA 2KDVA 3J7Ye 3FFUA 1KT9A 3EEUA 1JKNA 3MDGA 1NFSA 2I6KA 1JRKA 1NFZA 2YVNA 5FSMA 1X84A 2GT2A 4N1UA 3H95A 5C8LA 1QVJA 3X0OA 3ACAA 1VK6A 2DSDA 4IJXA 5ISYA 3HHJA 4J7HA 1VHGA 3I7UA 3SHDA 3GRNA 5FSNA 1IRYA 2YVMA 5DD4A 3R03A 1RYAA 3A6SA 2A8RA 3P5TA 3X0QA 5IW4A 3GZ6A 1SU2A 5ANSA 5FSIA 3EESA 4YPRA 2FMLA 1MUTA 5CFJA 4YOQA 3WHWA 3KVHA 5GHJA 1V8TA 4V14A 2QJTA 4KTBA 1V8NA 3I7VA 3X0PA 2FKBA 3ZR1A 3N9UA 1PUNA 3P6YA 3Q4IA 5GHPA 1MK1A 5C7QA 1Q33A 1X51A 3COUA 5FSOA 3X0IA 1TUMA 4KYXA 1PPXA 1V8LA 3GG6A 1PUSA 1OW2A 2A8TA 3EF5A 1R67A 1HX3A 1XSAA 3MDIA 5GHNA 2Q9PA 3A6VA 4MPOA 5BS6A 1X83A 1V8IA 2XSQA 4S2YA 3O52A 3BAPA 3HYQA 2FVVA 2PNYA 3OGAA 1MQEA 3X0SA 5GHMA 3GZ5A 3FSPA 5GHOA 2O5FA 3GZ8A 3A6TA 5DEQA 3BM4A 5ANTA 4HVYA 5LPGA 1RRQA 2YYHA 1NQYA 4NFWA 4J7GA 4S2VA 3Q2SA 5IW5A 4KG3A 2W4EA 1GA7A 3FJYA 5I8UA 1F3YA 1V8SA 1I9AA 3SMDA 3SONA 3ID9A 5ANUA 2R5WA 3RH7A 5ANVA 3Q93A 2GB5A 3E57A 3X0RA 1VIQA 1V8YA 2J8QA 3L85A 3Q91A 1V8UA 3A6UA 3F13A 3FCMA 3X0MA 1VRLA 1MR2A 3U53A 4N1TA 3Q1PA 2DSCA 4ZG0A 2QKMB 3DUPA 5HZXA 3EXQA 1MQWA 5CFIA 1KHZA 4JZUA 1VCDA 3N77A 1Q27A 1SZ3A 2B0VA 2DUKA 1XSCA 3QSJA 2DHOA 4KG4A 3X0NA 2GT4A 3X0LA 1G9QA 4NFXA 5C7TA 2VNPA 3CNGA 3O6ZA 1Q54A 4C9WA 4YPHA 3O61A 2A6TA 2AZWA 2DSBA 1V8MA 1VHZA 2B06A 2G74A 5GHIA 4C9XA 2CL3A 1U20A 1SOIA 3DKUA 2O5WA 2YVPA 3O69A 4ILQA 2O1CA 4ICKA 4DYWA 1V8RA 3Q2TA 1KTGA 5FSLA 3FK9A 4JZSA 2QJOA 2KDWA 3O8SA 1SJYA 2A8PA 2JVBA 3BHOA 2CZRA 2PQVA 1XSBA 5DDGA 1G0SA 2ICJA 4JZTA 3X0JA 1HZTA 3X0KA 2I8TA 1PVFA 1VC8A 3MGMA 3AC9A 2A8QA 1RRSA 2G73A 2I8UA 3MCFA 4HFQA 2VNQA 5FSKA 1VC9A 4S2WA 1V8WA 5GHQA 2ICKA 2RRKA 3I9XA 1K26A 5ANWA 1PPVA 1PUQA 3ZR0A 3G0QA 1K2EA 1MP2A 1V8VA 2A8SA 1PPWA 3GWYA 4JZVA
chains in the Genus database with same CATH topology
2B2KA 4S2XA 5BONA 2YVOA 1NQZA 1VIUA 3F6AA 4K6EA 5DPKA 2KDVA 3J7Ye 3FFUA 1KT9A 3EEUA 1JKNA 3MDGA 1NFSA 2I6KA 1JRKA 1NFZA 2YVNA 5FSMA 1X84A 2GT2A 4N1UA 3H95A 5C8LA 1QVJA 3X0OA 3ACAA 1VK6A 2DSDA 4IJXA 5ISYA 3HHJA 4J7HA 1VHGA 3I7UA 3SHDA 3GRNA 5FSNA 1IRYA 2YVMA 5DD4A 3R03A 1RYAA 3A6SA 2A8RA 3P5TA 3X0QA 5IW4A 3GZ6A 1SU2A 5ANSA 5FSIA 3EESA 4YPRA 2FMLA 1MUTA 5CFJA 4YOQA 3WHWA 3KVHA 5GHJA 1V8TA 4V14A 2QJTA 4KTBA 1V8NA 3I7VA 3X0PA 2FKBA 3ZR1A 3N9UA 1PUNA 3P6YA 3Q4IA 5GHPA 1MK1A 5C7QA 1Q33A 1X51A 3COUA 5FSOA 3X0IA 1TUMA 4KYXA 1PPXA 1V8LA 3GG6A 1PUSA 1OW2A 2A8TA 3EF5A 1R67A 1HX3A 1XSAA 3MDIA 5GHNA 2Q9PA 3A6VA 4MPOA 5BS6A 1X83A 1V8IA 2XSQA 4S2YA 3O52A 3BAPA 3HYQA 2FVVA 2PNYA 3OGAA 1MQEA 3X0SA 5GHMA 3GZ5A 3FSPA 5GHOA 2O5FA 3GZ8A 3A6TA 5DEQA 3BM4A 5ANTA 4HVYA 5LPGA 1RRQA 2YYHA 1NQYA 4NFWA 4J7GA 4S2VA 3Q2SA 5IW5A 4KG3A 2W4EA 1GA7A 3FJYA 5I8UA 1F3YA 1V8SA 1I9AA 3SMDA 3SONA 3ID9A 5ANUA 2R5WA 3RH7A 5ANVA 3Q93A 2GB5A 3E57A 3X0RA 1VIQA 1V8YA 2J8QA 3L85A 3Q91A 1V8UA 3A6UA 3F13A 3FCMA 3X0MA 1VRLA 1MR2A 3U53A 4N1TA 3Q1PA 2DSCA 4ZG0A 2QKMB 3DUPA 5HZXA 3EXQA 1MQWA 5CFIA 1KHZA 4JZUA 1VCDA 3N77A 1Q27A 1SZ3A 2B0VA 2DUKA 1XSCA 3QSJA 2DHOA 4KG4A 3X0NA 2GT4A 3X0LA 1G9QA 4NFXA 5C7TA 2VNPA 3CNGA 3O6ZA 1Q54A 4C9WA 4YPHA 3O61A 2A6TA 2AZWA 2DSBA 1V8MA 1VHZA 2B06A 2G74A 5GHIA 4C9XA 2CL3A 1U20A 1SOIA 3DKUA 2O5WA 2YVPA 3O69A 4ILQA 2O1CA 4ICKA 4DYWA 1V8RA 3Q2TA 1KTGA 5FSLA 3FK9A 4JZSA 2QJOA 2KDWA 3O8SA 1SJYA 2A8PA 2JVBA 3BHOA 2CZRA 2PQVA 1XSBA 5DDGA 1G0SA 2ICJA 4JZTA 3X0JA 1HZTA 3X0KA 2I8TA 1PVFA 1VC8A 3MGMA 3AC9A 2A8QA 1RRSA 2G73A 2I8UA 3MCFA 4HFQA 2VNQA 5FSKA 1VC9A 4S2WA 1V8WA 5GHQA 2ICKA 2RRKA 3I9XA 1K26A 5ANWA 1PPVA 1PUQA 3ZR0A 3G0QA 1K2EA 1MP2A 1V8VA 2A8SA 1PPWA 3GWYA 4JZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B2K A;  4S2X A;  5BON A;  2YVO A;  1NQZ A;  1VIU A;  3F6A A;  4K6E A;  5DPK A;  2KDV A;  3J7Y e;  3FFU A;  1KT9 A;  3EEU A;  1JKN A;  3MDG A;  1NFS A;  2I6K A;  1JRK A;  1NFZ A;  2YVN A;  5FSM A;  1X84 A;  2GT2 A;  4N1U A;  3H95 A;  5C8L A;  1QVJ A;  3X0O A;  3ACA A;  1VK6 A;  2DSD A;  4IJX A;  5ISY A;  3HHJ A;  3SHD A;  1VHG A;  3I7U A;  1IRY A;  3GRN A;  5FSN A;  2YVM A;  5DD4 A;  3R03 A;  1RYA A;  3A6S A;  2A8R A;  3P5T A;  3X0Q A;  5IW4 A;  3GZ6 A;  1SU2 A;  5ANS A;  5FSI A;  3EES A;  4YPR A;  2FML A;  1MUT A;  5CFJ A;  4YOQ A;  3WHW A;  3KVH A;  5GHJ A;  1V8T A;  4V14 A;  2QJT A;  4KTB A;  1V8N A;  3I7V A;  3X0P A;  2FKB A;  3ZR1 A;  3N9U A;  1PUN A;  3P6Y A;  3Q4I A;  5GHP A;  1MK1 A;  5C7Q A;  1Q33 A;  1X51 A;  3COU A;  5FSO A;  3X0I A;  1TUM A;  4KYX A;  1PPX A;  1V8L A;  3GG6 A;  1PUS A;  1OW2 A;  2A8T A;  3EF5 A;  1R67 A;  1HX3 A;  1XSA A;  3MDI A;  5GHN A;  2Q9P A;  3A6V A;  4MPO A;  5BS6 A;  1X83 A;  1V8I A;  2XSQ A;  4S2Y A;  3O52 A;  3BAP A;  3HYQ A;  2FVV A;  2PNY A;  3OGA A;  1MQE A;  3X0S A;  5GHM A;  3GZ5 A;  3FSP A;  5GHO A;  2O5F A;  3GZ8 A;  3A6T A;  5DEQ A;  3BM4 A;  5ANT A;  4HVY A;  5LPG A;  1RRQ A;  2YYH A;  1NQY A;  4NFW A;  4S2V A;  3Q2S A;  5IW5 A;  4KG3 A;  2W4E A;  1GA7 A;  3FJY A;  5I8U A;  1F3Y A;  1V8S A;  1I9A A;  3SMD A;  3SON A;  3ID9 A;  5ANU A;  2R5W A;  3RH7 A;  5ANV A;  3Q93 A;  2GB5 A;  3E57 A;  3X0R A;  1VIQ A;  1V8Y A;  2J8Q A;  3L85 A;  3Q91 A;  1V8U A;  3A6U A;  3F13 A;  3FCM A;  3X0M A;  1VRL A;  1MR2 A;  3U53 A;  4N1T A;  3Q1P A;  2DSC A;  4ZG0 A;  2QKM B;  3DUP A;  5HZX A;  3EXQ A;  1MQW A;  5CFI A;  1KHZ A;  4JZU A;  1VCD A;  3N77 A;  1Q27 A;  1SZ3 A;  2B0V A;  2DUK A;  1XSC A;  3QSJ A;  2DHO A;  4KG4 A;  3X0N A;  2GT4 A;  3X0L A;  1G9Q A;  4NFX A;  5C7T A;  2VNP A;  3CNG A;  3O6Z A;  1Q54 A;  4C9W A;  4YPH A;  3O61 A;  2A6T A;  2AZW A;  2DSB A;  1V8M A;  1VHZ A;  2B06 A;  2G74 A;  5GHI A;  4C9X A;  2CL3 A;  1U20 A;  1SOI A;  3DKU A;  2O5W A;  2YVP A;  3O69 A;  4ILQ A;  2O1C A;  4ICK A;  4DYW A;  1V8R A;  3Q2T A;  1KTG A;  5FSL A;  3FK9 A;  4JZS A;  2QJO A;  2KDW A;  3O8S A;  1SJY A;  2A8P A;  2JVB A;  3BHO A;  2PQV A;  1XSB A;  5DDG A;  1G0S A;  2ICJ A;  4JZT A;  3X0J A;  1HZT A;  3X0K A;  2I8T A;  1PVF A;  1VC8 A;  3MGM A;  3AC9 A;  2A8Q A;  1RRS A;  2G73 A;  2I8U A;  3MCF A;  4HFQ A;  2VNQ A;  5FSK A;  1VC9 A;  4S2W A;  1V8W A;  5GHQ A;  2ICK A;  2RRK A;  3I9X A;  1K26 A;  5ANW A;  1PPV A;  1PUQ A;  3ZR0 A;  3G0Q A;  1K2E A;  1MP2 A;  1V8V A;  2A8S A;  1PPW A;  3GWY A;  4JZV A; 
#chains in the Genus database with same CATH topology
 2B2K A;  4S2X A;  5BON A;  2YVO A;  1NQZ A;  1VIU A;  3F6A A;  4K6E A;  5DPK A;  2KDV A;  3J7Y e;  3FFU A;  1KT9 A;  3EEU A;  1JKN A;  3MDG A;  1NFS A;  2I6K A;  1JRK A;  1NFZ A;  2YVN A;  5FSM A;  1X84 A;  2GT2 A;  4N1U A;  3H95 A;  5C8L A;  1QVJ A;  3X0O A;  3ACA A;  1VK6 A;  2DSD A;  4IJX A;  5ISY A;  3HHJ A;  4J7H A;  1VHG A;  3I7U A;  3SHD A;  3GRN A;  5FSN A;  1IRY A;  2YVM A;  5DD4 A;  3R03 A;  1RYA A;  3A6S A;  2A8R A;  3P5T A;  3X0Q A;  5IW4 A;  3GZ6 A;  1SU2 A;  5ANS A;  5FSI A;  3EES A;  4YPR A;  2FML A;  1MUT A;  5CFJ A;  4YOQ A;  3WHW A;  3KVH A;  5GHJ A;  1V8T A;  4V14 A;  2QJT A;  4KTB A;  1V8N A;  3I7V A;  3X0P A;  2FKB A;  3ZR1 A;  3N9U A;  1PUN A;  3P6Y A;  3Q4I A;  5GHP A;  1MK1 A;  5C7Q A;  1Q33 A;  1X51 A;  3COU A;  5FSO A;  3X0I A;  1TUM A;  4KYX A;  1PPX A;  1V8L A;  3GG6 A;  1PUS A;  1OW2 A;  2A8T A;  3EF5 A;  1R67 A;  1HX3 A;  1XSA A;  3MDI A;  5GHN A;  2Q9P A;  3A6V A;  4MPO A;  5BS6 A;  1X83 A;  1V8I A;  2XSQ A;  4S2Y A;  3O52 A;  3BAP A;  3HYQ A;  2FVV A;  2PNY A;  3OGA A;  1MQE A;  3X0S A;  5GHM A;  3GZ5 A;  3FSP A;  5GHO A;  2O5F A;  3GZ8 A;  3A6T A;  5DEQ A;  3BM4 A;  5ANT A;  4HVY A;  5LPG A;  1RRQ A;  2YYH A;  1NQY A;  4NFW A;  4J7G A;  4S2V A;  3Q2S A;  5IW5 A;  4KG3 A;  2W4E A;  1GA7 A;  3FJY A;  5I8U A;  1F3Y A;  1V8S A;  1I9A A;  3SMD A;  3SON A;  3ID9 A;  5ANU A;  2R5W A;  3RH7 A;  5ANV A;  3Q93 A;  2GB5 A;  3E57 A;  3X0R A;  1VIQ A;  1V8Y A;  2J8Q A;  3L85 A;  3Q91 A;  1V8U A;  3A6U A;  3F13 A;  3FCM A;  3X0M A;  1VRL A;  1MR2 A;  3U53 A;  4N1T A;  3Q1P A;  2DSC A;  4ZG0 A;  2QKM B;  3DUP A;  5HZX A;  3EXQ A;  1MQW A;  5CFI A;  1KHZ A;  4JZU A;  1VCD A;  3N77 A;  1Q27 A;  1SZ3 A;  2B0V A;  2DUK A;  1XSC A;  3QSJ A;  2DHO A;  4KG4 A;  3X0N A;  2GT4 A;  3X0L A;  1G9Q A;  4NFX A;  5C7T A;  2VNP A;  3CNG A;  3O6Z A;  1Q54 A;  4C9W A;  4YPH A;  3O61 A;  2A6T A;  2AZW A;  2DSB A;  1V8M A;  1VHZ A;  2B06 A;  2G74 A;  5GHI A;  4C9X A;  2CL3 A;  1U20 A;  1SOI A;  3DKU A;  2O5W A;  2YVP A;  3O69 A;  4ILQ A;  2O1C A;  4ICK A;  4DYW A;  1V8R A;  3Q2T A;  1KTG A;  5FSL A;  3FK9 A;  4JZS A;  2QJO A;  2KDW A;  3O8S A;  1SJY A;  2A8P A;  2JVB A;  3BHO A;  2CZR A;  2PQV A;  1XSB A;  5DDG A;  1G0S A;  2ICJ A;  4JZT A;  3X0J A;  1HZT A;  3X0K A;  2I8T A;  1PVF A;  1VC8 A;  3MGM A;  3AC9 A;  2A8Q A;  1RRS A;  2G73 A;  2I8U A;  3MCF A;  4HFQ A;  2VNQ A;  5FSK A;  1VC9 A;  4S2W A;  1V8W A;  5GHQ A;  2ICK A;  2RRK A;  3I9X A;  1K26 A;  5ANW A;  1PPV A;  1PUQ A;  3ZR0 A;  3G0Q A;  1K2E A;  1MP2 A;  1V8V A;  2A8S A;  1PPW A;  3GWY A;  4JZV A; 
#chains in the Genus database with same CATH homology
 2B2K A;  4S2X A;  5BON A;  2YVO A;  1NQZ A;  1VIU A;  3F6A A;  4K6E A;  5DPK A;  2KDV A;  3J7Y e;  3FFU A;  1KT9 A;  3EEU A;  1JKN A;  3MDG A;  1NFS A;  2I6K A;  1JRK A;  1NFZ A;  2YVN A;  5FSM A;  1X84 A;  2GT2 A;  4N1U A;  3H95 A;  5C8L A;  1QVJ A;  3X0O A;  3ACA A;  1VK6 A;  2DSD A;  4IJX A;  5ISY A;  3HHJ A;  4J7H A;  1VHG A;  3I7U A;  3SHD A;  3GRN A;  5FSN A;  1IRY A;  2YVM A;  5DD4 A;  3R03 A;  1RYA A;  3A6S A;  2A8R A;  3P5T A;  3X0Q A;  5IW4 A;  3GZ6 A;  1SU2 A;  5ANS A;  5FSI A;  3EES A;  4YPR A;  2FML A;  1MUT A;  5CFJ A;  4YOQ A;  3WHW A;  3KVH A;  5GHJ A;  1V8T A;  4V14 A;  2QJT A;  4KTB A;  1V8N A;  3I7V A;  3X0P A;  2FKB A;  3ZR1 A;  3N9U A;  1PUN A;  3P6Y A;  3Q4I A;  5GHP A;  1MK1 A;  5C7Q A;  1Q33 A;  1X51 A;  3COU A;  5FSO A;  3X0I A;  1TUM A;  4KYX A;  1PPX A;  1V8L A;  3GG6 A;  1PUS A;  1OW2 A;  2A8T A;  3EF5 A;  1R67 A;  1HX3 A;  1XSA A;  3MDI A;  5GHN A;  2Q9P A;  3A6V A;  4MPO A;  5BS6 A;  1X83 A;  1V8I A;  2XSQ A;  4S2Y A;  3O52 A;  3BAP A;  3HYQ A;  2FVV A;  2PNY A;  3OGA A;  1MQE A;  3X0S A;  5GHM A;  3GZ5 A;  3FSP A;  5GHO A;  2O5F A;  3GZ8 A;  3A6T A;  5DEQ A;  3BM4 A;  5ANT A;  4HVY A;  5LPG A;  1RRQ A;  2YYH A;  1NQY A;  4NFW A;  4J7G A;  4S2V A;  3Q2S A;  5IW5 A;  4KG3 A;  2W4E A;  1GA7 A;  3FJY A;  5I8U A;  1F3Y A;  1V8S A;  1I9A A;  3SMD A;  3SON A;  3ID9 A;  5ANU A;  2R5W A;  3RH7 A;  5ANV A;  3Q93 A;  2GB5 A;  3E57 A;  3X0R A;  1VIQ A;  1V8Y A;  2J8Q A;  3L85 A;  3Q91 A;  1V8U A;  3A6U A;  3F13 A;  3FCM A;  3X0M A;  1VRL A;  1MR2 A;  3U53 A;  4N1T A;  3Q1P A;  2DSC A;  4ZG0 A;  2QKM B;  3DUP A;  5HZX A;  3EXQ A;  1MQW A;  5CFI A;  1KHZ A;  4JZU A;  1VCD A;  3N77 A;  1Q27 A;  1SZ3 A;  2B0V A;  2DUK A;  1XSC A;  3QSJ A;  2DHO A;  4KG4 A;  3X0N A;  2GT4 A;  3X0L A;  1G9Q A;  4NFX A;  5C7T A;  2VNP A;  3CNG A;  3O6Z A;  1Q54 A;  4C9W A;  4YPH A;  3O61 A;  2A6T A;  2AZW A;  2DSB A;  1V8M A;  1VHZ A;  2B06 A;  2G74 A;  5GHI A;  4C9X A;  2CL3 A;  1U20 A;  1SOI A;  3DKU A;  2O5W A;  2YVP A;  3O69 A;  4ILQ A;  2O1C A;  4ICK A;  4DYW A;  1V8R A;  3Q2T A;  1KTG A;  5FSL A;  3FK9 A;  4JZS A;  2QJO A;  2KDW A;  3O8S A;  1SJY A;  2A8P A;  2JVB A;  3BHO A;  2CZR A;  2PQV A;  1XSB A;  5DDG A;  1G0S A;  2ICJ A;  4JZT A;  3X0J A;  1HZT A;  3X0K A;  2I8T A;  1PVF A;  1VC8 A;  3MGM A;  3AC9 A;  2A8Q A;  1RRS A;  2G73 A;  2I8U A;  3MCF A;  4HFQ A;  2VNQ A;  5FSK A;  1VC9 A;  4S2W A;  1V8W A;  5GHQ A;  2ICK A;  2RRK A;  3I9X A;  1K26 A;  5ANW A;  1PPV A;  1PUQ A;  3ZR0 A;  3G0Q A;  1K2E A;  1MP2 A;  1V8V A;  2A8S A;  1PPW A;  3GWY A;  4JZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...