1KTCA

The structure of alpha-n-acetylgalactosaminidase
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
388
structure length
388
Chain Sequence
LENGLARTPPMGWLAWERFRCNVNCREDPRQCISEMLFMEMADRIAEDGWRELGYKYINIDDCWAAKQRDAEGRLVPDPERFPRGIKALADYVHARGLKLGIYGDLGRLTCGGYPGTTLDRVEQDAQTFAEWGVDMLKLDGCYSSGKEQAQGYPQMARALNATGRPIVYSCSWPAYQGGLPPKVNYTLLGEICNLWRNYDDIQDSWDSVLSIVDWFFTNQDVLQPFAGPGHWNDPDMLIIGNFGLSYEQSRSQMALWTIMAAPLLMSTDLRTISPSAKKILQNRLMIQINQDPLGIQGRRIIKEGSHIEVFLRPLSQAASALVFFSRRTDMPFRYTTSLAKLGFPMGAAYEVQDVYSGKIISGLKTGDNFTVIINPSGVVMWYLCPKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-N-acetylgalactosaminidase
publication title The 1.9 A structure of alpha-N-acetylgalactosaminidase: molecular basis of glycosidase deficiency diseases.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Hydrolase
total genus 140
structure length 388
sequence length 388
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2002-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1ktcA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ktcA01
8CGTA 5SWUA 4PSPA 1H63A 3M5ZA 3CEUA 2OYLA 5FEZA 2VEKA 2HMCA 3HJZA 3K30A 4O1CA 1IXNA 1U83A 4AYSA 1YADA 1KFBA 1V5XA 1EUAA 3A5VA 2O7SA 2ZUSA 1DKWA 3NQVA 3UERA 1G6CA 2DZTA 1FBAA 1AG1O 1J0KA 1RP8A 1GYNA 5G4EA 4LRSA 3GXTA 3VMPA 4MFDA 1W5OA 3S2CA 1EO7A 4H8VA 3ANYA 1QI5A 3GAKA 2BXYA 2QCLA 1XH1A 3QC3A 3LPOA 2E6AA 2NUYA 5LNVA 1QI3A 2CPUA 4GFSA 4FF7A 1NVMA 1D3CA 3WNMA 1FDZA 4DO6A 4O17A 1TV7A 3L0GA 3MUXA 2QV4A 4DO4A 4FIQA 1PIGA 3BUDA 2W79A 3GKFA 4IPIA 4WY0B 5A6MA 3QMRA 2VC6A 2A6NA 1EB3A 3TMLA 4UTWC 4O4VA 5I23A 3NM3A 4LC8A 4UTUA 3KL0A 4O15A 5DCBA 3KHJA 5CPOA 4JFTA 3QW3A 4DF0A 4Z0JA 4HT3A 2WO5A 1VZWA 2A5HA 3ATZA 1QHPA 4GQQA 4GUHA 1TYGA 1AQHA 2A4AA 2CLLA 2H3DA 2JK2A 4G1KA 3CZEA 1HL8A 1VHCA 2TYSA 5CLWA 2WSQA 1CIUA 3TONA 3PUDA 1KTBA 1C8QA 5D37A 2Y4SA 5G1TA 1SR9A 5J5RA 1LDCA 4JYDA 1XBVA 1QOQA 3RLVA 2GJLA 2EO7A 2EHHA 3M41A 2E5DA 5TD4A 1QO2A 3U6WA 1TMQA 4UTTA 1IF2A 5I5RA 4I7UA 4MUZA 4DXVA 4M56A 5U7SA 3CV5A 4Y96A 1E40A 3GB6A 4UR7A 4JICA 1KB3A 1ZALA 2CLKA 2ZTJA 3TDFA 4LV4A 2GJNA 1J0HA 1W56A 1R2TA 2OSYA 4MYAA 3LTSA 3L4XA 5AYYA 4RZ6A 3L9CA 3LI0A 4UFKA 2VRKA 4XZ9A 3CPRA 1X7FA 3TAOA 1JCLA 1K7EA 1L6WA 3W7RA 1H7PA 1M7PA 5F4XA 1ZY9A 1JDCA 2WVSA 2QJGA 3MI6A 2NWRA 4FB7A 3MP3A 3FKRA 2AAAA 1XDLA 2LLEA 4AVFA 3LRLA 1ME7A 2DZPA 1UOKA 3M07A 1KGXA 4H8UA 2Z6JA 2D73A 3WK3A 2E8YA 2CWNA 3P82A 2G95A 4KKXA 1GZGA 1L2UA 1SO4A 4HOWA 1TPC1 2O7QA 4UC5A 5LNWA 4GBUA 1EA0A 1KWGA 3VNZA 3WFAA 4M7TA 1YDVA 9CGTA 4FNRA 3TQ0A 3W1XA 3M5YA 3GXNA 2H8ZA 2ABBA 1JD9A 4Z1CA 2CW6A 1TO3A 3P5YA 1W5QA 3BLIA 4BWLA 5FF4A 3W37A 4O53A 4AHQA 4N9BA 5E9AA 1TQUA 4X9SA 1QMLA 3Q2DA 1J4EA 4L4LA 1KM6A 4AMXA 2B7QA 3G3MA 5D2TA 3P80A 2QCDB 4AF0A 1T96A 4KWWA 1B0IA 2QCEA 3L66A 3LB0A 5CPMA 3TQKA 1CLVA 1EHAA 3BLFA 3TROA 2PCQA 3LHVA 2QAPA 4PEEA 1FCBA 4JTLA 3BPWA 3C2VA 4JTKA 3L4VA 1Z41A 2E8ZA 1QPQA 1I2OA 3UY7A 4DO5A 1VLIA 3CM4A 1KWKA 1QNVA 1TMHA 3NQAA 3W7IA 1CX9A 3QH2A 2E9BA 3A23A 5CGTA 4KFOA 4XTIA 4MY9A 2P0OA 2I14A 3LXBA 5EL1A 5D30A 4CQAA 1KLYA 3BAKA 3HGOA 2C16A 1Q6RA 3H53A 3IIOA 4TVUA 2VFHA 1UKQA 4NX5A 5KITA 4X22A 5HR7A 3RK8A 1KTNA 5BMWA 3M43A 3TSMA 3W7LA 4A3UA 5BRBA 3VX0A 1JD7A 2RHGA 3G22A 4M6QA 2BXVA 1W31A 2R94A 1QPNA 2BHUA 1U30A 3BC9A 4PH6A 2J27A 1WAUA 2CLIA 4YCPA 1K7FA 2ZXQA 3VI2A 1FXQA 3TC7A 2A0NA 3NZ1A 3W70A 1TTJA 4MJZA 1JIBA 2C3ZA 3WDIA 1SSGA 4OGZA 3DXIA 5KZMA 1EPXA 6ALDA 4OJYA 4MAZA 4AWSA 3MI3A 3G1FA 1VYRA 5EYWA 5K9XA 2AMGA 1WZKA 1VIWA 4HPHA 4UZUA 1XSJA 5CLTA 5LHFA 3DFPA 4NJHA 2A7PA 2BY1A 1RZMA 5AHMA 5A2AA 1D9EA 3LGEA 3BO9A 1OFRA 1JVNA 2WSRA 1UKTA 1PHWA 1SZFA 1W3NA 4HN4A 4UTJA 1LOLA 3THAA 1KV8A 2V0TA 1V7YA 1OX5A 4W9TA 5A8GA 1FUYA 2E6FA 1Y0EA 1KM0A 2ISWA 3LRKA 4LVAA 3OLDA 1IIGA 4KWVA 4WD0A 3W7DA 4ZQMA 4JR5A 4UR8A 1VHNA 1YPFA 1H7WA 3RLUA 3S8HA 4NNBA 1XXXA 4C1LA 3W7CA 3T40A 4OV4A 3WJXA 3NQ6A 4RKAA 1TPVA 4FLOA 2X2JA 2YFOA 4UFIA 3VGDA 2X2IA 1KBIA 3A21A 2NLIA 3LBMA 2EACA 4JL1A 1PHQA 3FIGA 3TXVA 1AW2A 3R5EA 1XKYA 1B2YA 1AW5A 2JKPA 3VE7A 1KBJA 2E5CA 1U33A 3NQ8A 4EF8A 3D0CA 2WC7A 1VAHA 1L9WA 4GNJA 1Q6QA 3N19B 2D3LA 4MY8A 3E0IA 5BOOA 4ADTA 1BAGA 1B9BA 1R34A 3A4AA 2R8WA 3DX1A 3N9RA 4J3XA 1FCUA 1TQVA 1WQ5A 4FNQA 1MW2A 3FEMA 3C6CA 1XDMA 4NU7A 3S0CA 1XH0A 1AK5A 3CWOX 2WQPA 3AXHA 3IJ9A 3P84A 4ONVA 3NQ7A 1NOFA 1M6JA 1SSDA 1G69A 4ADUA 3AXIA 1O7DC 4XKYA 2ZZ5A 3PR2A 3QJAA 3PAJA 4BI7A 1XSKA 3L67A 3TMQA 2XWEA 5HDRA 4U28A 3MYPA 2F1AA 3KRUA 2ZRUA 3W2UA 3STGA 1ZS2A 1XD0A 3EDJA 1X1OA 4Q33A 5GVJA 3D52A 4UUIA 4W93A 4HPXA 3VM5A 3NQCA 5KSWA 2ZX6A 5DXXA 2Q3RA 4Z1DA 1OVDA 4LUIA 3ELFA 4Q32A 1WX0A 5AHNA 3L4ZA 1ZAIA 4TX9A 4ZQCA 1XBXA 3NAVA 5G1YA 2Y63A 3M1ZA 5U4NA 2CLHA 3C0JA 2EAEA 1F6PA 2V5LA 5CXPA 1Y7VA 1Z42A 2CZDA 4A2SA 4IXXA 2B7PA 4M6PA 1NF0A 3TW7A 3EWXA 3HO8A 1OT1A 3NL3A 4EVZA 2Y88A 2VFIA 3ZT5A 5L6UA 5EPDA 2XVGA 5E0KA 2QUVA 1GVOA 5AN7A 3SJ3A 1ZHAA 3LX9A 3FAXA 2X1RA 1FWNA 1RPXA 1LLZA 1S3HA 4OKDA 4K39A 1W1ZA 4POCA 1CGTA 2XN0A 1GOXA 1VCVA 4Z1AA 3B0UX 3I7SA 4TU1A 3NM1A 5AOUA 1HVXA 1DV7A 2A1YA 3O6DA 5HJLA 4AH7A 2ZXAA 2PURA 4JN6A 4N6EA 1S46A 3KLLA 3L0NA 1IZKA 1HNYA 1OGSA 5D04C 2V2CA 4P2VA 3EDEA 3QW4B 5EA9A 3VSVA 1P0NA 1KXHA 1GQNA 4AIEA 1RQEA 3HPXA 2ZICA 1L6YA 3WDJA 2Y6ZA 3A6OA 3CZKA 1JRCA 3BVXA 4AW7A 1OFDA 2B7OA 4JGDA 3WNPA 4JYEA 4UTWA 1EX5A 2I1OA 1CGXA 4FNUA 1YDNA 1VJIA 1YXDA 1HG3A 1WYIA 5CSSA 2RH9A 3CPUA 1QW9A 4S2BA 3TAKA 4PFMA 1R46A 2EQDA 3BVVA 1F73A 1W8SA 2RDUA 4WUIA 3O8AA 3OLGA 1UA7A 5CG7A 4GUJA 5TBOA 2OX1A 1KCLA 2WNQA 3NPXA 4JYFA 2YGYA 4AEOA 1F76A 1C29A 4JX4A 3UWUA 4UNIA 1V3MA 4GO8A 2FHFA 1AL7A 3EKZA 2F7QA 4TMBA 3SGZA 2NV1A 3WJWA 1XM3A 1T99A 3C8FA 1KM1A 3GXPA 4E2OA 5D02A 1L0PA 3IK2A 2NT1A 1SZGA 2TAAA 1EWDA 4GUGA 4FLRA 3WK0A 1JAEA 3VFLA 3MYOA 3RILA 3GXIA 2QDHA 3LERA 2NUWA 3B06A 3MBFA 3PY2A 2ZX8A 1BSIA 3NQFA 5KEZA 2J9ZA 1ICSA 3N3MA 2VFFA 3O16A 1KXQA 1GCYA 1QX1A 1VR6A 4JD4A 3TCEA 2NXGA 3QF0A 1OYCA 4K6AA 4RCXA 3MO7A 2YIHA 4JEQA 1RV8A 3EX3A 3NYZA 2X1UA 4H2CA 4QSHA 1MEIA 1MFUA 4NZFA 2NX3A 4FXRA 3EJRA 4JNMA 1VH7A 1R30A 4K7YA 1SUXA 2F7FA 3W86A 3S1UA 3EEGA 3QMTA 3TIMA 1AW1A 4O8RA 3C4UA 2BLEA 3BARA 3LCFA 1CGYA 3OVQA 1WO2A 4J3UA 4FX8A 3L21A 1E3XA 3D50A 4P61A 3EWUA 3L5AA 5LNUA 4XBSA 3C61A 3W2MA 4R53A 3VKJA 4HSNA 3MW7A 4UTMA 3R2GA 4JDYA 4UQBA 2H6RA 1ZFJA 4MZ8A 4AAJA 1QWNA 3CIWA 1VYSX 1IZJA 1WPCA 2VFDA 2WSYA 1Z48A 3W1QA 1QPKA 1XH2A 2BY3A 4DBEA 2YYUA 1SO6A 2ZFAA 2XN1A 3TFXA 1R47A 3UXAA 1BF2A 2QF7A 3GTNA 4A22A 1X8FA 5HNRA 1A50A 3G1SA 4JX5A 4DF2A 2WSKA 1JDAA 1LRNA 4LVFA 2YXGA 1I8JA 1NEYA 3B0PA 2PRMA 2BTMA 3EWYA 3KWXA 1XV8A 3GDRA 3NG3A 4GXMA 4M19A 5IBXC 3T78A 6TIMA 2OSWA 2C1HA 3O07A 2BSLA 5HMSA 3S42A 2QPUA 2ATMA 1OX4B 4FLQA 2RKXA 3TXZA 4FNPA 3ZOAA 4UQDA 4OU1A 3VCRA 1VGAA 3M5XA 3DX0A 1SZEA 3KEHA 3GAYA 1E43A 4HSOA 4J9JA 2YA0A 4H8HA 2QAFA 4LT9A 5K9CA 2ZUTA 1A5CA 1M7OA 3ZSTA 4MZ1A 5A5WA 2V2HA 1LBMA 3FAWA 1DL3A 2YZRA 4LWWA 4MZYA 3TUUA 3EDDA 4PL2A 2C14A 2DIJA 1JG9A 2F1BA 2NWSA 3CWNA 4JTJA 4BF9A 3W75A 3IRDA 2DJXA 1EO5A 1Q4NX 3JS3A 2B7NA 4N9DA 1WZLA 4JY8A 3MJYA 1MZHA 1MEHA 3OLIA 4M6VA 3SY5A 3LOTA 1G4TA 3F4WA 2C7FA 4MJMA 1K02A 4WLCA 4QQ3A 1I4NA 4E38A 4NZJA 1FX6A 3LM7A 4DEFA 2JKAA 4CNOA 3OEXA 3WFZA 3LTPA 2Y7DA 4R7JA 4Y9AA 3LTYA 1DORA 1SZNA 4NNAA 3N14A 4UTIA 5AHIA 3DC0A 1GEQA 3DFNA 4CCEA 5A6LA 3NZRA 4LU0A 5I3HA 3PBYA 2V81A 4JTUA 3IGXA 3ZR6A 5HR6A 3FKKA 2DIEA 1OFOA 1GT8A 2W6RA 3NGJA 2P10A 1H7OA 3NO5A 2Y7EA 4AWTA 1BVNP 3KL3A 2QCFA 3ZFHA 1K8XA 1KXVA 1PCKA 1CYGA 4H3DA 1XUUA 3GBEA 4U33A 1JR1A 2FFCA 4MFEA 5KMYA 1TQJA 1WBHA 2ZXBA 3WDHA 3OIXA 3CZLA 1F2JA 3G8EA 4A2RA 4X2RA 1J0JA 2CZEA 3W7GA 1XCWA 2FPYA 2ZZ3A 3DFTA 2WVTA 1EP2A 4BZYA 5D2YA 1ZAHA 1OFPA 5C6MA 4LY8A 1EEPA 3S5NA 1SQ7A 3LV5A 2I9EA 4ML9A 3EX6A 5E1QA 5E93A 1B57A 4ZQNA 4O4WA 3EJSA 3M7WA 4UQCA 4N02A 3G1HA 1H50A 3G0XA 3UD6A 1YPIA 5I3FA 2VR5A 2OT0A 4MYXA 2PWEA 1SPQA 4O50A 1F05A 1Q6LA 2GVJA 2X16A 2E1DA 1UH3A 1P0KA 1Q45A 3INPA 3KVKA 1KGUA 3DI0A 3DHPA 3M5VA 2DH3A 3CTTA 3FYPA 4O19A 4JS3A 1NFBA 1YYAA 3NQMA 1TREA 2VEMA 3QSTA 4LS2A 1BKSA 4MVAA 4LS1A 1H61A 4KFPA 1TV8A 5K4XA 3GYEA 4WX2A 4LVBA 3VGFA 3ZR5A 1IGSA 1DOSA 3DZ1A 3EJPA 1VC4A 2HS8A 5G2WA 3NEVA 2BY0A 2WPGA 1DHKA 3QZEA 3BMWA 2YA1A 2YJQA 3HG4A 1QWGA 1KLZA 2ZRXA 4UZSA 3LLFA 3NPWA 4MKNA 4ZMGA 3FJ6A 3W7EA 2CFFA 1TQXA 4NJIA 4GUFA 1B4EA 4K8EA 4CCCA 3W72A 3ZR4A 3VGGA 2FIQA 1QO5A 3FLUA 7TAAA 1O4UA 1T0OA 4JXCA 4WSKA 4MOZA 2DZSA 2ABAA 1UA3A 3S6DA 2ZZ7A 5C54A 5LNRA 3DU0A 5K3VA 1XUZA 3GNNA 1UH4A 2ZWYA 3STEA 4ICNA 3F1QA 3UPWA 2ZX5A 3DFQA 4PA8A 1H60A 3A24A 1UASA 4NJKA 3VSUA 3MI2A 1UD5A 3VU2A 2J25A 1FXPA 4I9AA 1BTMA 5F4WA 1UH2A 3FJLA 1MW1A 4U2YA 2X2HA 3OLEA 3SGUA 2X1SA 2WSPA 1ICQA 3W74A 1NM9A 1UD8A 3WENA 3EX2A 4O11A 1J5TA 3W1RA 1JXJA 4QITA 1KTCA 1W9XA 2E77A 2XFWA 4O0ZA 1LWHA 2EEXA 1RR2A 2AGKA 5HINA 3P7YA 4N9CA 2FH6A 5CZ0A 5EY5A 1XC4A 3LBCA 3HGRA 4JTIA 2A7RA 4N2YA 3S1XA 1PS3A 3O63A 3UG3A 1UKSA 4BK9A 4A21A 1RQHA 2DP3A 4O1DA 3RNDA 3S5OA 4BI6A 2ZUWA 3W84A 4PC8A 5AFDA 1SW7A 7CGTA 2C8NA 5CZJA 5DCEA 5AHFA 1G7VA 1CXKA 4E2DA 3K1DA 4MPQA 2VELA 2Z1KA 4WY0F 1RQBA 5A2CA 4JFSA 4ATWA 3P5ZA 1MFVA 2ZWZA 4MLJA 5DFAA 3NL6A 4QISA 2OW6A 2NXHA 1JGIA 4JX6A 5I3JA 1TQTA 3PB2A 5KTLA 3S1VA 1FY6A 1X6UA 1P4CA 3PBVA 5K7JA 3JRKA 2QCMA 2EADA 4B9YA 2ZDRA 2Y5EA 4ZQRA 3G0SA 4Z08A 1ZAJA 3CT7A 5AYZA 4UQAA 3O06A 2GQ9A 1FCQA 3IVSA 2E09A 4HNVA 1ONRA 2HSAA 2TRSA 3G24A 3L0KA 5C5YA 5KINA 1QR7A 3GDTA 5I3GA 3M16A 1BWLA 1UCWA 2GJPA 2XIIA 3L4UA 2F7RA 1CGUA 2QDGA 2P1FA 4IPJA 2ZQ0A 4LPCA 1F5ZA 1AL8A 1J2WA 2PE4A 1VCGA 5HUPA 4UTHA 3EXTA 5I24A 1OFAA 4BFAA 1SW3A 1UUOA 4LC6A 4H4IA 2WKGA 3TNOA 1HUVA 3LXCA 1MWOA 1B4KA 5G2HA 3P61A 3BMVA 1LROA 4NXKA 2WCGA 1F74A 3UCQA 1XBYA 3QPZA 3AMLA 3TSBA 3LCLA 4LVDA 4AF0B 5AHEA 1HL9A 4JTEA 4OV9A 5HWJA 2A7NA 4AWUA 2YYTA 1GG0A 5CZSA 4YWIA 4OIFA 2R91A 3W9ZA 1F6KA 1MW0A 2DZUA 4JY9A 4RK8A 3EJTA 1TPB1 1H5YA 3IVUA 5F2GA 2PRHA 1KW1A 1JFHA 1TPFA 3TFCA 3BG9A 1DJNA 1ME8A 2ZA3A 2JGYA 1UBSA 2DORA 3BUPA 1QPRA 1B3OA 3VGHA 2J9YA 3H54A 3P8JA 4B9ZA 4CCDA 1DJQA 1SFLA 1O5KA 3LHYA 3G1DA 3NPVA 4IX0A 1X1ZA 3WJZA 2WOQA 3GLCA 4PCTA 3VO0A 3O6CA 1K8YA 2FDSA 4E2BA 2ZX7A 4ORMA 2PWFA 1N7KA 1XL9A 1PIFA 1JXKA 4UNKA 1Z44A 4S2CA 1G67A 5H2ZA 2E6DA 3GDMA 3HPZA 3AMKA 2BZNA 2ALDA 2QKFA 2NV2A 1G4PA 1KBBA 4UMBA 1E3ZA 1OHLA 3PUOA 1CXIA 1GWJA 4NNCA 2FH8A 1TJPA 4UIOA 1M7XA 4WXZA 3OG3A 3O15A 3UXDA 1S5WA 2X1TA 5IBXA 3UWVA 1TQWA 3LHZA 1WZAA 5D05A 4DELA 3NPUA 2PRLA 3BAJA 2PC4A 5CPLA 2YFNA 2WVVA 3F03K 4RZ5A 4BR1A 2BX7A 4O13A 5FF0A 2FHBA 3QGVA 2Y7FA 5D03A 3BK0A 2VEIA 1N55A 4JFVA 4OWGA 4WOZA 2VUYA 1H7XA 1ODUA 3NQDA 3PS7A 1CXHA 5LGXA 3QSRA 2V30A 1N8FA 4RXFA 3EWWA 4NVTA 2GVYA 3BLEA 1IXOA 1LRQA 1R2SA 1QFEA 3B8DA 1NF7A 1YTDA 1D7FA 1GVIA 1EIXA 3PB0A 8TIMA 1A47A 3ZWSA 5BRQA 3E12A 1FDJA 4HKPA 4FO4A 5LZLA 3NR0A 5AB3A 3BW3A 1SO5A 3LXAA 1QCWA 4HHPA 2PWDA 1TPWA 1GPWA 3Q37A 2XN2A 1VYPX 3PSWA 2G96A 3UY8A 3W1PA 1VRDA 1PJ9A 2QPSA 2ISSA 2F7PA 5BMXA 5FF2A 3IGUA 3FS2A 2HS6A 1OJXA 3W1LA 5D32A 3LPPA 5A2BA 1HT6A 4PTNA 1GTHA 2FQIA 2B0MA 3CLMA 5G4WA 2XVLA 2V5BA 3G1AA 2CHNA 4WOQA 2ZA1A 1PL9A 3JR2A 3O1NA 3HMJG 4XBKA 2NT0A 3BLBA 3LDVA 4O0KA 1O95A 1YTEA 4QAIA 1U5JA 3LCXA 4BA0A 2GJRA 3UZ5A 3BVWA 3WEOA 4JTSA 3E9AA 3P67A 3DX2A 4CNPA 2Q8ZA 4ZZ9A 1LZOA 3SZ8A 3G0UA 3UWYA 4OE7A 3BAYA 3FOKA 1H1ZA 2Z1BA 2WNZA 1W5PA 3G1VA 1KFCA 2CXGA 4TO8A 1VS1A 3Q94A 4AXKA 2QUTA 1CXFA 3WNNA 1ADOA 3OA3A 4XUGA 1RVGA 5AC6A 5HWMA 3TJLA 2FPTA 3C56A 3STCA 3W76A 1PAMA 3P81A 2TSYA 2VENA 5FEXA 4DBDA 5LNSA 1IIHA 1ZCOA 4ALDA 3D51A 1LYXA 3W2KA 3LHTA 4OHQA 3IGSA 1UD3A 2ZXDA 5MHBA 3TU9A 2CZ5A 4XKYB 3M0ZA 5J5DA 2NSXA 1EWEA 1JUKA 2OT1A 1SO3A 2Y61A 4FMVA 4LXFA 3GR8A 4O18A 4IXHA 3HOJA 4O1AA 2OW7A 1XI3A 5IM51 5F2IA 1A5SA 2YSWA 3LRMA 4LW7A 2GQ8A 3TH6A 3TOPA 2J9XA 4FLSA 2DZWA 1EUNA 4FIRA 3R8RA 3W83A 3CB8A 3FFSA 2H3BA 1H3GA 5CZTA 3TQVA 5F7UA 3DDFA 1IV8A 1WOBA 5HULA 5I3KA 1R75A 2ZZ1A 3GK0A 2ZX9A 4YXGA 1JCMP 2C13A 2G3NA 2EAWA 3EXRA 1OG0A 3K8MA 4IMCA 1CGWA 2X2GA 3B03A 5F4SA 3C3NA 4IOTA 1TCDA 3HG3A 3G3DA 3QMSA 3S5ZA 1ME9A 3B05A 2GVLA 3R13A 2GQAA 4JFUA 1VFOA 4RX0A 2C15A 4ZL1A 3WK2A 1NAL1 3PUEA 2KZHA 1UD6A 1PS9A 2ZRZA 2X30A 4FNSA 4MB1A 4WY0A 1WXJA 1JULA 1KFKA 2WKLA 4WSJA 3ABSA 4UCGA 1DQWA 2TPSA 2EJ1A 3CTLA 3FYOA 1KFJA 2C19A 1LLWA 2A21A 3WELA 4J3TA 3TKFA 1VFMA 1PIIA 1QW8A 3ZS4A 1KM2A 3T55A 5HXMA 1W5MA 2OJPA 1CDGA 1TTPA 2WPBA 1AVAA 3PVFA 2QCHA 1SU5A 5D2WA 3EXSA 1P5BA 1EP3A 3EX4A 3PG8A 4QM1A 3HPSA 4MIMA 3MHFA 4K36A 1HWWA 1CW2A 1QHOA 3DAQA 4O28A 1ZJAA 4YCOA 1QDSA 2A6LA 3B04A 2V9DA 3ZWTA 4O54A 3M9YA 3UPBA 2VT0A 4JTGA 3E96A 3W1UA 5CKSA 3DFOA 3GDLA 3RMJA 3BV4A 2Z2UA 3TTSA 1MO0A 1XSIA 3NQGA 4CNNA 4CQ8A 1JCYA 2Z0IA 4I7VA 4LV9A 1HO1A 5F1UA 4R34A 5DN1A 1I2RA 1LP6A 1V3JA 3ZT7A 4NXSA 1OYAA 1GG1A 3PULA 3BVUA 2QJIA 1ALDA 1GVFA 1TPUA 1UUMA 3YPIA 3R12A 3W7MA 4GO9A 3WY2A 3W1TA 2FYVA 3WNKA 3BW4A 7TIMA 1XD1A 4QJ1A 2NX1A 5D2VA 5FEWA 5CGQA 4X0NA 3B4UA 2G97A 2CZFA 1ZNNA 5C55A 1G4EA 3HGJA 3A9IA 3LCHA 4PCSA 3WY1A 4AEFA 3TV8A 3QRHA 2ZZ4A 3BCFA 5DLCA 4J3WA 4K7VA 2EGZA 1NSJA 4N6FA 2BHYA 1FDYA 3CZGA 3Q58A 3EX1A 2NUXA 4TIMA 5KZDA 4AMWA 1E51A 2GUUA 4UNLA 1FWTA 3LCWA 4GI6A 4FEZA 3NNTA 1VFUA 3N2XA 3BSHA 2JBMA 3C2RA 3KX6A 4D2JA 4UMAA 5C2XA 1H51A 3C2EA 5HQEA 4JIPA 3QFEA 1M5WA 2DU2A 3WY4A 1AMYA 4UTLA 3ABRA 4DF1A 3L4WA 3W2NA 5FESA 3HQ1A 4L4MA 3KRSA 5DELA 1JJKA 3W6YA 3H55A 2VXNA 5CGMA 3KFTA 2OMAA 4FX7A 1XGZA 3WY3A 2Y24A 2Q8LA 4IGHA 1WOAA 4IWWA 1YXCA 5T26A 4FNTA 3GR7A 1QOPA 3QQ0A 5EBUA 2VFGA 2QCDA 4IQLA 3DHUA 1HFBA 3BLKA 2YA2A 3AJ7A 2J88A 2FGZA 1JUEA 4CQ9A 4UQEA 3KXQA 1OK6A 1OK4A 1CGVA 1KM3A 1I2PA 1TQSA 2VRQA 4BI5A 4LS0A 1UD2A 3DBPA 3MBDA 2D2OA 1RP9A 3BUIA 3L65A 3BAWA 1PPIA 3HB9A 1JF5A 3IEBA 3BH4A 1G1YA 4J3VA 2H90A 3MHGA 3N73A 1WV2A 4GC4A 4DQWA 4LNYA 3GXFA 3W7NA 1AMKA 3KAOA 1BWKA 4AEEA 5FEPA 4B5NA 2Y62A 3RIKA 3UQNA 4FHAA 4O57A 4MY1A 3EJQA 3DGRA 3VMOA 3CQ0A 5EKYA 3WJSA 2E0PA 2CLOA 3L2IA 1WP6A 3VSTA 1QPOA 2F18A 1JL8A 2F2HA 3DENA 5AHLA 3IVTA 1F7BA 1JCNA 2EKCA 4QNEA 1P1XA 1BLIA 2EPHA 3HGSA 4HNNA 3I7QA 4GRSA 4UXDA 2JGQA 3CU2A 3UZJA 1K3UA 1KFLA 1UD4A 5E6ZA 3WN6A 4UFHA 3UG4A 1TPH1 3CIXA 1JUBA 4DPPA 1C9DA 3GNDA 4K37A 4UOZA 1D3GA 2ZRYA 1RD5A 2E68A 4GKLA 4NI3A 4UOQA 3ZT6A 1L6SA 4I7WA 4M7SA 3DDGA 4GJ1A 4UFLA 1VPXA 3DFSA 1FQ0A 5BW6A 2DZXA 1CI1A 1GYLA 3TK7A 3PC0A 4RR4A 3LI1A 1H62A 2GPTA 4Y90A 2QUUA 4JL2A 3WNOA 1EH9A 2QR6A 5EMUA 3DKLA 4GINA 3KLKA 4RXGA 2YPIA 1JQXA 2QLYA 3ATYA 3BG3A 3W07A 1MXDA 3BSGA 3C52A 1Q6OA 3DI1A 4U2ZA 4AHPA 4J7RA 3NQEA 4LVGA 1GVQA 1U2YA 1PCWA 4IUOA 3WJYA 4ADSA 3KL5A 3PBUA 1TTQA 4X9YA 1PZ3A 1YTKA 3U2OA 3ECQA 4WQ6A 3SECA 2ISVA 1R33A 1HTIA 3EB2A 3W7PA 2BHZA 4NQ1A 1HTYA 3HG5A 3QM3A 3CC1A 3A22A 4Q4KA 1JCJA 3IIZA 1MW3A 1LBLA 2NX9A 4IX2A 5G5IA 5LKYA 2V8ZA 3BVTA 3V75A 3QEZA 1M53A 3M47A 3T7VA 5EMYA 1K8ZA 2DJLA 3W23A 4JCMA 6CGTA 4EOUA 4KWUA 1T8XA 4NJJA 1FCVA 2J6XA 2Y89A 5HPOA 4Y6GA 3VNDA 1OSEA 3KVMA 5LHEA 4FX6M 5HUOA 1TV5A 3DH7A 3KE0A 4GUIA 1ZENA 3NOEA 3DX4A 1BPLB 4UCFA 4IMFA 4EF9A 3P8IA 4RZ4A 4H7VA 3CZSA 5FF7A 1HO4A 4UQ9A 1OABA 2JKEA 1O94A 2Q3OA 2GVGA 3PWAA 1YLVA 4MLRA 2BY2A 3HZ3A 1SFJA 3BLPX 2FHCA 2ZA2A 4XWUA 1RPKA 4Z1BA 4PL1A 3S5YA 3L5MA 1I2QA 1EA9C 3MMTA 4XB3A 1JQVA 2HTMA 2OSXA 2NXIA 3THQA 1GJUA 4M5PA 1H7NA 1TCMA 1GJWA 1TJRA 2UV8G 1OX6A 2V3DA 3ABQA 3GZ3A 4O16A 2CU0A 1MEWA 4QIUA 3P60A 2E4TA 5BRPA 3HF3A 4LOCA 3OVPA 1GVSA 3IIPA 4LTSA 5LSMA 3BUBA 1XCXA 3SIZA 1LCOA 3VE9A 4GI9A 1A5AA 1YXYA 2NZLA 4LUJA 4EWND 4NJGA 4PSRA 3PG9A 3D4ZA 3VM7A 3E02A 1WBJA 5D09A 5LGZA 1V3KA 1PV8A 3WK1A 4CN6A 1HXKA 3K8LA 3GBDA 1DHPA 5TIMA 3ZSSA 1S5TA 2RDTA 2ZRWA 5FF3A 2YX0A 1WDWA 4J3SA 2V2DA 2CLFA 4DPQA 2Y70A 3LHUA 3N34A 4HP5A 3KRZA 3HG2A 1KCKA 1KBKA 2PWHA 4QNWA 1G5AA 3NL5A 1JRBA 3I6RA 1OB0A 2QEZA 4X3ZA 3BW2A 3BVJA 2ZUVA 2IQTA 3W7KA 2ALWA 4HNTA 3TR2A 3VGBA 2F61A 2D3NA 3IIVA 2F84A 4UTKA 2YCEA 3T4CA 2YDAA 4PCFA 1LOSA 3SFKA 2ZIDA 5DBTA 3AO0A 3GX9A 3W3OA 2QCNA 2F7OA 2ZRVA 3MP5A 4IMDA 4KFNA 3WEMA 3IJ7A 2Z6IA 5D2XA 3L2MA 4J27A 4LRTA 5DBUA 1DQXA 4XQ6A 5D33A 1CPUA 1KA9F 1VQTA 3LLDA 4XTDA 1GTEA 4JTFA 3G18A 4OQVA 1MVYA 4IJBA 3NQ2A 3IJ8A 4UTTC 3F4NA 3DKJA 4HOXA 2WVUA 3HJEA 4O52A 4ZQOA 1KM4A 3DX3A 4N9EA 4H6KA 4PEKA 1I45A 3VMNA 1KFEA 1WZMA 1EP1A 1VLWA 1PEZA 4PODA 2FE0A 3NXFA 3LCIA 3W38A 2FB3A 3OBKA 1OFEA 1HL2A 3UWQA 5K9DA 3TC6A 3STFA 2XVKA 1KM5A 3O05A 4HPJA 2Y85A 5H91A 3RF9A 4RJEA 4AHOA 3G8RA 1PVNA 1JDDA 4UMCA 1DVJA 3GDKA 1H1YA 3GVGA 3QYQA 5F2MA 4OT7A 1ICPA 1OFQA 3E49A 5E0FA 1GJPA 3W7HA 3W7OA 3UNDA 4ZQPA 1WE5A 4CLMA 1K03A 1UJPA 1FWSA 2YR1A 5D38A 2OYKA 2WV8A 1TSIA 5AYXA 2XIBA 5TQLA 4ORIA 1V3LA 3QQ1A 3TTYA 5ABTA 2VOMA 3GXMA 1LTDA 5E6YA 4KMQA 1DEDA 3PBWA 4ZVJA 6TAAA 1W0MA 3W85A 2DZVA 1CXEA 3CGTA 2J24A 2YKKA 4HOZA 3NDOA 2ZCGA 4JTHA 4EIVA 3N9SA 2BWGA 1FWWA 4BWLC 3U8GA 3TW6A 1QWUA 1Q3NA 1VCFA 2C6QA 3W87A 4C1KA 4TMCA 4Y8FA 1ZJIA 2VNCA 2WCSA 3W1MA 4AMAA 1D3HA 2ZYFA 3L4YA 2E6YA 5CPNA 3TX9A 2Y7GA 4GQRA 2QCGA 4J28A 2VKZG 4QAWA 4O12A 3KOFA 2G3MA 3TE9A 3D4YA 2W0UA 4HIBA 2D0FA 1THFD 3G1XA 3O6YX 2IGTA 2D0HA 3NVTA 2QMKA 1SMAA 2A2IA 3B0VC 3I7RA 5K4ZA 1JI2A 1H7RA 3RU6A 3DHFA 2XWDA 2ZBTA 3VX1A 3L4TA 3C2FA 4HNUA 3R89A 1S5VA 4YLWA 3EDFA 2YW3A 3EWBX 1Z32X 3EKLA 3ZQ9A 4E0CA 4LQ1A 3M44A 4S1FA 1ZJBA 3FW6A 4CN4A 1LWJA 3N2MA 3AJXA 2DH2A 3LCGA 3QPYA 3CZNA 5KZEA 2ZE0A 1VB9A 2A85A 3BG5A 3UG5A 4GI8A 2ATSA 4NT0A 1JCXA 2PWGA 1G4SA 3MP4A 1DBTA 3GKAA 3L2LA 1ML1A 3TSDA 1XFBA 2G5WA 1BVZA 4AYGA 1CXLA 3CHVA 3P74A 4O1BA 4OBTA 3IIXA 4JDBA 3EWZA 5DY3A 3VNYA 1IXPA 2FPVA 2WKJA 3W7JA 3UWZA 2R14A 2EF9A 1O5XA 2D0GA 2YOCA 1G7UA 4K8HA 5F2LA 4RV8A 2E5BA 5BNKA 3S1WA 4NUWA 1TRIA 1BG9A 4GE8A 4YL2A 3W2LA 3DHDA 1P6WA 2RDWA 4TR9A 3TA6A 1OX4A 3UWWA 4A29A 1JI1A 3W73A 4WZHA 2WANA 3T44A 2WJZA 1QAPA 1SW0A 3BAIA 3PSVA 3BAXA 2WVVB 1OF8A 4JIQA 4RLIA 4U3CA 1QI4A 5AC8A 2OZ0A 4HA1A 5E70A 3BGJA 4FXSA 3C2OA 2RFGA 3A5FA 3L68A 1MXGA 1MSSA 3PM6A 3NL2A 3I65A 2AQWA 1XCFA 2Y2WA 3P62A 1WA3A 4AB4A 1W37A 3MWAA 3PF3A 3BCDA 5HWNA 3MHUA 3G1YA 2VFEA 1XBZA 1TTIA 3LHWA 2BXZA 2FJKA 3RFAA 1KXTA 1LORA 4JFWA 4AIOA 4N4QA 1LRTA 1PZ2A 3I68A 1DTUA 2QMJA 3II1A 4N4PA 1LOQA 4K38A 2H8XA 4U4MA 1OT2A 2ZTKA 1C8VA 4CN1A 2VEPA 2FB2A 2QCCA 5I0DA 3LV6A 4O10A 3SSJA 1SMDA 1TB3A 2V3FA 3OHIA 3SW6A 1K7XA 2OCZA 3KVLA 2OYMA 2TMDA 3GIYA 3ZO9A 4CKQA 1W54A 1GVRA 5F1VA 4R33A 3VGEA 5DY2A 2V3EA 4O14A 1IXQA 4IMGA 3SR7A 4Z0SA 1OFBA 1I75A 4M8UA 1AQMA 4WJEA 1W3IA 1O60A 1TIMA 1TPEA 5I3IA 3M6YA 1BEUA 1PE1A 1TRDA 1A5BA 1G94A 1J0IA 2ZZ6A 3CLWA 1OF6A 2GUYA 1R2RA 5CSRA 1FWRA 3S9YA 1LM1A 3L5LA 3NA8A 1KGWA 2GOUA 2ZZ2A 3FA5A 2ZUUA 3GXDA 3CEPA 5AC7A 2WNWA 4JTTA 3W1NA 3WMSA 5L9FA 1LBFA 5DXYA 3OVRA 1G9HA 2QJHA 2V82A 3BGGA 1UB3A 2EABA 3WNLA 3SI9A 3W2JA 1YDOA 3W22A 2CLEA 4UFJA 2C0AA 4YMZA 3EDKA 3KVJA 5DCDA 4JCLA 4NX0A 2FTPA 3BUQA 4WF7A 4WXYA 1TPDA 4CVWA 4GWEA 2B4GA 1W3TA 2C18A 3UEQA 1KV5A 1OYBA 2WNNA 5FI8A 2CLMA 2FLIA 4GIAA 4IMEA 3TJXA 3A47A 5K2ZA 3IV3A 1VJSA 3W88A 5G2IA 3HIJA 5DO8A 1I2NA 1JF6A 1MXSA 4CGTA 3USBA 4U31A 2AAMA 3W71A 2YW4A 1A53A 3ABOA 3HBLA 4UFMA 3V1PA 3UYCA 3W1AA 3EJUA 1HX0A 3W7QA 1W5NA 3K8KA
chains in the Genus database with same CATH superfamily
3PPSA 5HJGA 4MNQE 5I28A 4BF5A 2AHIA 5JOFB 2Q10A 2OYLA 3BN9D 5IHUL 1XR8B 2DF3A 4AC1X 1LEGB 4DNHA 5LIWX 4LCWB 3NSDA 1YEYA 5IRPA 3TA3A 1DKWA 3DX7B 1BVKB 1XIMA 1RP8A 1AZCA 3NVQA 5BXPA 4PY8J 1BMWA 3QC3A 2J8FA 4GFSA 5DMIH 3WNMA 1DQQA 4H6RA 1MHEB 1ZTXE 4QY8A 1B4JL 3SADA 1HU8A 1TTGA 2AJ3A 3QMRA 4L2LA 3TMLA 3TT3H 3FFDA 4OTXL 2YPLD 1ZVHA 1KGCD 3D39A 2E9JA 4GQQA 4FTVA 2W0KA 4GXUN 1AQHA 1SF3A 2H3DA 2CGRH 2PCYA 3FL7A 1SR9A 3MRHB 1E7UA 5HGHB 1TMQA 2J55A 5EUKA 3GSNA 1UT9A 2O55A 3A3WA 4DGYL 3L4XA 4DYKA 4UFKA 4X7DC 4LP4A 1SN0A 2FAUA 4C7FA 1GOKA 2P43B 3APTA 1OP5H 2AABL 3JTSA 3VAVA 2XZ7A 2PW2B 1PTGA 2LLEA 1MAML 5F71A 1O6TA 2DZPA 3UJJH 2R1YB 2NCMA 4G9DB 1YN6A 1MFEL 1AZUA 4JDTH 3R10A 5EMJA 4PS8A 3IV8A 3DJSA 3MLXL 1ODZA 4V2XA 4Z2HA 3TWYA 1EJOH 3W37A 4YDVB 4FQXD 3UC0H 4IGBC 1JPKA 2CALA 1RZKC 4DRSA 4LCQA 5E9DB 1B0IA 5IEHB 4LGRB 3BLFA 2VUOA 2ALRA 2QAPA 2X89D 3ME3A 3SDCB 4K94H 3FT2B 2VUNA 1MCQA 1LEKA 5DRWB 3IF1B 1CLXA 3NO3A 4UT9A 3QXAA 3LIZH 2C16A 3H7VA 1N4XL 3TESA 3TSMA 2IWGA 4P23B 4A8IA 1TEYA 4LVHB 4PRRA 3ULVE 3WUWA 4MNGA 1W31A 4I3GA 2FTAA 1ET7A 2ZXQA 4P49A 3AXXA 3SOTA 3W70A 5DMKA 3VWJA 6ALDA 3ZKQD 3RDTA 4DX3A 4LCYB 4ZXLA 1JHLH 4XO7A 4G7EA 2NW0A 1P6AB 2J75A 3LGEA 2CNCA 1QPPA 3U57A 3PJSA 1JVNA 1ITQA 1SZFA 1HJVA 1T83A 4OUUA 4FAAB 1M7IB 5A8GA 3NSJA 1AJZA 2WO4A 2YD0A 1BF6A 1P43A 2A3CA 2EDXA 3R6IA 4B41A 4DKFL 3I2CL 2A6KB 2YFOA 2EDDA 3A21A 4IS6A 4YDLC 4ATDA 2QJMA 5HJXA 1JZ6A 4F80A 4UYPA 1K9TA 4UM9A 1LGVA 1HKLH 1B2YA 4Q6IA 2X10A 2E5CA 4HAFA 2B1AL 3N19B 2D3LA 3U36A 1F2QA 1C08A 4KV5E 3H3BC 3UBFA 3QIWB 2YGOA 4AOFA 1HQRA 4YBHA 1DVZA 2DYSB 3H7RA 1SSDA 2R2HB 1EANA 3MHZA 4XKYA 3L67A 4K7PL 1HESA 1X1OA 4HYRA 2WW5A 5DXXA 2YUVA 5IMMA 1HILA 1XBXA 4AD5A 2EAEA 2JKRM 3TW7A 4M6PA 2QT3A 3NL3A 3SGKA 4B7LA 2GFTA 4YVXA 4W7VA 1AJ0A 3S9IA 1D5MB 4Y4KB 1FWNA 2XI9A 4OECA 3E2HC 2XICA 1FWIC 5MEQA 1QPXA 3H2PA 1RJLA 1S46A 3RM4A 4JUTA 2WBWB 4U6YB 1YUHA 3MRMA 3L6FB 4LPVA 3NZGA 3J2PA 5IFJB 4RAHA 1VJIA 4M5YH 4JR9L 4UUJB 3RIAK 4C6KA 1EFZA 2QW5A 3EADA 4AZ8B 4M6NL 5BS0A 4U1IA 1RJRA 2XRAH 4LCWD 3WYRA 4AEOA 1DWIM 4RMUA 4LYQA 1AL7A 4AK1A 2OP4L 1XM3A 2EIZB 2WW8A 3TBYB 4GUGA 5I02A 1LDPL 3EIFA 3VFLA 3BPCA 1LQ2A 3CUZA 3UFIA 3BXNB 1GKOA 3AUJA 1WFJA 5JLZB 2X4SB 3E9TA 4NQCA 5A94A 4Q9QL 4HCRH 1IGTA 1YPZE 2CBTA 2VX4A 4E6MA 2QGCA 2XPGB 4H2CA 3P77B 4AV5A 2WQAA 1KIUB 2CXEA 1QR1B 1SUXA 2IXUA 4GEJA 5F96L 4L5FH 1NFDA 3EEGA 2V5RA 1AW1A 3V0DA 2PZ0A 4DVBB 4PGZA 4I2XE 2Y3NA 3DRTB 1BLNB 3D50A 5T3ZH 1QNPA 3L5AA 3W2MA 4D9PA 3SE9H 4MZ8A 1KCSL 4WJ5A 4Z78B 1QUNA 5LGHH 4G8GE 4XIMA 4KK8C 4L37A 3LHAA 4OU3A 4DLMA 3DOIA 4WI5A 1B9KA 3I2CH 2PRMA 2BTMA 3EWYA 4M19A 4JPWL 1JZ7A 3CUIA 1WS8A 2QPUA 1QQDB 4R3UA 5AZ2H 2JKXA 4MVBD 3SOBH 3T0CA 5DC9B 4EAYA 2J4WL 4TUJA 5J6GB 4XE5B 4AITA 1OIFA 3HC0B 5E5MA 2DIJA 4PL2A 2XA8H 4MDOA 1JGMA 4LIQE 1PGRB 3QK0A 1KXTB 3MYZA 3MJYA 1V7AA 1L9SA 5EU7E 5E9DD 5BYWA 3MC5A 4AYMC 3FOLA 3TBTA 2L7EA 1K02A 1XPGA 1I4NA 1FYTA 3SDCD 2HJFA 3MA9H 4K9EC 5FYLH 3FO2A 1HJXA 3TF7C 4IRSB 4WIWA 4GSRA 2WWMD 4KJPD 2OJEB 1FZKB 5DWUL 3FB5B 4L4TE 3M0IA 4H3DA 2L7UA 4AKQA 4U0RB 4A2RA 5JDSA 5IW6B 4P23D 5I6MA 3DFTA 4GYKA 3QORB 5K93A 4HD5A 3S5NA 4M5ZL 2I9EA 1G5GA 1JGEA 4ZQNA 1EZWA 4BZ2L 4AYID 2W65A 4CAGA 5JA8B 2YPLA 5B22A 2IWFA 3V9CA 4LSDA 3L5WB 5KYUA 3I6GB 2E1DA 3F2BA 1P0KA 5C0AE 3PHQB 3FYPA 2Y0FA 1UZ4A 4O19A 4JS3A 1F3EA 3W25A 4KZCA 5L0QC 2QVIA 2HS8A 2ADIA 3JWDH 3NSFA 2IADA 3IANA 4PJFA 1MQ8A 1HWHB 1AQKL 4UTBL 4KX8A 1TTRA 2FIQA 2IV9A 3OAUL 3SJVE 4JKMA 1KJ2B 4WNSA 4LBAA 2ZZ7A 1A0DA 4JIRA 1N0LA 4X6BA 3NGBB 1UD5A 4MRCA 3D6GA 5CEZL 3OPZL 2PC8A 1HHKA 5LUMA 5H8MA 1MW1A 1NKGA 3AXKA 3QIWD 1JXJA 3P7YA 4QDWA 4LLWB 4FQXA 4RPPA 1JYNA 4E2VA 3SD5A 1D5XA 1UKSA 3RNDA 3O8XC 3L3HA 1C8XA 1P2CA 1MLCB 2X89A 1OF2A 3K1DA 4KF1A 2O56A 3S2JA 4WY0F 3RFRA 2QR0A 4XPAL 2R51A 2NNRA 3D12B 3W28A 2Y5EA 3DOSB 2EKSA 4ZUVB 1AP2A 5HGAA 1XRTA 4Y4KD 1TENA 4OJFH 1EHKB 2CO2A 1XIGA 1JPGB 2QELA 3FTGB 3GKZA 3BLDA 4R97C 4C54A 4KGLA 2BDNH 2EICA 4X6FB 2YB4A 3ESMA 4ZMPA 1BAWA 1AE6L 3W00A 1CI5A 4FNLH 3LXCA 1RERA 5IESH 1ITUA 1LROA 4NXKA 4AXWB 5B21A 5I1GH 4JM0A 5AHEA 3HNVL 4MX7B 1H4PA 2KI6A 1TFHA 1DLHA 5CZSA 1GG0A 4XP1H 4PJEB 3AAZA 2DZUA 5F2GA 3EPOA 3ID7A 3OAZH 2ZA3A 1U8LA 5KVGE 1XF2A 1GORA 4ZW8A 5LNGA 2MCG1 2MQ3A 1HI6A 2BWIA 1X1ZA 2EIJB 2UXTA 2FDSA 4ZEPA 1U2HA 5T91A 2G4EA 2QVMA 5H2ZA 3K91A 1VFFA 4CEXC 4MMZB 5C08E 2OU4A 5KSBE 2Y5SA 2OMYB 4ANUA 1ET8A 5DGQA 4QG6A 3O15A 2ENSA 3MCLL 1UENA 1GOHA 5DCCA 5E03A 4DELA 4ZO7A 4XMPH 5DQPA 5BV7B 1XR2A 4JDZB 2WZEA 1R5WA 1J0ZA 2KDYA 3OG4B 2YLLA 1DVSA 2IH3B 3AY2A 4BJHA 3VJ6B 4PJBB 2DEYX 2X05A 3FF8A 5F7FA 1D7FA 3RY5A 5BRQA 1J5OL 1IAOA 3E12A 2DQ6A 2XZZA 1QTWA 3EO1A 1KSRA 4B0MM 4HPYL 2XN2A 2VC9A 1W9DM 5HTSA 2VLLB 3FTUA 1HSAB 3JVFC 4ELKB 4GYPA 1CQYA 2B0MA 2VR4A 1MWAL 1PL9A 4NM8L 3ZE0B 4F7MB 5GGUB 1JYXA 3OPZH 4EUPG 3LV3B 2Q8ZA 1QSFB 5IXEA 5ALCL 3S36L 4WHBA 3SE3C 1VS1A 4AXKA 1AZRA 4QYOB 1BGXH 2A0LC 2Q8AH 2OZ8A 4PTUB 1BYDA 4C60A 3WD1A 3H0TA 2PTZA 1I31A 2VENA 1F18A 5LNSA 4NPKA 1I85C 4UQIM 3GRGA 3W2KA 2ZCKL 5DC0A 3UTQB 1S5HB 5FM5M 4DESA 2Y61A 4L05A 4IRSD 1W1B1 4L3EB 3LRMA 2HB0A 3K13A 3TH6A 5JOFA 3I3DA 2BIOA 1XR8A 4HZAA 1TF4A 1LEGA 4LCWA 2B16A 3C87A 3DX7A 3BQUB 1BVKA 4HH8A 4IMCA 1PSCA 3B4YA 4FF9A 1PBGA 3HHMA 3FFOA 2HWZL 3QORD 1B1YA 4EZKA 4KVPA 2HE8A 3THMH 1R0MA 1UD6A 1PS9A 2ZRZA 4Z7WE 4D0DA 2VN5A 1KOAA 3FYOA 1QI0A 5B39B 1VFMA 4YIQB 1KC7A 4HUUB 1GKRA 2HISA 4Q6JA 1FSKC 4G42B 3DG6A 2HNEA 4MIMA 4M5SA 3H2EA 3MRHA 5DD5H 1P9MA 5HGHA 3RXZA 1XG3A 1UJ3B 5BNXD 4PWGA 4ALAC 5DN1A 1V3JA 3S3PA 2XIJA 3SJNA 1KYOJ 4LOEA 3WY2A 4QJ1A 2H6OA 1CTMA 3HGJA 5C6TH 4JFQB 3R1GH 4DKEL 5C0NC 2PW2A 1OTUD 4PBDA 4V2CB 5KZDA 2R1YA 4G9DA 4QHLA 3BH8A 4JFOB 1NANH 1KBVA 4UOW1 1M5WA 2TSBA 4UIMB 4U6VH 3EHBB 3W6YA 3IGKA 3ATDA 1A7QL 1NCTA 4YDVA 1K8CA 1NQKA 3F58H 4WW2C 2Q8LA 2VGGA 5E9DA 5IEHA 1G84A 3EGJA 4LIQL 4F4RA 1MHCB 3SDCA 2WNGA 4LS0A 1SDDB 3FT2A 3GBML 3GH5A 1INDL 3P3SA 6PAZA 1BXBA 3PAOA 2AJZB 4ODXB 3QIBB 4QWWD 4OLYH 2Z4GA 5DRWA 5TF0A 2QFPA 3IF1A 1C93A 3GRWH 1MCSA 5HGGS 4IJ3B 5DXWA 4BK4A 4P23A 5E6ZA 3WN6A 4L2YA 4WI9A 4RGOL 3BZ4B 3CU7A 2Z31B 3ZDYF 1J79A 4XAWH 2GPTA 2WN2A 1OB1B 4AVJA 4LCYA 4LLUB 3SQOH 1I1CA 5DJ0B 3RJYA 1Q6OA 4YMPA 5HMFA 4UANA 1JPSL 3WJYA 3MGAA 3TFBA 3NAAH 1XIWC 3ECQA 2IPTH 1YC8A 1M7IA 1TWZA 3CLEH 5JHLA 4PI2A 1IE7C 3DPBB 1PVHA 4NP7A 3T7VA 1J9RA 1Z3RA 3WQ5A 6CGTA 4EOUA 2J6XA 4G6FB 4NAFB 2A6KA 1OAUL 2XVBA 2BOLA 4HYVA 2GDUA 5I1KH 5FF7A 1HO4A 5FK9B 4WGKA 4R83A 2HJPA 2PDLA 3G6LA 3S5YA 3KPSE 2OSXA 3GU1A 1JK8B 4P7OA 2WCPA 3QIWA 1AO7B 2MUCA 2W9DH 1B4LA 3ECWA 3LNGA 2NZIA 1TQCB 2R2HA 1YECL 2G5RA 1A5AA 3LZNA 3VW3L 4XAKD 4PG2A 2PP0A 4FFYH 4N7QA 4MCNA 3TURA 3LZ5A 3TEWA 5DRXB 3BL3A 2V2DA 3KWUA 2PWHA 4QNWA 2G0WA 4KK6D 2Y6TE 1ZDQA 4GZIA 2Z1XA 4ANKA 2HK0A 1NJ9B 3DV4B 2PETA 1QSFD 3KCJA 1D5MA 4Y4KA 4GRLB 3W3OA 4Q89A 4ETQA 2ZRVA 1AGDB 2MWCA 3GSRB 3UO8B 1O7SA 1RVFL 4PJ9C 4DXKA 4PYSA 4U6YA 4ZQOA 1XISA 4N9EA 3L6FA 5IFJA 1B0WA 2VDOL 2GQHA 3W38A 1XF3B 4X63A 3S34H 5H91A 3WLIA 2DQUL 3LH2L 4UUJA 4L3ED 5ICXB 4AZ8A 3TC9A 4O9HH 1E5AA 2WWOA 4G71B 1MI5E 4DZHA 2AKMA 3BQUD 5D38A 3LS5H 1ETJA 1OHQA 5KETA 2EIZA 3KM2A 5CZVH 3UTSA 3TBYA 4IDLA 3N9SA 1JPDX 2K4WA 2XJKA 5HQLA 3V9EA 3GS6A 3VOJA 5JLZA 2X4SA 3NCYP 1GYMA 1A6AB 3BWSA 5CJQH 1F61A 5GIRB 2XPGA 4ZUUB 5F1NB 3P77A 1QR1A 4PJ7E 5F89B 3O2VH 1SMAA 3HHSB 1XWYA 4DVBA 2B2XH 3HAEB 3DRTA 1BLNA 4ZFOL 1KELH 3E2SA 3WUEA 2VYRE 3BCJA 1KULA 2DH2A 3LCGA 3UNTA 3IJ6A 1JCXA 1VFLA 4Z78A 3KCLA 3JZYA 2IGFL 3W39B 5T33H 3CK0H 4U0QB 3IIXA 4AEHL 4L9LC 5E2UH 4K8HA 4NUWA 3UGUA 3KBFA 2FT7A 2ARWA 1TG7A 1QQDA 5E4EC 3BAIA 3BAXA 4WCJA 1BBDL 1ZJHA 4Q4QA 4PG9B 5FJUA 1WFNA 4ELDA 5J6GA 2LTQC 3EHBD 3HC0A 3LNIA 1W37A 5TQ0L 4HUWB 3MHUA 1YECH 1TTIA 3AIQA 2BXZA 1MJJB 1KXTA 2W9EH 3MJ9H 1WBYB 4NT6A 5CIPB 4GFIA 1OT2A 5TE6L 4O10A 5C0IB 4LAUA 3NGFA 5E51A 5E08H 4Q6YA 5EO0B 3SR7A 1W3JA 2VAJA 2YEZB 2OJEA 1FZKA 3QIBD 2XT1B 4OCSL 3FB5A 2OWWA 1Q13A 4FDWA 4G82A 1J0IA 2GUYA 1IB5A 3BTNA 4B53A 5IW6A 2ZWKA 2C5DC 2ZUUA 3V6FB 4FAMA 1ZK5A 3RX7A 3QORA 3W2JA 1KFAH 4RCAA 1JCTA 1FGVL 2Z31D 3IV3A 1VJSA 3L5WA 4AQ1B 3I6GA 4C90A 4LEEA 3ABOA 3HN5A 2PF0A 1YHTA 4LLDB 2HX9A 3PHQA 1H63A 3M5ZA 1F6YA 1UHVA 2EIDA 4JKKA 5PTDA 1JGUL 4H9UA 3NQVA 1GGCL 4PI0A 1IQWL 2ZUMA 2JCCB 1Q6DA 3KOXA 3CFEA 3MLWL 2VDLH 3KNBB 4XX6A 4G6FD 1TV7A 1PIGA 3J7HA 4KEMA 3F7RA 2FZDA 5HI5D 2R1MA 3KL0A 5DCBA 4H41A 2DQEL 5CPOA 1PKNA 2HMIC 2WGNB 2MKLC 2VDPH 3QUZB 1LDSA 2JK2A 4RNJA 1AO7D 3TONA 1DE4B 3S6OA 2Y4SA 5G1TA 3EO0B 4LLWA 5K9KB 1SYVA 2BNQB 1XBVA 3RLVA 1A1OB 4KTGA 5U7SA 4M6ML 4Y96A 4AZIA 5D71L 4UR7A 4N3TA 1ZT1B 1QI2A 1MLCA 1IIIA 5EU3B 3LTSA 2BK8A 5HVHB 3P0YL 3V4UH 4TNFA 4LSRH 1PB0A 6XIAA 5T5NG 5EA0L 4XP4H 4WK9A 1O9WA 2QIIA 3DOSA 2NQ9A 3UO1H 4G6JH 3B0YA 3THCA 3AG2B 3L23A 4HIIB 4LDCA 3HFTA 4D6DA 1IIKA 1JPGA 3FTGA 1KWGA 9CGTA 4X6FA 4CU8A 3WKML 1KN2H 4KEZA 1W5QA 1FUNA 3N6HA 2J7EA 4HEPG 3KP1A 1WYJA 1CLVA 1IGFH 4ROQA 2HH0L 4PJEA 4A68A 1KG0B 3FFDB 1VEMA 5JW4N 2WXNA 4QDPA 1QPQA 4MS6A 5GHWH 1M65A 1FNHA 4ZG1A 2ZJSH 1KWKA 1UWYA 1QNVA 2IAMB 3V4LA 3BO8B 3E5BA 5CGTA 1EJVC 1DDTA 1UM4H 2J8UF 3QYMA 1Q6RA 1YY9C 5HR7A 1A5FL 1BYCA 4MMZA 1POJA 2GAZB 1U58B 3DO3A 1FVCB 1P5VB 4K2UH 3NURA 2OMYA 2AKRB 4KRMB 4HJEA 2YPKB 4J2PA 3EA3A 3SBWA 3BGFB 3B7RL 2C3ZA 1K5NB 4TXEA 4JDZA 4Y8EA 4AE1A 3AS0A 4OJYA 1YN6B 2G4JA 4J3OC 2IH3A 3VJ6A 4PJBA 1JPTH 1YY8B 3BOFA 4Y88A 4BSVB 1DE5A 3S8FB 3PWNA 2CM6A 2A2QT 2F15A 2VLLA 1HSAA 4ELKA 3TN4A 4YXKH 1J87A 5DD3H 1IAIH 2A6IB 3NJGA 4F7MA 3WJXA 4JN1H 5GGUA 1LEKB 1KBIA 3LV3A 4JQIA 1QSFA 1V0NA 4US5D 3SUTA 5IHLB 4C6LA 3QO0B 4QYOA 4PTUA 3R8HA 1CDHA 1WXZA 2DM4A 4FNQA 3TWCH 3QEGL 4MNGB 5TH2B 4KXBA 3WXVL 4DP5X 1G69A 3A6BL 4U28A 5HDRA 3UTQA 1S5HA 2PAJA 3BDKA 3D52A 1VFHA 5IHHA 1IUZA 2ATKB 3RDTB 1WX0A 2PABA 4AQLA 4L3EA 4XVUC 2C3WA 3MRBB 1E4NA 1ACYL 5CXPA 1UZDA 4LVOB 3BQUA 3PJSB 4IZGA 1I1RA 1FA2A 1X4XA 1CWVA 4ZI8A 4FQIL 1E9OB 4POCA 4W4QA 3IMUA 1O5DT 4YE4H 2CXKA 3V7MA 5GPRA 2NPLX 2A83B 5JTWA 4IUGA 1KXHA 3ZHKA 4KOBA 2HH0H 1JRCA 4GRMB 1A14L 4AW7A 4FTDA 5B39A 5JUEL 4YIQA 4HUUA 3NSYA 4GT0A 5D96B 1HYSD 2YAQA 4G42A 2XG4B 2WXOA 5CG7A 5TBOA 4KRNA 4XMTA 4AX3A 5LGJB 1UJ3A 3CFIC 4B95C 2GIXA 3EWCA 1PFCA 2HP4A 3EKZA 5JIQA 4ZS6D 1MIEL 2EDJA 4Z8FH 1ISVA 2Y9RT 3M0KA 3PYCA 4JFQA 2KH2B 2X0UA 1GCYA 1TTBA 3D8MA 3PPEA 4HX1B 2ZAHA 4JFOA 2C4XA 1CLYL 2NX3A 4LUYA 3TTEA 4UIMA 3QUZD 1CGYA 5TAOA 4B91A 2XZAH 1U2CA 4L1XA 1Y5WA 1Y65A 4DAFA 4JG1L 2BNQD 5J06A 3MW7A 4UQBA 2GY5A 2WSYA 1CK0H 1MHCA 3W1QA 3RX2A 1YJDL 1SDDA 1TVPA 3S96B 4LVFA 5DT1L 3NYDA 1G0XA 4RDWA 2AJZA 2C1HA 4ODXA 3QIBA 5FV1L 1OX4B 3Q05A 2RKXA 4UQDA 1AZZC 3K2GA 2EEAA 3MSDA 1UB5A 4GIRA 2R0WL 1QBAA 3CBWA 9XIAA 3BZ4A 2DJXA 1T1WB 4Q8BA 1Q4NX 2Z31A 3ISWA 2WYTA 1UA6H 4NASA 4NQCB 1G4TA 3F4WA 5IOBA 1OB1A 4LLUA 2HSIA 5DJ0A 5D7IF 1UJQA 3NZRA 2VDKB 4J12A 4HNOA 3DYOA 2IAMD 1BFTA 4D71A 2P45B 4JVPA 1OCCB 3S48A 3QUYA 1UWUA 5A3ID 1F2JA 3MDJA 4X2RA 2O6PA 1VEPA 4G3YL 3DPBA 3APDA 4Q9CA 2FPYA 5FA4B 4L9YA 3BP5B 4I85A 1QJWA 1UR3M 4NAFA 2WMPB 2Z7UA 4RGMB 4LF1A 5CPSA 1T41A 4Z7UE 3H42H 3UD6A 4TULH 1BW8A 1GHFH 5FK9A 2OT0A 1QTSA 1F6AB 2V7NB 2F68X 2IH1B 3S2MA 3Q67A 5CU9A 4OM1H 1JK8A 2YDSA 3M5VA 3BZGA 1MNUH 2ONEA 4N8VG 3JUZA 1F13A 1A5MC 3EJPA 4NRXA 4GAJL 4RLDA 3BPOC 1KLZA 3K4WA 2QQKH 2VCAA 2ZPKL 5DRXA 3WLPA 1MEXH 3GSUA 1C5DB 3SUUA 1HQ4B 3APFA 3O0FA 3QJRB 1XGPB 2DN7A 1M68A 1NJ9A 3DV4A 1J9QA 1UASA 1WCGA 5KANG 2AQPA 4GRLA 4MWAC 3WLQA 2Q86B 1T1YB 1AGDA 2GSJA 2ZAIA 3IETB 5A8QA 4XUYA 1J93A 3GSRA 1DYZA 1UWEL 3FRPB 2GI0A 4HVBA 5DT5A 2EDKA 4OZGF 3KYOB 2OQHA 4BI6A 4HLJA 2ZUWA 3KPRB 1XF3A 4QCIB 2Q3XA 1T03H 5JBEA 2ZYRA 1KUMA 3MCMA 3RDTD 5ICXA 2D4DA 4MLJA 2LFEA 2O5NA 1NIBA 3S1VA 1OZUA 2QCMA 2I27N 2OMWA 2ZDRA 5FIEA 4PJIB 1CR9H 2GQ9A 4JFFE 5KSUB 2GLKA 4BFOA 4R9HA 2BP1A 4ODBD 4KI1A 5HHXH 1A6AA 1CTNA 3P0WA 5GIRA 4ZUUA 5F1NA 3M8OH 1QFPA 1A0QH 2PSNA 3TBCA 2HKHL 5F89A 3HHSA 4NOFA 3HAEA 2R56L 3BDBA 1L0YA 3IFPB 3CMFA 5J3HD 4LHUG 1PSKL 1H15B 4F8QA 3OWRA 3PE9A 2NQ5A 1FLTX 4A55A 4WWKB 3W39A 3O3BB 1L3WA 3FT3B 2DJMA 3L7FB 3GDMA 2GI7A 1JFXA 2UZ9A 2NDFA 3SCMC 4W70A 4B27A 3OGSA 3UXDA 4PV9B 1IRAY 4DK5A 4OFPA 3NPUA 4N0YH 4JPKH 1F8IA 4HB7A 5FF0A 2FHBA 3CH9A 4PG9A 5CCGE 5T3XH 1ODUA 4US5A 3H9HB 1CXHA 1AY1L 3FXIC 1KDJA 4KRZA 1EK3A 3WD5H 3F6IA 4HUWA 3SGGA 2VDQH 5C7ZA 3PTDA 1EIXA 1RUKL 1MJJA 1WBYA 1BMGA 4C8XA 5LZLA 5CIPA 1QCWA 3OKMB 3Q37A 2G96A 5C0IA 2E7CA 1HT6A 2FQIA 3QPKA 5A6BD 5EO0A 4XC1H 2CHNA 5FCUL 1WUZA 2FSEB 2Y7LA 4FE9A 4GH7B 2YEZA 1U1JA 4CD8A 2ED7A 3SO3B 3PWJB 3FCSB 3QQDA 4KCVA 4IGMA 4CNPA 1E1EA 5K1NA 3BAYA 3V6FA 1FL6B 2Z1BA 2J71A 4TO8A 2JJSC 3UACA 4Q9BA 4PJXF 1X5KA 1NCGA 3C56A 2OKMA 3W0WE 3NCWA 3Q2LA 4W9ZA 1RZJC 3MSGA 4HCLA 3KG5A 4NQCD 2X12A 4M1GH 3AMCA 4AQ1A 2VLJE 3N42F 2A99A 4POUB 4KWSA 2HT2D 4FMVA 1T6MA 4LLDA 2BOEX 3H2QA 5L9DH 5IM51 1OARH 4KCUA 3KPMB 1H8SA 2J9XA 4HG4J 5A8PA 1CICB 3COTA 3WMQA 2I5YH 2DBLL 1SEBB 4YU1A 1MCPH 4Q58C 2CDGB 5AL0A 3ANVA 2JCCA 4R4ND 3NCOA 5BPPA 3KNBA 5J11C 2Z27A 1EYWA 3L3IB 1T3FB 1NAL1 2RUSA 1YMME 2CGZA 5A6SA 4A1RA 3L5XL 4WSJA 3RAJL 4O5LL 1QRNB 2ZAGA 1ZLUK 2C1IA 1J01A 5HATA 4Y2LA 4XWGL 1JZ8A 1F6LL 3QUZA 1ZGLM 2QCHA 1HJUA 1AC6A 4XPHH 4U5KA 4AZ6A 1QHOA 1ZJAA 3EO0A 4N87A 4YCOA 2YEQA 2B4CH 1P6BA 5CLZA 5K9KA 4ZTXA 2BNQA 4GY7A 1R24B 1A1OA 4OOZA 3ZYJA 1F4XH 1ZT1A 1ISYA 1VFSA 1TPUA 3R12A 4HIXL 3W7MA 1EXHA 4XBEL 2NVDA 4GAGL 5EU3A 1XEDA 2JJTC 3UZXA 2HTKC 5ECVA 1T21B 1ZNNA 4P4KB 3A9IA 2VDMB 2VDNL 4LCUB 5DZVA 1Y18B 4F2FA 5IV2B 1AQDB 3B2DC 4YBLC 4HMCA 3SPGA 2G37A 4HIIA 5SX5H 1H51A 1PD0A 4MD0B 2J7LA 1WTLA 4A2HA 2BM3A 2CLVB 4NNPL 1DFBH 4HHAB 3QHFL 5FYKH 3KBNA 1QOPA 3QQ0A 3VFNB 1JDEA 3KPRD 3MBXH 1RUAL 2QKIC 4D0DB 1L9PA 2CO6B 5I1JL 1HCYA 1KG0A 5FOBB 1PPIA 4G8FB 3MHGA 1WV2A 5G4NA 5CSYA 4ZX3A 5FEPA 2IAMA 4LAQH 1IM9B 1ZLVK 4AGPA 2V5DA 4HNCA 3BO8A 2EYTB 2PPEA 3IVTA 1R3IL 4B9CA 4GH3A 3HGSA 1BLIA 3BD3A 4CC4C 3FUNA 5FLVA 2GAZA 1U58A 1FVCA 1P5VA 2AKRA 4R27A 2YPKA 3O6FC 2DUZA 1UFGA 2IXVA 3BT2H 1K5NA 3PC0A 1TSRA 1C92A 3PPFA 3Q7JA 4QHLB 1QZ1A 3BH8B 5C6WH 1SYTA 4V1DB 4DPRA 4OQTA 1DZBA 1BG4A 3NIDB 4L23A 3LNDA 3WF0A 4G7YH 3VFUB 1YY8A 1T7WA 3VFSB 4BSVA 3O4LE 4WWKD 5C0EB 3O4OB 1S1PA 2Y06L 2YL9A 2YAHA 4QRPE 3F6LA 4PBVC 3OJDB 3Q6GH 3QUMB 1GC1L 2A6IA 3RAJH 4OJEH 4N0CD 4AYBA 4F0LA 1BFNA 3MUGB 2VXVH 2GGIA 4J23A 4OVUA 1NCDL 3RCYA 1I3GL 5EDXA 2PGEA 2DSKA 1Q7QA 1D7KA 2NXIA 3QO0A 4Y9BA 3R4RA 3LB6D 2LAGB 1RXLA 3GUGA 2ZOLB 5C2CA 1Q90A 3VOCA 5TH2A 4HSCX 4X6CE 1L7IH 2VCCA 3HPLB 4GAGH 1P6CA 3WTYA 4PSRA 5A69A 3IWUA 5D1QE 2ATKA 5XIAA 2ZRWA 2RDTA 4D8LA 1YCSA 3MRBA 1CCZA 1YE6A 3HPFA 4FOJA 3DSFL 5IHUH 2IQTA 4HNTA 3NFUA 3TR2A 2F84A 2JKJA 1E9OA 2WB5A 3CN4A 2QCNA 3MP5A 5E23A 4L18A 1ZRUA 2A83A 3VG0L 1B4JH 1J8HE 4CKVX 3VIHA 2APXA 1PMYA 4GRMA 4OTXH 1VLWA 2QNEA 2BS8A 3O05A 3MPGA 2XG4A 1PVNA 3CX2A 1L9TA 1CICD 1PX8A 5F7WC 5LGJA 1HJQA 4FA3A 3OQ8A 5CJ8A 1DSWA 4N85A 3GUTB 5JPNC 5DMMA 1FHNA 5FJJA 4DGYH 3MTXA 4KI5F 1S7XB 4JTHA 1LQ0A 1FWWA 1W2KT 4Y8FA 3CE1A 2AABH 4DI8A 5J4MA 1MAMH 5JIWA 4HX1A 4HFUL 2GVEA 4Z6AT 1MFEH 4HIBA 1I8IB 3U9PL 2JB6A 1E8ZA 2A2IA 3MLXH 2X6BA 2ZBTA 4HNUA 4ETQB 3CXOA 3LEVL 2LT9A 2OR8A 5I78A 2FZ9A 4A8LA 5HYEA 4KQ0A 4KRTA 4NSKB 1J10A 5E1GA 3W11C 4QJ4B 1G4SA 1FNEB 2JV6A 3WMPA 3S96A 3TM6A 4P4KD 3W7JA 1QNRA 4POZC 2V63A 4A6YL 2E5BA 5A6BA 4DN4L 3QTPA 2HXAA 5DRCA 3W2LA 3RY4A 4RNHA 2MQCA 1OX4A 3T8MA 4MAYB 1U95B 1N4XH 1PKLA 5BZDB 5HMEA 1XT5A 4K0OA 3UTSB 4P5TB 1ZV2A 4KXZH 2O30A 3G1YA 1RJZB 1T1WA 5KBLA 5C86A 3SGJC 1LRTA 1D9KB 2EH7L 3HZVB 1ZGLP 1FC1A 3T0DA 2XDFA 5IBLD 1VIZA 3ZZ1A 1IKNC 4R33A 3OKOB 2POZA 1IM9D 4M1RA 1OFBA 1Z9SA 1BCIA 2FBRA 3M6YA 1NUGA 3EA2A 2J6EA 4KXDA 2ZZ2A 3U6RB 5FA4A 3QKZA 4DKFH 1G4MA 3BP5A 3P4OB 2WMPA 1YDOA 3W22A 2L0DA 2FJGB 1TETL 2OKOA 4WFGD 1YW1A 3AU0A 1F6AA 2V7NA 5BO1L 2IH1A 2ENJA 4V1DD 4F9PC 3UYCA 1HH6B 2B1AH 1JZJA 1NA8A 1HHGB 2JF6A 4XIAA 1BGAA 5A43C 3K30A 3QDME 1Z8AA 1V5XA 3RFZC 4NT6B 4K7PH 4IMAA 1AA1B 3KZPA 2E6AA 3HZMB 1NU5A 1II4E 2E28A 4HFUH 4R5TA 1C5DA 2QV4A 4FIQA 1HQ4A 4F0RA 3FJ4A 2J73A 3IPEA 4U3HA 1XGPA 4D3CL 1YNPA 4UTUA 1UCBL 4PMRA 4RA3A 4XP5L 2H8PB 1AANA 2Q86A 1T1YA 2Y8KA 1VZWA 3IETA 1QHPA 4W7WA 5LDUA 4F2TA 3CZEA 4YUEL 2PP9A 3QW9A 1C8QA 3FRPA 4YSUA 4NZ3A 1QLRB 3M41A 1I0DA 2E5DA 3KYOA 3VAEA 3KPRA 4G1EB 2CKBL 5GGVL 1ZALA 3OB0K 4L4JA 4QCIA 2CLKA 2HVJB 1W56A 4JR9H 1ZTXL 8FABA 2VRKA 1X7FA 2OL3L 1XAKA 4V15A 4M6NH 1UM6L 1JMXA 3VI4F 4FB7A 3MP3A 4MDIB 4GGBA 1A6PA 2G8ZA 4PJIA 5BW7A 1TZGL 3WK3A 2E8YA 2OP4H 5KSUA 4WHTB 3L12A 1GZGA 3HQOA 4NHUB 2RTTA 1LDPH 3GSMA 3AU6A 1GHSA 2ZWNA 5IB3B 2VDHA 3CFEB 2X6VA 4Q9QH 3WN5B 2B31A 1G9NL 4XZLX 2FQEA 5CC3A 4RGNB 3TROA 5F96H 1PUDA 2JXMB 1PLCA 2M2DA 2XBZA 1ZANL 4JTKA 4BQCA 5HK4A 2XVPA 2Y1HA 3IFPA 5HDWA 1H15A 3VZXA 2DQJL 1KCSH 1AHMA 3VA8A 1M1XB 3QXDB 2I14A 4WWKA 1SYVB 5E9XA 1N18A 3O3BA 3FT3A 3EJYC 4KEVA 3L7FA 3MUZ1 1SXBA 2VIRB 1TETH 4G8TA 4JPWH 2CSPA 4ZJ9A 4FFZA 2GKIA 4PV9A 3CS2A 5T3ZD 3P0GB 2EKGA 2WXPA 1NCCL 1TTJA 3FK4A 3WDIA 4DP4X 2XHNA 1BEYL 3H9HA 2PPCA 1GK8A 1WZKA 2J4WH 3RR4A 3KBSA 2GJ6B 3TYDA 4PJAF 3P69A 5EBLB 3V6OE 2W4XA 5F3BB 4HN4A 1E55A 3T8VA 4PRAB 3OKMA 2ESVB 2MSPA 1OAJA 4X83A 4W5ZA 3ULVL 4XV0A 5D4QA 4NAQA 2FSEA 4QGTA 1SJAA 1IC1A 2XACC 3GWJA 1ZP4A 1E0VA 4OLXL 5DWUH 2AQ2A 3PWJA 3FCSA 4UFIA 4WENB 4MAYD 5JHAA 2VE6B 4FXGC 3P11L 4JL1A 2X4QB 1JN6B 4FXKB 4BINA 2F38A 1XYAA 4EF8A 1FL6A 1TO4A 3UTSD 2VN6A 4P5TD 2J1YA 4ONHB 1WDAA 5KAQF 5BJTB 3QZWG 1FWEC 5AW7B 4M5ZH 3ZE2F 1MW2A 4KKAC 4JJHA 4BZ2H 3TA4D 1D9KD 4X4KA 1MY5A 4BQ4A 2ZZ5A 1AG0A 4UMSA 1ZS2A 1HP4A 2V5CA 4E9QA 5KBDA 3V4VL 1GQLA 1CGSL 3BAEL 4Q32A 1E9PB 4L29B 3KPMA 2DBJA 3DI2B 4ES8A 1TZGH 1CICA 1SEBA 1B3VA 2CDGA 2LGNA 2VFIA 4LCRA 2JELL 4B9PA 2EUWA 2PTVA 1EZLA 1AGCB 3PWNB 3T0TA 1UOZA 1AQKH 4UTBH 1NGXB 3UTPD 3OAUH 3L3IA 1T3FA 1TWDA 2FX8L 1QRNA 1QNIA 1KN4L 3CZKA 2B7OA 1M05A 1ZANH 5EEZA 5CEZH 4F0MA 2YRLA 4X4YB 4OF6A 2CYGA 3IRZA 2DQJH 1C9SA 4DKTA 1R24A 3RWFB 4EACA 4B5VA 4RDQG 3AYRA 4FQJL 3CAKA 4TMBA 2FHFA 4ZO6A 2VDIA 4OD3L 3UX9B 1T21A 4P4KA 3MYOA 4XPAH 2VRAA 2DGAA 4LCUA 1Y18A 3NQFA 5IV2A 1ICSA 2XH0A 1AQDA 4I88A 4QRQB 4YSOA 3NXLA 1R9FA 2O4QA 2Y7NA 4XXWA 4MD0A 2CLVA 1PTZA 3TV3L 3KVPA 4WAFA 4HHAA 4U1KB 1WO2A 3M0MA 2F5BL 2F2KA 3EPNA 2NY4B 4QGYA 1AE6H 2E75C 4HTYA 1E4XL 5LNUA 5I6LA 3R2GA 4JPQA 2R2BB 3HZKB 3VFNA 3HNVH 1WPCA 2CO6A 2A3AA 3LIZA 4DBUA 3FHAA 1R47A 5FOBA 4G8FA 1A50A 1JDAA 3OQ3B 2PD9A 4GXMA 4MD5B 3BPNC 1IM9A 3FBQA 3TEUA 2FUTA 1KB5L 1AAJA 2EYTA 3DJ9A 3DFHA 5XIMA 1SXAA 2ICES 3KPOB 3HS0B 3K0YA 1SVBA 3KEHA 4J9JA 4HH9B 4GAFB 4QHPA 4YAQB 2C14A 4HIPA 2XBTA 3MCLH 4XVTL 3G6JF 3JS3A 2B7NA 4MSSA 4K5OA 4RGND 1CGSH 4TX8A 4MJMA 4V1DA 3WFZA 4UTIA 4X80L 5DMNA 4JTUA 5F7MC 3I9AA 2GTWB 3QI9C 3IDJB 5HSFA 3NGJA 4HYWA 3VFUA 3NO5A 1J5OH 4I9MA 1BVNP 3KL3A 3ISRA 3VFSA 4HPYH 4IKIA 2F8VA 1XUUA 5C0EA 5KMYA 3OJDA 3GQFA 3QUMA 4F7KA 3VH8B 1MWAH 1OFPA 2HUEA 4NM8H 4IU3B 4HXAL 3LV5A 1WHPA 5E1QA 3MUGA 2FD6L 1R9ZA 3ZL4L 2APVA 3N50A 1ECQA 4G7QB 2PWEA 4YBQC 5ALCH 5D6DA 3S36H 1L0XA 32C2B 4J1UB 4O00A 2Z4TA 1TZZA 2GJ6D 5B1BB 1JZ2A 3MLZL 3CIQA 3WIAA 2A4CA 1OC7A 4P9HL 2ZOLA 1TSHA 1UB5B 4MVAA 4OIBA 5GJSL 1TV8A 2ESVD 3HPLA 1PY0A 2ZCKH 3DZ1A 4Z7VA 2BY0A 3UJTL 2F6XA 1WLHA 3FJ6A 4MD4B 4I90A 2FR4B 3GNML 2N4IA 2OMBA 4INFA 5HI4D 5ISZB 4NQDB 5FUOL 4E9LA 3F85A 3EMQA 4WTQA 3DBSA 4FQ2L 4KKBC 3H8NA 3QUYB 3FEQA 2HWZH 1ZE3H 1E4XH 1NM9A 3WENA 2FZMA 4Z2LA 5IBTL 3W1RA 1OLLA 4AQZA 3AB0B 3NESA 2WOBA 4G8IB 4JY5L 2GDQA 4FKHA 1PS3A 3O63A 2P7TB 3PF2A 3BD5A 2DDXA 4JTQA 5CZJA 3NSCA 2XIOA 3BIAX 1TVDA 5HHQB 5REQB 3NPSB 1G0YR 5B38B 3QC5X 1FY6A 5LN8A 3RU8L 1NUNB 1WIOA 3RBGA 3GUTA 5GRZA 5D1XC 4XD6A 1QZNA 1S7XA 4NRXB 3VNMA 3SO5A 4LYRA 5I0WA 4DKEH 1ZLWK 1SW3A 1ADQA 5GGTL 4XHJC 4A37A 2HZGA 4QE5A 3GSUB 5G2HA 1AJ2A 1I8IA 1A3LL 4X80H 4HOMA 4LOUD 5KVDE 2YYTA 3RYMA 2Z24A 2R91A 4PVNA 4KK5C 4WHYG 4X4XB 2VQUA 5T1DL 1ACXA 4P8VA 3GH4A 4R9XA 3PABB 1A7QH 1OP9A 4W68A 2UX6A 3FZUD 3AS1A 1DJQA 4NSKA 1O5KA 1E8WA 1SGKA 4N6QA 1H3TA 4NZ8A 2MCAA 3P14A 3D85B 4LIQH 1FNEA 2VSCA 4N0UE 1UUSA 3GBMH 1HYRC 1INDH 3GIZL 5C07A 4APQC 4EUPH 4NNCA 4DJMA 2X09A 1HZYA 3CSYB 2J5LB 1T89C 1RY0A 3QZMA 1U95A 4MAYA 3N4AA 1KCVL 1N82A 2OMWB 2Y7FA 4V1YA 1PJWA 4NO2B 5BZDA 4KO7A 5KVGL 4OWGA 2VUYA 3M7SA 4KIRA 2DUXA 5PAZA 1S38A 4P5TA 1ET5A 3HKZA 5JUVA 1NF7A 2NY4D 4RGOH 1RJZA 3ABKB 2QF8A 4LGPB 3U30C 3FXYA 2PR9A 4HKPA 1D9KA 1QVOB 3HZVA 2YGNA 3TYZA 3UY8A 3TVMC 1T1XB 3FS2A 1G0CA 3RE0A 3KHOA 4OCMC 4PTNA 1JPSH 5GNZA 3OKOA 4K68A 1CB7B 2ZA1A 3V36A 3BLBA 4BA0A 4X6DE 3ES8A 3ISYA 3ZDXB 3EMCA 3IYLW 3U6RA 3G0UA 1E67A 2JFEX 2ADJB 4U6HB 1NICA 3P4OA 3DXAE 3DMMB 3N2CA 3HBZA 3ULUF 2R59A 1IQ8A 3TJLA 4GJJA 1OAUH 3STCA 3ARFC 3FQ4A 2FJGA 3AGVA 1G1CA 4DBDA 1TIUA 3TN3A 3NBNA 1UD3A 3EF4A 1HH6A 1SVCP 4QNPE 1HHGA 3HOJA 4G6ML 3FCUB 5DA4A 2VDLB 2GQ8A 4LW7A 1Y0LB 4W9FC 1JSYA 4NB7A 1MDRA 1AGEB 4Z7OF 3VW3H 4XKMA 2G3NA 1RLCL 3CB3A 3NIFB 3QMSA 5HYSG 5FO2A 3RX4A 3HZMA 1OW0A 3T9WA 4KY1L 5E0CA 5GS3A 3TC3A 1DQWA 1YNYA 5T1DH 3RX3A 5ID0A 1W9BM 2A21A 4KJQC 3QQDB 2H8PA 3Q5YA 3WELA 2E27L 1TTPA 1INEL 5F7KC 1GTNA 5MP6L 4IIBA 4AIBA 1RVFH 1QLRA 4PV8B 4L80A 4P2RB 4G1EA 3ZT7A 2QJIA 2VDOH 1ALDA 1GVFA 4KPLA 3TYFB 4G7RB 2DQMA 2HVJA 2FYVA 3GZKA 2Q9OA 2I60L 4BQ5A 4LNCA 2DQUH 3LH2H 4UAOB 3B6SB 1FWAC 4C4KT 2EGZA 1FDYA 4IMKA 1KJMB 4MDIA 3PY9A 5ISZD 4NQDD 4AMWA 1FWTA 2W3ZA 1HE7A 4WHTA 1VFUA 2BIQA 3BSHA 3V55A 5C2XA 2DM7A 2WZIA 2ADAA 4H1LG 4NHUA 2FECL 1AMYA 3QUYD 4UTLA 3T9PA 3UR5A 5IB3A 3NOYA 3WN5A 2OMAA 3LGGA 3ERPA 3NACL 4GNVA 2AXFB 4XMWA 5IVZB 3MY9A 2JXMA 1RP9A 1OAXL 4PLJC 3HQNA 1FORL 2H90A 4S1QL 5E1IA 3KGRA 1CZ1A 2CLOA 4DP1X 5F88A 2F2HA 1M1XA 3QXDA 4AD3A 1J48A 2IGFH 3MDUA 4GRSA 2JH2A 2D4FA 5CUSL 4BFFA 4AEHH 4UFHA 4KU1A 4RSYA 2VIRA 3QISA 3WJMB 5ERWB 3CL6A 1H62A 1BBDH 1S3KL 5T5FL 3DKLA 4N9OB 3H7BA 1P0DA 1JQXA 3BE7A 3R8BB 4GRLD 4U2ZA 4JM4L 1IWAA 2GJ6A 5TQ0H 4ZW5A 3ZO0A 4A8NA 5XINA 4X9YA 5EBLA 2DEWX 5F3BA 2XDHA 4PJGE 3QGAC 4PRAA 2ESVA 4OD2B 4N24A 3D85D 4KQ4L 5TE6H 3RUGB 2BZ7A 1M53A 1DJSA 3WJLA 3WBXA 4NJJA 4Y6GA 3MTWA 1MELA 2XZ9A 1SHSA 4OCSH 1XBRA 4WDUA 4WCYL 2VE6A 2X4QA 1JN6A 4B50A 4Z3EA 3JZ7A 1WKFA 3QWRD 3WFCL 3C5SB 4FXKA 2WMIA 4P5MB 3RY6A 1UROA 4ONHA 5BJTA 1OX6A 4NQEE 3AHVA 3MV01 4HWBL 3P60A 2BZCA 1FGVH 2N7AA 3TA3C 3NZHL 4NFBA 1R1CA 1J05B 1LO0L 1LCOA 4S1SL 3CX5K 4HCFA 2NZLA 4NJGA 3D1MC 2IXQA 1ODAA 4FG6C 3K8LA 4KXAA 4W4OA 3LEYL 1E9PA 4L29A 4YO0B 4TPRL 4PMVA 3N34A 1V05A 3HG2