1KTCA

The structure of alpha-n-acetylgalactosaminidase
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
388
structure length
388
Chain Sequence
LENGLARTPPMGWLAWERFRCNVNCREDPRQCISEMLFMEMADRIAEDGWRELGYKYINIDDCWAAKQRDAEGRLVPDPERFPRGIKALADYVHARGLKLGIYGDLGRLTCGGYPGTTLDRVEQDAQTFAEWGVDMLKLDGCYSSGKEQAQGYPQMARALNATGRPIVYSCSWPAYQGGLPPKVNYTLLGEICNLWRNYDDIQDSWDSVLSIVDWFFTNQDVLQPFAGPGHWNDPDMLIIGNFGLSYEQSRSQMALWTIMAAPLLMSTDLRTISPSAKKILQNRLMIQINQDPLGIQGRRIIKEGSHIEVFLRPLSQAASALVFFSRRTDMPFRYTTSLAKLGFPMGAAYEVQDVYSGKIISGLKTGDNFTVIINPSGVVMWYLCPKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-N-acetylgalactosaminidase
publication title The 1.9 A structure of alpha-N-acetylgalactosaminidase: molecular basis of glycosidase deficiency diseases.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Hydrolase
total genus 140
structure length 388
sequence length 388
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2002-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1ktcA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ktcA01
3PWAA 4O18A 3KRZA 3W2LA 3M9YA 3FYPA 4JN6A 2WSQA 1QWGA 4J3SA 5CLWA 2X2HA 4CN6A 1SZGA 2FIQA 3W2KA 2GJPA 1F7BA 4UC5A 3H55A 3KVMA 1FBAA 1J4EA 4GRSA 1CXHA 5G1YA 4ORIA 2ZE0A 1UH2A 1K03A 3TIMA 5FEPA 4I7VA 1HWWA 1WDWA 3O07A 1WAUA 5CPMA 2CLLA 3N2XA 1E51A 2WVTA 4Y96A 2ZRWA 1R75A 2QCCA 4S1FA 4MY9A 3B0VC 3MBDA 3GXFA 3G18A 1PHQA 4JTFA 1KB3A 3O6DA 2YGYA 1H1ZA 1B57A 2PRHA 4Y9AA 4U4MA 1Z48A 3FA5A 1EEPA 2C1HA 3AMKA 2PWHA 1VLIA 3WY4A 5D04C 2BY1A 3KLKA 1UJPA 3LCLA 3V75A 3IJ7A 3VU2A 1PJ9A 1IZJA 5CZ0A 1NVMA 1CYGA 3GIYA 1L9WA 2VT0A 5C2XA 3TXVA 4LPCA 5D2XA 2QKFA 1SR9A 2C15A 3DBPA 2WKGA 3S5YA 4FHAA 5D32A 3WK0A 2TSYA 5FF4A 5BMWA 4JTTA 3BLPX 3PM6A 4TU1A 4QSHA 1G94A 4GQQA 1PZ2A 3KHJA 4WX2A 1XCXA 1KM4A 2QPUA 2OX1A 5HR7A 5I3IA 3PSWA 1DVJA 3R8RA 3TR2A 1WZKA 2ZZ4A 5F2MA 1U5JA 1JF6A 2DJLA 1YLVA 4EF8A 3EJSA 1EPXA 2FJKA 4P61A 1K8XA 1SMAA 1SO5A 3IIXA 4TMBA 4PA8A 2ZZ5A 2V5BA 2XVKA 1KV8A 3BLFA 4M7SA 4AIOA 2ZRVA 3IVSA 3TNOA 4X22A 1WBHA 4A3UA 1N8FA 4NNCA 5DCDA 1WX0A 4RZ5A 4AF0B 3DH7A 3N19B 3DDFA 1R2RA 4JY8A 4AEFA 3W7JA 5AHLA 1F6KA 1HTYA 1VCVA 3CV5A 1R2TA 3LBCA 3W86A 3HGRA 3TU9A 3M43A 1TTIA 4UTTA 1QCWA 3IK2A 5T26A 3C8FA 1X7FA 2JBMA 1VGAA 2D0FA 3W1QA 3VX1A 4XBKA 5GVJA 3MHFA 3P82A 2VR5A 1FWNA 2D3LA 2YA1A 4DO5A 3EXTA 1EA9C 2WANA 5AC6A 2XIIA 4XBSA 3LX9A 1FWTA 5BNKA 3UEQA 3ATZA 4NZFA 4IMEA 2ZUWA 4NXKA 4GQRA 4POCA 1KFLA 1DTUA 1F74A 4FXSA 1FUYA 1XH0A 2GQ8A 1HO4A 3C6CA 3HB9A 2HMCA 3MBFA 1X8FA 2YW3A 3CZEA 1CW2A 1KTCA 1PCWA 3RLVA 3KLLA 3GXDA 2EAWA 5LZLA 1P0KA 3M5VA 4QAIA 4X9YA 4EF9A 3LM7A 1NF0A 4O12A 4H8VA 1G6CA 2QUUA 3DFNA 4DBDA 1RQHA 2NZLA 2WNZA 2GVYA 5KINA 1LTDA 1TCDA 1GEQA 2TRSA 4NJKA 4GWEA 1H62A 2I9EA 1LWHA 1WPCA 4RLIA 3UWQA 4M6QA 5EPDA 3PB2A 4GIAA 3M7WA 3S1WA 4RXGA 4LOCA 3TTSA 3EWUA 4MY8A 3O16A 4HNVA 1KM5A 3NZ1A 1QR7A 3NVTA 4WY0B 4AXKA 3TAOA 3TUUA 3TJXA 2H8XA 1C9DA 1LBFA 4EVZA 5LNSA 2QEZA 1ZJBA 3L0NA 1ME9A 1VH7A 4FX7A 2ALDA 4OIFA 3QPZA 2Z0IA 1FQ0A 3USBA 4UFMA 3PAJA 7CGTA 3HGOA 4LWWA 1HFBA 3FKKA 4K6AA 3L66A 2OCZA 1TV7A 2FH8A 3L4TA 4PSRA 1W5PA 1BG9A 3LB0A 2QJIA 3GNDA 4UTTC 4AH7A 1DJQA 5K3VA 3M07A 3KEHA 3HGJA 2QF7A 3K8MA 2GVGA 2ZBTA 2AMGA 3DDGA 4UTJA 5BW6A 4HSNA 3W1NA 3MHGA 2NUWA 1RR2A 4CQAA 3TK7A 5A6LA 3UPBA 2ZX5A 2A7PA 2ZFAA 4FXRA 4GBUA 2BHYA 3IRDA 1QDSA 2ZXDA 2YFNA 4GUJA 1GVQA 4H3DA 4EOUA 5IBXC 2Y7FA 3TJLA 1X1OA 4RZ6A 2ZA1A 3UYCA 2YYUA 3L68A 2Y24A 4JD4A 4WXYA 1K7FA 4LC8A 5DCBA 1WZMA 4UR8A 1OFBA 4N9EA 4LVBA 2NX9A 3UXAA 4Z0SA 4IJBA 4GI8A 1B0IA 3UWUA 4RZ4A 2WCGA 1RP8A 2ZZ6A 4Q33A 1MVYA 1I2QA 3O6CA 2RHGA 3RF9A 3CWOX 1AL8A 1G4PA 4MJMA 3SR7A 2X1UA 4MKNA 4HN4A 3LI0A 2A6LA 2NLIA 2WNWA 3SJ3A 2UV8G 3PBWA 3LCFA 3VO0A 3VMPA 4O0ZA 2WVUA 3TROA 1SSGA 4OQVA 5EL1A 3GXIA 1GJWA 3DX1A 2GUYA 1F76A 4H7VA 4M6PA 3EWYA 4JX4A 1VJIA 3WENA 5K2ZA 2VFFA 4YLWA 1TJRA 5LNVA 5AHEA 1EIXA 2JKAA 5EBUA 3C2FA 3LV6A 1WOBA 3EX2A 1UKQA 2ZXBA 3F1QA 1OFDA 5FEZA 1KWKA 2VEKA 1YPIA 5KZEA 2R94A 3S9YA 3LPPA 5I3HA 2Y2WA 3N73A 4JTIA 3L4ZA 1SQ7A 4HP5A 2BLEA 4A29A 1W56A 1CGUA 5D33A 1Y7VA 1FDJA 3P8JA 4MLJA 5A8GA 4IMGA 4IOTA 3S42A 1CIUA 2FGZA 3BUBA 1VRDA 2YPIA 4FB7A 4LVAA 3TV8A 3GXTA 6CGTA 1PVNA 3EB2A 3MHUA 1IF2A 3A9IA 3W1UA 3UWYA 3CEUA 2ZUTA 5I3FA 4EIVA 4FNQA 1O5XA 4UTWA 4AW7A 3GKFA 1NEYA 2GPTA 3L2LA 3MYPA 3C4UA 3EWWA 3W1MA 4DPPA 2NWSA 5KMYA 3SGUA 3UNDA 4J9JA 1RD5A 2ISVA 1ZFJA 2F84A 3O6YX 3MUXA 4E2BA 1SUXA 3P5YA 2EAEA 2F1AA 3II1A 4FNSA 3S5OA 4GKLA 3BAYA 3NM1A 2WOQA 3WNLA 3BV4A 4JTKA 3ZSSA 3JR2A 3VNZA 3W72A 2WV8A 2J25A 2Z1KA 3DKLA 2E1DA 3F03K 4XTDA 3W7DA 3MP4A 1RP9A 4FLRA 2RKXA 3NGJA 1C8QA 4IX2A 4KWUA 3NQFA 3WJWA 1E43A 2QCNA 4RCXA 5CSSA 4N4PA 3OIXA 3NPWA 2ZUVA 4KWWA 3TC7A 1JVNA 3PS7A 2X30A 1N55A 2Z1BA 4UTIA 4OV9A 4AHPA 1ZAIA 1ZALA 4JXCA 4LY8A 3RMJA 3TH6A 4N6EA 1QPQA 2FDSA 1KCKA 1ZHAA 1UD3A 1V3LA 1VHNA 1H3GA 3B0PA 2D2OA 4A2SA 5EMUA 3HZ3A 2A4AA 2JKEA 2OW6A 1HG3A 4JCMA 2A7NA 3F4WA 4QNWA 3A4AA 1SPQA 2Y5EA 4HHPA 5CZSA 5CZTA 4GUIA 4UTHA 4GC4A 4MPQA 3A6OA 4LT9A 1ME7A 4Q4KA 5AYXA 3OG3A 1XBYA 4J28A 4NVTA 3DI1A 2WVVA 3BC9A 1K3UA 2WSYA 3HPZA 1QW8A 2BXYA 2CLMA 3SY5A 5G4WA 4AHQA 3F4NA 2Y89A 4YL2A 2FHCA 5HWJA 4I7UA 5LHFA 3FFSA 2NUXA 1HL2A 1WZAA 4UTWC 1G4EA 5DELA 1G4TA 4E2DA 3O8AA 1LYXA 5KSWA 1MFUA 1DHPA 3R89A 4MIMA 4LV9A 5AOUA 1JI2A 5U4NA 2TMDA 3CB8A 1KV5A 3HJZA 3A23A 3PC0A 3L5MA 4H8UA 2BY3A 3TONA 2JGQA 1LOQA 4UFKA 2OJPA 2QAPA 4QISA 3IJ8A 1L6WA 5LHEA 4MYXA 3CZLA 3K1DA 3SGZA 3UY8A 3VM7A 1H7NA 1TPDA 3W9ZA 2ZX8A 4N9BA 1O60A 1XD1A 1T96A 5I5RA 1IIHA 1JXJA 1CPUA 1FCUA 3LHWA 3NQEA 4MZ8A 4O13A 1S46A 4FO4A 4W9TA 1S3HA 1EA0A 1XUUA 2B4GA 4HNNA 4JTLA 1F2JA 3C3NA 3FOKA 3GDKA 1X6UA 1BKSA 1JCJA 3M16A 1W5MA 2FH6A 3AO0A 2JGYA 1UUOA 2VKZG 2BHUA 2CXGA 1QPOA 3DFOA 2QMJA 3G3MA 1D9EA 1H7XA 3M6YA 3BVTA 3ZR5A 4MZYA 4WXZA 1R46A 5F2GA 3QW4B 2YIHA 3ABRA 4Z1AA 1LORA 4FIQA 2OW7A 2WPBA 2A85A 3BVJA 1ZAJA 4AVFA 4ZQPA 2A2IA 3PULA 4BK9A 2EKCA 2J88A 1ICPA 5CSRA 1LOSA 1OT1A 1V3KA 1NM9A 4TVUA 1P0NA 1WBJA 5HUOA 3AXIA 1WO2A 1NFBA 1TPFA 3NPUA 1YDOA 2EPHA 3LCIA 3B0UX 3HJEA 3OLEA 1TYGA 3LOTA 1ICQA 1UD4A 2JKPA 3GYEA 1JCXA 4N6FA 4HNTA 1CGXA 2DORA 5EYWA 4CLMA 3LTSA 1VYPX 2DIEA 3GDRA 4ZQRA 2IGTA 3UCQA 4X0NA 5F2IA 4NNBA 3O63A 5HDRA 2OYLA 3IJ9A 2RDWA 3T4CA 3GLCA 2R91A 3EJRA 1EP3A 2O7QA 4O17A 3W1LA 3G0UA 1TQVA 1IZKA 1Q45A 2FQIA 2YR1A 4AEEA 4DEFA 4PFMA 1IXPA 3L2MA 3UWVA 3DU0A 1MSSA 5LNUA 3LRMA 5KITA 3CZNA 4HPJA 3INPA 3N9RA 1I2OA 2DZXA 4MLRA 1OF8A 3OVPA 2ZWZA 2C3ZA 1ICSA 3LBMA 5FEWA 1HL8A 4IWWA 1XCWA 3WFAA 3KVLA 1KBIA 1IXQA 4J3UA 3BAJA 4H8HA 1UCWA 1PIFA 3L5LA 1JGIA 3LERA 3W7PA 4PH6A 5J5DA 4HOXA 1QPRA 3EX3A 1LLWA 1LP6A 4JTHA 3WEMA 2CLKA 3VX0A 2AGKA 2ZTKA 5CPNA 3EWZA 2EJ1A 4TR9A 3DX0A 2WSPA 3BH4A 1B3OA 2YW4A 4JX6A 4IMCA 3W85A 2W79A 3IIOA 3ZT6A 3BPWA 5D03A 2VNCA 4UQBA 3NA8A 1JAEA 5H91A 3FEMA 1UOKA 2ATSA 3STEA 3THQA 2AQWA 4LTSA 2PURA 3TXZA 4DPQA 2WC7A 2ZRYA 4JGDA 5BMXA 1XBXA 3BG5A 5TQLA 4BZYA 3TMLA 3QZEA 3KL5A 1DL3A 1R47A 3MI3A 5K4XA 1YTDA 5AC8A 2DH3A 2ALWA 3LHVA 1GWJA 3EJTA 3CLMA 1I2RA 1KXVA 2D3NA 5L6UA 4GUFA 2X16A 5CGQA 2ZWYA 3W83A 1QOQA 7TAAA 3VE7A 5I24A 5A6MA 4XQ6A 1SO3A 2WPGA 2NUYA 3NL6A 1G1YA 1H60A 2ZRXA 4M8UA 3W2MA 4RX0A 3VKJA 2GVLA 1F05A 2ZRUA 1PS9A 2J9XA 3IGXA 4AMXA 4GUHA 4LUIA 3QMRA 2Y7DA 3PBYA 2AAAA 3BO9A 3LHUA 4LRTA 3W7CA 4C1KA 2QPSA 4UXDA 3M47A 4O19A 3IIPA 4J3TA 3GKAA 4K36A 2B7QA 3O15A 3BK0A 3G0SA 3TSMA 1GVFA 1ZY9A 4QQ3A 3KRSA 4IQLA 4AWSA 1U83A 4O52A 3BLEA 5E0KA 4R34A 1YADA 2V30A 2E68A 2A1YA 2X1TA 3C2RA 1YTKA 1DKWA 4H2CA 4ZQMA 5D2VA 2YCEA 4JYDA 4JIPA 4UTUA 1UH3A 4J3WA 1VC4A 3W1TA 2CHNA 4XKYB 2Y70A 3VGHA 3B05A 4O57A 1XUZA 2OSXA 2XIBA 2C14A 3SIZA 2VFHA 5HQEA 1FXQA 3ANYA 1G9HA 2DP3A 4CN1A 1FY6A 1D3CA 4TIMA 2RDTA 1BF2A 2EGZA 2PWFA 1A53A 1JQXA 3EXSA 3W7GA 5F7UA 1KCLA 4FNUA 1J0KA 1J0IA 1L2UA 1TQXA 2G3MA 2G96A 3R2GA 3LCWA 1JIBA 4U28A 4UIOA 4UFIA 3WJSA 4Z1BA 1PS3A 1J5TA 2OYKA 2EABA 3LXAA 2C6QA 3BSGA 3A5FA 1XSIA 1WQ5A 2C16A 3QMSA 2QCHA 3BW2A 4AF0A 5CXPA 2ZZ2A 5CPOA 2J6XA 1J2WA 4YWIA 3ZSTA 3BMWA 4K8HA 2PWEA 1W5NA 5D09A 2ZXAA 1XV8A 1D3GA 2J24A 1ZJAA 4CCDA 2PC4A 3C2EA 2FHBA 1MW1A 2DJXA 2V0TA 2CLEA 1TMHA 3M5ZA 3W7HA 2VXNA 4DF0A 4OBTA 1FXPA 1ME8A 3MMTA 5IBXA 3CEPA 1RV8A 1DJNA 1V5XA 2E5BA 3IIVA 4YMZA 4AWTA 5E1QA 1QI3A 1P6WA 2ZA3A 3E96A 3TFCA 1BSIA 3KVKA 2VFDA 3G1AA 1FDYA 3S5NA 2VOMA 2XWDA 1ZAHA 1PIIA 2A0NA 2TAAA 2ZQ0A 5KTLA 3IGUA 1OK6A 1G4SA 4DXVA 1IGSA 4UFLA 3B06A 4PCFA 4AIEA 4JDYA 1T8XA 2YSWA 4UCFA 4M19A 3BLKA 3BUIA 3CQ0A 2LLEA 3BUPA 4JFTA 4J3VA 2Y61A 1GYNA 4NUWA 1AVAA 4LVDA 4L4MA 3KL3A 3D52A 1JRBA 3BW4A 4FLOA 1IXNA 4N9DA 1PV8A 2QDHA 3G0XA 3EKLA 5CLTA 3LCXA 4I9AA 3VSTA 2GVJA 4B9YA 1K8ZA 1P1XA 4O4WA 2G5WA 1FDZA 4WSJA 2QUTA 3LI1A 3OLDA 4ATWA 2QR6A 3ZWTA 2TYSA 2CZFA 1ZS2A 4ORMA 3ZOAA 2CPUA 4HT3A 3DAQA 1LWJA 1A5CA 3HIJA 3MJYA 1V7YA 2VEMA 3LDVA 3WY1A 2QJGA 1UBSA 5FEXA 3L4UA 1ZNNA 3TOPA 2W6RA 4WUIA 3E9AA 2I1OA 4WY0A 1VAHA 3A22A 1W37A 1JI1A 3GAYA 4WF7A 3THAA 5C5YA 5I23A 2E9BA 4MY1A 3TX9A 1P4CA 5AYYA 3ZT5A 5DBUA 2NWRA 3L0GA 1OFOA 2VRQA 4A21A 1TMQA 2G97A 2E4TA 5F4WA 1EH9A 4D2JA 1PPIA 2XWEA 1GCYA 3P74A 1L6YA 4WJEA 1JULA 4UTKA 3TTYA 4AYGA 3B4UA 1KXQA 3N9SA 3CIWA 4IPJA 1H50A 1JD9A 4UMCA 2PRLA 4AWUA 4ADTA 1VPXA 4HOZA 3TFXA 4PODA 5D2WA 4JEQA 4LUJA 1R34A 4XUGA 5EY5A 3KVJA 3EDDA 2Q3RA 1OFPA 3QQ1A 3HMJG 3W3OA 2B7OA 3TSDA 2FYVA 3PSVA 2XN1A 5AHIA 3UXDA 3W2NA 2FTPA 3HF3A 4UFJA 4Z08A 4PL2A 1KFKA 2R14A 3VGGA 1THFD 1PEZA 1QO5A 2WSRA 3HG5A 1KLYA 4YXGA 3NPXA 3Q37A 3W37A 3OLIA 2Y85A 1WYIA 3M44A 3IIZA 5AB3A 1KA9F 3VFLA 3VI2A 2IQTA 2YFOA 2BY0A 1GG0A 3W7QA 4WOQA 1SZNA 1KGUA 5MHBA 2RDUA 3O1NA 1OSEA 5A2AA 3KX6A 4OKDA 5EKYA 1RVGA 2ZUSA 1OABA 1LROA 1WP6A 2ZX6A 3EKZA 3CWNA 2V81A 3R5EA 1VYRA 4JDBA 1OHLA 3V1PA 2DU2A 2NT1A 5L9FA 3WK3A 3G1SA 4N9CA 3PG9A 3G1HA 2YA2A 2D0GA 4U2YA 1G7UA 1FWWA 2X2JA 3GR8A 1JUEA 1KBBA 1LLZA 2Y62A 3N14A 1LCOA 2VC6A 3D50A 1OK4A 1QX1A 4JFUA 4RK8A 4ALDA 1RQBA 3VCRA 2BX7A 4K39A 3S5ZA 2BTMA 4PCSA 4GJ1A 3TMQA 3HG3A 3BARA 3W7OA 3LHYA 5DXXA 1KTNA 3A21A 4TX9A 1JFHA 3WJYA 1DQXA 5FF3A 2CLIA 1Z32X 2V82A 3CPUA 3VGBA 2ZZ1A 3LLFA 5HULA 3WJXA 4ZQOA 3BUDA 3IVTA 5G2HA 3W7LA 1VLWA 1QNVA 1XDLA 1LZOA 2ZTJA 4LS0A 2ABBA 4FLQA 4O8RA 3W1PA 1W9XA 3BMVA 1QO2A 4O11A 2A6NA 3WNKA 4WQ6A 1SSDA 4P2VA 3CHVA 3QPYA 3L5AA 4UTMA 4UNIA 3DENA 3N34A 1S5TA 1JF5A 1O4UA 2CWNA 1E40A 2QCDB 2WQPA 1YDNA 1Y0EA 3K8KA 1GTHA 1TTQA 3NQDA 1T99A 1XC4A 4LQ1A 3UWZA 1WE5A 1ML1A 1Q6OA 1BVZA 1ALDA 1SW3A 5DY3A 3RILA 3GNNA 1JJKA 3W7RA 2GJNA 3BG3A 1J0HA 3IV3A 4UQAA 3UZ5A 3SI9A 2ZUUA 3I7RA 4MVAA 4O1CA 3GVGA 3L65A 1UB3A 1CI1A 5LNRA 4JTGA 5KZDA 1H1YA 1DBTA 1OJXA 5ABTA 4HIBA 4LXFA 4TMCA 1MZHA 4OE7A 3OA3A 4HA1A 4ADSA 3IGSA 1OVDA 1PL9A 4N4QA 1JCMP 3UQNA 2WNQA 4FEZA 1VQTA 1QW9A 3G1YA 3KAOA 2E6DA 3T78A 3FAXA 1W1ZA 4BI7A 4IX0A 4CNNA 4ZMGA 1UKTA 1CXFA 3CC1A 1HXKA 3FAWA 2CZEA 3G24A 1Q4NX 4K8EA 6TIMA 5CGMA 3NQCA 3E49A 3NL3A 3I7QA 2PRMA 3G22A 3W2UA 1UD5A 4U2ZA 2BWGA 2X2GA 2EADA 1FCQA 3GXMA 1M7PA 1Q6QA 4DF1A 1FWRA 4GI9A 5BRPA 3QGVA 1TV8A 3WFZA 3P5ZA 1BEUA 4E0CA 4OU1A 4NJJA 1TJPA 1JG9A 1OX4B 5TD4A 1CXIA 4JICA 1GOXA 2DH2A 1DEDA 3QRHA 1H61A 4FNTA 2WKLA 4WZHA 3W7EA 3TQ0A 2Y7EA 4BI5A 1D3HA 2VEIA 3EXRA 1TTJA 4B5NA 3LXBA 3FKRA 1B4EA 1GVRA 3EDEA 1JUKA 5J5RA 1JDCA 3CZGA 4JY9A 3LCHA 3TE9A 2FPTA 1KBJA 1UASA 2OZ0A 2FE0A 3HPSA 3NAVA 3PUDA 1MXSA 1W5OA 2G3NA 3HO8A 5A5WA 1KFCA 3RU6A 4HOWA 2VFEA 4O28A 1W3NA 2WKJA 3HG2A 3W7NA 3U2OA 5HINA 3PUOA 1DQWA 3C2VA 3T7VA 5AHFA 3G8RA 4LV4A 2E0PA 3GAKA 1LRQA 5E0FA 3M5YA 2BXVA 1LBMA 4OHQA 1NF7A 1SW0A 5BRQA 3LPOA 3NO5A 3W2JA 2ZX7A 1CGVA 4JFVA 1YXDA 1R33A 1TV5A 4NX0A 3MI6A 2CLOA 2R8WA 1MEIA 2P0OA 3CIXA 2EF9A 4OT7A 3LLDA 1GJUA 4MJZA 3L4YA 1PIGA 2X1RA 3MW7A 4RJEA 1TQJA 2NX3A 1UA7A 2F7PA 3UPWA 3W22A 2QCFA 3JRKA 4E2OA 4QIUA 2ZIDA 3C2OA 3P80A 2VFIA 5AYZA 2B7NA 3UD6A 1CXEA 3BAWA 1KLZA 2V2HA 5AFDA 1G69A 1WXJA 3PVFA 4ZQCA 4O1DA 1UKSA 5I3KA 4A2RA 3ZR6A 2E8ZA 3ECQA 3VM5A 4HPHA 4WLCA 1MWOA 4UQCA 3NXFA 4FMVA 5E70A 1PZ3A 3MWAA 3TSBA 2CLHA 1TPB1 5FI8A 4UQ9A 3EWXA 4U3CA 3UG5A 3VSUA 1FCVA 2V2DA 1U30A 4K7VA 1AK5A 5G4EA 1JCYA 3BW3A 3WNNA 2ZICA 2NV1A 3GTNA 1H7PA 1KM0A 3IEBA 2V3FA 3A5VA 4HNUA 2NV2A 2WSKA 3DFSA 2GQ9A 4N02A 1N7KA 4MZ1A 5TIMA 4QAWA 1JRCA 2E5CA 1TRIA 1VFMA 2QDGA 5AHNA 1TQWA 1F73A 3STCA 3D51A 1XH2A 3LV5A 4MFEA 1OFAA 2PWDA 2QCEA 5C6MA 3RLUA 2V3DA 4E38A 1QPNA 3IVUA 1MXGA 4DELA 4HSOA 3T44A 3OEXA 4JTJA 4O10A 5LKYA 3WK2A 7TIMA 1L6SA 3GXPA 4LU0A 5LNWA 4Z1DA 3VNDA 3LRKA 2FLIA 4GUGA 4MUZA 2E6YA 2C19A 3RNDA 2P10A 4LC6A 3W1XA 3S1VA 4JL2A 3QYQA 1YTEA 4R53A 4JTSA 1MW2A 4DO4A 1S5VA 4K38A 3B8DA 1CGYA 4AEOA 3Q94A 3R12A 2CZ5A 2ISWA 5HUPA 4UZSA 1CGTA 1JD7A 2DZUA 1RPKA 4BF9A 3BSHA 5E6YA 3W1RA 2WNNA 3T55A 1EO7A 1AW5A 4JYFA 5D37A 4S2BA 2E6AA 1CDGA 3NM3A 3NL5A 5AN7A 2KZHA 5FF0A 4MYAA 1MW0A 1AQHA 3TW7A 3VNYA 2YX0A 2YKKA 2PE4A 4HPXA 4BWLA 3D0CA 3L4VA 1HT6A 3QF0A 3H53A 4PC8A 4UFHA 3CT7A 3W1AA 1W54A 1LBLA 1QI5A 3DX4A 1HUVA 4KFPA 3QSTA 5EA9A 1HX0A 4UOQA 3W75A 5F4XA 3WDIA 3ZT7A 3QFEA 2ZX9A 3AJ7A 1KM6A 1TREA 4AAJA 3PY2A 5HWMA 3CTLA 1TQTA 1QOPA 3D4YA 1VFOA 2TPSA 3E12A 2QLYA 3HOJA 3M1ZA 2V5LA 3LGEA 4JTEA 2XN2A 1FCBA 2ZA2A 3BAKA 4UNLA 4AHOA 2VUYA 5C55A 1IV8A 1XCFA 4FIRA 5DLCA 1TPC1 5H2ZA 1ZENA 2QCGA 3TA6A 3S0CA 5F2LA 4BR1A 3OHIA 1IXOA 3HGSA 3NYZA 1AQMA 3QC3A 3DHUA 2O7SA 1GJPA 4UQEA 3FJLA 4DO6A 1A5BA 1M53A 5LGZA 1L0PA 3W23A 2H3DA 3OBKA 4PEKA 4RXFA 4QNEA 1XSJA 3E0IA 4G1KA 2QUVA 1XSKA 1H7RA 2ZXQA 2X1SA 3WY3A 3DI0A 2V8ZA 1BAGA 4Y6GA 1TQSA 3M0ZA 1EB3A 5BRBA 2BSLA 4YCOA 4JCLA 3QH2A 3WEOA 1LM1A 3W76A 3YPIA 5CKSA 4AB4A 1DHKA 1NOFA 3NQMA 2C7FA 3WMSA 4JX5A 1QWNA 1OFQA 2XVLA 3QM3A 3QEZA 1JCLA 2OSYA 1LOLA 3TAKA 2E09A 3BVUA 2NXGA 1AMKA 1XI3A 4UQDA 1Q6LA 3PBUA 3A47A 2Q8ZA 3STFA 5E93A 4B9ZA 4LVFA 1C8VA 2HS6A 1RPXA 4BWLC 1RZMA 3P67A 4JR5A 5G1TA 1GVIA 1I2NA 1SO4A 1YXCA 1MEWA 8CGTA 4O0KA 4C1LA 2NSXA 1GTEA 4XKYA 1C29A 1AW1A 4J7RA 3BGGA 1PHWA 3CLWA 2V2CA 1GT8A 3MYOA 4UMAA 4PSPA 2HSAA 1KBKA 4DBEA 1XD0A 2RH9A 3M41A 3W88A 1Q6RA 4OWGA 1OFRA 2EO7A 2F61A 3M5XA 4O54A 1H5YA 1UA3A 1VFUA 4UMBA 1KM3A 1VHCA 1I4NA 1P5BA 2F18A 4LVGA 1V3JA 3NQ6A 5G2WA 4JL1A 4H4IA 2GQAA 2WJZA 1SW7A 3NZRA 4HKPA 3BVWA 4WD0A 3EDFA 4GE8A 4CN4A 1OYBA 1O5KA 4U31A 1KFBA 3L0KA 1QHOA 4I7WA 5C54A 3S1UA 3L4WA 1YPFA 1EP2A 5F4SA 1KXTA 3EJUA 3KE0A 5HR6A 1SZEA 3C0JA 5HNRA 3LXCA 1EP1A 3I6RA 3TC6A 5CPLA 1SZFA 1CX9A 3DFQA 3LTYA 3ABOA 4XZ9A 3OVRA 3HQ1A 2C8NA 3UERA 3STGA 5KZMA 3QMTA 4ADUA 3GX9A 4NQ1A 2GOUA 1NSJA 3MP3A 3WDJA 4LS1A 2QJHA 2XFWA 2H6RA 1QHPA 4FX8A 3GBDA 2Y6ZA 2YDAA 3W71A 1NAL1 1CGWA 3K30A 2VEPA 2XN0A 1E3XA 3NQ2A 1OG0A 2DZWA 3L4XA 2OT0A 3GK0A 4R33A 3HPXA 4IGHA 1WOAA 4MOZA 1I2PA 2VENA 1GQNA 3DX3A 1XL9A 2ZDRA 3KOFA 1JL8A 2D0HA 4CVWA 4NZJA 1KFEA 4Z1CA 5D2TA 1W3TA 2A7RA 2DZSA 2NXIA 5HWNA 1HL9A 1KWGA 2J9ZA 5FF2A 5TBOA 3S6DA 3NG3A 3BGJA 4FNRA 3WNPA 3BLIA 5DO8A 3FIGA 5K9XA 3GBEA 5E9AA 3W7MA 5F1UA 3RIKA 3KRUA 2YJQA 3BG9A 3W07A 1TIMA 2CLFA 3W6YA 4FF7A 8TIMA 3B04A 4EWND 1RQEA 1UUMA 1H63A 3P8IA 2HTMA 1TPWA 4JYEA 1SMDA 2C0AA 1HTIA 4OV4A 1GG1A 3W7KA 3LCGA 3P62A 3P60A 3NQVA 4PCTA 1MXDA 1GYLA 3ZS4A 4ICNA 3HBLA 1KFJA 1WA3A 1BLIA 5HMSA 4BFAA 5HPOA 1G5AA 4TO8A 4K37A 4PEEA 1JDAA 1TCMA 1HVXA 2DZVA 1TB3A 3ELFA 5CZJA 4KFOA 4Q32A 3QW3A 5K7JA 4ZVJA 5E6ZA 1SFJA 4Y8FA 1TPUA 1MO0A 3VGDA 4JNMA 3WY2A 1DV7A 1VR6A 2B7PA 3CM4A 3L9CA 1ADOA 5IM51 4KKXA 2Q8LA 4IXXA 3GXNA 4BA0A 3KXQA 1GZGA 2J27A 2Y4SA 4ONVA 4QM1A 3H54A 3N2MA 4LRSA 1D7FA 3UG4A 4QITA 1JCNA 3FLUA 3DKJA 1KGWA 1XFBA 1JXKA 3G1DA 3KL0A 2EHHA 2NX1A 4K7YA 1QPKA 2ZYFA 5LSMA 1Z41A 2Q3OA 1JR1A 4CNPA 4UCGA 1KXHA 3CPRA 1UD8A 2OYMA 3P84A 4FX6M 3CZKA 3PR2A 2JK2A 3C52A 3PG8A 2D73A 2BHZA 1VJSA 3VGEA 3NDOA 4LW7A 5AHMA 2EACA 3A24A 2FPVA 3NQ7A 4NT0A 4RKAA 1EUAA 4NXSA 5D2YA 4GO9A 2QCMA 3LHTA 1GVSA 4JIQA 2DZTA 1B4KA 3EEGA 1OYCA 1XBVA 4IMFA 5I3JA 2H3BA 5A2CA 3OVQA 1OF6A 2XVGA 4MB1A 4UOZA 3PBVA 2E8YA 1KM2A 1XDMA 4H6KA 2EEXA 3NEVA 3ZO9A 2F7RA 1KM1A 2ABAA 2A21A 1F5ZA 1XGZA 1MFVA 1O7DC 1OYAA 3C56A 1MEHA 2ATMA 3TDFA 1QAPA 1TSIA 2A5HA 2F1BA 2V3EA 4CQ8A 5G5IA 2RFGA 2ZRZA 3UWWA 2J9YA 5KEZA 2YYTA 1VS1A 4YCPA 1GVOA 5F1VA 3AXHA 4W93A 3ZR4A 3P7YA 1I8JA 3NQAA 2YZRA 4KMQA 3Q2DA 1G7VA 1OX6A 2OMAA 2NXHA 3AJXA 3LTPA 1AG1O 3CU2A 1OB0A 4M7TA 3ZQ9A 1EWEA 1DORA 1G67A 1CXKA 1VCGA 3LHZA 1B9BA 3U6WA 3DC0A 1BVNP 2GUUA 1M5WA 2E6FA 5DY2A 4OJYA 1A50A 2QV4A 2Y88A 1VB9A 3LRLA 1R30A 2QCDA 3BCFA 3RFAA 4JFWA 4MFDA 4IUOA 4M6VA 5CGTA 4GINA 1TPEA 5K9CA 4CGTA 4CQ9A 1YDVA 2FPYA 1KTBA 4AMAA 3MP5A 2QCLA 3SZ8A 2CZDA 5DBTA 3UG3A 1O94A 2F7FA 3W87A 1A5SA 3S8HA 1CXLA 3BUQA 3O06A 3K8LA 3VMNA 1U33A 3ABSA 5DCEA 2NT0A 1SU5A 4O50A 4RV8A 9CGTA 4XB3A 1W0MA 3ZWSA 3UY7A 2OT1A 3BCDA 4UR7A 5K4ZA 4UNKA 4FNPA 3EX1A 1A47A 5I3GA 3DX2A 1M6JA 1J0JA 3EJQA 3UZJA 3OLGA 3NQGA 2Z6IA 1AMYA 3GDMA 3MI2A 1M7XA 4X9SA 3EX4A 3GDLA 4WY0F 1PCKA 2F7OA 1FWSA 3JS3A 3SECA 4R7JA 3BVXA 3WK1A 3VGFA 4M5PA 4ZL1A 1XH1A 2WO5A 4XWUA 2OSWA 4M56A 4NX5A 2E5DA 3EDKA 4N2YA 4AMWA 4CCCA 1GPWA 4NU7A 5I0DA 1OX4A 2V9DA 3G8EA 4PL1A 3P81A 3KWXA 1JQVA 1B2YA 2X2IA 3C61A 3GDTA 3W70A 1TPVA 1ODUA 3WN6A 4J27A 2QMKA 1EWDA 1ZJIA 3GZ3A 1WZLA 5AC7A 3G3DA 1BTMA 1JUBA 3PUEA 2WVVB 3NR0A 3S2CA 4L4LA 1OT2A 1YYAA 3DHFA 1UD6A 4O4VA 1AW2A 1K7XA 2I14A 4NJIA 1IIGA 1V3MA 2E77A 3DFPA 3ATYA 4JFSA 5K9DA 2YA0A 4IPIA 3QQ0A 2DZPA 3W84A 5G2IA 3ZFHA 4NI3A 1XBZA 1F6PA 3G1XA 4CKQA 4GFSA 1DOSA 2W0UA 1TTPA 4ZQNA 1ONRA 1Z42A 2C13A 4IXHA 3BAIA 2CFFA 1HO1A 4S2CA 1XM3A 3L2IA 1M7OA 2Z2UA 1Z44A 3P61A 6ALDA 1W8SA 3TQVA 2BXZA 4GO8A 4GI6A 4XTIA 4BI6A 3WELA 2WVSA 1I45A 1VYSX 3N3MA 1A5AA 2BZNA 4OGZA 2DIJA 1H7WA 3FS2A 1KGXA 3D4ZA 4WSKA 3W38A 3PB0A 1QFEA 3QSRA 2FB2A 5FF7A 3WJZA 3VMOA 1OFEA 3RK8A 1I75A 4A22A 3AMLA 2Z6JA 1PAMA 3DHDA 3O05A 2HS8A 4Y90A 3DFTA 4WOZA 1BWLA 4Z0JA 1O95A 3S1XA 2FHFA 5U7SA 3TCEA 1PE1A 2AAMA 3BAXA 3DGRA 4NJHA 4O1AA 3W7IA 5HXMA 3W73A 4DQWA 3GR7A 3DXIA 4NNAA 1WV2A 1CLVA 1K8YA 3EWBX 3I7SA 5D38A 2ISSA 3T40A 5D30A 4X3ZA 5DFAA 6TAAA 4O53A 3TKFA 1K7EA 1TRDA 1QI4A 2G95A 1H7OA 1VCFA 1OX5A 3NL2A 5DXYA 4JS3A 1VZWA 1H51A 1UD2A 4J3XA 2QAFA 2P1FA 2VFGA 3E02A 2F2HA 4X2RA 4O14A 2EQDA 4U33A 3EJPA 3EDJA 1Q3NA 3CTTA 1LRTA 3TW6A 2YOCA 1BWKA 2B0MA 5D05A 5D02A 4O16A 1W3IA 3TQKA 1ZCOA 1TPH1 3R13A 4GNJA 4GXMA 4LS2A 1AL7A 2CU0A 4CNOA 2PCQA 4FLSA 2VRKA 2FB3A 4O15A 1TQUA 3BLBA 4MAZA 5EMYA 1R2SA 2C18A 3FJ6A 4LNYA 4DF2A 1EX5A 2FFCA 1YXYA 1BPLB 4ZZ9A 2GJLA 3CGTA 4UTLA 1XXXA 3HG4A 5A2BA 4UZUA 4AYSA 1EUNA 5BOOA 1SFLA 1U2YA 3EX6A 3U8GA 2H90A 3DHPA 5CG7A 2H8ZA 3KFTA 2Y7GA 4NJGA 3FW6A 1S5WA 4IMDA 1JDDA 4ML9A 2BY2A 3NPVA 1E3ZA 1KW1A 1LRNA 3L21A 4O1BA 3SSJA 3GB6A 1QMLA 1FX6A 3DZ1A 3G1VA 2GJRA 5SWUA 3MO7A 3B03A 3WNOA 2PWGA 3G1FA 4PTNA 1SO6A 3W74A 3I68A 3NNTA 3CZSA 3VSVA 1K02A 2VELA 2CW6A 1XKYA 1TO3A 4KWVA 1QWUA 3QJAA 1T0OA 2Y63A 3L67A 1HNYA 2F7QA 2WCSA 3BVVA 1VIWA 4CCEA 1MW3A 4KFNA 1LDCA 3I65A 1X1ZA 3FYOA 5DN1A 3VE9A 5FESA 1EO5A 3NQ8A 2ZCGA 3ABQA 3Q58A 1OGSA 1W5QA 3PF3A 1UH4A 3WDHA 1EHAA 4QJ1A 3SW6A 5LGXA 3SFKA 2ZZ7A 1W31A 2ZZ3A 4JTUA 3WNMA 3NOEA 4UUIA 5HJLA 4RR4A 2YXGA
chains in the Genus database with same CATH superfamily
4LLMA 5CU5A 1QWGA 2FUTA 2FT6A 3W2KA 3LZQA 2JCCF 2CRIA 3OKLB 1W1TA 2ZWSA 1MRCL 3B0VC 5FKAA 3QJFA 3QIWC 5LCVL 3QHFL 3NCXA 1A3QA 2PWHA 4IIQA 4RMVA 1NCDH 1UJPA 1U3HC 4BDVB 1TZGH 2ZJSL 2LHAA 2ESCA 4PJHE 4JTTA 4AZ8A 2XCMC 4U05A 4PCNA 2ISFA 1WZKA 2ZZ4A 3WIAA 1RSYA 4DP5X 1EPXA 5I8CA 1K8XA 1SO5A 2G9HB 2WXFA 2CRYA 5AB9A 4N1EA 1YNYA 2RR3A 5JXAH 3P54A 2BK8A 1OF0A 1X7FA 2A1WL 5C0DB 1G6RH 4URIA 3H0TA 1S2TA 3MHFA 1EA9C 4U10A 4LSSH 4X2PA 3C87A 4XAYA 1MHPL 3N2OA 1QNRA 4JTDA 4POCA 3CXHK 1NCBH 1F74A 2EE3A 3X1GA 1CBGA 1OIMA 2HMCA 1ZGLM 2D2CC 2AL2A 3QWQB 5J6HA 3BVNA 2OZ4H 2QUUA 2FBJL 2J5LC 3RFZA 1TCDA 4I6KA 1S9YB 2ITFA 3QCUH 2YPVA 4HHHA 1UC5A 4GWEA 1H62A 2GIXA 2OK0L 3CD4A 3NSFA 3IJHA 4X8GA 2R8SL 3LKRB 1C9DA 4L7ZA 1NCWH 2IADB 3X3FL 5FUZL 3F85A 4ODXA 4ERSH 4TUJA 1EEYA 3DI2B 2O5YH 1B6DA 1BAWA 3T4AA 4HSNA 1HJVA 1T7ZA 2ZADA 3V0DA 2F38A 3NCJH 5HVWA 1GVQA 1QVOA 5IBXC 5I1LB 3VIPA 3BSZH 4ODVL 4HKBB 4KF1A 4KW2A 5FECB 1LXMA 2B1OA 4DEWA 4NO5B 5E1IA 2DIKA 5C0AE 4HK3N 1G4PA 2QUNA 4HN4A 3HS9A 3VZZA 2WNWA 4WJKB 4BF7A 2XSAA 2ICEB 3APNA 2DD8L 3MUHL 1Y1DA 3WIFA 4Y16B 5L6YL 1GW0A 1OWQA 1LGVA 1N64H 2IG2H 5FYKU 4DVRL 3ESUF 3SE9H 1QU4A 1WUEA 3EA2A 4AUYA 3WIHL 4X7DC 5FV1L 4M4RA 4AQ8C 1VPQA 3CUZA 1PTZA 2XV6B 5KBKA 1SFSA 3F1QA 3WXVL 1KWKA 1BQLH 3HAEB 5CD3B 2R4SL 1R3IH 4G5ZL 3ZTNL 1R9YA 4OTKA 4A29A 5D33A 3SE4A 4XWOD 5EU4B 4WKZA 1A7RL 1O5XA 3LS5L 4AGQA 4Q6XA 4UAOB 4M03A 2XGBA 4QXGL 1EQCA 3CSTA 2F84A 1T7YA 2C79A 4GKLA 1E4WH 5BV7B 4HU0A 4E68A 4MDIB 2Z1KA 3DKLA 4PJAE 1TTAA 1GGIL 2AJYH 4XVEA 4WWOA 3RIAF 3TC7A 2BS8A 1KV3A 3KWSA 3SE8H 1N55A 3RMJA 4N6EA 4ODSL 2VGLM 4ABWA 3S2MA 2Z1SA 3B0PA 1YPZF 1B30A 3AS2A 1D2PA 2DQJH 3U82B 2CRMA 3QC0A 4GUIA 4AYID 2P3ZA 1ME7A 2H2SC 4DAGH 3FHAA 3ZVVA 1K3UA 3RO6A 1T6MA 3SY5A 5C07D 5DMKB 1Q0YH 4LNRA 2WLZA 1G4EA 4US6A 4PTTB 1EAJA 1A1MA 1JI2A 1PX3A 2TMDA 2GT9B 4XX5A 2OO6A 1EF3A 4HWZB 1WQVT 3KPNA 2XTJB 3CU1A 5A8MA 1H7NA 1G5GA 4N6RB 1MCHA 4OLUL 1CPUA 3TM6A 1XICA 3RNKA 3W01A 1XUUA 1X6UA 2D2HA 2MOVA 5HYJB 4ZW5A 5DHYB 2GI0A 1NKOA 2DLEA 3URNA 1A4MA 5GGVL 1EK3A 4DGYH 1JN6A 3TN5A 3F4DA 3ESNA 4NSKA 4TVUA 3GGWA 4X4ZA 4ZQKA 1GVYA 4HXAH 3MBED 3HJEA 3UTTB 5I30H 2P24A 3DX7A 5B3JF 1ZBVA 2PO6D 4YDNA 1K8DA 2VJ0A 4CC0A 2PLKA 4PBGA 4IKNA 5H6HA 3QDMD 4L9YA 4OF6A 2IANB 4E41A 3BP4A 5EC2B 3DU0A 4ZR8A 3UTOA 1T83A 2C3ZA 3TJEL 3OKDA 15C8H 1MCRA 3TURA 3MLWL 1HS6A 4R6UA 2JWYA 3DUSA 4OZGE 4JREB 4ZXBA 7ODCA 1DLHB 3KTCA 5D03A 2XNAB 3VFRA 1U21A 3LLXA 3IJEB 3C5SA 3STEA 4JPSA 1RXLA 4WY7H 3UG8A 4N2EA 3UZEC 4JGDA 2GW5A 4GYFA 3BVDB 2RGMA 4ABQA 5I73C 1A7NH 3X17A 3GSXA 4J39A 2FFIA 2A3HA 4R7DA 2XWBA 3CMOH 3PWPA 1A49A 4U6VL 2UWEA 4AMXA 4GUHA 2FEDC 4LRTA 4UXDA 1O0VA 1I6NA 2YPLA 3U0TA 3GSNL 3O2VL 3NGBB 3MGOA 2IC2A 4K9JA 4CC4C 3APGA 1S4IA 1R3LB 5J8OA 4UTUA 2DBLL 1EGVA 1W0VA 1U42A 1N3NA 4KXZI 3T2NL 1K9FA 4BIKA 3UO1H 1AQ0A 2VR2A 3W29A 3Q8FA 4E0RA 1CL7H 2IXQA 3A5FA 3UTSA 3QUML 1XSIA 2EG8A 4Q4MA 5KW9L 5E5UB 5CSUA 4HUUA 2YQGA 3BQUC 1W5NA 1U6AL 5K9JL 5BVPL 4NI8A 1MVFA 3NJMA 4ZMWA 3EZJB 2PF0A 1YY8A 4LAMA 3TFCA 3HFML 4MA8L 2ZQ0A 4L3EB 4UFLA 3WFBL 1FSKB 4UCFA 1U2CA 3DVGA 3GIVA 2ETWA 1IXNA 3IDGA 4NM4H 2BSBA 2WYZA 2YXWA 4I13B 1XB8A 2PDPA 3JXAA 3VDBA 4XVDA 5AYUL 1SFTA 2P8LB 4NP4H 2P43B 4OLZH 2K9FB 1YW1A 5IMLB 4KH9A 4MY1A 1ND0A 3AXLA 1M05A 2Z3FA 5F4WA 3PQYB 1GCYA 3T77B 1L6YA 4RFEA 3B4UA 4GAAA 1BZ9A 2BOBB 4GABA 1GPOH 1IT8A 2P9RA 3UP6A 3IDJA 4PODA 4CNUA 2QQQA 5A8QA 5EY5A 2B7OA 3TTOA 3PSVA 5ANHA 4A2HA 4UFJA 4Z08A 3NVQA 2P7TA 5BROA 1NBQA 5CJNA 3RAJL 2J56A 5GJNA 3TN4A 4M1DH 4GIEA 1OEPA 5EKYA 3QEUB 1ZV9A 2ZUSA 1D6VL 5D71L 3EKZA 1EUUA 4B5ZA 2BH0A 4NQEA 4GXUM 3WK3A 3UYPB 3RGVD 3EH3B 2CLZB 4U2YA 1Z5YD 5LXGL 3D50A 2J4WL 3NZ8B 2MPVA 2BX7A 4G7EA 3S5ZA 4ISVB 3MRGA 3D3VD 3BARA 4LP8A 2ENQA 3VB9A 5FYJE 3WH8A 5ABEA 4W9IC 4XAKD 3VGBA 5A40E 4W87A 5K1NA 1QNVA 1XP3A 4X7EC 4YPGB 5JUEL 2K70A 5GNXA 1FDLH 5E6SB 4NNXB 1E1EA 2YGOA 1CG9A 5FDYA 1T99A 3KPLB 2CALA 5ITFA 3M8OH 1OCCB 1IAIM 5ID1B 5ESAB 3NAAL 2FZ9A 3DO4A 4S0SD 5IVZB 5JHDB 1V6UA 4L1WA 4JKWA 1UZ4A 4Y4FC 1OGAE 1KCBA 3BIBX 3CC1A 1Z5LA 4OBSA 2OXHB 1F9CA 1AE6H 1U2HA 1HJSA 2V69A 2WW5A 3U46B 3W2UA 4LEQA 4MMZC 4OCXH 5BRPA 4IQHA 2XG5A 4D7PA 3H3KA 1OX4B 4IS6A 3S3CB 2EEDA 5KSUA 4ZD3H 1QSEE 3P0VH 3MSPA 3TYGH 4XCYB 2X4QA 5HHPA 1OAKL 1S5NA 3RU6A 3R8BB 2VFEA 4O28A 7A3HA 1QLFB 2EICA 1V02E 3C2VA 1FO0A 5G5DA 1HXJA 4HV8A 1NF7A 1CGVA 1TV5A 4NX0A 3RL1B 1MEIA 3CIXA 2ED7A 3GO2A 2GYSA 1U5HA 1OM3H 2ATKA 5I71C 2XY1A 2ROYA 3WAKA 1F2QA 4BY3A 3OKYA 3B40A 2B7NA 1KLZA 4INFA 3GRWL 4L56A 1QRNA 4K5MA 3L3JB 3P3YA 4A2RA 3GI8H 2IPKA 1MOEA 1SOSA 2GBVA 4V1DE 3C5JA 3S3JA 3MWAA 2YRZA 1A6UL 1YE4A 3BWUF 4QRUA 5EDSA 4U3CA 4LOFA 4LYRA 3WFDH 5HQLA 1WV7T 4UOJA 1HXMA 3DV4B 1NFDB 4HNUA 2NV2A 3VYNA 1UJ3C 1E70M 1TRIA 5IJBC 3PGFL 3B2PA 3KH3A 4MFEA 5C6MA 3LIZA 5TF0A 5J11B 1PKYA 5DD5H 1KY6A 1CBVH 4HBCH 2WMIB 4MUZA 4DX3A 3ZM8A 3IXAB 1F5WA 2HFFB 4LC6A 3QYQA 4FERA 1UTDA 2W9DL 4CNIA 5HI5D 4IOFC 4OD1H 4MYAA 3HAEG 1FGNH 2F5BL 4P57A 3W6MA 2V0AA 4KO5A 4ZXOA 1JP5A 3MUGB 1NBVH 2OPCA 1OM0A 5FKPA 1EFXA 1UENA 1FFPA 3CHPA 4LKCB 5AOJA 3KDMA 2YXVA 2WMKA 1NIBA 3T2OA 1SEQH 3U48A 4JPWL 2QLYA 3Q43A 4XKMA 3BAKA 4UNLA 1A0CA 4DKFL 4G43A 3S0CA 4XMZA 5GS0C 3H2WA 3KJ4C 1UVQA 1A5BA 3RBGA 5FAGA 1U8IA 4JVPA 1CWVA 4DGIH 3E0IA 3E74A 4POYA 2O72A 4YHIB 2VDGA 4DEPC 2BV9A 1XIWC 1EB3A 1XGQA 1RAMA 2VE6A 5BQ7A 2B1AL 5MERA 4WJ5A 1XZ0A 1MVUA 5FO8B 2E6PA 2OSYA 3EFFB 2PGRA 3PBUA 1OSZA 3B9EA 2BINA 1IT0A 4NZCA 5LQBL 4PRPA 2HN7A 1GTEA 2X9WA 1QEWA 4J7RA 3CLWA 1H8SA 3PNWA 3M41A 3CH1B 3SPIA 3WMBA 4O54A 4G6JH 3CN2A 4YBLB 3BXNA 3WGVB 1P5BA 4R3SB 4G6KH 3BDYH 2GQAA 5I7GA 2BVTA 3VI4A 3BPLB 4MCZA 1OAQL 1FE8H 5ABZA 2D2GA 3V8OA 1HYSD 5D7LD 2E28A 4FG2A 2FVNA 3ARFC 1MJJA 4AM0Q 5HR6A 5HNRA 1EP1A 3I6RA 4Q22A 1ACYH 4GSQA 1J9RA 3RU8L 3WNIA 4Q8TA 5FA4B 2Z8VC 1YDYA 3NQ2A 3HPXA 4KJWC 4YHNA 5DJDB 4OH2A 2LLLA 2DZSA 4YTUA 1KWGA 2WB7A 5DJ8B 3WNPA 3D87B 4HPOL 2DQMA 4PJ9C 3GBEA 2VLLA 3ME0B 5HHMB 2CNZA 1RQEA 3H4WA 4XX1G 1OW0A 4IKLA 3P60A 4OTXL 3KTSA 4GXUN 2R39A 1HVXA 1TCMA 1AHKA 1KBVA 1KOAA 1DV7A 1V5JA 5FJIA 3L9CA 1X98A 1KT2A 3G6DH 2BNQB 2Q8LA 3VOIA 5IESL 5DHEA 4JFYB 2K0RA 4XMWA 4A3RA 5FGCB 1OE1A 1ET5A 4K7YA 5T3ZD 3EPMA 4UCGA 3J27A 4AMCA 4GY1A 1AO7D 4TPRL 2WNGA 1XBVA 3H85A 4A35A 3VXSD 5DX7A 4IQJA 2Y6TE 3COTA 1OCNA 2QZRA 4QTFA 1NLBL 2F7RA 4EVNA 4CADB 3LB6C 1E5NA 2OWXA 3QA3B 1XLKA 3GU9A 5LBSH 3MRDA 4MD5A 4ETQB 5DUBB 1R17A 2NY1B 1RUML 1B4JH 2OMAA 3AJXA 4KK6C 3FT3A 1VCGA 1OPGL 3PPFA 4R7LA 4MVBD 1BVNP 2X1IA 3GI9H 3WFEL 4WV1B 3HHMA 3IFPA 4M6VA 2C1OA 3GG0A 3K71A 2DYPD 2YN5A 3WN5C 4LUYA 2EO1A 1D7DA 2JNZA 3RWFA 3ZBMA 3O3DB 3QXBA 1II4E 3QZNA 5F9JB 2VC9A 4OIIH 4BK8A 2VEGA 1T1WB 4U1KA 2R1XB 2IGFH 3SGEI 1QNIA 3N43B 2Z6IA 4DWSD 5I1GL 4W9JC 4LASL 3IN2A 4R7JA 4YHKL 2IQ0A 4Q7DA 5F1IB 2OSWA 1P53A 3EDKA 4HU3A 2WMPA 1FGVH 1TLMA 5E08L 3TZFA 5CGYD 1OVZA 1E6ZA 3O6LL 2K3HA 1FNSH 5IJKC 3G3DA 1G9EA 1WTGT 3WF0A 4GS7C 4G3YH 1IIGA 4DKEL 5F88B 1DOSA 4L6DA 4S1SL 4FQHA 4NQCB 1D7BA 3W26A 1KENH 4X80L 4X5WA 1KGXA 4IQEA 3AABA 2R23A 4C56D 4UV7L 1MFBH 3NACL 1KIPA 3KBMA 1FHUA 1FFOA 3DHDA 4Q4SA 3JZUA 2P44B 2E4FA 1JNLH 5T8IA 1B6UA 4XVUC 4XP5H 4TNEA 2VXTH 4OCMC 1WBZA 4F37K 3CFCH 4YQXH 1XLGA 4PMZA 4JFEE 1GGBH 3C08L 3QJHA 4X2RA 1ID5I 2FQDA 5D05A 4W6XB 4HWBH 1EHKB 5I6MA 1CDIA 3F12A 3TT3H 1IM3D 2GBTA 4F7TA 4ZNEA 1IBYA 3HG4A 1CT8A 3ZIZA 3QEGH 2YKLL 3NA9L 3IFNL 3NPSB 2Y7GA 2LAGB 4CILA 5JQ9A 3TZVB 1S2EA 4TMPA 3GB6A 3ZHNA 2ILLA 3GNML 3WNOA 1XR9A 1S8DA 1AQDB 1BVWA 2A6JA 5I00A 2VXQL 2CKBH 3MY9A 1HWGB 5K39A 1T0OA 1Y18B 1VIWA 5MEND 5CINL 3TCSA 2FSEB 4LPTA 4K3EH 4D3CH 4DUOA 3D39D 3JT2A 1FNGA 1EHAA 2J66A 4QJ1A 4O4YH 4C5ZA 2N7BA 4RR4A 3KRZA 3PPGA 5AQ0A 3HS0A 4M1GH 5AW7B 1F8IA 3VTMA 1J4EA 1X5KA 1F3DH 5FEPA 1QWHA 1EV2E 4DKDC 5I0ZA 1GIGH 4S1FA 3ITXA 4GEIA 1W0WB 2FJUB 3H56A 1H1ZA 5EO9A 1VKXB 3X12A 3O3UN 2UWEE 1V51A 3IJ7A 4FL4B 5CLXA 2A7BA 1MHEB 3EOTH 3QRGH 2YK1H 4LALA 1S38A 2WKGA 5DS8A 2VDLB 4K68A 4XK2A 4UINL 2YGQA 5KS9E 1X1NA 4TU1A 5FYJU 1V4YA 5AVTB 5FOOA 3TR2A 1KPUA 3NYKA 1HHIA 3HG1B 1SMAA 3MWCA 1XYLA 3BLFA 5LBGA 4NQXB 1NFGA 2H6UA 3QO1B 4HNCA 4LL4A 4A3UA 4NNCA 4RZ5A 5EIIA 1R2RA 3W7JA 3TU9A 3UTSE 4X9GA 1MG2C 1MWAB 1AY1L 5AD0B 4KKAD 4N0FB 3DIFB 3M17A 5GS1B 2AJXL 2P8MA 4Y4HA 3C8HA 3V52L 3O2LA 4PJ7A 4L29A 5L7XL 4GXVH 3VXQA 2ZUXA 4HIXL 5KTEL 1OGTB 1GZJA 5KETA 4F9DA 2ZCHH 4FZEL 1XH3B 3CZEA 1TLKA 3GXDA 5JLZB 4QAIA 4M7KH 4I5BB 1I8UA 1P4LB 4DBDA 3DARA 1UBPC 1NQKA 1LTDA 4NN6C 3NIFF 2CO7B 1T04A 3MV8D 4NO0B 2Y69B 2C26A 3S1WA 1F13A 2ADGB 1C8XA 2GSIA 3ORJA 2C9XA 3TUUA 1DBKH 1UYWH 1BVKB 1VH7A 2ALDA 2HRGA 4ANVA 3FU9A 1EJWC 2R82A 3BPCA 1ZHNA 5GJTH 4Z7VF 5E6IB 3REVB 3GMNA 4MUPA 1U8HB 1DJQA 1F07A 3HN5A 2BVUA 3OR6B 2AMGA 3IUHA 2NUWA 1QUNB 2ZXDA 4P8WA 1GZQA 1XT5A 4EOUA 3T0VA 1EXUB 4AX3A 4MJ5A 4CCZA 4ZJ9A 3PZTA 4WW2F 4UR8A 1KV7A 3FH5A 4AU0A 2EXTA 4RZ4A 1PUDA 4W88A 1YQ2A 3M1BA 1AL8A 3PFRA 1GQLA 1JPTL 3RFZC 43C9A 1CECA 1OHQA 2WVUA 4QS6A 5ALCL 1A7PL 2B4CL 5IY5B 3QGAC 1RZIA 1KC5H 1MI5B 5JBDA 3ULSB 2BNRA 4PRHA 1HJQA 2P5ED 5GISL 4NN7C 2FBRA 4MJ2A 2OULB 2Y2WA 5E2TH 3VG0L 4JTIA 3RKDD 1SQ7A 1U91B 1BVLB 1H49A 2WHMA 3FTXA 4HIHA 1TENA 4E9WA 4QTIL 4X6DF 1US0A 5BO0D 4HWNA 5F9WB 4JTQA 4PS4H 2ZC8A 3DG6A 3S4SG 5FHAH 1I8KA 4N9OB 5FM8A 2NPLX 5KZCB 3JU2A 2XGIA 4NYUA 3N1QC 3AAZB 3NM1A 3NRFA 3V4VB 3ZSSA 3R94A 2Y2TA 4QRRD 1L6XA 1NTDA 4PRAB 4ZAKB 1M3JA 3OZOA 4JG0H 5B80A 1XJBA 2WYTA 3TLLA 2X1OA 1MEXL 4XN8A 3AWGA 4LIQL 2O9RA 5D6DA 1GGCL 5K33A 1KB5A 4HAKA 1EZUA 4J28A 1FFNB 4K8RH 3IN0A 3SE4C 1D9KD 2CLMA 3GNXA 5C0RL 4KGLA 4NC1E 4JM2F 2OL3H 4UQIM 4X7TB 5KANG 3ASWA 3D05A 2J88L 3L5MA 4MDJA 3NTCH 5AVXB 2CR6A 3JTTA 5EU5A 2ZX8A 3ZRFC 1XD1A 2X4SB 3TCLB 1NLDL 1J11A 3HMXH 1BD2D 1AXTH 1KYFA 2AJZA 2FX8L 2YD6A 2ALAA 1R7AA 4BKTC 1W5MA 1T0NB 2VDNB 4RISH 4G5AA 2DBJA 5H37A 3ZU8A 1QRNE 4AC1X 1C93A 2REQB 4J4PA 3QNYB 3K4DA 4MZRA 4OF8A 4TSAL 2EKCA 1G0YR 4JRWA 3QUYA 3WDRA 2X4NB 3UU0A 2RCSL 2PDWA 4YHLH 4G6AD 2CMRH 5HYEA 2IGTA 3SQOL 1VPOL 3KMDA 2ZT9C 3CUIA 2UXFA 5FSDC 1XCQA 1FC1A 5DMMA 2UYLA 1PCXA 5J6SA 2W1NA 1KEMH 1CFTB 4GFTB 3WKNA 1OF8A 2OQHA 1Z9SB 2FSDA 3VWJB 4JFFB 1TR9A 4F2EA 3MV9D 2WXKA 5IFPA 1LP6A 4NKOB 5D2LF 3DV6B 4K2UH 1G7LB 3ZHDA 4JX6A 4E8CA 5I1JL 2YCLB 4UQBA 4RZBA 3SCMB 3GU2A 4A2FA 5D9SA 1BXVA 1BJMA 3B7UX 3FQ1A 1CLZH 2OMWA 5DZVA 3VXOA 3TYFB 1R47A 3MI3A 4LGPB 5C0CD 4EJ1C 4M7LL 4OV5A 3GUWA 5L6UA 3ATBA 3CQHA 3O45B 1SO3A 1H60A 3E9UA 3S37X 2YL5A 3OWEA 4ZB0A 5DJ6A 3LN3A 2FX7L 2FATH 4K36A 3L3GA 1ETB1 3TSMA 4QQ3A 1IGCL 3P0YH 3FQXA 4FG4A 1TJHL 3ZE2B 5JHMA 4C6PA 3GQFA 4NQSA 4N0UB 4ZXBC 1DJYA 3E3QE 2C14A 1QLEH 1QJWA 3C6EA 1U8KB 2PB1A 4JQ3A 4PRPE 1BRLB 3W7GA 3L16A 5F7UA 3HE6D 4XHJC 2WLHA 1MQQA 3FQNA 2X7VA 2EIKB 2AXFB 4AF0A 3D07A 3VWKD 2VX5A 3QUHA 4E9VA 2J24A 1MW1A 2E3VA 5I1CH 3LA4A 4DF0A 2BW5A 4KFZC 2XJKA 3EBAA 4X0KA 4GW1B 4FG6C 3Q8AA 1J8HE 2LLEA 1HH9B 1KBGL 3SPHA 2EVFA 4L05A 4LVDA 2N7SA 1NEZB 3T3ME 1Z7AA 3N0AA 4AD0A 3RPDA 4NPYA 4B9YA 5IW1B 1E3FA 3U7YH 2EH7H 1QG3A 4G6MH 3MGTA 1TZZA 4KKBD 2E56A 1Q5MA 3PP4H 5DI8B 3CUJA 5FOJA 1HKFA 2FVLA 5T5FL 4UT7H 3L0GA 1PX4A 3P74A 4ELDA 4Z9KB 3TTYA 5BXTA 4Z1PA 3RDKA 2ARJQ 3IBOA 2C7UB 1Q72L 4JO4L 3W3OA 4PMQA 3K13A 3P2TA 3TN0A 3BEWB 3C60A 4K8GA 4P5TC 1A14L 4FI6A 4IJ3B 1NDVA 5I06A 3LKOA 3OX8A 1QSFB 3B7RL 2V9QA 2EIBA 3SGJA 4NO3B 3SBWC 2ORBL 1KF9B 4JDBA 4XCNA 4N9CA 4OF0A 1AANA 3AG1B 2OP4L 4ZX6A 3IRSA 1HHJB 5TDNB 2FZBA 3TVMA 4O2EA 2ESVD 3WTUA 4HZ6A 5E1AA 1SLXA 1CFSA 2DF3A 2O6FA 1GQIA 1A3RL 1BIHA 1QO2A 4UT9H 4JFQB 3MLXL 4UNIA 3VFVA 3UWZA 1ML1A 4MDOA 3OHXA 5L2KB 4BFKA 1BYOA 4TMCA 4XPGH 3S9IA 2Q1EA 4Y9FA 1VQTA 3K4WA 3GDBA 1NOAA 2HRLA 3VI3F 1KLGB 4RGNE 4PGEB 1J5HA 2PRMA 4QD2E 4KO7A 2BWGA 5JYMA 3NJNA 1FCQA 4JJ5B 1F4YL 4NKDA 3T08A 3OBEA 4OZHA 4EBQL 3FJ4A 4F8XA 2P26A 1NUGA 1L0QA 1NKRA 5FUOL 3VRLF 2ZYHA 2MPAH 3PHOA 4X98A 4MB4A 1IEAA 3DSNB 4B5NA 4ENLA 1TU2B 3TE9A 5ADOH 1W1YA 3AMCA 4JKLA 2OZ0A 1GEHA 2EDJA 1RHFA 2WXLA 1OC6A 3V5HB 5JHAA 4BQ8A 1W3NA 4PREB 2JCCA 1DE4B 1RH9A 5DFVC 5AAMA 4JG5A 3SDYL 5IMMB 4OHQA 4HIJA 2VXVH 3D2UD 4JG1H 3MI6A 5C09A 4EIUA 3ML8A 4R2GD 3DETD 2FEEL 1UB6B 1INQB 3QAZB 2GWNA 2AV1B 5B38A 3Q3GA 5DQDH 3EO9H 4E42B 4A7GF 3NFPA 1OEZW 4R4ND 2V2XA 8RUCA 2R2EA 1V8EA 4RNIA 4BSWB 5FC9A 2IFFL 4MADA 3CXHJ 4HMCA 4GO6B 5GRJL 1EHXA 4AZ7A 1QSVA 1FWFC 1XRTA 5KVEL 3UR5A 3HQPA 3HV9A 5AVNA 2PTUA 4ONGH 2GGHA 1IGYB 4GKNA 3BW3A 3JWNG 3W9EB 2XETA 2GGGA 4BQ4A 2QKIC 4NC1C 1TCRA 2Z31B 1N9PA 2G2NA 3VNLA 4TUKH 3FDKA 4HSOA 5CEZE 1LL7A 3FGCB 1ET7A 4QR7A 1CEOA 4GOAA 2WWMD 3CIVA 1WB0A 3ASOB 4JL2A 3QRBA 4XVTL 4JHUA 1HHGB 4ELKB 4ZNEE 3KH4A 3L1GA 2MOQA 2KZHA 1D5BB 4JGNA 3VQ1C 4PFHA 3QUZD 3HC0B 4HPXA 2ADYA 3PHQA 1M56B 2VO8A 2VSCA 1BBDL 1YEYA 1NMAH 4N5ED 4KQNA 2Z8WC 3UZVA 3W2DH 1E28A 3S47A 3ORWA 3ZK0A 3EBHA 3TNNA 1FCBA 4RZCA 2DM4A 3F7YA 2Z0UA 3CYVA 3CXFA 3FZUC 1AH4A 2IH1A 3HGSA 2AK4B 1T1XA 3HZKB 4UQEA 1B4TA 4X4YB 2EXWD 2E7LA 4X8JA 3WQVA 1RALA 3MO1A 1NCDL 1J9YA 3DO3A 1MF2L 2CNYA 1LM1A 2XZZA 2NQDA 2YAMA 4MWAA 4Z76B 4B27A 2E09A 2COQA 3WUGA 4GIYA 5JMRA 1L9NA 4ZMXA 3HPJB 5E93A 3HZMB 4RETB 2KDGA 3CLEH 3FSZA 5FWQA 5E0QA 4C1LA 2CO6A 1EDHA 4HDIB 4YN5A 4HHAB 3O3BA 4OUUA 3MYOA 4BQ3A 3CUGA 2JMRA 4OWGA 3UR2A 1UA3A 3GBMH 1VHCA 1CLOH 1G6RL 5JIMA 1YUHA 3NQ6A 1KYOJ 5JQIB 4NG3A 3IRCA 5E8EA 4LSSL 3H9SB 2MRYA 1TWDA 1OB1B 2DI8A 1KFBA 2L5HA 1D6EA 4GW4A 1NCBL 4DHGA 5F4SA 3WH5A 3DFQA 2GFBA 1R3JB 3LMJL 2OZ4L 1SYVA 3BANA 4PI0A 5F1SA 5CJ8A 1ES0B 1QNSA 5FFOA 3QCUL 1SFDA 1CGWA 3K30A 2WJ5A 2ADJA 4X6FB 2JF6A 3E3QC 5E2WH 4FFZA 1EXBA 5F21B 1KFEA 1W3TA 1ISVA 2V2WB 2A7RA 3ZYZA 3T6QC 2H9GB 1ACCA 2JIWA 5DWUH 3K80A 1VZIA 1CB4A 2J7GA 4AYFB 3HR5B 4Z7WF 2O5YL 1BHGA 1SLWA 3ZDZE 4OR1A 4MPKA 3QDGE 3MX0B 1JDAA 5CZJA 1FL6A 4FTVA 1LP9E 1GGOA 1W1B1 3NCJL 3IU4H 1ASOA 4MAYD 1SM3H 3BSZL 3QXAA 2J27A 4GVIA 4G8GB 4AM0B 3FLUA 3UP8A 1JXKA 5D7IF 4Q7NA 1QPKA 1Q9KB 3PL6A 3PR2A 3PG8A 2PDIA 1XF3A 4LW7A 3VG9B 2IG2L 4M24A 3SE9L 3MTRA 2NZ9D 3WHXA 2GJZA 1KIRA 3P77B 3GIZH 2NY0D 2YPKB 5DJ2A 4IHOB 1QFWI 5DK0B 3N41F 2ENYA 1F11B 3U2IA 2RFGA 4PHXA 2FVKA 1OW0C 5I6XB 3LRSA 3N25A 2BNRE 1XYCA 4FLHA 2G5RA 1ZCRA 3QT2A 1XVSA 1A5OC 2FLMA 3BJ91 2UZYB 1IGFL 1D7KA 4FAAB 2QXWA 4F1ZA 5T5NF 2DUZA 4U7KA 5T3XD 1XF4A 3ZE1F 3MMEB 4X2UA 3DRQA 4JDVB 1E4WL 2WGNB 4AD2A 5K9CA 4QOKA 3DGDA 3ULUE 4BK5A 2BODX 1KB9J 3I3EA 2EJAA 3DTUB 2AJYL 3K1KC 1S7QA 1RCXB 1LEKB 3JUYA 9CGTA 4ZUWA 3SE8L 4JN2A 4PGCB 5K4ZA 4P2QE 2GY5A 1KYOK 3EX4A 2RAMA 5GGSA 3L5WB 3JS3A 4HTYA 4PBWD 3BVXA 3FTZA 2DQJL 1L6PA 3UJRA 1Q9OB 1Y8BA 3C2AH 4TVSa 1XGPA 1VGKA 4DAGL 2OBGA 3C61A 1TTGA 1DN2A 4J27A 4RIRA 3LEYH 2WLMA 3PUEA 4A6YH 1SF5A 5CGBA 5J5EA 3AM8C 4ZMNA 5DRXB 4FKKA 5CMAB 2HT3D 3U2EA 3V5DA 1N59A 5DS2A 1O68A 3T3PF 4RGNC 1JYNA 2NDGA 4DAFA 1PAMA 3O05A 3F7PC 4DGYL 2AAMA 1MHHB 3W7IA 5GGQH 4I9TA 5C0BA 4MD4B 1CLVA 2NX5D 3EWBX 5E8NA 1AZRA 3TKFA 4QX4A 3QZBA 1LQ0A 4F2MA 2JKXA 4KKZA 1EEZA 2MEJB 4NRRA 3O9WB 4GNJA 1WBYA 4KRUA 1MJ8L 3SDDA 5CN3A 3UNTA 5EMYA 4V2BA 5DO2C 2AQQA 15C8L 4A39A 2X4UB 4P2RD 2YWYA 4PLKD 5A2BA 1AP2A 4GG8A 4AYSA 2F74A 1CWYA 3UZQA 3CAWA 4RAVB 3V2AR 1W6LA 4RSVA 3BRFA 3QKEA 1NANH 4X61A 3MO7A 2B81A 3B03A 2OA9A 5DFTA 3NNTA 4NY2A 3C3UA 2AZAA 4WY7L 4WHCA 3GNOA 4TLSA 2VC2B 3ARED 4Y5YA 4LLUA 1G84A 1HDMA 3HZVB 4BE5A 1A7NL 1EDTA 2CA3A 1S7VA 3Q5YA 5CKGA 1YEDB 2G2RA 3W2LA 3M9YA 2PW2B 4XT1C 1KB9K 2NQ5A 2CDEB 1AGDA 4I77H 3OQEA 4WGXA 3DUHA 3W02A 3MBDA 2AK1H 3EGJA 3OQRA 1NJ9B 5DZOA 1YMMA 3UPRA 5HNUA 1X9QA 3N6QA 3VU2A 3FCUB 4DWDA 4M6OL 1Q13A 4LPCA 4FHAA 1RLBA 4GQQA 2XPZA 5DRNB 3BKJH 3UO1L 1TYEB 1HWHB 3QIUB 1KM4A 4UU9A 5I3IA 1DVJA 3ARDA 3LDBC 3KP1A 3H4GA 5A6AA 2W9LA 2XVKA 5C2BH 3GZQA 3VVWA 2YQ2A 1F3EA 4JO1H 1LDSA 1R2TA 4C8XA 3IK2A 2YSSB 2VDMH 1M71A 1CUOA 2Z7UA 2Z4GA 5ALBH 2YA1A 2RB8A 5SWQA 4IMEA 4ECNA 2EYSA 4HGWB 2GQ8A 2KPNA 4NM4L 2ZG3A 5AKVA 3VDCA 2DSUA 1NCIA 4Z5RB 5D6CA 4OZIA 1P0KA 1TWSA 4PJ8D 4HG4J 1T6WA 3L2NA 4NP4L 3OMZA 4OLZL 4BFEA 1UWYA 4KPLA 3L13A 1H0DA 4Z3IA 5D9OA 5HJGA 5BOPA 2QV5A 3CHXA 4C6FA 4I3SH 4Y7MA 4B97A 1QOXA 4P4KA 3GSQB 1DFBH 1GPOL 2PXYD 3D69A 3UBXA 3LMZA 1ADSA 3BE1H 3AHVA 1WICA 2E7BA 3L4TA 2CUIA 3LB0A 4M6AA 5K3VA 3H12A 1DVFA 1PMYA 2XRAH 4NQUA 2BVWA 4Y4HC 3SJVD 2IWEA 2R2BA 2OOGA 1FFRA 5C08B 3II3A 4M1DL 1BXAA 3DURB 4N0CD 1DBJH 4HHMA 3ITYA 2RQ8A 2ZZ6A 3RHWK 1P0EA 4MJMA 4MKNA 2XOTA 1T21A 1O7VA 3RZCC 3VMPA 4H8WL 4ZMPA 1QFOA 2J6EA 4AGOA 3CV1A 3SM0A 1S7XA 4S3JA 3HKFA 5C0EA 4H7VA 3NIDF 5CCKH 2XWCA 4FHBD 1FF5A 1TJRA 2OOFA 4YIWA 2W3ZA 1W3JA 3RPKA 2CJSA 1Z3NA 1IBFA 1HQ4B 1NEPA 5SWZB 4IH3A 4XMPH 1I3GH 3AB0B 5IQMA 1J7VR 1R5IB 1FDLL 4MQ7B 5AZUA 4PTXA 5T1MB 1PCSA 4PB0H 3WFCL 5DRIA 3PJUA 4GNVA 1IF2A 3M8OL 3GKFA 2F68X 3MYPA 3ILQC 3VXPA 2GZXA 4XNZC 1TVLA 3QH3A 4OQTL 1BIIA 4P23D 4JFHE 3EH4B 3II1A 1ONWA 3GLDA 4AVOA 3MLPA 3OHMB 3FUDA 3E1F1 3L3KA 4I2XE 2VMEA 2JIXA 5JW4Q 4YTTA 1C8QA 1E43A 3QUXB 2PLTA 4KWWA 2J1KA 4P46B 4WVRA 4JXCA 3Q2NA 5CWSB 3RDJA 1T5XA 4ZD3L 3P0VL 2OW6A 4BKLB 3TYGL 5JORB 3ARBA 5EEWA 5J9PB 2X2YA 3WHE1 5DMIH 1ORQA 4A05A 5F2FA 2WSYA 4B9GA 2L7EA 4AHQA 2CK2A 1V77A 2VDRH 3ULUC 4HG4K 1G4TA 3O8AA 5KSWA 4RAHA 5C0GA 3H8AA 4R85A 3DPBA 2X0SA 1V03A 2X3CA 2WQUA 4X4XA 3DI3B 4X9IA 1A0DA 2QAPA 4QISA 5LHEA 5K9OA 3K1DA 3TWBA 5DHVA 1PAZA 4WGHA 5GS0H 2AQSA 4YSQA 2FRGP 3GI8L 3PF2A 3DX6A 4ES9A 2FZ3A 4PR4A 2AXGB 1F6FB 3M6YA 5F89B 3IB4A 2VM4A 1P5UA 4MZYA 3WFDL 3T0ED 1BQHA 1AGCB 3ARGD 1S7UA 2DWEA 2D7QA 1GA2A 2X4RA 5KYNA 2J2ZB 1ICPA 1V3KA 3P4MB 1ZUAX 3ILPA 3V0IA 3O2DH 4XOEA 3NPUA 1YDOA 3LMYA 5DD5L 4HBCL 4Y1TA 1E6RA 1CDHA 4G59C 3V7AG 5EYWA 4YSSA 1LE5B 1QOKA 2FT7A 2B3IA 2BP3A 3ABLB 1E1FA 3R8QA 3GT6A 4ELMF 2EUWA 1Q45A 4WWKD 4RX4D 4DEFA 4OD1L 3N3TA 3ZVHB 5KITA 3HV8A 12E8H 1ITCA 4LPXA 4QJ3B 3P9WB 4MLRA 1FGNL 2XIDA 1FVDA 3VTTA 4Q9QH 5F7AA 2YAFA 3URBA 5CILH 4F58H 1CZ1A 5AVVB 3MPCA 1RUQL 5CPNA 3G5VA 2EJ1A 4TNFA 25C8L 4IGBA 3BPWA 4FR1A 2VNCA 1IL1B 4OF5A 1UB5B 1AR1C 4KERA 5EUOB 1D5MA 4KI5D 3H24A 5BXFA 3QUYC 3DG3A 4PGDA 4QYAA 4D6EA 1HQRA 2BS71 4QEHA 4DGIL 3CDYA 1BXUA 3V5KA 4WRHA 3CLMA 1K4GA 1QOQA 2ZRXA 3WJJC 4J8RB 3FFCA 1MQ8A 1DJGA 4GYJA 3K81A 4PYHA 4TUOB 1M01A 4Z3JA 4BJHA 2LE9A 1MPAH 5LYRA 2F1EA 2IJ0C 3FNDA 4P5MA 4DN3H 2IVFC 1C7TA 4DHLA 1T0MB 1H9DA 3G9AB 4NP7A 4G6JL 4TIMA 4EI5B 2IXVA 4O0QA 1A53A 1SXCA 5IMKB 4G6KL 1R8LA 3TYCA 1SHWA 2MQCA 1IQDA 2EE9A 2WQDA 3CFJA 1FE8L 4KCVA 3H9YA 2JIEA 3GSNB 4H2AA 3ES6A 1A6AA 4YWIA 1MCQA 2O6PA 3RPIA 4H6QA 5D09A 2DWXA 1ACYL 2A74B 2WLKA 1FXPA 3X3GH 4HEPA 2ZA3A 3E96A 3DOHA 4WEEA 3NBNA 1YDPB 1ZAHA 2WUBH 2A0NA 5EH1A 3VCLA 4S3CA 2YSWA 2NV9A 3MU7A 3H9ZA 4GZIA 3BKMH 4N2BA 2QDHA 4NC2B 5CLTA 3M0KA 3WLJA 5DQ9B 1SJHA 1R5WB 4V2CB 3OLDA 1WITA 4ATWA 2TYSA 1MFNA 3CAQA 1KYAA 1B0RA 1V7YA 2EYRA 2I7OA 5DZPA 3HVDA 3KS0H 1N5YL 3W4RA 3V6BR 2Y8UA 1KN4H 1C12A 2NY4D 2F6UA 4AYGA 3G6DL 2E75C 2NUPA 3P40A 2ENPA 2EIDA 3X1FA 3MRFA 3LY6A 1D2OA 4FTVE 4AZ6A 3GKWH 3C6LC 5AHIA 2EXSA 2VMJA 5FYJH 1GR7A 1KG0B 4Q6JA 1I7RB 2Q01A 3W37A 5JR1L 2A3LA 4D8PB 5GGVY 4WOQA 1KJ2H 2GSMB 1ZGDA 4KX7A 5D9PA 2WINB 3T0WA 3FO9B 4DKAA 1E8XA 5BPPA 5LBSL 3QI9A 1JUEA 3QY7A 4RWYH 3L3HB 4KRLB 3MSRA 3W39B 4NRXA 5HGAB 4OCWL 1B4JL 4AY7A 5C2UB 3C9NB 3VFTB 1DQXA 4MNHB 2UX6A 1RZFH 3WCYA 2V82A 3BUDA 4LS0A 2ZTJA 4R96B 5FO2A 3GRGA 2R83A 3CFDA 5A3ID 3S36H 4H6RA 1A25A 4JFPB 1I7UB 2ARJB 3RDTD 3VFOB 1YDNA 3WEBA 3DGGB 3TN0C 3GBNL 4Y1AD 5IHRA 3ITVA 1JJKA 3W7RA 4OIIL 3IT8D 3O4LA 1DBML 4X8XA 2IGFL 4HA1A 3SGJC 1PL9A 1NGQH 4YTSA 1LQBC 3UQNA 4GZJA 1AODA 4IX0A 4ZS6C 3L5JA 1E4IA 5IKCB 6REQB 3UTZA 4KJYA 4PJGB 3L95B 4C59B 1FGVL 3SUVA 1WC7A 5D1XD 3KS5A 3FRPA 3LKSB 3TVMC 4NJJA 1FNSL 3D0LA 3DRTB 1TJPA 1IIKA 1EGZA 3ZDYE 2VWEE 1TOXA 4G3YL 1ZA6A 2VEIA 4ZX3A 3CPLB 4APQC 2DMKA 3R6IA 4H5SB 4LKXA 4DEUA 3T7VA 5AHFA 4HZ7A 5J56B 1CB2A 5IB5B 3OHXC 3MREA 1AC6A 3CNYA 4UT6A 1NDMB 2DMBA 3V79C 3AZTA 4R7OA 4JQAA 4MJ6B 3X1BA 2RFXA 4LSBA 1KNOA 1JNLL 4F57H 1ADQA 4QWWD 2V2TB 4YNGA 3ULVH 2GFTA 4XP5L 1I85C 2V9UA 3NJIA 2VXTL 3QNZA 3FV9A 3CFCL 4YQXL 5LJYH 2XJ7A 5DVPA 3IXTB 1AI1H 1GGBL 4EZKA 1TPB1 1YJDH 2C9UA 3DIVA 2IAMB 1T22B 4QIRA 3B2XA 4HWBL 3HMWH 4AT6B 5FW6A 5DJAA 4ZB2A 4LCUA 1RMFH 3K72B 3CDCA 5TIMA 4CJ1A 4JK0D 2NXZC 5JVLA 4F2ME 1Z9LA 2Y3NA 2QGCA 2FGWH 1IM9D 4R5XA 6PAZA 3OKMA 3S7GA 3MJ9H 2C4FT 3OEXA 4JTJA 3QEGL 5FW8A 4Z1DA 1HE7A 4JHAL 2GC7C 4Z2KA 4ADGA 5EPMA 3B8DA 4DJFA 3ROLB 4QHLA 4UZSA 4YLBA 1ZPTA 2DZUA 5F6IB 3TPUB 3BSHA 4IOIB 3AGVA 4B91A 5D7JA 3MRBA 1BZDA 4LCWD 4HQVA 2CKBL 4E41E 2ZYRA 3SBQA 5GGRA 3C2SA 3VNYA 3LV3B 2YD5A 4D8ZA 4K3EL 1CD8A 3EJZC 3SODB 1DBAH 1C1EH 4H9MA 3OKEB 4D3CL 3R4RA 4UM8A 3TO4B 5G1MA 3OXRB 2ICCA 2ZX9A 5CSGA 3MYJB 5DTFB 5LXVA 4M1GL 1TUFA 4QHUB 1RZ8B 4EOWH 1XCFA 1COBA 3WBYA 1V0NA 1Z89A 2PLCA 1U8PA 1AQMA 4Z7VA 5I75C 1HXYA 5E4EC 2R0KH 5GRWA 4NNYB 3LZRA 1S9VA 3AU2A 2H3KA 1BAGA 4QXTB 1JZIA 4DPCX 5A8NA 5BRBA 2YK1L 3MXWH 4XSLA 1NCCH 4G1EA 1P7QD 4PGZA 2V7NB 1JF1A 4R97C 5DMJB 3ONCA 3PWPE 4WW2A 3VYPA 1YMME 3WD1A 3AT8A 4X9BA 2H26B 2PPDA 4HK3J 1ZDSA 4AD5A 5CSZA 2YPLE 2K6YA 5B7EA 4WU5B 2OMVB 2NSXA 3B8UA 1JUFA 1WEJH 2WZ0A 5JPMC 1UZGA 4PUKA 3GMLB 1OFRA 4G1MA 5SWSA 3ZZSA 2C4FU 2JTDA 3BW9B 1JK8A 3VDHA 4LVGA 2CESA 3U2SA 4H4IA 3FCSA 3NZRA 4JPIB 1YYCA 2Z35B 4GXVL 1A5FH 3S1UA 3LZNA 3W11C 1M42A 2E7LC 3G5WA 4F7EB 2ZCHL 1FKWA 4I0PA 4HT1H 4X6DA 2NY3C 4M7KL 3MCLH 4NAEA 1V6VA 1YEGH 1JOIA 1MRAA 5EFFA 3LEVH 2QDWA 2WBKA 3FONA 3QYCA 4IIQC 1MQRA 2H3XC 3KOFA 4P7RA 5HNNA 4OZIE 2I24N 1QZ1A 1DBKL 1UYWL 3S6DA 3WJMB 5BXRA 5DO8A 1RK0A 3E6HA 5E9AA 3KRUA 3CG8A 4OZFH 3W07A 5GJTL 5EEVA 2PDBA 3LQAC 3ATDA 3IJLA 1ZS8A 4Y2DA 3LCGA 2JKRM 4AWJC 1SDDA 1KFJA 3FYEB 5I1EH 4K37A 4K94L 1TB3A 3JV4B 4Z0BH 3N6HA 3SN1A 2DI7A 4HU2A 1IEBA 3O6FD 1P9MA 3FQRA 2B5IC 2CCWA 4LRSA 3LNHA 2XINA 1WIOA 1NGXA 1DZBA 4JM2A 4I48A 4AGPA 3T6CA 2HROA 1VBJA 2V63A 3VGEA 1M2VA 5L8LB 3LN4B 2PP3A 1KC5L 7PTDA 3VE0B 2DZTA 5PCYA 3V4PA 1B4KA 1OYCA 5JIKA 4OUOA 3SPVB 2POZA 4XN1A 2GIYA 5J1TC 2BSSB 5HMFA 1LD9B 1MFVA 5ES4B 1RLWA 2HTKD 3DJZA 4ERAA 5E2TL 5FGBA 4NQEE 5G5IA 4AQOA 1RVKA 3B8WA 3ZZQA 2C3GA 2NY6B 4KZEH 3P7YA 2VP8A 3RR1A 3NQAA 1NAMA 2YZRA 1QNQA 3CU2A 3GRIA 4CGUB 4YDVA 4PS4L 2WTRB 1CXKA 4PJDB 4XZUB 5FHAL 3T4AC 2DYSB 3E6FA 2WOBA 2VLJB 4HYWA 3APYA 1A4KA 5F7YC 2OV0A 3R7QA 4PRNB 4YC2C 2ODHA 3IK4A 2VGBA 4JG0L 4O50A 1CD9B 4KNUA 4L1SA 1M3UA 3IAPA 2NQ9A 4XD4A 1J0JA 4E4PA 5E4AA 3WBWA 5FJPA 2PTTA 1XRFA 5D2LA 3L17A 3T8XA 4G9FB 1CLXA 1IKNA 2WIIA 2ZSVB 4M5PA 5LGJB 4XWUA 4NX5A 1T1YA 1OWRM 3KWXA 1JQV