1KTCA

The structure of alpha-n-acetylgalactosaminidase
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
388
structure length
388
Chain Sequence
LENGLARTPPMGWLAWERFRCNVNCREDPRQCISEMLFMEMADRIAEDGWRELGYKYINIDDCWAAKQRDAEGRLVPDPERFPRGIKALADYVHARGLKLGIYGDLGRLTCGGYPGTTLDRVEQDAQTFAEWGVDMLKLDGCYSSGKEQAQGYPQMARALNATGRPIVYSCSWPAYQGGLPPKVNYTLLGEICNLWRNYDDIQDSWDSVLSIVDWFFTNQDVLQPFAGPGHWNDPDMLIIGNFGLSYEQSRSQMALWTIMAAPLLMSTDLRTISPSAKKILQNRLMIQINQDPLGIQGRRIIKEGSHIEVFLRPLSQAASALVFFSRRTDMPFRYTTSLAKLGFPMGAAYEVQDVYSGKIISGLKTGDNFTVIINPSGVVMWYLCPKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The 1.9 A structure of alpha-N-acetylgalactosaminidase: molecular basis of glycosidase deficiency diseases.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Hydrolase
molecule keywords alpha-N-acetylgalactosaminidase
total genus 140
structure length 388
sequence length 388
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2002-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1ktcA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ktcA01
3ATZA 2BY3A 3W3OA 1KFBA 3S5OA 4HNUA 3GDRA 1LLZA 4OV9A 1H50A 1JG9A 4LC8A 3W2JA 3PM6A 2TMDA 4S1FA 3BG3A 1L6YA 4MZ1A 4FIRA 3ZOAA 1X6UA 5FF4A 2AGKA 2Y7GA 3KRSA 2ZX6A 1TREA 4TO8A 1K8XA 4J3SA 4AYSA 1KFEA 1MXSA 1X8FA 2E8YA 4ORMA 4QAIA 2CLMA 3EWZA 3ABQA 3HGJA 2Y4SA 1EPXA 4Y8FA 1KV5A 2PRHA 1F7BA 2WPBA 1G69A 3UG3A 3BMWA 1JUEA 3W7KA 3DKJA 1L6SA 4UTWA 4TR9A 5C54A 3W9ZA 1Z41A 3UWUA 3W75A 2XIBA 2ZUWA 3LCLA 1OFOA 4IMCA 3NQMA 4IXHA 1CYGA 4MOZA 3W1LA 3TE9A 4GUGA 2EABA 5CGTA 3DDGA 3CU2A 4JYEA 1AVAA 3MI3A 1FDJA 3OA3A 4DPPA 1MFUA 4FX8A 4O1AA 1UKTA 4U28A 4HN4A 3WFZA 4KFOA 3SR7A 2V30A 2OYMA 1MO0A 2W79A 2D73A 4QSHA 1OF8A 3IJ9A 1F73A 2E1DA 3O6DA 3PBVA 2I1OA 2NX9A 2NUXA 4QAWA 1P6WA 3GBDA 2JKAA 1S5WA 3LHTA 2V3FA 3C2RA 3IRDA 3OEXA 3VGGA 3UWWA 3TAKA 1H1YA 4UOZA 1EO5A 4BI5A 3WK0A 1AMYA 3QRHA 1LZOA 4I7UA 5HNRA 2ZZ6A 3QYQA 5AC6A 2WPGA 1HVXA 2DJLA 2P1FA 2V5LA 2VELA 1L0PA 1MXGA 1Z44A 3EX1A 2UV8G 2AAAA 3MO7A 3BAXA 5HWJA 3AXHA 1B9BA 2EPHA 4UTHA 3W1XA 2WNZA 1JD9A 4PCFA 4IUOA 2OW6A 1GOXA 2RKXA 1WZLA 1P0NA 3QSRA 5HINA 5G2WA 1NOFA 1AW5A 1IIHA 2VFEA 4QM1A 5D30A 4WY0F 1WYIA 5AHNA 4ALDA 2EACA 3LRLA 1R46A 1W31A 2Q8LA 5AC8A 4JX4A 4UQCA 2VFFA 1H51A 5F4WA 2G3MA 1JCYA 4LWWA 1KM1A 1ZJIA 4JTFA 4GUFA 1B2YA 1D3HA 3GX9A 1G94A 2Y24A 4O18A 1OT2A 1UBSA 2CLIA 1MEHA 2QKFA 4M6QA 4AHPA 3EB2A 1DQXA 1OFPA 1ZAIA 1OYAA 3Q2DA 3HPSA 4PC8A 2C15A 1SFLA 2V2HA 3P80A 3DFNA 1WP6A 3LXCA 3QQ1A 1TPH1 1TMQA 3NPUA 3N3MA 1EA9C 4RLIA 3LV6A 4RZ5A 1DVJA 2D3NA 3C0JA 4Z1AA 2GJNA 4HNVA 4H8VA 4O28A 1FY6A 4M56A 4N9DA 5AYXA 2FDSA 2WQPA 3NL5A 1AW1A 3P7YA 2EEXA 2YJQA 5C55A 3DFPA 2AQWA 3VMOA 3OBKA 1HX0A 1WAUA 2ISSA 4IPIA 3W1NA 2C1HA 3L0NA 1E3XA 2ZE0A 3EJPA 3L4XA 5G1TA 3T40A 2JGQA 1O5XA 2GVYA 3MBDA 3V1PA 2Y62A 4TMCA 3N9SA 3P60A 4OU1A 2X1TA 2FH6A 3BVTA 2OCZA 2DJXA 4RR4A 1XBZA 4A21A 1I2RA 5G5IA 2Z6IA 3BLKA 1U2YA 2YA1A 5LHFA 2DH2A 5HULA 3SZ8A 1R2TA 3R89A 3W07A 1LCOA 3TONA 2XWEA 1WOBA 4LVAA 2ZTJA 2X2IA 1CGYA 1TO3A 3GXFA 1TV5A 1ZJAA 3F4WA 4UXDA 3JS3A 1QI5A 4DELA 3GR8A 1V3LA 3DX1A 1FCQA 4GO9A 3G8EA 1UD5A 1U33A 1CDGA 1I2QA 1LLWA 1ZY9A 5LNSA 1GZGA 4PSPA 1LRTA 3NEVA 1O95A 1MZHA 1DHKA 1TPEA 1FCBA 3RU6A 3SIZA 4UCGA 3QMSA 5H91A 4MZYA 5I3IA 3FOKA 4J3VA 3N73A 3W1PA 3CWOX 1SZEA 5DCBA 2FTPA 3EWWA 3G1DA 2BXYA 3JRKA 4K37A 3B05A 5CZSA 3L5AA 5TIMA 4FNTA 1QI4A 4HIBA 3LCWA 4JIPA 4ZQNA 1J0KA 4NJKA 4BFAA 1CXHA 4GUHA 2QAFA 4HSOA 4CN1A 4JX5A 2ZXAA 2G97A 5DXYA 1KGUA 5DN1A 4NXSA 5DLCA 3VU2A 4HPHA 3LXAA 1OYCA 1BTMA 1O94A 2PWEA 4GC4A 3K30A 3K1DA 1BAGA 5AHIA 4J28A 4O0ZA 3W2NA 2EGZA 1UD2A 3GXMA 4UFIA 1WV2A 1X1ZA 1H7RA 1WOAA 2ATSA 4DO4A 1IZKA 2CZDA 1SFJA 2P0OA 4M7TA 3B4UA 3D0CA 4QQ3A 3O06A 3W7CA 1FQ0A 3CV5A 4FNRA 3CPUA 3BAJA 2D2OA 4LS0A 4HSNA 1JUKA 3SY5A 3EJUA 3DGRA 3P8IA 1H7PA 2V3DA 1W3IA 1K02A 4KWWA 1QAPA 1EIXA 4JTJA 1XKYA 4YMZA 3W87A 1G67A 1JIBA 3BVWA 5D2VA 3THAA 3E49A 3KXQA 1T0OA 2EAWA 5D37A 3UCQA 1OB0A 1G9HA 1QOPA 5BRBA 4UTIA 1UUMA 1KM0A 3W2MA 2E8ZA 3MMTA 1HNYA 3IIZA 1XGZA 2HTMA 1T8XA 2JBMA 4UMAA 3W83A 4AVFA 2BY1A 2X2JA 2VRQA 2G3NA 3BLIA 1TCDA 2X1SA 4K39A 2CHNA 1Q45A 1IXPA 1SQ7A 5I3FA 2ZZ7A 1NM9A 3TMQA 3WNNA 4MIMA 2J27A 3CQ0A 2OJPA 4A3UA 3GK0A 1WBJA 3EEGA 1G4SA 3UD6A 4I7VA 2E5DA 1FCVA 4LS1A 2CWNA 4PL1A 5TD4A 1ALDA 4OT7A 4CN4A 4WZHA 2E68A 1W3NA 1JL8A 4CKQA 3MP4A 5IM51 1BVNP 3UXAA 1UKQA 3II1A 1TQSA 3S2CA 4KKXA 2BTMA 2Z6JA 4JTKA 2DZTA 1DV7A 2ZDRA 3CZLA 3WMSA 3TQVA 1T99A 3QW4B 2J9YA 2GVLA 3OG3A 1WPCA 2QJHA 5G1YA 2Z0IA 4UNIA 1R47A 3P74A 5G2HA 3STEA 3RLVA 4KMQA 2WANA 2QCDB 3W7RA 3CB8A 3W72A 1HO1A 3BARA 3LXBA 1WE5A 1UKSA 3WJYA 3UG4A 4UQDA 1W5NA 1H62A 4OE7A 2Y63A 2NSXA 2A1YA 3G1HA 4OIFA 2QUVA 3UERA 4N02A 3LBMA 4LY8A 2XN0A 1DKWA 1JI1A 5E6ZA 4JN6A 3O6YX 1LRQA 5BNKA 2EKCA 5K7JA 1OFRA 1ZAJA 5BMWA 1QI3A 3LTPA 1KFCA 5HR7A 5HR6A 3HF3A 1YXYA 3G1AA 3M41A 3FKRA 1KM2A 4KFPA 1GVOA 1DTUA 3DHFA 1JDDA 3HJEA 3DENA 2BSLA 3C56A 3CPRA 3UZJA 4IX2A 4JTLA 2GOUA 1MW3A 5E70A 3O1NA 1M7OA 2F84A 2YR1A 4U2ZA 3B8DA 1RP9A 2NV2A 1TV7A 3QC3A 1RR2A 4DF0A 2ISWA 4N9EA 5AFDA 2YYTA 3TFCA 3G22A 4Z1CA 4RZ6A 1OFQA 2NWSA 3IK2A 5G4WA 3W7IA 3Q37A 3DFTA 2GJLA 2VNCA 3S5ZA 3LGEA 2CZ5A 1XSKA 3TC6A 5KTLA 4RJEA 3MYOA 1XH1A 3WENA 3SW6A 4HOXA 2C6QA 3GLCA 3O05A 4UOQA 2A6LA 3VKJA 3NGJA 2DZSA 2DZWA 2WV8A 5J5DA 2NT1A 3FS2A 1JDCA 2H8XA 4A2RA 3TW6A 4HT3A 1JQXA 6ALDA 4ZVJA 1OK4A 2Y7EA 3RFAA 3ABSA 5I3GA 2GVGA 4MFEA 1WBHA 1SW3A 2EQDA 3WK2A 1VCVA 3KEHA 2V3EA 4I7WA 1K7XA 3OLIA 4Q33A 1QX1A 4JIQA 1AK5A 4TU1A 4UTWC 3E9AA 2RH9A 1JXJA 3NDOA 1BKSA 5E0FA 1VZWA 2NXIA 3NL6A 2Y2WA 2AMGA 2VOMA 2CXGA 4UTMA 4UTTA 3CLWA 3TU9A 3L67A 3M6YA 2ZQ0A 2E5CA 1JGIA 1T96A 3DC0A 3IIOA 3ATYA 1OX4B 4CQ8A 2QF7A 3C6CA 4JNMA 3VGBA 2V81A 5HQEA 3IVUA 3LBCA 4WOQA 4LRTA 5CGMA 3TA6A 2W6RA 4OQVA 2GQ8A 3E0IA 4IGHA 3B0VC 1DJQA 2YW3A 4OBTA 2PE4A 5D03A 5I3KA 5KSWA 2XFWA 2Q3OA 3N9RA 1BG9A 3TV8A 1VGAA 2ZFAA 4WLCA 1WDWA 3TMLA 1VLWA 4DBDA 1UH2A 3EX6A 4KWVA 4AHOA 2E77A 4LOCA 3PBWA 3IJ7A 2C3ZA 1TQUA 1G7UA 2YIHA 2OT0A 1WO2A 5C5YA 4FX7A 4NJIA 6TIMA 4ONVA 1PHQA 1PV8A 1W9XA 3QPZA 3W1UA 3QW3A 3VM7A 4JS3A 1XH0A 1G4TA 1ME7A 4CCCA 3S0CA 3TQ0A 1OSEA 2ZZ1A 4NU7A 5AC7A 1JVNA 4JX6A 3BC9A 2LLEA 1CXIA 1ME9A 1LP6A 3PWAA 3BAIA 2QCLA 1G7VA 4WXZA 3WJZA 3L4UA 2VXNA 4LW7A 4QJ1A 2EF9A 2YCEA 1K7FA 2E9BA 3ZSTA 4LVFA 4O54A 4LXFA 1OT1A 1H1ZA 3EJTA 3KL3A 6CGTA 3RK8A 1FWRA 3L9CA 3WY4A 4XKYB 4HKPA 3WNOA 3NXFA 2PRMA 1K8YA 2QEZA 4FMVA 3PBUA 4QNWA 1QW8A 1SZNA 2F1AA 3G24A 3VGEA 2ZIDA 4UQAA 1BLIA 3W70A 5K4ZA 4ADSA 4DBEA 5FEPA 3BW3A 1ADOA 1MW0A 2WSYA 3HGSA 2FPYA 3G0SA 1XBXA 4JTGA 2HS6A 1SO3A 5E1QA 2VC6A 1TIMA 1Q6LA 3UWYA 1NSJA 1OVDA 3C2EA 3M7WA 4DO5A 4ADTA 4M19A 3AXIA 1JCNA 3S1UA 1KFJA 1TPDA 4KFNA 2ZXQA 3BVVA 2A4AA 2IQTA 1TV8A 3T44A 1ICQA 1JUBA 1KWKA 1VYPX 4LQ1A 2AAMA 1PVNA 1TB3A 2A6NA 1GTHA 4LNYA 3KWXA 1QPOA 2JK2A 3SSJA 1D7FA 2F61A 2F7OA 4UTJA 4DXVA 3HB9A 5LSMA 3QMRA 4GI6A 1EB3A 2Y89A 1U5JA 1HUVA 3TAOA 1WA3A 2YX0A 3O8AA 1O60A 3UWVA 1WZMA 3BAWA 3KLKA 4X0NA 2GUUA 3T7VA 4UTKA 1TPB1 1H60A 4YWIA 3DX0A 3MI6A 4N9CA 1F5ZA 2EHHA 2XN1A 3NO5A 4EIVA 1XDMA 3UXDA 3G3DA 2YOCA 1TQXA 5D2WA 1LBMA 3DX4A 3LHWA 3DI0A 3L4ZA 1Z32X 2WCSA 3WNMA 4X22A 2H8ZA 2WJZA 1G4EA 3MUXA 4YXGA 1GEQA 2YXGA 1GWJA 3GNDA 1J0IA 4NI3A 3MYPA 2ZRZA 3W38A 3GAYA 5A6MA 3G1FA 4LUJA 4IXXA 1OJXA 1IZJA 3RIKA 3BLFA 4JY9A 2Y61A 5D05A 3FAXA 1KA9F 2VRKA 4AHQA 4MUZA 1TJPA 5DCEA 4Y90A 2TAAA 3NM1A 1MWOA 3OLEA 4O15A 2C19A 1Z48A 1J2WA 2FB3A 4MY8A 2WKJA 1KFKA 3G0UA 1WZAA 4P2VA 1EWEA 1XI3A 5BRPA 3IEBA 2VEKA 8CGTA 4Z0SA 1JJKA 9CGTA 2DZUA 1EH9A 3A22A 5AN7A 4BF9A 1FWWA 4JCLA 2Y7DA 1UA7A 3BGGA 7TAAA 1XC4A 4QITA 3SJ3A 3HG5A 1ONRA 1KLZA 2NXGA 1TQWA 2X1UA 3H55A 3O15A 3W84A 4JTSA 4PCSA 1FWNA 1VCFA 2X30A 2FHBA 3LCFA 2NT0A 5KZMA 4H2CA 4GRSA 2PC4A 3PSWA 1QHPA 4CN6A 4J27A 2J9ZA 1ZENA 4Z1DA 1KGWA 5IBXA 2OW7A 3TJLA 3DFQA 2QJIA 4IMGA 4AF0B 4EF8A 3S1WA 5K9XA 1ICSA 2GQAA 3WJSA 1BF2A 1CLVA 2WNQA 5EY5A 2WKLA 4R53A 4H8HA 1PS9A 3BSGA 1JDAA 1IGSA 1KWGA 5HWMA 2RDTA 3WY2A 1D9EA 5HUOA 4MKNA 4Q32A 2ALWA 3LHUA 4UTTC 3UNDA 1TRDA 3BSHA 1TRIA 1DEDA 4GI9A 2CPUA 1F74A 2I14A 4GWEA 3LRKA 2Y88A 3S6DA 3QQ0A 3GXPA 3DKLA 3TXZA 1N8FA 2JKPA 5F2LA 4NNCA 2EJ1A 4LVBA 4ZL1A 3L4WA 3NPVA 1Q6RA 1HO4A 3NZ1A 3DDFA 3VM5A 4O52A 5LZLA 1IF2A 1GTEA 2GJPA 3IJ8A 1UOKA 3G8RA 5CKSA 4FEZA 3TUUA 4GIAA 3PG9A 1UA3A 3HQ1A 3L0GA 1S3HA 2F7RA 4ZQRA 5FF0A 1VB9A 4WD0A 3DX3A 3VCRA 3M5XA 3BLEA 4H7VA 3QFEA 3RF9A 5L9FA 4H8UA 3BUQA 1PEZA 3TSMA 3K8LA 4UR7A 1LOSA 3ZO9A 1OX4A 3L2IA 3LOTA 3W23A 4FNSA 3DBPA 4WUIA 5AHMA 1RQHA 5BRQA 3EDKA 1R34A 3W1TA 3ZT7A 1A5CA 5KZEA 1JRBA 3GKFA 3B0PA 3VGHA 3KLLA 1YPIA 1VC4A 3KFTA 5K9DA 2HSAA 3LV5A 3KE0A 3CTLA 1TPUA 1ZJBA 5MHBA 2C13A 4HPJA 1H61A 3SGZA 4WOZA 1D3CA 1M53A 4L4MA 4M6PA 4O1DA 4PL2A 4E2OA 2CLLA 4GE8A 2OSYA 1FUYA 1VJSA 1YDNA 2EAEA 4AMAA 3BLPX 4MPQA 3EDJA 3TOPA 3TX9A 3YPIA 2GVJA 1QW9A 3U2OA 1KFLA 4O8RA 2E09A 1KTCA 3BUPA 1KM5A 3HJZA 5CZ0A 2VFGA 3VGDA 3WNPA 1JCLA 4JYDA 5D2TA 2A2IA 3ZR5A 1C8VA 1S5VA 4LC6A 3NR0A 5CPLA 4NJJA 1FX6A 3U6WA 1O5KA 3TSDA 1BWKA 2I9EA 3L0KA 3B04A 2TRSA 3N19B 3N2MA 4NX5A 4TIMA 4GKLA 3U8GA 2YYUA 5F2GA 4JDBA 4UFJA 3E02A 1TPVA 3W7OA 3WDJA 2BHYA 4GQRA 4MFDA 3NL2A 4YLWA 3EDFA 3CHVA 1TTQA 4ORIA 3KVKA 3QGVA 4XKYA 4FO4A 1XCWA 1QOQA 2E6FA 3W74A 3MI2A 5F1UA 2Z2UA 4LV9A 1N7KA 3TH6A 1Z42A 1ZAHA 2ZRXA 3DXIA 3FW6A 1BVZA 1I2PA 3A9IA 1SO4A 1XD1A 4Z1BA 4AF0A 1OFEA 3IGUA 4ZQMA 4OGZA 4FLSA 4MAZA 3TR2A 1K7EA 1AG1O 2FH8A 4H4IA 5EPDA 4DQWA 1CGTA 2CLOA 1KCLA 1SSDA 2OYKA 2B7QA 1SMDA 1EUNA 3A21A 3PSVA 7CGTA 4K7YA 2YSWA 4OV4A 3BG5A 4MB1A 3AMLA 2E6DA 5LGXA 3CC1A 5AHLA 5TBOA 4OKDA 4XTDA 1X7FA 4WQ6A 5EA9A 1V7YA 5DXXA 4CVWA 2ZZ5A 4RK8A 1VYRA 1MSSA 2BHUA 1R2RA 3BVXA 3EDDA 1OGSA 5AB3A 3WK1A 3BW4A 1B0IA 5CG7A 1PS3A 2VR5A 3LHYA 5AYYA 3Q94A 1OK6A 2FFCA 1AMKA 3UWQA 3GNNA 4PTNA 2RHGA 4A29A 2V2DA 3EXSA 2D0GA 3WDHA 4UNKA 3SI9A 3TQKA 5TQLA 4BI7A 5I23A 1OFDA 3GDLA 4IPJA 1MFVA 1GJUA 4UIOA 5E93A 3GYEA 4CGTA 3HOJA 1EWDA 4CCDA 4O19A 2QCFA 1JAEA 4XTIA 2Q8ZA 4WSJA 3NQ8A 2A21A 3GDMA 1MW1A 1VS1A 1Y0EA 3D4YA 5DCDA 2EADA 1PE1A 2HS8A 3S8HA 1TQTA 3L21A 2JKEA 4AEEA 2R14A 3EX2A 5I5RA 3HGRA 1EA0A 1WXJA 1MEIA 3K8KA 3MHGA 1GT8A 1WX0A 3A24A 1CIUA 3ZT6A 1QPQA 4NT0A 3S1VA 4C1KA 4ZQOA 1KM4A 3KL5A 1IXQA 1D3GA 2YGYA 3ELFA 3EWYA 5FEXA 3AO0A 3M47A 1GG0A 4QIUA 5DBTA 3HBLA 3D52A 3W7LA 1FBAA 4E2BA 2NV1A 2R91A 3UZ5A 2DZVA 2J88A 3W2UA 2FPTA 2ZUSA 4GUJA 7TIMA 3VNDA 1KV8A 4O4WA 3W7JA 3P67A 1QWNA 2D0HA 1NF7A 1G1YA 3GAKA 1SUXA 2VEPA 1Q3NA 5CZTA 1JF6A 1DHPA 2VT0A 3S5NA 1SO5A 3EXRA 3UY7A 4CNOA 1AL8A 1J4EA 3FKKA 3LI1A 4JFWA 1W5QA 4FB7A 2FLIA 3KOFA 2NX1A 5G2IA 5DO8A 4MLRA 4A22A 1IV8A 2ZZ4A 4N4PA 5LNRA 3NQCA 3EWXA 3DFSA 4B5NA 3W7HA 1G6CA 4UFMA 5K4XA 4J3XA 2G95A 1VPXA 5EMUA 3W6YA 4LTSA 3KVLA 1GCYA 3UEQA 2DIJA 4HP5A 2FE0A 2V5BA 3CIXA 1QO5A 1V3KA 3CEUA 3BUBA 2F7PA 2BXZA 4FLRA 1CGVA 2OSWA 2VFIA 2BHZA 2RFGA 4NJHA 5CPMA 2B7NA 5CPOA 1SPQA 5DBUA 2A85A 1NF0A 2DH3A 4CQ9A 4AEFA 1W1ZA 2JGYA 4FX6M 3LB0A 1U30A 4ZMGA 2H90A 1I2NA 4FNQA 3DU0A 3W2KA 1S5TA 2ZA2A 1JQVA 2OX1A 4HNNA 2A5HA 1NAL1 1VRDA 2QAPA 1GVRA 4J3UA 1V3JA 1GVFA 4CNPA 3BCFA 4FLOA 4JR5A 3BLBA 5F4XA 4PSRA 3BAKA 1UD6A 3DHPA 3VMPA 1YXCA 1YXDA 3TNOA 3CM4A 2V2CA 3W2LA 4PODA 1KBKA 3GDKA 2O7QA 1NVMA 3NG3A 3NQ6A 4WY0A 3ZR4A 1HTIA 3BH4A 3TFXA 3ZS4A 2TSYA 1VFMA 1XBYA 3ZFHA 5C2XA 2Y85A 4U4MA 1JR1A 3VX0A 1BWLA 3BG9A 2E5BA 4XBSA 1P4CA 3GVGA 1MEWA 2G96A 3QZEA 4M5PA 2C14A 5CSSA 1VCGA 5A2CA 4W9TA 2XVGA 1IXOA 3DFOA 1UH3A 4MVAA 4K38A 4MJZA 1FDYA 1G4PA 3NL3A 5CZJA 3ZSSA 1OX5A 1ZCOA 3BVUA 5DY3A 4BK9A 1QCWA 2WSRA 2C18A 4EOUA 3WY3A 3LPOA 3G3MA 1HTYA 3IGXA 3PAJA 2XWDA 1TPC1 2ZX9A 5A5WA 2WOQA 1E40A 3UG5A 2QDGA 5HMSA 3W86A 4K7VA 4WXYA 4UC5A 2FB2A 1GVIA 3VX1A 1NFBA 1QDSA 4XQ6A 3WDIA 2WKGA 3HO8A 1QR7A 1XM3A 1BPLB 1N55A 5F4SA 3QPYA 1J0HA 3VGFA 1SZGA 4O11A 4X9SA 5EMYA 1V3MA 3T78A 4JGDA 1XV8A 1FXQA 1THFD 3QSTA 1VFUA 4OJYA 5D32A 4JICA 4N2YA 1VH7A 2CZFA 2VEMA 3W7MA 3W1QA 3QEZA 1OABA 3P62A 1A53A 1RD5A 3AMKA 3DHDA 3OVQA 4AIOA 2ZRUA 4O50A 3LHVA 4O14A 3TIMA 2YA0A 3P61A 1VYSX 1I75A 3MHFA 2ZRVA 1TMHA 4GFSA 3PG8A 3IVTA 2CLEA 1M7PA 1YADA 1XCXA 4WJEA 2A7NA 3W7EA 4NJGA 4DEFA 2NUYA 3S9YA 1XD0A 3UYCA 1U83A 4TX9A 2X2GA 3VSTA 1PIFA 1XXXA 5I3JA 3GBEA 4PCTA 1KXVA 5AOUA 3S1XA 3N34A 2F18A 3M43A 1GYLA 5IBXC 3HPZA 1E43A 2ZX7A 5GVJA 5DELA 4UMBA 1CGUA 3H54A 3ZT5A 4AH7A 3W71A 3K8MA 3FIGA 3L66A 6TAAA 1QO2A 1H7OA 4O4VA 1JCXA 4OWGA 8TIMA 1ICPA 2NWRA 3KVMA 2D3LA 3MWAA 4JFTA 3LCGA 3QM3A 1O7DC 5E6YA 2J9XA 1XUUA 2H6RA 3QF0A 3A6OA 2KZHA 1RQEA 3F03K 3DHUA 4B9ZA 1L2UA 3VSUA 4PEEA 4JTIA 2J6XA 3KRZA 2F2HA 3LM7A 4UQBA 3ABOA 1PCKA 3HG3A 4EF9A 4NZFA 1UASA 3CGTA 1XL9A 2V82A 2Z1BA 4HNTA 1GVQA 5K3VA 1VAHA 3LLFA 4L4LA 1C29A 1WZKA 4GQQA 2Q3RA 2ZRWA 5LGZA 3P8JA 4A2SA 3IIVA 4JXCA 3KL0A 2P10A 3TJXA 4LPCA 1QPNA 4MY1A 3PUEA 2WO5A 1OFBA 4LVDA 4U31A 3GB6A 2YKKA 1JRCA 4S2CA 4UTLA 4ADUA 3LX9A 2QUTA 3FJLA 1ODUA 5BMXA 3B0UX 1QFEA 1CXKA 1CXEA 3I7SA 4HPXA 3CTTA 3PS7A 3DAQA 2ISVA 4LVGA 3F1QA 2DU2A 4LV4A 2E6YA 3EWBX 3FLUA 3TSBA 1F2JA 4TMBA 3L4TA 3VMNA 3ANYA 3UQNA 1VR6A 4KWUA 2OZ0A 4RCXA 3QH2A 3R2GA 3BO9A 4IQLA 1B57A 5U7SA 3PBYA 1RPXA 2B0MA 4GBUA 1UUOA 2X1RA 5A2BA 3L68A 3M5VA 3R13A 4BA0A 2QDHA 3GKAA 4FF7A 3INPA 1ZFJA 4H6KA 4QISA 3T4CA 3EXTA 2PWGA 2A7RA 2RDWA 4XZ9A 3STFA 3B06A 4HHPA 4AWSA 1GG1A 1GVSA 1PJ9A 1AW2A 2FPVA 4GJ1A 3NA8A 4AEOA 1Q6QA 3BPWA 1KLYA 1E3ZA 1H63A 4AWUA 2GJRA 4JFVA 4UUIA 1QWGA 3GZ3A 2J25A 4AXKA 4M8UA 5CPNA 3LCXA 5FI8A 3C2OA 3NQ2A 1CXFA 3CZEA 2TYSA 4O53A 1I8JA 1SMAA 4UNLA 4AMWA 4IMEA 1R2SA 1EP2A 2ABBA 3CEPA 4IX0A 2PURA 3NAVA 5E0KA 1K8ZA 2Z1KA 1CPUA 3QMTA 5KZDA 4YCOA 2V8ZA 1EHAA 1I2OA 3B03A 3GXDA 4FXRA 4H3DA 3G18A 5T26A 2YA2A 3NM3A 5EYWA 4AAJA 1HT6A 4UZUA 1CX9A 1DBTA 3ZWTA 4AMXA 1KXHA 1RV8A 2ATMA 3WK3A 4MY9A 4ML9A 3A4AA 2C0AA 2WVSA 3FAWA 3P82A 5AYZA 1LOLA 1A5AA 1W5OA 1RPKA 5LNWA 4JTEA 2ZXBA 4Y9AA 1R30A 3PF3A 3WJWA 2VKZG 1TCMA 4NQ1A 2OSXA 1RP8A 1S46A 3TXVA 3NQAA 1KW1A 3WY1A 2YFNA 2ZZ2A 1PAMA 3F4NA 5AHFA 5K2ZA 1AQHA 5F7UA 1X1OA 1RVGA 1KGXA 3TC7A 2H3BA 1EO7A 2HMCA 2ZA3A 3NVTA 4UFHA 2BY2A 1JXKA 2Y6ZA 3W22A 3EKLA 5K9CA 3O07A 3I7RA 3L2LA 3EX4A 3GTNA 3MP5A 4LT9A 2QUUA 1W54A 1QWUA 1DORA 4FNUA 1OFAA 5D04C 3M1ZA 1QPKA 1P5BA 1V5XA 1H7XA 3WEMA 3W7NA 3ZQ9A 3BW2A 3C2FA 3NQVA 1AQMA 2ZX8A 4UFLA 2XVLA 2DP3A 3OHIA 2CFFA 1W0MA 3M0ZA 3M5ZA 4EWND 1SO6A 4E2DA 3HGOA 2CW6A 5ABTA 4JDYA 1MXDA 1A47A 1YLVA 3BAYA 3NOEA 1LRNA 4O16A 1KBIA 1YPFA 4JTTA 3PB0A 3LERA 2QPUA 3NQEA 1DL3A 1VIWA 4JD4A 1QNVA 5EBUA 1QPRA 2VENA 1RZMA 1KB3A 4MYXA 5LNVA 3HG2A 3PULA 5D09A 5FF7A 4PA8A 3L5MA 4DPQA 1I4NA 3OVPA 1PHWA 3WJXA 2FJKA 3MW7A 4O57A 3PB2A 5LKYA 1HFBA 1RQBA 2B4GA 2PRLA 4M7SA 4D2JA 4J7RA 3I65A 1KXQA 2DZPA 5DY2A 4Z08A 3BV4A 2ALDA 1BSIA 2V0TA 1TTPA 1CXLA 4K8EA 2XVKA 3VNZA 3BUDA 4YL2A 1GJPA 4IJBA 1KM3A 5DFAA 3W1AA 3BK0A 2FHFA 1CI1A 2DIEA 1ZS2A 2QCDA 4JY8A 2WNNA 2Y70A 5D33A 2C7FA 3S5YA 3R8RA 5FEZA 1A5BA 3LCHA 3WEOA 3G1VA 3NQ7A 1VJIA 3NYZA 3VO0A 2ZUVA 3NPXA 4U33A 1DQWA 3JR2A 5F1VA 4UR8A 1PIIA 4K8HA 3IGSA 1LBFA 3CZGA 1TTJA 1TPFA 1OX6A 2VFHA 2CZEA 1UH4A 3MP3A 4HOZA 2CU0A 4ZQPA 3PR2A 3GXIA 1OF6A 1HL2A 3HPXA 4DF2A 2WVVB 3HIJA 3VSVA 1HL9A 1LROA 3SFKA 1H3GA 4JL2A 1SW7A 3SGUA 4FLQA 3A5FA 1LTDA 4B9YA 3P5ZA 4RXGA 1LOQA 2BX7A 1NEYA 3S42A 4IMDA 1IIGA 1KTNA 2BLEA 2J24A 3M07A 3WNKA 4CQAA 1OHLA 3L4YA 2WVTA 1O4UA 2ZXDA 1YTDA 2EO7A 4R7JA 2B7PA 5CGQA 3TK7A 1YDOA 3M16A 3A47A 1R75A 3G1XA 2ZX5A 3O16A 3UWZA 2D0FA 4ICNA 5C6MA 2ZUUA 1K03A 1JCJA 2ZRYA 5KEZA 4MZ8A 2WC7A 3NNTA 4EVZA 3EJSA 5I3HA 1KM6A 5FEWA 3Q58A 4RX0A 2GPTA 3DH7A 3USBA 3W73A 1K3UA 3LDVA 5A2AA 2WSQA 1YYAA 3C52A 1B4KA 3G0XA 3LPPA 3E96A 4M6VA 2F7QA 5G4EA 4O13A 2ZWZA 3GXNA 1TSIA 3EJQA 1FWSA 1L9WA 4K36A 1L6WA 4AW7A 4JYFA 4NNAA 1EUAA 5H2ZA 2FYVA 1SZFA 4G1KA 2QCNA 3STGA 2A7PA 2W0UA 3EDEA 4UQ9A 3NQDA 4LRSA 3D51A 1PZ3A 5FESA 3W88A 1DOSA 4JTUA 4J3WA 3WN6A 2YZRA 3MHUA 3PC0A 5CSRA 2ZTKA 3NQGA 3A5VA 2DZXA 4S2BA 3RILA 3VFLA 3PVFA 4GI8A 3VNYA 1SW0A 3IVSA 3P81A 3OVRA 2Y5EA 1GQNA 4BWLC 3LRMA 1PZ2A 3CZNA 2NUWA 4FIQA 2OMAA 4GXMA 4LS2A 2PWFA 4POCA 5F2MA 4UFKA 2WCGA 3W7QA 2FQIA 3I6RA 4QNEA 1LBLA 3DX2A 4MJMA 3LTYA 3M5YA 4O17A 5D2YA 2DORA 3C4UA 1A50A 2QCCA 3L65A 5EKYA 3LI0A 2G5WA 1W56A 1HWWA 3MJYA 1M5WA 3O63A 5D38A 1UB3A 1W3TA 3CWNA 3LHZA 4JTHA 4LUIA 4R33A 1XDLA 4Y6GA 1HXKA 2PCQA 3PUOA 4O12A 4NXKA 3BGJA 5CLWA 3L2MA 1YDVA 5L6UA 4AYGA 3M44A 3THQA 5BOOA 1VLIA 5FF3A 4E0CA 1GJWA 4NX0A 3O6CA 3R12A 3R5EA 1VHCA 1GYNA 1EEPA 1XH2A 2XN2A 1Y7VA 1HG3A 1QHOA 4MYAA 4X3ZA 1UCWA 3AJXA 3HMJG 1C9DA 2E0PA 5CXPA 3OLGA 3KHJA 3KVJA 4WF7A 1KBJA 1QMLA 2NLIA 2X16A 4RXFA 3C3NA 4FNPA 5D02A 1F6KA 4NZJA 3FYPA 3UY8A 4JFUA 5HDRA 4GUIA 3D50A 4UZSA 4IOTA 3W7DA 1FXPA 2VEIA 5E9AA 3OIXA 5SWUA 2NZLA 4K6AA 4NNBA 4UMCA 3WNLA 1ZALA 3BVJA 3TROA 4NVTA 5HWNA 3WFAA 4AIEA 3EX3A 3PY2A 3H53A 1FWTA 1H7WA 4O1BA 3STCA 4AWTA 1LYXA 4GINA 3UPBA 2QCGA 1Q6OA 2QCHA 3UPWA 1W37A 5LNUA 5LHEA 3NPWA 1XFBA 1BEUA 3ABRA 4O10A 1UD4A 4OHQA 2TPSA 1F76A 2ZBTA 2C8NA 3BMVA 4CNNA 4YCPA 1M6JA 2NX3A 4XUGA 4BR1A 1GPWA 2ZCGA 3G1SA 3I68A 1I45A 1TTIA 4RV8A 2QCMA 5BW6A 5EL1A 4LU0A 3TKFA 1KXTA 2WVVA 4IWWA 1JFHA 3CZKA 1F6PA 4GNJA 1TQJA 3VE7A 3TTSA 3G1YA 5FF2A 1B3OA 2A0NA 2OYLA 2QCEA 2B7OA 4FHAA 4P61A 1EX5A 1P1XA 1P0KA 3BCDA 3RNDA 2F1BA 3ZWSA 2QPSA 1R33A 3EJRA 4X9YA 5J5RA 1UD8A 4PFMA 4U2YA 3EKZA 4JL1A 2PWHA 1MW2A 4XBKA 1IXNA 1PCWA 5A8GA 3TTYA 1B4EA 4MLJA 3T55A 3GR7A 4C1LA 1TPWA 5I0DA 1CGWA 2VUYA 1ZNNA 3CLMA 2CLFA 1JI2A 3SECA 1ZHAA 4AB4A 3N2XA 2CLHA 4JEQA 3IIXA 4PH6A 1ML1A 3M9YA 4CCEA 3V75A 2BWGA 3BUIA 4WX2A 1LM1A 5D2XA 3C61A 1W8SA 1CGXA 1Q4NX 3E12A 4CLMA 3P5YA 2F7FA 2CLKA 3GIYA 4W93A 1H5YA 1VFOA 3NZRA 4J9JA 2QJGA 2XIIA 4Y96A 4J3TA 1EP3A 4N9BA 1SU5A 3W7GA 4NUWA 1MVYA 2Y7FA 3LCIA 1SR9A 4O0KA 4GO8A 5I24A 2O7SA 3EWUA 3IIPA 5HJLA 1LWJA 2ZUTA 3W1RA 4UTUA 4ZQCA 1H7NA 3KAOA 4DF1A 3TCEA 1EP1A 1A5SA 5KINA 3LTSA 5KITA 3HZ3A 4XWUA 1WQ5A 3VE9A 4HA1A 4JCMA 2FGZA 2QMKA 4E38A 5A6LA 2R8WA 3FA5A 4TVUA 2H3DA 3L4VA 4U3CA 2V9DA 3VI2A 1W5MA 2BZNA 4PEKA 2YW4A 1YTKA 4WSKA 1AL7A 4N6EA 4XB3A 3D4ZA 4UCFA 2R94A 4N6FA 1LDCA 4N4QA 5HUPA 3FYOA 1XBVA 3CIWA 1M7XA 3ECQA 1E51A 4Q4KA 2IGTA 1F05A 3FJ6A 2BY0A 1FCUA 2PWDA 1C8QA 1SSGA 2ZICA 2GUYA 4ATWA 3QJAA 3GDTA 2ZA1A 1YTEA 2FIQA 5F2IA 2FHCA 3TW7A 4I9AA 3KX6A 1OYBA 2ZYFA 4IMFA 2WVUA 3W1MA 2X2HA 4O1CA 1CW2A 3AJ7A 3NQFA 4UQEA 1UD3A 1VHNA 3W85A 2QR6A 4ZZ9A 1J5TA 3CT7A 3W37A 1JULA 3DI1A 3OLDA 5HPOA 1XCFA 2BXVA 5KMYA 3GXTA 3RLUA 4R34A 1FDZA 1XUZA 2ABAA 1OG0A 2YPIA 1PL9A 1ME8A 3PUDA 3W7PA 3KRUA 4BWLA 1TQVA 2RDUA 4Z0JA 2VFDA 3L5LA 2NXHA 1PIGA 3I7QA 2E4TA 4HOWA 3CZSA 3WELA 3HG4A 2YDAA 3MBFA 3W76A 2QMJA 2C16A 1JF5A 4WY0B 1DJNA 2WSPA 4RZ4A 5U4NA 3A23A 3LLDA 3DZ1A 2WNWA 3IV3A 5HXMA 2WSKA 2YFOA 5CLTA 4DO6A 3C8FA 4RKAA 1J0JA 1HL8A 1PPIA 4FXSA 2E6AA 1TYGA 2ZZ3A 1LWHA 1JD7A 3P84A 1G5AA 4X2RA 3C2VA 3FFSA 2QV4A 3ZR6A 2QLYA 1XSJA 1JCMP 1W5PA 3RMJA 2OT1A 1UJPA 3TDFA 1XSIA 2ZWYA 4BI6A 1VQTA 1KTBA 4BZYA 4JFSA 2GQ9A 5AHEA 1LORA 1KCKA 3FEMA 1KBBA 1TJRA 3N14A
chains in the Genus database with same CATH superfamily
3CSYA 5F96L 1JZGA 1L7IH 3NQKA 5HGBB 5IVXB 3M1CA 4HUMB 4TS6A 3W3OA 1SLWA 1QI2A 3D1MC 1P5VA 2UWEF 2D2HA 4OLWL 2YBGA 4LC8A 2QV2A 1FAKT 2ZONA 1LEGB 3CN1A 3DX9A 3EYQC 3RP1A 2BOBA 4KFMA 4GBXB 2X7WA 3CMFA 1L6YA 3BP5B 1WBZA 4FIRA 2OMYB 5FF4A 3BKYL 1CTMA 2WQRA 2XJLA 4L5FH 3SDCD 3T0DA 1OC6A 5KYUA 2AGKA 4S38A 1OM3H 5E0CA 4UUJB 5D4IA 4J3SA 4AYSA 4D2NA 4NQVB 1X8FA 4ORMA 5CINH 5HHME 2CLMA 4Z95L 2J4WH 2R2HA 1QHZA 4QAIA 3NSXA 5F0LB 2DQIL 1L6ZA 3B9VA 1WLHA 1ZUAX 2YUVA 3CH0A 4HK5A 4WO4A 5AD0A 3A64A 4YIQA 5D7IB 4ELKB 1TPXB 3GIVB 4FXKB 3UG3A 1UP2A 2CK0H 2WPBA 4R8WH 5IVXF 1A7NL 3WMQA 4BEUA 2WXNA 3TC3A 3AWOA 5GXBB 3TA3A 1J0YA 3QWRA 1XX9C 3F7VA 3RDKA 4JG0H 5BO1L 3W9ZA 4AMCA 2ERJB 3FU9A 5G5DB 3TEUA 5B7YA 2VDIA 1UXLA 2ID5A 4OZFG 1OFOA 4IMCA 3KOZA 3UA3A 2EECA 4PW9A 3QWQB 4OGAD 3FU7B 2GAZA 4OT1L 3AROA 1RUPH 2DW5A 4MJIB 3QLDA 2OQJA 4H9UA 2X0WA 4C7GA 4CRPA 4HVBA 4O1AA 1UKTA 3B9KA 4X50A 1UUNA 1U36A 1D7CA 4HN4A 1HS6A 2PTYA 1OD0A 3WJMB 3QFWA 4KFOA 4C56B 2NY4D 1WVZA 4FQQB 3SR7A 3WMLA 2JQXA 3L5XL 2R23A 2X4QA 1MLCB 2D73A 4QSHA 4C6DA 2WLIB 3U30B 1ETA1 4HWBH 4L8BA 3HE6B 3UTQA 3G2GA 3PBVA 3SDOA 2NLJA 3ZTEA 3NPZB 2NUXA 3QXTA 5C0JB 4QAWA 2MPVA 2P28B 1YYLH 2JKAA 5HHVH 4V27A 4I85A 1VFSA 3C2RA 3IRDA 2DMKA 2VN4A 2G30A 3DJZA 5A3HA 4NNYA 3OGSA 4JY6B 2WXOA 2H0JA 2XWTA 5JUEL 3GNML 2NQZA 1JMZA 3WJLC 3MVTA 1H0DA 4AD0A 1EO5A 3JZ7A 4NFCA 1UOWA 5A8QA 2P26A 4G80B 1C9SA 3EYUH 3HCVB 3QE5A 5F7YC 1D5MA 2J78A 1RUAL 2HYMA 2ZZ6A 4LSBA 4GFIA 5I78A 1HVXA 1QKZL 2V5LA 2YLAA 2VELA 3QEHA 3MRJA 2IIJA 1Z44A 4X8JB 1EBAA 5BXSA 2BCKB 5HWJA 3QJHB 5BMFH 4ENZA 1RZ8B 2ED8A 3VI4E 2LLNA 4EPEC 3ILPA 4KK5C 2VQ1B 3K6SB 4CVZB 4LX4A 1E72M 1ILUA 3GGWB 1UXSA 2HMIC 1CU4H 3EGXA 4LCIH 4PJCE 1GG0A 3Q4DA 3UTSD 3QSRA 3ERPA 2ESVD 4Q9RL 2FAUA 2Z3FA 2JQMA 1IIHA 4QM1A 3A4FA 1ZT7A 2XH4A 4WY0F 4WI6A 4IBTA 1WYIA 4BCEA 1OP4A 2H1LM 2IADA 1R46A 2X7LA 1R6WA 2X42A 1W31A 1H41A 1EV2E 1KLFA 2E40A 3ESOA 2Q8LA 4JLRA 3T2OA 1S7VA 2VFFA 3KLDA 4XVTL 1H1NA 1H51A 2Z65C 4O4YL 5F4WA 1KM1A 2IKHA 3THMH 3RRAA 2BLFA 1B6DA 4GS7C 3B7SA 5DTFA 1G94A 2Y24A 1OT2A 1EXGA 3O3DB 4KKBC 4KRMB 4XT1C 5SX5K 1F41A 4PP1D 1MCLA 3MRCA 4BCYA 4Z78B 3QZNA 1Z3NA 3FT4A 4GBXC 1RFDH 1UXSB 4CL7A 4N7QA 4W7VA 3W24A 5AKRA 1DUYA 2CLRA 1PZCA 4RFEB 1OFPA 3EB2A 1ZAIA 3MBEC 3NIDB 5FW7A 2PUQT 1DANU 3HW7A 5EUKA 3PIQB 4JHVA 5TDNB 3ZKSD 2QIIA 5ICUA 4H6RA 4LSUL 4F2EA 3GZAA 4D72A 2F9BT 1UPPA 4N8CL 3U6RA 1JZ5A 1NGXA 4DK3A 5C0RL 1HKMA 1SFLA 1VEOA 2ICEC 2V2HA 4XX6A 3O0LA 4JE4B 4ZUUB 2F19H 2AC0A 3EYFA 1KIPB 2NXYB 1TMQA 4OZHE 1ETJA 3TXAA 3CVCA 4LAUA 1E1CA 1EA9C 1YPZB 4HW6A 1PLGL 4RLIA 4KDTA 2FVKA 1KFGA 3I6TA 3N4FA 3ARBC 1UWRA 4RZ5A 1JZHA 4IRSD 3OZKA 1FG2B 1UT1A 3OSKA 4LSTH 2R2BB 4TUOA 2M2DA 4TNVF 4H8VA 2Q86A 3UL4A 2FZMA 2MNRA 2R4SL 4FR1A 4M56A 3P3TA 5B21A 2PP9A 3NGJA 5AYXA 3U2EA 3UR5A 1QASA 4J2PA 1HJUA 1O6VA 2EEXA 2MCAA 3WQDA 3HAEB 4NWUH 2CGRL 3CFKB 3PP3H 5C55A 9XIAA 3BP6B 1FHDA 1IGIL 3G6JF 3GH7A 4G1MB 4Q9QH 5HNTA 3RUBL 43C9B 3VXNA 4IPIA 1EIBA 1PD6A 1IAIM 3W1NA 2ODIA 4WU7B 3EJPA 4W9JC 1YY9C 2YRBA 3KGTA 1PKMA 4L9YA 3VINA 1LK2B 2GVYA 3TBBA 3UCCA 3MBDA 1Q65A 4UV7H 2J57A 3V1PA 1U3YA 3EA1A 3VFRB 1OCRB 5C08B 3P60A 5AW9B 3QUZC 2DL2A 4LFHG 5TPWH 4JQ1A 1UM5L 5EO1A 1EAJA 2FH6A 3BVTA 3A4XA 4JANB 1JNJA 3EBVA 3GMPB 1ZCCA 1BLNB 1TZ9A 4RR4A 5GISH 1WD9A 2Q8BH 1BQHA 1MFCL 2DEYX 3VC5A 1NQBA 1FDLL 4F20A 3I84A 3BLKA 4NZUH 5DR5L 3QRGL 2DH2A 2P52A 3SKJH 4KHXL 3AM8A 1GY2A 1V7AA 5HULA 4IRJD 1R2TA 2J72A 3HE6A 1ZIAA 5BRZE 2GL5A 3N4EA 3T8XB 2HVKA 1SR0A 1FH9A 4HAFA 4J2MA 4X8XA 1NQKA 2OMZA 3BAEL 3MNVA 2G5BB 1KJVA 3RJQB 4I3SH 4TN9A 1IGIH 3GXFA 4IKNA 4NZ4A 1CDIA 1U91B 2ZAHA 4OCSL 2NY6C 4XN8A 1VD6A 3F4WA 3KZSA 3ZPDA 4FC3E 1X7QA 2FEJA 3AB0C 3KPQB 2RGSA 4NWTH 5IFJB 1KTJA 3JS3A 1Y1UA 1M71A 1R3JA 1V3LA 2W94A 4YHPB 5DJ8B 1M56B 3KPPA 3GSWA 1IBDA 1UD5A 3HCVA 3CDCA 4IRJC 1RY0A 3S6TA 1T5XA 1I2QA 2WUBL 4RE0A 1I1YA 4PSPA 3CDYA 1LO5A 2X38A 1BXAA 5GGRY 3FT1A 1OP5K 3QHOA 2AQ3A 3RU6A 1CBVL 3SIZA 2FLBT 1J12A 2I25N 2KZBA 4RAVB 3ZXWA 4LPUA 2OL3A 2Q8BL 3B8YA 3UP1A 4LDEB 1MI5B 4WTZG 3V5FA 4MJJA 3JWDC 4JJHA 4MB3A 1S78D 1SZEA 3O2WL 3RWEA 4PH8A 4I9WE 3G1DA 2OZ8A 3G6DL 3B05A 3KS0H 43C9A 2E74C 3JWNE 3V6BR 4TUFA 3Q1SL 1QI4A 4ICXA 4JIPA 4A8RA 2CCWA 2JV6A 3UZYA 2B2XL 2OLDA 2TODA 4JPIA 4GUHA 4NJKA 1JPSL 4X4ME 4CN1A 1XYMA 1YNQA 3TX4A 1NLDH 1M7JA 3TYUA 1LO4L 5DN1A 2RFXA 4JFQA 1KLGB 4NXSA 3SBPA 4AKQA 1IEQA 3VU2A 3N6JA 5DLCA 3VQLA 3ROOA 3TBYB 3RVVC 3EOSA 1US2A 4FA7B 1LL4A 4GC4A 3N85L 2P3YA 1KJ2L 2K3TA 4OF5A 3E2QA 4ZQTA 5AHIA 1FWCC 3FONA 5I8KL 1E5JA 3O6AA 4G8IB 1GW9A 1RA5A 4OCXL 4JO2L 3BQVA 4B95C 1FWJC 2G4GA 2WMFA 2COQA 3PIQA 3U0WL 4Z3EA 5JORA 1H7RA 2G5UA 4B5UA 1IZKA 3HZMB 2DT3A 1UEMA 4M7TA 4CC4C 2XYLA 4PRHA 4ZRGA 5HHOB 4QRFA 2XHNA 2IANE 5IB2B 5T3XE 1NGYA 4G7RB 1KJVB 1TMCB 3S37X 1HIZA 3FT3B 4LCYB 4MXVE 5I1EH 3CPUA 3BAJA 4O4YH 3VFOA 4WI7A 2A9AA 3VD9A 3CFBB 4HU3A 4EN3C 1F90H 2BVDA 2UY2A 3IPBA 3PZOA 4MCNA 1Z9LA 3P8IA 2V3DA 1G0YR 3I85A 2FSDA 4LCWD 1K02A 2Q86B 5JH2A 4ENLA 4F7MA 1QVOB 4PTDA 3DVGB 1MCHA 3QDHA 5FA3B 2AEQL 5K59E 4JTJA 1J5OL 2RCSH 2VMFA 2WWKO 5FM5M 4E41E 3UO1L 5D2VA 3THAA 3OVGA 2XV2A 5FL1A 1KJMB 1S2TA 2DWDB 3LZNA 2WZ0A 2GTWA 5ECJE 3EGSB 5B38G 4UTIA 1QSZA 2WXQA 4N6RA 1UUMA 1REIA 5HHOE 1KM0A 1T0NA 1WCBA 2E8ZA 3FT3A 4LCYA 2OYPA 4M48H 3IIZA 1MAJA 1XGZA 1U42A 3EJYC 5GRVK 4FXKC 5GS0H 2X6CA 2E28A 4GIRA 4LP5A 4HJFA 3GY1A 2JBMA 4IK6A 4LCIL 2OA9A 2YXMA 1W0VA 3BJ91 3HZYA 1OHZA 1I53A 2PCYA 4L8DA 4JPSA 2BY1A 3RTQB 2FQFA 4AVHA 2YBUA 4EUPB 1SUJA 3F5WA 4G6KL 5HHMB 3UJIL 2UZXB 4ELMB 1ZV5A 2B31A 4K39A 4G1EB 4CW1A 1SQ7A 5I3FA 5H8PA 1FE8H 2ZZ7A 3TA9A 3RGVD 1G7PA 4ODSH 3WNNA 2IAMB 2WZTA 4A3UA 2J7DA 5K39A 2DIKA 2UZ9A 5HDOA 3RM4A 1HQ4A 1WBJA 1RZ7H 1G4SA 3ZE1E 5IJDC 3CXHK 1K9DA 2WMJA 5JIKA 2I57A 3KCPA 4I7VA 4ACZA 2E5DA 3MLWL 3X1NA 2JCWA 1FCVA 5K9KA 3DFHA 5HJYA 2ALRA 4PL1A 2IKIA 5J8LA 1ALDA 4G8EA 1UM4H 5C86A 3ARFA 4BWTA 2JE8A 4HIEA 4CKQA 1W3NA 2ATKB 1CK0L 3NIGB 2X9WA 3U30C 1DQJB 1GORA 3IXTB 3KPQA 3UGEA 5IFJA 1CFTB 4PV1C 3S2CA 2QT6A 1OP3K 1YN7A 4O51B 2BTMA 4XHJC 4E9XA 3M0IA 2DZTA 4R7XA 1OM3L 2AXFA 1LYQA 2ZDRA 1NEZA 1ADQL 3LKRB 4YHYC 1T99A 2J9YA 2GVLA 3ATEA 2C9PA 4L4VE 1Z6JT 2XSAA 4Y9MA 4PY8J 5E6SB 4B7IA 4ZW5A 3NFUA 1AXSA 4UDUB 4BJLA 2YB1A 3ME0A 5J0BA 1IC4L 2QJHA 3A4JA 4PY7B 4UAOB 4RAVA 3MN8A 3A3YB 4AVIA 3BP7A 4FXGC 2YAQA 3GH4A 3KRBA 5C0AE 1A4BA 1IAIL 1NCIA 2H9GB 4YS1A 1IFGA 1GL4B 3N41B 4IU3A 5EZIL 5G2HA 3FRPG 3QG6A 5TDOA 4KMQA 3CLEL 1H5BB 5DDHB 3L8QA 3NZ8A 2WANA 3T81A 4NUJB 3PL6B 1GZ1A 5HQLA 4P7RA 4XRCA 1W72H 5EO9A 1SFSA 3C2AH 4H4NA 1HO1A 3BARA 3CB8A 3LXBA 2AJ3B 2YQ3A 2XH2A 5KZ6A 1I9CB 4DUOA 3CFTA 3GEFA 5B39G 4GG6A 3ITLA 4UQDA 2X53A 4Q4IA 2AXFB 2DEWX 1XHGA 3ZKXB 4BFOA 2VQ4A 4PTUA 4LZKA 4OIFA 3KCWA 3LCYA 4M1CC 3UERA 3G1HA 4LY8A 3F62A 2XN0A 4IGBD 3SD2A 1DKWA 3M46A 4OGXL 5E6ZA 2WZ5A 3W3BA 1SJAA 1JTOA 4NKMA 4JN6A 3AYVA 4W81A 3AAMA 5BCAA 5BV7L 1GQLA 4PD4K 3EA3A 2QVTA 3R94A 1AKPA 2Q76A 1I4FA 2LW3A 3GTTA 4FE9A 4WFGE 5F3BB 5L8LB 1E4MM 3VD2A 1FGNL 2AHIA 2DEPA 2INZA 3AISA 3LTPA 1Q2SA 3L7EB 2AGTA 3DG3A 1U3HD 3KS5A 2XZAH 1GHRA 5HR7A 5HR6A 2B3IA 4D9RE 4DJMA 1P7QA 4X9HA 5A3IC 1VSCA 3HF3A 5D93B 1KM2A 1BFOA 5DHXB 1GVOA 1I3GL 1DTUA 1TETL 5SWZB 3HJEA 4ZS7L 2YL6A 1JZEA 1DIOA 1KIRA 2LLLA 1PKNA 1FNHA 3B9AA 2VSDA 3RX2A 4JFFE 3BP4B 5EF1A 2FVNA 1MW3A 1PKQB 3FSTA 2C9UA 4NKDB 2F68X 5JYMA 1EGVA 5DANA 4U4IA 2YR1A 7FABL 1KDJA 1DVFD 3UTOA 4NKMB 1MCPH 4K3EL 3S96A 1XGYH 2C9XA 4KRZA 2FRGP 1RR2A 4DF0A 1O6SA 2QGHA 4NQED 4ONHA 2BC4B 5HI4C 2BVEA 3MQIA 2REQB 3PZ9A 4M6UA 12E8L 4OF0A 2IGFH 5D1XC 4Z7VA 4Z1CA 3WLNA 4RZ6A 4TLTA 4PMJA 2JJTA 2VL5B 4M00A 3NYKA 4P9MH 3Q37A 3PXJA 4KKAC 4OLXL 4PRAB 3C8HA 2PN5A 4TV3A 2QJDA 4XZWA 3W01A 4IRZH 4DWDA 4I1RA 1RVFL 1XSKA 1MHEB 2QEJA 4ZUVB 4L9XA 5FYJH 3JUGA 4LAQH 1OP3H 3V0JA 1MNNA 3ZJ8A 3CFUA 4TNWK 2Z26A 5KTLA 1XH1A 4N87A 3WENA 4LSDA 3K80A 3PZQA 5CAKA 1F6LL 2OK0H 4LESA 1N8WA 1T41A 1RK6A 4A67A 1PX3A 3CXHJ 4XO5A 3ULVD 1U3NA 1QU4A 1DE4B 2CKRA 1I7UB 5MEPA 5BYWA 4ZXOA 5MKGB 4E42B 1EHNA 2HG5A 4XCFL 1GQKA 2XGBA 3C8NA 4GC3A 3F5WB 4XD3A 4AQ1B 2BC4A 3G04B 4RWHA 2REQA 2DZWA 5JMOC 2WV8A 2APXA 4JGUA 5DZJA 3BXWA 3HFYA 4NP7A 4LCUA 3SCVA 4A2RA 3HPJA 1KELH 3MKGA 3JV4A 4W9CC 1JQXA 1M6OA 2ICSA 2GCYB 4ZFFB 2CIPA 3WO4B 1CC3A 1OKEA 5JU6A 4NN5B 5I3GA 4OW6A 4AISA 4Y19E 3IU4L 3LN4B 4P5KA 4IS6B 5IW6A 4I6KA 1BXVA 2EQDA 3KPNA 1VCVA 2DMCA 1WDAA 1AZ2A 5LHDA 4QRRA 4HDIA 1K7XA 2KHAA 2VDOH 3F01A 4IHCA 4ODUB 1AD0B 2H6PB 2KQMA 3FRPB 4RSVA 3PU7A 4U0RC 4ZPTA 4JIQA 4XZMX 2XNAB 1F5WA 4M61B 3L3DB 1BD2E 4IRJB 1HH6B 1DBMH 4NO5A 2KS0A 4FFZL 2NXIA 2QZRA 4A05A 5FYKL 4GH1A 4W4OA 4YHKL 4PJHB 1A6ZB 2R9HC 2CCRA 3M6YA 4A66A 1AH1A 1W6LA 2R7EA 2AJSL 5HDQH 5BNXD 2FVMA 3MUY1 4MWAC 4F3FB 3ATYA 3CSBA 4KMTL 5ESVB 4G42B 2Z27A 4LRTA 5CGMA 3OD3A 4NRZA 5LA2A 4LCVA 5IESL 3B0VC 1XR9B 1G7QB 3U4AA 3PRZA 5KYXA 2CWXA 3E0WA 4OBTA 4NHCH 3S2AA 3IBEA 1LG2A 2EXWC 3KD4A 4JQ2A 4ABUA 4NY2A 3PL6A 3VAEA 2QNEA 3GG7A 3N9RA 4LEOB 2ZFAA 2IQ0A 2QVMA 2YXFA 3T4YA 3MXWL 2WBJB 2I9TB 4TTGA 3EMZA 4P9HL 4EIUA 3EX6A 4AHOA 2O9OA 4PJXE 2E77A 4LOCA 2PA6A 3V0WH 1AGFA 3IJ7A 3BZEB 2HPTA 4Z7OB 3QR2A 3HMXL 4XN2A 3EXLA 1BCIA 1W3LA 1AGEB 3ABGA 3CX2A 4Z5RB 5IR1B 4Z77A 2XZAL 1JDEA 1YNLL 3AHTA 3KCOA 1OCBA 4ONVA 4FL4B 4N1CA 3FUJA 1ZP4A 4ZMOA 2R1KA 1F2XK 1JCKA 2CWRA 2YD9A 4I18A 5G55A 1Q7QA 3K2UH 5BXFA 3QPZA 1M4KA 5CLYA 3VM7A 1EJTC 3AY2A 4JIEA 5D6CA 3T0EB 4UTAA 5FHBL 4CCCA 4F8QA 1M1SA 1XF4B 2WIIB 3HI6L 2EILB 2VN5A 3Q2NA 1BF5A 3HG1E 4G8GA 4QCEA 4HUXA 3BC9A 2OO0A 1AOHA 3KTXA 4BIKA 3DMMB 5KJRL 4B5SA 3GSQB 2QELA 4OZFH 4HCDA 3BAIA 1BFSA 5EU6B 3AS0A 4XZ4A 3WLRA 1JPFB 3QJXA 1G7VA 3V18A 3WJZA 1AD0A 2H6PA 5GS3A 2VXNA 1H0DB 5C2GA 1OD7A 3SCQA 3CJPA 2FJGB 4KKNA 2GJ6B 3N2CA 2EF9A 2I24N 1J05B 3IUHA 2E9BA 3MOBL 3MSRA 1DJIA 4LXFA 5AUMB 3GU1A 5BV7H 2FB4H 1GKQA 1ASPA 6CGTA 1SNRA 1RZKC 3CXDH 4JPQA 4RSYA 3MNZA 1EQCA 3L3OB 1IT9L 3V4VB 3UXFA 1DJYA 1HGYA 3F6LA 5KAQG 3S36H 3BWUF 1JNLH 4JM2D 5ABZA 1F3DH 4FXGA 6PAZA 4L6HA 4G9FB 2QEZA 1MN4A 4FMVA 5ESAB 1SY6L 4HIJB 3PBUA 4KKPA 4M7ZC 5AKQA 4D6JA 4V2CB 6A3HA 1TTCA 2F1AA 3T3ME 1JZ6A 4C83B 4JTQA 3BRDA 4MD0A 3IS4A 3DVIA 2UX6A 3MRHB 1T3FB 3Q8CA 1TCRB 1KCUH 4G7YL 3D39A 4IIQA 4R5VA 5EIQA 4ZYKB 1NCWL 2IXQB 3TWAA 3WUEA 4LLWA 2G3JA 3IDXL 1MW0A 1DO5A 3WJJC 3DETD 4YHOL 2E7HA 2W0FA 4IICA 1GOKA 2DUAA 2FPYA 4G8FB 3D34A 3W82A 3ZYJA 2WD0A 1XBXA 4IGBB 5FCZA 1MI3A 1UGNA 3VYNA 3QHNA 12E8H 4GMTL 4XNXL 5E1QA 3LV3B 3RVUD 1TIMA 2VC6A 1Q2RA 2F6AA 3UWYA 1YDPB 4P5MB 4QRAA 4MG4A 1IQWH 3M7WA 3TT1H 4FTDA 1B5TA 4QTFA 5ITBL 3GK8L 3WG7B 5ESAA 4BBWA 4Z7NB 2XSBA 4M19A 1LP9E 3T0EA 1X5MA 5B3SB 4OZIF 1MRCL 4I9JA 3DX6B 5FFLA 1P53A 3QAZC 4H25B 5F8QC 4ZSOE 1PUDA 2IQTA 2PDBA 1KJ3L 1ICQA 4P8VA 4S1SL 4XMPH 3GPEA 5TQ2L 4G80A 3TASA 2XQYA 5FYLH 2PR4L 4BQ8A 4S3CA 2N7SA 1PVNA 2P9RA 4LNYA 3KWXA 1QPOA 5BZAA 1F2QA 3EWDA 1C7SA 4GIEA 3S9ZA 1BZOA 3CHXA 2F61A 2F7OA 4TQEH 4UNUA 4UAOC 4AM0A 3HPAA 3MY9A 1GGCL 4QROA 3IK4A 2VDPL 3L95A 3QS2A 3ECUA 1YY8B 3QMRA 3EYVA 1URLA 3WTSA 4KHTH 1ET5A 2WLZA 4NUGH 3RAOA 4MQSB 5C7XL 3UWVA 1X4XA 2AJZA 1XR9A 2J1ZA 3IUDA 4KJQD 2VC7A 4EZLA 1RBAA 1WZMA 3BAWA 3NIDE 1PX4A 4L8BB 4N2CA 5AVQB 1QRND 4NKCA 1EHLL 4MX7A 3BPCA 3DX0A 3UYRH 4Y5YB 4D1IA 1I85A 1M7DB 2EHHA 1KENH 3REQA 4NAQA 3BGFB 1XLAA 1N5YH 2X6VA 2Z28A 1NIFA 1D9KA 3LHWA 1TO4A 2Y1YA 1T0MA 3DX4A 1Z32X 2WCSA 4G6KH 3TEYA 1L4IA 3MUXA 3F7KA 4RNIA 3CMOL 4XNQA 3HE7C 2VJXA 2YXGA 2ADIB 5KVMC 3KM2A 4OZGB 5HHMD 4N20A 5IQ7L 1GWJA 2BNRA 2XTKA 5IOBA 5B1CA 1BQUA 1E65A 4NI3A 3SYCA 3TNMB 2ZRZA 5D1ZI 4KIEA 1E9OA 2DKUA 5C9UA 4KS0A 5A6MA 3B83A 5D7IA 5GGUA 4ELKA 4IXXA 5HDBB 1VBUA 3E6FB 1RHCA 5I79A 1J1OL 5D93C 3NMEA 1U6AL 1BM3H 4PBVC 3HU7A 2HFFA 4Y19B 2FLMA 3CO8A 1G6RL 1OSYA 2F08A 4N90D 2FJFB 1RL1A 3ULUC 5IGXL 4IKJA 4UIMA 4AQ8A 1KA9F 1MFBH 1A7RH 1GMEA 2VRKA 3D6GA 3U4KA 3ZYIA 1H9DA 3CQHA 4AHQA 5BU9A 1E6XM 4P2QA 3GHBH 4DX3A 3SDXF 1WC7B 1CFMA 4X8CA 3NM1A 3R7MA 3ABMB 1OPGL 5AVTB 1YN6A 3WF2A 5I8KH 4XH2B 1A9BA 3CCHB 3EAKA 4G5DA 5BXTA 2C19A 3GS6A 2FB3A 2BNRB 3HR5A 4OD2A 2G3IA 3ASNB 1Y1DA 1KB9K 4P2VA 1E9OB 1MUWA 5HDLA 4HS6B 4R3UA 1XI3A 5FXCH 2HVOA 1NGPH 4GRLA 3ASWA 8CGTA 3KBFA 1E0XA 1JJKA 1JZ4A 3A22A 4MWAA 2VC2H 5AN7A 4N2EA 2NX5B 4G9FE 5DD3H 1JRHH 2IH1B 2IDTA 4PS4H 2Y7DA 1ZBCA 4OQ1A 3L2NA 1TVNA 3VFPB 3UGXA 1A9EB 3LZ5A 4QITA 3MRPA 1HWGB 5D9PA 3MZNA 4RA3A 4G6JH 1ONRA 4HSCX 1M42A 1VBHA 5F6IC 3KNBA 1TQWA 1TZIA 3W53A 2G5RA 3WUZA 4ILDA 2ZG2A 3EHBB 4MXQC 4AQAB 1VCFA 1E4XH 3IRZA 1LJYA 4PGLA 3UYOD 1HCFX 3BD3A 2NT0A 3MJ8A 1DFBL 3FU7A 5CZVH 3KWTA 5IHUL 2PC4A 3PSWA 5EO0A 3NSYA 3NA4A 1I8MB 1GGIL 1HIML 5F93C 2J9ZA 3OZOA 1KGWA 3TJLA 1ZA6A 1XLFA 4IMGA 2WC3A 4AF0B 1BDYA 3B3BA 1DQML 4MHBA 1A5NC 3D6NA 4QYOA 4F7EA 1ICSA 3WJSA 3IJHB 1IM3D 5A2KH 4HK7A 1BZEA 2WKLA 1NAKH 2IH3A 3NCCB 1Y18A 4R53A 3N42B 3N2OA 1XXDC 1WKEA 3WYZA 1PS9A 2I7GA 3V0VB 4LB4A 3RY4A 2E25A 2C26A 4HUNB 5HUOA 3W28A 1BEYL 1OTTC 5DK0A 1C1EH 4Q32A 3GSVA 2ALWA 3HS8A 4HXBH 4NKIL 3UNDA 4KXDA 1TRIA 1JTTA 2C5DC 2N0MA 3ISWA 2H9AB 3MUAA 4TIMA 3RVXC 3LRKA 5B1JA 3BO8A 2J73A 3BYTA 3CHRA 3QIWD 3CL7A 4DIXA 4F57L 1N8FA 2JKPA 3H4HA 3CSPA 1RZJC 5F2LA 1FFNA 4LVBA 4DJDA 4ZL1A 1MI5A 1BYBA 1Q6RA 2NUPB 2O6PA 4NC0B 5EU5B 4AX7A 4YXLH 1JGEB 1DVZA 2NW2A 4UIKL 4ZBJA 1IF2A 3WGVB 1UOKA 4KI5F 4C6NA 4M8QA 4OB5H 3TUUA 3VXOA 1CFNB 1H0IA 4OCYL 7PCYA 1QLFB 1XR8B 3NJVA 1UR2A 4WR3A 1NGXB 5FV2A 4ZQRA 1U8LB 3AT0A 5DMGD 3DYMA 2V5MA 2OELA 5E24E 2VGBA 4X4KA 3ZJ7A 4U4BA 1ES0B 3ESMA 3QFEA 3OZMA 2EDEA 4IOSD 4J8QA 3X12A 3BUQA 3SN4A 3V7PA 2JCCB 3IFNL 5LAXA 5LIXX 4Y2OA 5C07A 3LOTA 2ZOLB 3CVHL 3GSXA 3REVA 4FNSA 4X42A 3P9MB 5K1VA 3GMQA 1OD8A 5F3FA 3DBPA 2BOCA 5JBEA 1RQHA 2GSMB 1KACB 3NWRA 3EDKA 4HCRH 1FVDA 2CZVA 2Z7WA 1J9QA 5D72L 5C6TL 1JRBA 1EOMA 5KZEA 1LILA 1ZA6B 3KLLA 4AL8C 3WL0A 1QA9A 3LV5A 3MLUL 1DQQB 3KZPA 2QBWA 1LNUA 3KE0A 1NC4D 1MG3C 5IK3B 1TPUA 3MRMA 3PCYA 4P0DA 4DKDC 1DTNA 5DD0H 4TM9A 3LH9A 2BK8A 2Q02A 4M6PA 4O1DA 4P2QB 3A6CH 2H1XA 3JUZA 1QSEE 2H0PA 5EU7C 5KS9E 1MNZA 1TWDA 2XFXB 3WUGA 4PLKC 2OSYA 1TTGA 1J2BA 2YCJA 2XRAH 1VJSA 2EAEA 3BLPX 2BMBA 3TX9A 3YPIA 2YPLA 3DMMC 3OB0K 2UZPA 3GM0A 4TKWA 3L6FA 4ZO9A 2GVJA 3U2OA 4E3TA 4F7TA 1KFLA 4B9PA 3AYSA 4O8RA 1WAAF 4DVRL 1A5KC 4PRBA 1RCYA 1C12B 3K2GA 4AEIL 4A7UA 2X4RB 1FI8C 5FEBA 3BUPA 3FHEA 3FFOA 4HPYH 1V3IA 3HJZA 5CZ0A 1XIWB 3VGDA 3WNPA 3EMQA 3O7UA 3WFHB 4XN1A 1C8VA 4RESB 2NSQA 1VADB 5EUOF 3C09B 1VA9A 3MUCA 5BZWB 3E0FA 5MP6H 3PUUA 3U6WA 4WDWA 3UU0A 1XLEA 3GMLA 15C8H 3N1QC 4GKLA 5BJTA 1P5UA 3BEWA 1RZPA 3EYSL 3U8GA 1T66D 3C5XA 2YYUA 2W88A 4UFJA 1TPVA 2P3ZA 1I85C 1A1NA 4PR5B 1UP0A 1TF4A 3APNA 3TWBA 4Z2GA 3DJ9A 4YLWA 4Y9BA 2HJLA 1A25A 4O02L 1UHVA 3HN8A 3VE0B 4ORIA 1H15B 2OPJA 4XKYA 1HHKA 1QOQA 1NAKL 2W38A 5JHDD 5A40E 3Q67A 3EFFA 3CV7A 3MPGA 3WFEH 2YL8A 3MI2A 3B2PA 3L1OH 1KB5B 2ODHA 2XTJE 1VLXA 1H2JA 2Z2UA 4CD6A 4ISVA 4MADA 4I4WA 2R4RH 5DD3L 3AY4C 3DJRA 3MRNA 3SN0A 1U8QB 2XX0A 4IGBC 4I6VA 5DJAA 3TO4D 1Z42A 4NBZB 3AB0B 3DXIA 2F6KA 4E8CA 2YC1A 1I2PA 1SO4A 4AYMC 2G75B 1XD1A 5CLXA 2OMBA 1O6IA 5CJXC 2OXGA 1KBVA 4APQC 4GKOA 3PFRA 1HZHH 4ZQMA 5D2NC 4MAZA 2QZ5A 1UOLA 1NGZB 5LCVA 2NXYD 3QFJA 4BHUI 3TR2A 3VIOA 5I8EB 2ZSVA 2FJHA 2WXFA 3F7YA 5GGQL 5FO9B 5EPDA 5ABGA 3WD0A 4F2BA 4M6MH 1CGTA 2JXMB 3I4EA 3M6DA 5GS1C 1W0VB 1SSDA 3F2CA 2X12A 3CHPA 3DV4B 5DZAA 3CU7A 5EU4B 2OMUA 2Z6FA 1QTPA 1T6WA 3TJEH 1FNAA 4ONHB 2AW2A 1CO1A 2YSWA 5JDJA 4E2VA 3AMLA 1ZWIB 2E6DA 3W6LA 4S23A 3NZPA 3AU6A 4OKDA 4D9RD 7ODCA 2J4WL 1WNOA 4WI3A 1D6VL 5B4MC 1NLBH 5EDSA 1E0OB 4I88A 3GBLA 4KI5C 1X9LA 1NCDL 5GRZA 4F8LA 3HQPA 3CSTA 2PO6A 2YWZA 2Q71A 6PTDA 5HI4D 4CVWA 1TR1A 4OF7A 5AOKA 2KLTA 4H0HB 2KX9A 3NDZE 1MSSA 3NDYE 1K4CA 1OGSA 5AB3A 4GSQA 3VA6A 4WJXA 3QUKB 1IBHA 4XP5H 4G7QB 5T5FA 4BSVB 4KKAD 3GI9H 3UPRB 1IT7A 4FQHB 4KRLB 3VTAA 5BS0B 5CG7A 1PS3A 1R5WB 2VR5A 2Z31C 4K23H 2ZKHH 1G87A 4UM8B 2PDNA 2Q0ZX 3LB6C 3LKRA 4R97B 3GNNA 4JO1H 1I3RA 1JRHI 2RHGA 5FF6B 4A29A 2BW4A 2YSSA 4CKVX 1H15A 3UZQB 4JN2B 2HRHA 3PV6B 4E41D 1ZVSB 3EXSA 3BVNB 2VDGA 3TIEA 4X0KA 1MCKA 4OCWL 1DSFL 3SPCA 2FNBA 3Q43A 1LJMA 2YEZB 4OJEH 5ESQB 3US0A 1HJSA 3HJ0A 4BI7A 5I23A 1OFDA 3GDLA 3RM9A 4IPJA 1KIRB 2DQHL 3FONB 3VRLF 2R0ZL 8XIMA 1T7ZA 3EAUA 3ES8A 3K5XA 3ZXAC 3KLQA 4WDTA 4CGTA 2BDQA 2MOGA 3VXTB 3HOJA 5E8NA 1P7TB 4NUJA 1ZLPA 3BT2H 3QUXC 3E2VA 4HIQA 5DT1L 1NBQA 5AZ2H 5I18H 1HZLA 3C60B 5F9JA 1A1MB 1GW1A 5BVPH 4FOKA 3EX2A 4LO9A 3HGRA 4MHHG 3M0HA 4G7EB 3RY6C 4BKNA 1MEIA 3K8KA 3VFOB 3MHGA 4TL4A 3OYXA 3ECVA 1WX0A 3A24A 5TF0A 1CIUA 1QR4A 1S9XB 5I8OH 4MNGA 5GZND 3QY6A 3MR9B 2HV5A 3IRPX 4S1DD 4G42A 1D3GA 1K4DB 3QUMB 4O02A 1ZP3A 2YGYA 3ELFA 3P14A 4L1XA 3O2VL 5DJCB 2OMXA 4PJDB 5DBTA 2PCPB 1ITBB 4Q56A 1PKLA 4Y2WA 3TT1L 3MRIA 2PTTB 1OCWL 2JEQA 4HIEB 2B0SL 4TXVB 2I07B 3VD1A 2DZVA 2CA4A 5HD8C 3BH9B 3GSNH 5A16B 3INOA 1MJ7L 3DUSB 3OGOE 5IMMB 4GUJA 7TIMA 5F9JB 3VNDA 1KV8A 4L56A 3PWJB 5LXGH 2F5BH 2NLYA 4CMMA 2AJUH 4ZFGL 1QWNA 3C12A 1JP5A 2D0HA 3OU8A 1G1YA 3PPEA 1SUXA 1TVBA 3L5JA 5A94A 2NY5L 5C0NC 2VT0A 4K9JA 3UY7A 1L9SA 5LGJB 1AL8A 4LSRL 3VXRB 4Z7NF 5F9WC 3UYPA 4PPTA 4WNJA 4S3FA 3M0MA 1JGMA 2I32A 4GCXA 1V7MH 2OMXB 3QIBC 4PJDA 1I2RA 4PWIA 1WDSA 2MNWA 5MEQB 2WMIB 2YN3A 1QEWB 3AU0A 3NEEA 3RGVB 3W11D 5DO8A 1H0GA 1ORSB 2VIRB 4QTGA 2X4SB 4FI8A 4M62L 5LN4A 3WQGA 4PRRA 3EWXA 4S1QH 2CCVA 4XP1H 4B5NA 4F37F 1IEAA 1PLAA 5TE7H 4PGEA 4PJFA 4F79A 2AKMA 5EMUA 3W6YA 3LSCA 2CESA 4TL5A 4IQHA 4XCEB 5FOBB 3UEQA 1PZ1A 2PPCA 4HHLA 3VH8G 1MZYA 3CIXA 4LRIC 4K1WA 2VLLA 1H8LA 3BUBA 5CBJA 1L7TH 3NCXA 2VGLM 5CBEB 1CGVA 1W8EA 5DWUL 1Q9WA 1UPMB 2B7NA 2XIQA 4M5ZH 4HKBA 1NF0A 4NPKA 4UOW1 5I07A 2XRAL 3AS2A 2HKFH 2K8QA 5AKTA 5CEZE 4CQ9A 2EP6A 5EU3A 4JFEB 4AEFA 5AB0A 2Z1WA 3BRFA 2VE6B 4L4VA 3RGVA 1BOGA 4QRSB 4ASTA 3LB0A 5I1GL 3HRZC 4OM0H 1MWAA 3ZHFA 4K3ZA 3WTWA 3DU0A 5TE6L 4QXWA 1J9TA 1PZ5B 1A64A 2Y07H 2BNQA 4HU2A 4GQZA 4NRXB 4L1SA 1HKIA 3ZVHB 4J3UA 3WV0A 5JO5A 1NKOA 5K9QG 5I00A 5SX4I 3MJ9L 4HHAB 4PD4J 5H6HA 4I13B 4MJ4A 2VGIA 2OWCA 1ADQA 4W8BA 4U6YA 3BAKA 1DFXA 3FUKA 2NQ5A 2VDRL 2AKRA 5CCHE 2V2CA 3TH3T 4P7LA 2DQFA 1AZBA 1CE6A 1N68A 2G4FA 5L7XH 1CR9H 1FFOA 1IE4A 3OR7A 4L6OA 3ZKMC 1BWMA 3GDKA 1S8DA 5ENWB 1H6UA 3NQ6A 4LBSA 4J3OG 4HSAC 3S4SA 3PPCA 5K93A 2PZ0A 1RU9H 5FYKH 2TSYA 2PXYA 5KSAD 4YTSA 3FXIC 1XBYA 4LJ3A 2Y85A 2J2ZA 1XCTA 4K3GA 4ZG1A 1Q6CA 4GBDA 4C6FA 3CIQA 4XP9H 4P48A 1ZVNA 5I26A 2E5BA 4B3ZA 1EUTA 4YBLC 4NM8L 1MEWA 3AWGA 1TQCC 1DBAH 3LEXB 3BKMH 2PP0A 3QZEA 2WMHA 1YJDL 3RU8X 1E28B 3CUJA 4Q9QL 5SWZD 1HKWA 3HUJE 5IW1A 1VCGA 3LZOA 3X3GL 4AW4A 5JW5B 1AGFB 4W9TA 3NN8B 1IXOA 2VX5A 3DFOA 1UH3A 1F6FB 4MVAA 1B3WA 1CIDA 4F5CA 1DQLL 5DMYA 1SFTA 3ZDZE 4YHNB 1RFDL 2PLMA 1GCFA 3P0WA 2ZOOA 4IMAA 2V69A 4WDUA 2L0DA 3TFKD 3BVUA 2CBMA 1IGCL 2Y6SC 4G5ZH 5CP3H 4EI5A 3WLMA 4P5KB 5IW6B 5KSBA 1ZJHA 3ZE0F 1G0DA 2O1AA 2Y72A 4EOUA 4JZOA 2EKSB 5C0CD 4YIQB 4KRUA 4FJ6A 5CH9A 3T0EE 5FX3A 2VXVH 1K8IA 3DWTA 1FZJB 4ENEC 1NWOA 4PRDA 1TPC1 4B3LA 3WUWG 2WOQA 2G0WA 3OBEA 5E8DH 1E40A 1IVTA 2VAAB 1BIIB 2VXQH 1HEZB 1FYTD 3H3BC 4JRYE 4ZK8A 5HMSA 4LT7A 1GVIA 2MNJB 3VX1A 1NFBA 1PG7H 2Q8XA 5HJ3B 3PAVA 3SRHA 4KVNH 3WFDL 5JQ6L 3DC8A 1U8IA 3HO8A 1ND0A 3HUJB 4HK0A 1HU8A 1BPLB 1F00I 1RZIB 5GGTH 1M1BA 1J0HA 3LQGA 4X80L 3ARBB 2X4OA 4EO5A 5EMYA 1V3MA 3BQ6A 4MJIA 4V11A 1O1HA 1L0QA 2FJGA 2XWXA 1A3QA 3NTYA 3WF0A 4OJYA 4IRSB 3X1GA 4AZGA 5BRZB 4N2YA 4GXPA 2P5WA 3H0TA 2CZFA 2PWVA 2VEMA 4Y9PA 4NQQA 1EBGA 3HAEH 5C09D 2VDRB 3JVGA 2R0WL 3CH1A 3ITTA 2ESCA 1OABA 3AS3A 3VRLE 1FVEB 1MCEA 1YEGL 3AMKA 3D85A 5ANHA 4AIOA 5KYXB 1RAMA 3FN0H 3NCOA 3OVQA 1QFUL 4QBXA 5DFTA 3SCNA 3IKCA 3I10A 1ORSA 2VIRA 2I5GA 3GLZA 3MV01 4UWMA 3LQAC 3ZE0B 1TMHA 4IIFA 1KGYE 4AIUA 1YADA 3OWEA 2CC0A 3QGAC 1MFDH 2ACQA 3WUWB 1GGIH 1HIMH 3FRUB 2C9VA 1NFGA 3STBA 3APYA 2Q7YA 1WBZB 4JFED 2OKMA 5DQJA 4KDWA 1UEYA 3MOAL 4AU0A 3RCYA 4NO5B 1MF2L 4AIXA 1D5MB 1E55A 2H3KA 3ET9F 4PJ7E 2X4UB 1NGQL 3EOTL 3HBGA 5IROA 3JTSB 3TNNA 4GKSA 3RJDA 2QSVA 2HNHA 5AOUA 1EJXC 1XLJA 4ZS7H 1ZHBA 1R0AH 4PRIA 2F18A 2BDNH 4ERSH 4Q9CA 4R90H 2VD9A 2VDHA 5D7HA 2VVSA 3RGTA 3HPZA 3VUSA 1E43A 4Z7AA 1T4KA 2H45A 3QFGA 1TE1A 4LSVL 4GYJA 1IR2A 3UR2A 5HYQB 1ZLDA 3E3HA 1GOOA 1XGYL 3BSZA 2VXUH 2BNQB 3L66A 3GKWH 4NZRL 4XCNB 4JHZA 4F0SA 5IVZB 4ECLA 4QOKB 4AVJA 3B34A 5GNYA 5I5JA 3AHZA 1NIEA 1R85A 1JCXA 4IKLA 1AI1H 3WIFB 4MB4A 2BVOA 3PABB 1DQUA 3MWAA 1HHHA 4HUUA 3T0BA 1O7DC 2KBGA 5E6YA 3QM3A 4ZW8A 3L1EA 1GW0A 2J9XA 5EV7A 5ID0A 2OZNA 2KZHA 4Q6IC 1RQEA 2NY0D 1PZAA 4ODHH 4Y1AA 7REQA 5H2BB 3OJ2C 4PEEA 3KWWA 3CFJB 4ODSL 1KLUA 4JFHE 1PCKA 4Q6YA 4NZFA 3PJUA 5EMJA 4W8AA 4LLQA 1EGJL 2J62A 2Z1BA 4YTQA 1INEH 1NQ6A 3CAWA 4K15A 3U9UA 4MD0B 2CETA 4PJ5D 3ONCA 4H88H 4XN7A 4JXCA 5EU9A 2P10A 1I7RB 1CGSH 1XC6A 1MCOH 1WFIA 4IMKA 5BUGA 1UR8A 1ADQH 1D9KD 1DDHB 1YNYA 3PUEA 2DV6A 5T3ZH 2WO5A 1OFBA 4HWZB 4MY1A 1FSKB 4LVDA 1CICC 3RG6A 1JRCA 2DLHA 4NFDA 4GYKA 1JWUB 2F8OA 1PMYA 2Y7OA 3B2VL 3SDCB 5LO7A 3TVMB 1EO8H 3FJLA 3C6LD 3L1FA 3O8XB 3QJHA 1JZJA 2D03H 3RX5A 1KXTB 35C8L 4YR6B 4P5MA 3NSNA 1KCRL 4K94H 2PYEB 3F1QA 1NWUA 4YC2C 3BIAX 4L2LA 2E6YA 3TSBA 3FLUA 4XK2A 3LHPL 2NNAB 4TMBA 1WBXB 5I15H 2JJSC 3VMNA 1NU5A 2IXUA 3ANYA 3MYJA 3KUMA 2OZ0A 5J1AB 4H04A 1MCFA 3LEYL 1S5HA 2ZE3A 3R2GA 2O4QA 2X7LB 3VFNB 2D1ZA 2DUXA 1ZLUK 3R1GH 4WU5A 1HKJA 5E08L 1U8IB 2GUOA 2B0MA 1SM9A 1RLWA 4Y4HC 3A67L 3HNVH 2ICWB 4MGXA 3QBUA 2N4IA 3M5VA 4O58L 3DK2A 2HWZL 5DC2A 5EORH 2WZEA 3EFOB 3H56A 1XZ0A 2EIJB 2GABA 3P0VH 4MWAE 2DICA 2JQAA 1J5OH 1DN2A 3ABKB 4F8OA 2YD1A 3PHSA 1YQ2A 4P3CL 1ZFJA 3PWVA 4HKZA 15C8L 1J1XL 2CGYA 3SPHA 1UZ1A 4S2SB 1MQRA 3EXTA 2PWGA 2WBKA 5F9OH 4FP8H 2A7RA 1DDTA 1F90L 2RDWA 4F5CE 4HGXA 3HMXA 1RZGB 4XZ9A 4PW4A 3P30L 4HHPA 1IBGH 3HZKA 2KMWA 1AW2A 1Z5HA 3HHRB 4L4TA 4GJ1A 3RYSA 1T5WA 2PXYC 2HT4D 3MU3A 4MNJA 1E3ZA 2JVUA 4UU9A 1XGQB 4MTMA 3N3TA 4CAGA 1XGUB 2J25A 4AXKA 4Z7VE 1T0MB 1BECA 4M8UA 3LCXA 4XXDA 1SYSA 2ADFL 1VJZA 1FCCA 3DGDA 3UGVA 1CXFA 3LDBB 2TYSA 1I8JA 4OGQC 4DP2X 1SMAA 3QY7A 1B88A 1RI8A 4PJGB 1KN2L 3O0RL 4IMEA 1R2SA 4Z2KA 3TZVB 4WGKA 3H9YA 1CL7H 3LAFA 4IX0A 2AP2A 4D6CA 4Y16A 1K4GA 3URAA 2NY2B 4KK8C 1QLFA 1XR8A 4GQPH 4BSWB 3DOIA 3QZOA 3POCA 1YCSA 3QXAB 2O61A 5F7HA 5T26A 3EOBB 4PJFE 3ATFA 2VZUA 1XPGA 3IU3B 4FP1A 2P1YA 2NQDA 4NNYB 1GPFA 4QRPB 2ATMA 3MBXH 4XC3L 3GC3A 2FB4L 4K7PY 5GISL 1NMCC 5C9ZA 3I02B 3O3AA 4WUUE 2VXVL 5LG6A 4U6XA 3E2RA 2X4TB 5DMNA 4L05A 4MA8H 3RKDC 5CJ5A 3BPLC 1AHKA 4TUKL