1KTCA

The structure of alpha-n-acetylgalactosaminidase
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
388
structure length
388
Chain Sequence
b'LENGLARTPPMGWLAWERFRCNVNCREDPRQCISEMLFMEMADRIAEDGWRELGYKYINIDDCWAAKQRDAEGRLVPDPERFPRGIKALADYVHARGLKLGIYGDLGRLTCGGYPGTTLDRVEQDAQTFAEWGVDMLKLDGCYSSGKEQAQGYPQMARALNATGRPIVYSCSWPAYQGGLPPKVNYTLLGEICNLWRNYDDIQDSWDSVLSIVDWFFTNQDVLQPFAGPGHWNDPDMLIIGNFGLSYEQSRSQMALWTIMAAPLLMSTDLRTISPSAKKILQNRLMIQINQDPLGIQGRRIIKEGSHIEVFLRPLSQAASALVFFSRRTDMPFRYTTSLAKLGFPMGAAYEVQDVYSGKIISGLKTGDNFTVIINPSGVVMWYLCPKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-N-acetylgalactosaminidase
publication title The 1.9 A structure of alpha-N-acetylgalactosaminidase: molecular basis of glycosidase deficiency diseases.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Hydrolase
total genus 140
structure length 388
sequence length 388
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2002-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1ktcA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ktcA01
1XBYA 4GO8A 4PL1A 5FEWA 3TCEA 5K4ZA 1HX0A 1K8YA 4LC8A 5DCDA 1QI3A 4ZMGA 4JGDA 1QPKA 1XUUA 2OZ0A 2F7OA 3NO5A 3G1YA 3A4AA 5A6MA 1TYGA 4FO4A 4HNNA 3BCDA 5CPOA 5DLCA 2VEMA 3O63A 5DY2A 4CN1A 1A5SA 2ZRWA 2C7FA 2CLEA 4HSOA 1FDZA 4E0CA 1W54A 1ZAHA 3K1DA 3L68A 3GDLA 5G2HA 3VKJA 3LHYA 3IEBA 2H3BA 4O8RA 4L4LA 4WXYA 3GDRA 3E12A 4HPHA 3O8AA 3GBDA 3ABRA 3JRKA 5CZ0A 1XH1A 3IIXA 1H51A 1SO4A 3W73A 3G1SA 3HZ3A 3BUBA 3C0JA 3FKRA 3MUXA 4HPXA 4R33A 2Q8LA 3W2MA 4JFWA 3AMLA 4K6AA 3W85A 4ZL1A 4H8HA 4RR4A 4UOZA 2E68A 5G2IA 4O15A 3G1AA 4DXVA 1JL8A 4DEFA 4NJIA 4IX0A 4NVTA 2Z1KA 1IZKA 3A21A 1FUYA 3DFQA 2W6RA 3CWNA 3F4WA 4HNTA 3L4TA 3EXTA 1WO2A 4NI3A 4UTWC 2ZIDA 3B03A 4WD0A 3DI0A 2GQ8A 4O14A 3VGHA 3Q58A 1JQXA 4PODA 4IGHA 1SFJA 4LTSA 2GJPA 4EVZA 3QMSA 2VRKA 2C0AA 1VYPX 3QH2A 1I4NA 2ZZ5A 6ALDA 3A5VA 1G69A 2E8ZA 3N2XA 3N2MA 3IRDA 1I2QA 4JX5A 2F1BA 1N8FA 1FCVA 3N9RA 1HTIA 2IGTA 3PB0A 5K2ZA 1LDCA 3EJTA 2GQ9A 2R91A 3RLVA 1YTEA 2ZA2A 2BY0A 3R13A 5D2YA 1XCXA 1GG0A 1W31A 4TU1A 3OLDA 5C54A 2ZWYA 4Z1CA 1U33A 4UNKA 1KFLA 2DU2A 1UB3A 3CEPA 1SZEA 1FCBA 1J4EA 3QQ1A 3TW7A 4QNEA 4U2ZA 3BUPA 1EO7A 1JULA 1VC4A 3EDFA 9CGTA 2Y7GA 4OKDA 4IMFA 3W70A 2GQAA 3W7RA 2C13A 3CB8A 4JIQA 4MUZA 4NNBA 1VJIA 1BWKA 4WJEA 3FEMA 2QCDB 3DFTA 2HS8A 3W6YA 1H7XA 1DORA 3BUIA 1EX5A 3WDIA 1LROA 3D4ZA 4MAZA 3BLFA 3FS2A 1BAGA 1PEZA 4MY1A 1GJUA 1SW0A 2VEPA 3CPRA 3LRMA 1Z41A 3GIYA 2QCCA 5CSRA 4BFAA 3PG8A 4GUIA 4UQDA 2PE4A 3A23A 2YFNA 1VGAA 1JD7A 2CLOA 2ZZ3A 3FYOA 1NOFA 1Q6LA 4AH7A 2J9YA 1UD4A 1JGIA 3MW7A 1DHKA 3WK1A 2QLYA 1OT2A 5AHLA 2OYKA 1TQUA 4OWGA 4UTWA 1SO6A 3W22A 5BNKA 5E0FA 3O6YX 3WNKA 5CZTA 3MWAA 1AQHA 2WCGA 2NV2A 2P1FA 1AG1O 1VQTA 3BLKA 2J6XA 4Z1DA 1G4EA 3OIXA 4O1AA 2FTPA 1TTIA 4GFSA 4UTUA 2OJPA 2NXIA 2Z2UA 4QM1A 4PSPA 1S5VA 3LTYA 5EY5A 3S0CA 1WZKA 3DHFA 1W8SA 1EP1A 4ORIA 4HN4A 4OJYA 3QMRA 1N7KA 4Z1AA 3AMKA 3STFA 1JQVA 4IPJA 1O95A 1NF0A 4JD4A 2WVSA 1R46A 1KFBA 5HPOA 4M7SA 2CLHA 4EIVA 4HKPA 5KMYA 5I0DA 1WX0A 2D3LA 1GCYA 3ANYA 4CQAA 2F7QA 2VR5A 3SFKA 4JY9A 4O10A 2D0GA 3BVXA 1TO3A 1W9XA 1RP9A 4GWEA 2RDUA 3C4UA 1YDNA 3ZR5A 3M41A 3S6DA 4QJ1A 5D32A 3RIKA 4O11A 4Z08A 1BLIA 4OE7A 1TPH1 1L0PA 4UOQA 2I1OA 2VNCA 5EKYA 5A2BA 4R7JA 4LC6A 1VYRA 1J0HA 1GJWA 3PF3A 1FWSA 2FDSA 5FF7A 1EA0A 3KHJA 2NWRA 1O94A 3EJRA 2QUTA 5F4SA 4UFLA 4ZZ9A 3BVTA 2CZ5A 4JTFA 3L5MA 4PSRA 2DJLA 3W7QA 2G97A 4XTIA 6TAAA 1P6WA 1TB3A 4FNTA 1YXYA 1O7DC 3HIJA 4IXHA 4XZ9A 4LU0A 1ME9A 4GQQA 2VENA 4U2YA 3NPWA 5G2WA 3WJYA 1MW1A 2FH8A 2ATSA 5A6LA 2GPTA 4AWTA 1TQJA 5E6YA 1Q6RA 4DELA 3BAIA 4CCEA 1CW2A 1H60A 4UQ9A 1QW8A 2YW4A 5D2TA 1QWGA 1S3HA 3BLEA 3WDHA 1DKWA 1JI2A 3TQVA 4BI5A 4MLRA 3VGEA 2H3DA 1IIHA 3RF9A 4ZQPA 3OLGA 3BLPX 2ZXDA 1UOKA 4XB3A 1GWJA 2HS6A 3KVJA 1SQ7A 3FW6A 2A85A 2ZRVA 3DX1A 1FX6A 5HDRA 4LUJA 2YGYA 3N14A 3STGA 3W75A 1QPOA 4LV9A 2QMKA 2VC6A 2BLEA 2V3DA 4AHPA 1MEWA 1JCLA 4MZ1A 5EA9A 4UC5A 4XQ6A 3C2FA 4I7UA 1TJRA 3HB9A 5U7SA 2OT1A 2B4GA 3EWXA 2ZXAA 3U8GA 3BGJA 3ELFA 1H63A 4I9AA 4L4MA 3OLEA 1OF6A 2EADA 3IVSA 4JFSA 2V9DA 3BC9A 3FOKA 4AAJA 3UPWA 3D0CA 4U31A 1I2RA 1ZENA 5E70A 3LCWA 2V8ZA 1B4KA 4IOTA 1QAPA 3G0UA 4R34A 1IV8A 3ABSA 1KWGA 3LTPA 1GVOA 1T0OA 1W3TA 3BAJA 1F05A 1KW1A 3LX9A 1DOSA 2Q3RA 4LRTA 3NQVA 3VNDA 1OB0A 2G5WA 5F2GA 3TSDA 2DZUA 3W1MA 3CTTA 4FNPA 2ZZ2A 3BUDA 1PV8A 3FJLA 5CG7A 3L65A 3IJ8A 2A2IA 3NGJA 2BZNA 3CQ0A 1WPCA 2XWEA 1MW3A 1V3LA 1DEDA 3CIWA 1FY6A 2EAWA 4Z1BA 2Z1BA 3L4UA 1KGUA 3D52A 3O15A 2B7QA 1UD2A 5F7UA 4MVAA 3UY8A 1W5MA 4IXXA 1V5XA 1FCUA 3DHPA 4HHPA 3GZ3A 1KBIA 3CZKA 1KM6A 1YLVA 4DQWA 4CNPA 4UTHA 4CNNA 1CGXA 2V2DA 1QCWA 5BRQA 3EWUA 3G18A 5DBTA 3OG3A 3W1PA 3GXDA 3DKJA 4CLMA 4O4VA 1YXCA 3W2LA 4BI6A 4FF7A 3TAKA 4BR1A 5TD4A 2ZE0A 2AAMA 1EO5A 3L4ZA 2X2IA 1VYSX 2PWHA 1FWTA 4JTSA 3VMPA 1LRTA 1OT1A 4PCFA 1DBTA 4WOQA 3MHFA 2FHCA 4M7TA 2QJIA 3HPXA 4GC4A 1KLZA 3DXIA 4FX8A 1X1OA 1QDSA 5F4WA 3WNPA 1QPNA 4RV8A 1F2JA 2CLIA 5IBXA 5G4WA 4BA0A 3SI9A 1E3ZA 3GAKA 4AHOA 4UCFA 3GVGA 3W38A 3LXBA 3L0GA 3IIZA 3VGBA 2BSLA 5D30A 5BOOA 1SMDA 2E09A 5KINA 3A9IA 2GVYA 4UR8A 1T99A 5I3IA 5H91A 1JXKA 2WPGA 4XBSA 1F5ZA 1FWRA 2J9XA 2F7FA 1W0MA 4EF9A 3MHUA 4AMWA 1TIMA 2JGQA 3DFOA 3L0KA 3GR7A 3FAXA 1KV8A 4QIUA 4AMAA 5U4NA 2C3ZA 2QKFA 3G1HA 1M7OA 2F7PA 1DHPA 1W5NA 2ZICA 4U4MA 1ZS2A 3NM1A 1W3IA 2Y7DA 1VIWA 4JDBA 2ZCGA 6CGTA 1OK6A 1JIBA 3DHDA 3G1XA 3P7YA 4B9ZA 3G22A 3TROA 3PSVA 3B4UA 1RPKA 2PRLA 5C55A 1ML1A 2G3NA 3C2RA 1CXFA 3NQGA 3UZ5A 2OT0A 1M7XA 3W7MA 1YTDA 4Q33A 1I75A 3DH7A 2TPSA 1OYCA 2VFDA 1TTQA 4OV4A 4NUWA 3MMTA 1UA7A 4O54A 3NL2A 4NX0A 3WY1A 1NM9A 2V0TA 4O4WA 2F84A 1Q3NA 4ZQNA 3W1NA 4J3SA 5LNSA 4JEQA 3BVJA 1IZJA 4UNLA 3GDMA 1I45A 2JKPA 3BSGA 3W76A 3TQKA 4RLIA 4GE8A 2D73A 1TMHA 2YCEA 4GI8A 2BWGA 1QX1A 3NL5A 3QRHA 4TIMA 5EBUA 4PA8A 1AW2A 4MB1A 3LBCA 2RHGA 3PBVA 4JYEA 3TH6A 1MFUA 4M56A 1XXXA 3LXCA 4GUHA 1D3CA 3KLKA 2YX0A 1IXNA 4UFJA 2FYVA 4O1BA 3G1DA 5KZEA 1PIFA 2CXGA 1NFBA 1ZFJA 3NQMA 1AL7A 1L9WA 4AXKA 1H61A 4RXFA 1PIIA 1S5TA 2ZUWA 3DHUA 2P10A 1HO4A 3PVFA 2X1RA 4A21A 1TQWA 3UQNA 3QM3A 3M16A 2ZFAA 2QJGA 1VPXA 1QPRA 1IGSA 2WVUA 1NVMA 2D0HA 4MZYA 3VX0A 3RMJA 3QSTA 4OQVA 3VE9A 2GVJA 3G24A 1QMLA 1C8VA 1J0IA 4NZJA 1UBSA 4KKXA 4JCLA 1TQTA 1C29A 3HJEA 1TCDA 4U3CA 4HOWA 4UTMA 3DKLA 2V82A 3PS7A 5L6UA 3T78A 2EHHA 1T96A 1D7FA 5TBOA 4XKYA 3ABOA 1F6KA 3LOTA 1JCJA 3I7RA 1UH4A 5AHIA 4ORMA 4IMCA 4X9YA 3HGSA 3VI2A 1AMKA 1JCNA 5J5DA 3C2VA 3P82A 1LLWA 2NX3A 1HO1A 2ZZ1A 4Y90A 2B0MA 5D2XA 2V81A 2DORA 2PRHA 3PSWA 2VFEA 1FXQA 3P61A 5BMWA 4QITA 4A2RA 4RCXA 5LNUA 5G5IA 1O5KA 1R33A 3II1A 1LOLA 2CZDA 1CXHA 3BMVA 1KBJA 2QPSA 3MI6A 2O7QA 2BXZA 1JRCA 4UZUA 3KWXA 1HL9A 5CKSA 1XSKA 3CZGA 1B3OA 2EKCA 2QR6A 2FB3A 5HR7A 1XFBA 2C16A 3M5VA 3PG9A 4DO4A 2NUXA 1RZMA 1VFMA 2DJXA 2NX9A 4GKLA 1AL8A 4AEFA 1R2TA 3TMLA 3T7VA 1QWNA 1UASA 3LHTA 2NT1A 3P5ZA 2QEZA 3LDVA 1KV5A 5EPDA 5FF4A 3R5EA 2BXYA 2QCHA 5BW6A 1GEQA 4X22A 3L67A 3EWBX 2QCNA 1LYXA 4WY0F 3GXNA 2ZUVA 4ATWA 4UFKA 2FB2A 1SO3A 4NQ1A 4XTDA 1GQNA 3UWWA 4S2BA 2QCMA 3S9YA 4AEOA 3DFPA 1XD0A 2VFIA 4TVUA 5I3GA 2F18A 1CGWA 3E9AA 1J0KA 1B9BA 2QJHA 2FHBA 1J0JA 2NXHA 1LCOA 1CDGA 1JCYA 2CZEA 4GINA 1BVZA 2V5LA 4JIPA 3KVMA 2EABA 5CGTA 1HNYA 3GKFA 3L5LA 1BTMA 5I3HA 1AW5A 3L4XA 2WOQA 2Y7EA 2YPIA 1V7YA 3KFTA 2PWFA 3TOPA 4YL2A 2UV8G 1D3HA 1FCQA 3S2CA 4WXZA 5K9DA 1SR9A 2NXGA 2X2HA 4FXRA 1KXTA 1TV7A 5D03A 2DZXA 3ABQA 2BHUA 3L9CA 1QO5A 5FF0A 3W9ZA 5D38A 5HWNA 3WNLA 2TYSA 1LOSA 1KFJA 1BWLA 4JFUA 4TX9A 1UUOA 4CKQA 3W2JA 1FDJA 8TIMA 1ME8A 3TJXA 3BVVA 1UH3A 3W83A 1TTPA 1RQHA 2TMDA 3VSUA 5HMSA 3PBWA 1VAHA 3EKLA 1OX6A 4MYXA 2EEXA 2Y4SA 4DO6A 3B04A 3BK0A 1Q6QA 4AVFA 2JGYA 1H7WA 3BV4A 3WJZA 3I65A 4DPPA 2E6AA 1OK4A 4LS2A 1JR1A 3NQ2A 3RLUA 2E6YA 2X30A 5DCEA 1ZHAA 3M47A 2VFGA 1JCXA 3NM3A 3STEA 4TR9A 4LWWA 1NF7A 3BPWA 1EHAA 1MEIA 4FNQA 2ZA3A 2ZZ7A 1HVXA 2YA1A 4FIRA 4HIBA 3W2UA 3CTLA 2J27A 1KGWA 3C56A 4X2RA 3C6CA 2ZDRA 1BEUA 3WDJA 5DO8A 3FKKA 2Y61A 1MVYA 3NQDA 5AOUA 1W3NA 3QGVA 1G1YA 3O1NA 3W7OA 2BTMA 3IGUA 2ZUTA 3CIXA 1X7FA 4MYAA 1WOBA 1GTEA 1F76A 4J3TA 1HUVA 2WVVA 1XSJA 1HFBA 1OX5A 4MY9A 2Y89A 1G67A 3W1RA 3PM6A 3H53A 3OHIA 3GKAA 5A8GA 3EJQA 5DY3A 5CPLA 1AK5A 4WF7A 5AHEA 4LQ1A 3ZR6A 1TREA 2WSRA 2E5CA 3GK0A 4RZ4A 3UWUA 2QPUA 3VGDA 1J5TA 1EB3A 1H50A 3E0IA 1ICPA 1AVAA 1FWNA 2JBMA 3IVUA 1HG3A 3S5NA 1Z32X 5C2XA 3WEOA 2E5BA 2CLLA 3CZNA 1O5XA 1OVDA 2BY3A 3BVUA 2TAAA 3MI3A 2QAPA 3AJ7A 1GTHA 1W1ZA 2YW3A 4HSNA 3K8KA 2JKEA 5HQEA 4LVAA 2FH6A 4MFDA 4QSHA 4O17A 2J9ZA 4NJHA 2G96A 3GNDA 1SZFA 1TJPA 2F61A 3W71A 4WQ6A 3BAWA 3NQ7A 4CQ8A 3BGGA 3O16A 4OBTA 1BF2A 4UMBA 2E0PA 3PR2A 3W87A 3DAQA 4NJJA 3RU6A 2BX7A 1SSDA 3UXDA 3NXFA 4Y96A 2A6NA 3KL3A 5EYWA 1UD3A 3F1QA 1W37A 3IGXA 1WXJA 3F03K 5FEZA 3KRSA 2I9EA 5I3JA 2PWGA 4XWUA 4ML9A 1A47A 1EWEA 3GBEA 5D02A 3LRLA 1CI1A 3W7EA 1WYIA 4PEKA 2ZQ0A 4H6KA 1UD8A 1XL9A 2CU0A 3PUDA 2ALWA 1G7UA 1W5PA 4ZQRA 2CLKA 5AYYA 1EWDA 1NSJA 3UWQA 3QYQA 2CFFA 2V2HA 4JFVA 4R53A 3TJLA 2RDTA 2DP3A 3A24A 3P84A 4H8VA 4XBKA 3CPUA 4K37A 3M5XA 2XN0A 1PHWA 2RFGA 4C1LA 1THFD 4MY8A 5D2VA 2GUYA 3THAA 3QC3A 3B05A 4UFMA 3PWAA 4X3ZA 2WSYA 3SGUA 2A7RA 2E8YA 4QAWA 3UG3A 3IIVA 5CLTA 4WLCA 2GUUA 4O0KA 1XBVA 1VHCA 3BG3A 1K8ZA 3OEXA 3FAWA 3W1QA 1OFDA 3R2GA 3EDEA 1YXDA 4M8UA 4H4IA 5F2LA 2A21A 1E40A 3TXZA 4CQ9A 3UG4A 4WOZA 3IK2A 5FEXA 3VM7A 1HXKA 3OA3A 4JTEA 1R47A 5K4XA 3LHWA 4S2CA 1KBKA 3WFAA 5LNRA 1BVNP 1UD5A 2WNQA 2CWNA 2CW6A 2B7PA 4AIEA 4RZ6A 2OMAA 3T44A 4RZ5A 2QCEA 4B9YA 3G8RA 3H55A 3LTSA 3OVPA 1U30A 2NUYA 2A1YA 4GIAA 2KZHA 4LPCA 5CXPA 3W7LA 3INPA 3NQAA 4O50A 4UTIA 3PUEA 1GYLA 1YPIA 2QV4A 4U28A 1JI1A 3WN6A 1J2WA 3WJXA 3ZWTA 5HUOA 1ALDA 4O1CA 3SW6A 2YXGA 1K3UA 2WQPA 4LV4A 1QHOA 4UNIA 2RH9A 3OLIA 4RX0A 3TC6A 4JL1A 1H3GA 2ZYFA 5D33A 2EACA 3SECA 4DBEA 5IBXC 1FDYA 1Q4NX 5LHFA 3CLWA 3IJ9A 2ALDA 1IXPA 3W1XA 2OSWA 1WZMA 2WVVB 3IVTA 4ALDA 1H7PA 4M6QA 3JS3A 3YPIA 2JK2A 3GXFA 5DFAA 4GI9A 3A5FA 3R8RA 3EXRA 1Z42A 2X1SA 3D4YA 4UXDA 1HT6A 7CGTA 5F1VA 3GR8A 1W5OA 3WNMA 2B7NA 1U2YA 3WFZA 3C52A 3L2IA 1QFEA 1TQSA 1OHLA 3HGRA 1TMQA 2ABAA 5HWMA 2WSPA 5T26A 2DIEA 3BG9A 3USBA 4EWND 1OX4A 3LPOA 5KZDA 1TPC1 5I24A 1MXGA 4IX2A 1TCMA 2WNWA 2E6FA 3NG3A 3NVTA 4JL2A 1NEYA 4O52A 3ZFHA 3TSMA 3WEMA 2OYMA 5ABTA 5E1QA 1C8QA 2NV1A 5HULA 1KXVA 1ODUA 1V3MA 3S5ZA 1VCFA 4CN4A 3VCRA 2PURA 3QPYA 3WK0A 3S1VA 3KX6A 4LS1A 2DZVA 3NZRA 5MHBA 1TPFA 2AGKA 3L5AA 3P81A 3FIGA 1DJQA 5AFDA 3VMNA 4FXSA 4ADTA 4MJMA 1XH2A 1M6JA 5IM51 3M44A 3TA6A 2NUWA 1KFKA 5SWUA 4Q4KA 4I7WA 4DBDA 1YTKA 1KGXA 4O1DA 5FEPA 1Y7VA 2GJNA 1CYGA 3UPBA 3DDGA 1PCWA 1A53A 2WJZA 5CZSA 1HL8A 4JNMA 1QOQA 2C8NA 3BG5A 4YCPA 5E93A 1VRDA 3B0PA 3GXTA 1QI4A 4OU1A 4AYGA 4GUGA 4O53A 2ZWZA 2V5BA 3G3MA 3IGSA 1PL9A 3QJAA 3WK2A 1XH0A 5A5WA 3P67A 2NSXA 4IQLA 4CGTA 3GB6A 3WY4A 2OCZA 3NOEA 3DZ1A 4FMVA 5E6ZA 2V2CA 4J3UA 1LP6A 3P8JA 3NAVA 2R94A 2YDAA 4OV9A 3Q94A 3KEHA 1GVSA 2OW6A 4N6EA 1WAUA 3T55A 1MWOA 2NWSA 3CLMA 3W7HA 3DDFA 3G0XA 1DL3A 3MYPA 3LV6A 1XD1A 1WP6A 2NLIA 4JTGA 4N6FA 3T40A 2XN1A 1BPLB 3W07A 3UZJA 3GXPA 3O6DA 2YYUA 5HINA 4YWIA 4LVBA 3W74A 2FPYA 1LORA 3TNOA 1L6SA 4ADUA 1P1XA 3BARA 2HSAA 5CLWA 4JN6A 5LHEA 2WVTA 3GDKA 3EB2A 3UYCA 4E2DA 5LSMA 3GTNA 1HWWA 2WV8A 3NQFA 4OGZA 2ISVA 1KM3A 1F6PA 4NT0A 2E4TA 3EDKA 4KMQA 1KFEA 2Y5EA 1KWKA 1OFAA 1NAL1 1PZ3A 2Q3OA 3W1TA 3KOFA 1OFBA 1SU5A 3LI0A 2BY2A 3LLDA 2WKGA 2DH2A 3N73A 3CZEA 4PEEA 4HOZA 4IPIA 2Y7FA 1PAMA 3HG3A 1H1ZA 3EXSA 2D0FA 4UZSA 4KFOA 4ICNA 4UFHA 1XKYA 3LHVA 4FHAA 4P61A 4XUGA 3HBLA 1ME7A 4GO9A 2FPVA 2A0NA 1VFOA 1U5JA 3W7KA 4N9BA 3KL0A 3PC0A 3IIPA 4UTLA 4C1KA 3MO7A 3NPXA 3CHVA 3FFSA 2P0OA 4JY8A 3KRUA 2V3FA 1OFRA 1SZNA 4LT9A 3KVKA 2GJLA 1KXHA 4PC8A 3BAKA 2EJ1A 4H7VA 1B0IA 4NXKA 1MEHA 4MKNA 1KBBA 3DX0A 3GXMA 2CPUA 1G4SA 1YDVA 2WC7A 3EJUA 3HG5A 1KM2A 5G1TA 2FQIA 1UKTA 2CZFA 1JRBA 3EX1A 4A2SA 2FLIA 5AB3A 3KVLA 3W7IA 4JX4A 1G4PA 2BHYA 2YA2A 3G3DA 3Q37A 3BAXA 5LNWA 2ATMA 3NDOA 4JTUA 4IMDA 1K7XA 4AW7A 2A7NA 4CCDA 5E9AA 1QW9A 2BXVA 4LS0A 4S1FA 4HOXA 1DVJA 2XWDA 3M43A 1XI3A 3LB0A 1VR6A 1ONRA 3DBPA 4GXMA 1RVGA 4NNAA 3LBMA 2X1TA 3DX3A 3W7CA 4AMXA 2Y62A 3W7GA 3UERA 5AC6A 1DTUA 1VHNA 2ZBTA 3DU0A 1EA9C 3VSVA 4IMGA 3P62A 1OG0A 3QQ0A 4MIMA 4OT7A 1H7OA 1GVRA 1OYAA 3S1WA 1G5AA 3NPUA 4Z0JA 4JTHA 3HG4A 4A3UA 3PBYA 3EEGA 3B0VC 3BAYA 5BRPA 2A7PA 3MI2A 1TPVA 1VCGA 1OF8A 5LKYA 1RQEA 2C14A 4MPQA 1TRIA 1GJPA 2ZZ6A 3TV8A 1F7BA 4HPJA 3HMJG 2XVKA 1X1ZA 2VFFA 5AHNA 2QCDA 3L66A 5HR6A 2QMJA 2O7SA 3E49A 3OBKA 1C9DA 3QEZA 4BWLC 3R89A 2V3EA 3LHZA 2J25A 4J3XA 4IMEA 2QCLA 2EPHA 3VGFA 1QR7A 3QZEA 5F4XA 2E5DA 4YLWA 3SZ8A 3M7WA 4M6PA 4LXFA 1O60A 4JX6A 3N3MA 3VNYA 3STCA 1CLVA 1A5AA 1BG9A 4FX6M 2X16A 3NQCA 3S8HA 2ZTKA 1VZWA 3O06A 1YPFA 4TMBA 4CVWA 4HT3A 3FLUA 4MJZA 5F2IA 5AN7A 4HNUA 3UCQA 1M7PA 3I68A 2YR1A 3W7JA 3TSBA 3UNDA 5K7JA 3E02A 1MFVA 4N9EA 2XIIA 1IF2A 1IXOA 2YA0A 1OFOA 4LVGA 4PCSA 2DIJA 2VKZG 2WSQA 4YCOA 4MLJA 3AJXA 1MXSA 1K02A 4NXSA 5D04C 1VB9A 1PS3A 1XCFA 3ECQA 3LXAA 1E3XA 3OVQA 4KFNA 2C6QA 3MHGA 4FLRA 4GUFA 3SR7A 3DI1A 3AXHA 4U33A 1OFPA 1Q45A 1G9HA 3DFNA 4M6VA 2ZUSA 1MZHA 2EO7A 1ZNNA 5EMYA 1LWHA 1S5WA 5I23A 3T4CA 2RKXA 4GJ1A 5F1UA 1PS9A 3LCHA 3CZSA 1RD5A 3BUQA 5KEZA 1E51A 3QPZA 4IJBA 4UCGA 4JYDA 4JXCA 2AQWA 3B06A 3W1LA 3SY5A 3EX6A 4GBUA 3MP3A 3VE7A 1ZAIA 3CGTA 1I2PA 1JDDA 3VMOA 2C15A 5BRBA 5I3KA 1CGTA 3G1FA 3HGOA 5CGQA 1P5BA 2QUUA 1JVNA 2YIHA 5BMXA 1XM3A 2QUVA 4FIQA 1WDWA 4MFEA 1AW1A 2H90A 3BH4A 3W2KA 4GNJA 1MO0A 2F7RA 4DF1A 1ZJIA 2QDGA 4NJGA 1UD6A 1JCMP 1UKQA 2Y2WA 2JKAA 4JDYA 3LPPA 4BWLA 4GQRA 7TIMA 3HG2A 1I2NA 3A6OA 4FNSA 1ICQA 4ZVJA 4A22A 3IJ7A 1PIGA 1SSGA 5A2CA 1BKSA 3HJZA 3BW3A 3N9SA 5G4EA 3CC1A 2VEIA 4W9TA 3WJWA 4NU7A 1B2YA 3W84A 3DX4A 1DV7A 1P4CA 4JTIA 3WMSA 2QF7A 4N9CA 4O57A 3GAYA 5C6MA 1VH7A 1UJPA 2VFHA 2FPTA 2Y70A 5EMUA 1JFHA 1GZGA 1F73A 1JJKA 4LNYA 4TMCA 1UA3A 2VUYA 4M19A 1IXQA 4XKYB 3UD6A 3HPZA 1EH9A 1TPDA 2Y85A 3CT7A 2IQTA 2ABBA 3VNZA 3W23A 1MW0A 1L6YA 3TUUA 3MBDA 4CNOA 4AF0A 4JYFA 3D51A 2A6LA 1LM1A 4UQAA 2WPBA 2XVLA 3A47A 4A29A 3B0UX 1HL2A 4LW7A 4Y6GA 3SSJA 3WNNA 3DGRA 2WKLA 1EUAA 3TTSA 3A22A 3ZO9A 5EL1A 1KB3A 4JTJA 1UCWA 4JTTA 1QHPA 3W1AA 1FXPA 5LGXA 1KM1A 1LWJA 1XC4A 4UIOA 5DELA 2GVGA 3M5ZA 1L2UA 3S5YA 1GPWA 3ZS4A 1JDAA 4PH6A 2X2JA 2NT0A 5A2AA 2ZUUA 1PVNA 3ZT7A 5TQLA 3WELA 1L6WA 5FESA 1H62A 2VXNA 4K36A 2VRQA 2E77A 5LGZA 4B5NA 3TKFA 1PE1A 4X0NA 1GVQA 1XGZA 1R2SA 1B4EA 4QQ3A 1A5CA 3B8DA 3JR2A 2I14A 1DJNA 3W37A 3UG5A 2Y6ZA 1RQBA 2EQDA 5FF3A 1FWWA 4J3VA 3PY2A 1B57A 5AC8A 5HJLA 2W0UA 2G3MA 1VS1A 3I6RA 3UXAA 5E0KA 4Q32A 1JUKA 5CSSA 3LCLA 4MZ8A 1XUZA 3MP4A 3EJPA 4ZQMA 4E2BA 3TONA 1XDMA 3P60A 4AEEA 1WBJA 4GRSA 1OYBA 3NL6A 3NZ1A 1SFLA 3KXQA 3NPVA 3MYOA 3TK7A 1DQXA 5K9CA 4W93A 4N02A 4RKAA 1R2RA 3S5OA 3V75A 2YFOA 4UTJA 3N19B 1VCVA 4DPQA 1KTBA 2X1UA 3IIOA 1OJXA 1LZOA 2D2OA 1XDLA 4KWVA 4LY8A 1K03A 5D37A 1LOQA 4MOZA 4KWUA 2WNZA 1M53A 1PHQA 1TPWA 2QCGA 3VO0A 4WZHA 5CPMA 1ADOA 1GT8A 1T8XA 1QWUA 2HTMA 4BI7A 2H8XA 2W79A 1CX9A 1EUNA 2YYTA 3P80A 5FF2A 4BK9A 2XN2A 2QDHA 4JCMA 2DZPA 3LCIA 2VOMA 2XFWA 3H54A 5G1YA 3HQ1A 3GXIA 3ATZA 5K3VA 1WE5A 1YYAA 1IIGA 3W72A 4WSKA 3TDFA 1WQ5A 3C61A 2C1HA 3L0NA 1GYNA 3L2MA 1XSIA 2DZSA 3PULA 1KM0A 1G4TA 3LERA 1D3GA 4JFTA 1VLIA 2YOCA 3I7QA 1JUEA 4PL2A 3W7DA 3K8MA 1JUBA 2Q8ZA 3QF0A 1LRNA 3TX9A 3CEUA 1N55A 3S42A 3BW2A 2Y63A 1RR2A 3L4VA 3FJ6A 5DXYA 1YADA 2ZX8A 3W88A 4Z0SA 3NQ8A 3KAOA 4WY0A 2YSWA 4LRSA 2CLMA 4O0ZA 5LZLA 4DF2A 1JF6A 2RDWA 7TAAA 3GNNA 4DF0A 2X2GA 1PZ2A 2ZRZA 2R8WA 3O07A 3TU9A 2EGZA 2ZA1A 2ZTJA 3MJYA 2B7OA 3R12A 4K39A 5H2ZA 3UWYA 3M0ZA 1LBLA 4WUIA 2J24A 1TV8A 4LVFA 5LNVA 3C2EA 1R30A 2A5HA 1F74A 2HMCA 3PBUA 5GVJA 4NX5A 2D3NA 3L4YA 1CGVA 4AF0B 4M5PA 5AYZA 3FA5A 3HOJA 4K7VA 3LCGA 1GVFA 2OSYA 1SPQA 4K8HA 3NA8A 4JTLA 3P74A 3HGJA 3NL3A 1K7EA 3KLLA 3UEQA 3EWYA 5D2WA 1PPIA 1H1YA 1Y0EA 4H3DA 3GDTA 4Y9AA 2Z6IA 1GG1A 4J7RA 1M5WA 3WNOA 1S46A 4QNWA 3M1ZA 1KA9F 4I7VA 3W86A 1AMYA 3IV3A 2A4AA 4E38A 5J5RA 3CU2A 4HA1A 1I8JA 3UY7A 3TTYA 4N4QA 1MW2A 4G1KA 4BF9A 3LCFA 2YKKA 3D50A 3W2NA 2QCFA 1K7FA 4P2VA 4ONVA 3PAJA 4KWWA 3L21A 3WK3A 3VSTA 2PWDA 3HF3A 4FX7A 1JG9A 1KFCA 3TE9A 4POCA 1VFUA 2OYLA 3RFAA 1W5QA 3DX2A 3W3OA 3OVRA 4ZQOA 5DN1A 3E96A 3MBFA 3GX9A 3NYZA 4Y8FA 2YZRA 1TPUA 4LOCA 4JR5A 5TIMA 3BCFA 1ZJAA 3Q2DA 4TO8A 1QO2A 1RPXA 3LM7A 3DENA 3EWZA 4RJEA 2J88A 2OX1A 1R34A 4UQCA 3ZT6A 4AWSA 3C2OA 3S1UA 4LVDA 4O28A 2Y24A 4OIFA 4UTTC 2FJKA 5AYXA 1PCKA 4O13A 1MSSA 4LUIA 3LCXA 4JTKA 3EX2A 1ZY9A 2ZX6A 2GVLA 3TIMA 3LLFA 5HNRA 3RILA 4EF8A 1XBXA 1H7RA 3EX3A 1TPEA 1DQWA 1UUMA 2XVGA 3TFXA 5KSWA 3EX4A 2F2HA 1SW7A 1JDCA 1RV8A 3C8FA 4BZYA 1G7VA 1P0KA 3FYPA 2WNNA 3BLBA 4H2CA 2ISSA 1K8XA 1TSIA 4AYSA 2FGZA 3K8LA 4YMZA 1H5YA 4UTKA 3WENA 2AMGA 1ZALA 3QFEA 1OGSA 3VX1A 4DO5A 2QAFA 2R14A 4GUJA 5D05A 4PTNA 1CXKA 2ZXBA 1X6UA 3M5YA 1Z48A 4ADSA 2ZZ4A 5FI8A 1ICSA 3LI1A 3GYEA 1EEPA 3UWZA 4UUIA 1WV2A 4OHQA 3BMWA 1U83A 2CHNA 5HUPA 4J27A 3BSHA 3ZSSA 2ZRUA 1TRDA 2TRSA 5D09A 1SZGA 2WANA 1OSEA 3K30A 1WBHA 4K8EA 1JF5A 1CPUA 2NX1A 3DFSA 5CGMA 1G94A 3W1UA 1UKSA 3NNTA 5I3FA 1KTCA 3NEVA 3G0SA 3RNDA 1FBAA 4ZQCA 5KITA 3QW3A 2TSYA 8CGTA 1OABA 1JD9A 2C18A 4N9DA 3TR2A 2ZX5A 3ZSTA 1QOPA 1TQXA 2ZRXA 1WZAA 3O6CA 3CZLA 5KZMA 3HPSA 1V3KA 4WY0B 4X9SA 1WOAA 3EJSA 1P0NA 2WKJA 3ZQ9A 4IUOA 3TQ0A 1OFEA 3TMQA 3WY2A 3LHUA 3ZWSA 2GJRA 3SGZA 1CGUA 3CV5A 1CXIA 3BVWA 1D9EA 3AO0A 4K7YA 3HO8A 4FNRA 1A5BA 1LLZA 3M9YA 4NZFA 2ZX9A 4O12A 3M07A 5KTLA 4QAIA 3LRKA 2C19A 2PCQA 3U2OA 4FB7A 4UTTA 2ISWA 5HXMA 3SJ3A 3TW6A 1TQVA 3TC7A 1LBFA 1FQ0A 1XBZA 1ZAJA 4QISA 2BHZA 3S1XA 1LBMA 2H8ZA 2ZXQA 1TTJA 3BW4A 4O18A 4UFIA 1KM5A 3N34A 3NR0A 4RK8A 3ZOAA 2FHFA 1A50A 3M6YA 4O16A 1CXEA 1OFQA 4CCCA 3EDJA 3LGEA 4HNVA 2ZRYA 1V3JA 4EOUA 1PJ9A 1CGYA 2FIQA 4K38A 5K9XA 2F1AA 1KLYA 2Y88A 3EKZA 4D2JA 2WSKA 2YJQA 4H8UA 5CZJA 2E9BA 4NNCA 1VJSA 3F4NA 4CN6A 3L4WA 1Q6OA 2VELA 1KTNA 1OX4B 2V30A 2VEKA 3KL5A 2G95A 4JICA 1EP3A 4JS3A 3CM4A 1UH2A 1KCKA 1SO5A 3P8IA 3TAOA 1QPQA 3RK8A 4HP5A 4UMAA 4WX2A 3ZR4A 2Z6JA 4N2YA 1G6CA 1KCLA 3VGGA 1TPB1 3MP5A 2FFCA 4PFMA 3VM5A 2WO5A 1LTDA 2LLEA 3KE0A 3V1PA 1EP2A 1RP8A 1JAEA 2GOUA 4J3WA 1QNVA 2H6RA 3NQEA 4GI6A 1Z44A 5CPNA 5AHFA 2VT0A 4UQBA 1XCWA 1KXQA 1W56A 4FLOA 4O19A 3PB2A 1O4UA 4UR7A 1MXDA 3WJSA 1CIUA 1H7NA 1WZLA 1HTYA 2PC4A 3U6WA 1JXJA 1XV8A 3KRZA 4J9JA 4UQEA 3W7PA 4AHQA 3WY3A 1KM4A 3I7SA 3P5YA 1EPXA 3VU2A 4RXGA 4AB4A 3ZT5A 4N4PA 3UWVA 3PUOA 4IWWA 1AQMA 4E2OA 2EAEA 1VLWA 3EDDA 2Z0IA 3G1VA 2ZX7A 5HWJA 4FLSA 1SUXA 1GOXA 1GVIA 2FE0A 3O05A 1CXLA 5L9FA 4J28A 2E1DA 1EIXA 3L2LA 1WA3A 2EF9A 5F2MA 3NQ6A 1E43A 1X8FA 4WSJA 3QSRA 1TV5A 2NZLA 2DZWA 3CWOX 4YXGA 1LRQA 3BO9A 3AXIA 3G8EA 3QMTA 3C3NA 6TIMA 2PRMA 2BY1A 3W7NA 3TFCA 3QW4B 3GLCA 5AHMA 3LV5A 1YDOA 3BLIA 4AIOA 4UMCA 2OSXA 3DC0A 4AWUA 2WCSA 1SMAA 1BSIA 2DH3A 2AAAA 2PWEA 1ZJBA 4FEZA 1R75A 3EWWA 2E6DA 1ZCOA 3ATYA 5DCBA 4FNUA 5C5YA 3THQA 2OW7A 4KFPA 4NJKA 4PCTA 2CLFA 1SW3A 5DXXA 5DBUA 5I5RA 2DZTA 3SIZA 5AC7A 1QI5A 2XIBA 3VFLA 3TXVA 1I2OA 4FLQA
chains in the Genus database with same CATH superfamily
4NQEA 4IRJC 4LC8A 3ARDB 4OLYH 4QCIA 2MNUA 3RWFA 1NDMA 5CFHA 1TYGA 1EWHA 5TNVA 1ZLUH 4P9HC 1RPQA 2X4TB 4LPYA 5CZ0A 1D7DA 2KPNA 4B90A 2ZPKH 4ZPTA 4WWPA 3S34H 3KXFB 3W85A 4H8HA 3IXTB 4EN3C 3SJNA 4PBGA 2FNWA 3D0LA 3CWNA 4JG1H 3MX0A 2I56A 3VGHA 4PODA 4Q7DA 4W9LC 2VRKA 3ZTJH 4GFIA 1S5HA 1D5RA 1M1SA 2HFTA 5GGSA 5TH2B 2EE3A 4ETQB 1SBSH 2OJZH 2Y25A 3RLVA 3O3UN 3K6NA 2G0LA 4W9CC 1W31A 3FNKA 3OZ9L 4GAGL 3BT2L 2F8OA 5DUPH 1A4JB 4U2ZA 3UJIH 4OKDA 4IMFA 1U92B 3CB8A 4MUZA 4S2SA 4V2XA 1WKDA 1BWVA 1H8LA 4P2OB 1EX5A 1CR9H 4BFNA 1SFHA 5JH1A 4N2AA 3FJNA 5JHAA 4R5EA 3OKNA 1IT7A 2YFNA 3GZQA 2AQNA 2ZSWB 2EDTA 4PB9L 2J9YA 4QYOA 5L88L 5CSBA 5I76B 2W62A 1JHTA 3G6JA 4OWGA 1ZEAL 3S37L 4EX4A 3NCEB 5E0FA 4RFEA 3BWZA 3X1FA 3CSBA 3OL2A 1VQTA 3SE6A 4KUCF 1HINL 3VIFA 4F9PC 1E8ZA 1VGEH 2J6WA 5B4MD 4AE1A 3KNBA 4WFED 3ZHDA 3P3BA 3QMRA 1N7KA 4Z1AA 1KBPA 4JHWH 4P7RA 1OCNA 5HYIA 2I9LB 4IPJA 5CZVH 4U6VL 1ZV9A 2WTOA 2P47B 3E3QE 1GCYA 3IFLH 4HPYH 1TO3A 3O0FA 1EFXB 3ZRSA 4GKZB 3CFKB 3SDXB 1XIWD 1A1OB 4KTYA 3RU8X 4ECLA 5E4IA 2FT6A 2BNRE 2FDSA 4IL2A 5KYWA 4BS0A 3TZVB 5ETUA 4JTFA 2F58L 7REQB 2OCCB 2FGLA 3WLIA 5G2WA 3P4NB 2WNKA 5A6LA 3DTXB 4XVJH 2BG5A 3WDRA 3B97A 1KBLA 3WDHA 4MJ5A 4BI5A 2H3DA 4C1NA 4PJHB 5AC4A 3U4KA 2PMZA 4LUJA 1V7NH 2Y2YA 4MZ1A 3GKZA 4GSRA 2BRRL 1MRQA 2OZ3A 2VX5A 3K1GA 1DJYA 2YUXA 4I7ZC 3IVSA 3EGDA 5E70A 4TSCL 5KBNC 1OCQA 5F3FA 3RL2B 4ZTPH 2PYEE 2OTUB 4UBDD 4GIYA 1CT8B 2Q3RA 2ZZ2A 2R1XA 3AXLA 4LKCA 2ADJB 5IB2A 3VH8G 4C4KT 4YGVA 5IMKA 1DQJA 4LP8A 5F7UA 4MVAA 4MMYA 2KERA 2XVBA 4QRPD 4KKZA 5EF1A 4CNNA 1N5YL 2VSCA 2QNEA 5BRQA 4U6HB 3H85A 4WWKD 4X6BB 3SDAC 2UYLA 1JV5B 2FJUB 4NFDA 1I9EA 3VMPA 1JWSB 4DCQA 3VFRA 1DBTA 4WOQA 4M7TA 3H9SD 2W95A 4FX8A 1JRHL 3CVIL 5DEFA 4I5RA 1M65A 3NG5A 1FYTD 4IBUA 1TJMA 5KINA 3EOTH 5HGBB 1CLZL 3TVMD 3RPTA 3DIDA 5U4NA 5I26A 1IC1A 1OZMA 1W5NA 3LZFH 5D7IB 5DRIA 5C09D 3P7YA 4UT6H 1T5WA 5IB4A 5EF0A 4PJCE 2M8XA 3TA3D 2QQLL 4YO0B 2RDXA 4QHLB 2TPSA 1WV7T 5E99H 1E6JL 3OAUL 4IJRA 4B5UA 4LPWA 1DJWA 5L2KD 4AQ1A 4A8NA 4FAMA 1NWPA 5TDOB 3FQRA 1SDYA 1A6UH 1OSPH 5IZ7A 3QN3A 2O9RA 3O0RH 1O5QA 3EH4B 3QRHA 4LCCB 5BVPL 2R1PA 3VE0A 3L3IB 3TFKD 4IG2A 4J4PC 3ITLA 4X7SH 2ZOXA 2IPUK 3UQNA 4NZRH 1M68A 5H8PA 4M3HA 43CAB 5J1TC 1ZV2A 3VFUB 2WVUA 43C9B 3PHQB 3RTQA 2HFEB 4LLAA 3IE9A 4UTMA 2VLKA 3FB7B 1FTXA 4L4PA 3IWPA 3GNML 5CLYA 1HEJC 3LOTA 4ONHB 3I7RA 1UH4A 3RWEA 4OD2A 4RMWA 1JCNA 1AFVH 3VZZA 4YH6A 3P9LB 2PRHA 3V6BR 1XDJA 1OTUD 4M6UA 3QI9A 1IVTA 3B56A 4UZUA 2J21A 1I3GH 3WJLC 5GGQH 4IIEA 3ATAA 1OWWA 3N4FA 3C5ZB 1JGLL 1RURL 3PPGA 2G2PA 4G9FA 4ZMXA 3TMLA 2VC7A 3FY1A 4GAAA 2OA9A 4UFKA 3L6FB 1W32A 4XBMA 3UWWA 4DGYL 1CGWA 1YCSA 1P6CA 1CDGA 4GFXA 4IFRA 2Z25A 4IH3A 1N0LA 1ZBWA 3RUGB 3V5FA 4HGWB 2AMUA 4MNQD 5D03A 1KYOK 4AOFA 1F3WA 5DWPA 3L9CA 1QO5A 1FH9A 5JH2A 4ZI8A 1BWLA 3ARFD 4CJ1A 1TTPA 1G9NC 2X4SB 5JIHA 4B9GA 3V4PB 4Y0GA 1OX6A 4DN3H 1BECA 2HFFB 3B04A 1YEDB 2APBA 2IAMA 3TCXA 3PPFA 1YNTF 1T1XB 4XOBA 2X30A 4NQEE 1ZHAA 1HILA 3LH2H 2VFGA 5DJZA 2P5WA 4GVHA 3V0FA 2J78A 5T1LD 4KRZA 1H1NA 1BEUA 2R27A 2WVVA 1XFCA 3TYAA 5ES4B 4N2CA 4WFGD 1T7VA 3LQAH 3P77B 4Z3EA 2DY2A 1SJEB 1ONQA 5AWNH 1XZWA 1Z32X 5GRVK 4AZ5A 2XTJD 3GSNH 4QCIB 1W1ZA 4HSNA 3P2DA 2FH6A 3URAA 5KSVA 3M0HA 4YDLB 5DX7A 1MREL 2Z29A 1M56B 4NQDB 3P4LA 3HC3L 1S9YA 4NJJA 3ID7A 4BK5A 3IGXA 2YUZA 2R4RH 4FXKC 4GZ7A 5AY7A 3LYRA 4PEKA 1BLNA 1E9YB 3QNZA 1G7UA 3D0LB 4H8VA 1NGPL 4WHBA 1S5HB 4GNKB 4BEUA 4PRPD 3L95B 4OCYH 4M8UA 4H4IA 3VM7A 3VXMA 4Y2WA 3F3HA 2YL8A 4XSMA 3K6OA 4DVBA 5JMRA 3G6JE 3P30L 2B7PA 1FWFC 5B38A 1F61A 2PDJA 3Q8FA 3BN9C 3ECWA 2NUYA 2KZHA 3NJKA 1HH9B 4QOKA 4S2SB 4U28A 1I8IA 2CSPA 2ACUA 4TVPH 4X6EA 2J66A 2YXGA 3G5VA 4RX0A 3SECA 2ZYFA 3VTTA 2H3XC 3KH4A 2WLYA 2XQYK 4I9WD 3JS3A 4RE0A 4QYOB 4PGZA 4P2QA 3EXRA 4O2CA 1R6VA 3MRJA 3AT0A 3V5KA 4RDWA 1ZRQA 3M45A 3E6EA 1L7IH 4ZOEA 3HG1D 1TTAA 12E8H 3MRHA 3TR9A 4O52A 3EB3A 2GI0A 2F5BH 1UWSA 3AHYA 2EC9T 1ODUA 3A3HA 1NDVA 1V3MA 3GINA 4RMVA 5FYKD 4LS1A 4DGVH 5MHBA 1M1XA 3L5AA 1F4WL 1P4LA 4CEXC 2YBRA 2CG9X 4I9XA 3FYEB 2EBNA 4M3JA 1UUNA 4PM1A 1LT8A 1CYGA 3F62A 5I73B 2WYTA 3NQKA 4GNVA 5FJRA 4PTDA 3SYPA 1MHPL 4U4IA 3QIWD 3HKFA 4M93B 5KYWB 2X8RA 4XPAH 3U57A 4BDVA 1Y5WA 5ETUB 5FR3A 4PJ5A 5GISH 1PZSA 5BV7H 3NAVA 3KYKH 3HS8A 3CV7A 1LUCA 4R5TA 2HKHL 4RL3A 2V5CA 4GMSL 4ONGH 4GRLC 4IF2A 2WIIA 4BWUA 2YYUA 3UADA 3TPKA 3TF7C 3O8XD 2ESVA 5HVGB 3PL6C 5GJTH 1IWAA 4W70A 3MV11 4NT0A 4EOWL 1MCIA 4J3OD 3UEZA 3LI0A 4X7FC 2ODHA 3NJFA 2A9MH 2PTDA 3EGDB 1G1KA 3CSTA 3C12A 3HS0C 1R3KA 3M0JA 4YE4H 3OMIB 2QJMA 4B9IA 4C6JA 1JZ5A 2AVFA 2R1XB 3AXLB 4PJXE 4A7UA 5CCZA 1NY1A 1YDVA 3CQJA 1W9DM 3MRRA 1KM2A 4HEPG 3IMRA 1ZHBB 4LKCB 1BZEA 3GJFA 5IB2B 5EZOH 4YGVB 4Z7OB 3U36B 2B31A 5IMKB 1DQJB 1E4WH 2WO2B 1JYXA 4DK5A 3H6JA 3VIMA 4CCDA 1UIOA 2PLJA 4WNJA 5J9PB 1VIZA 3UAJC 2UYLB 4QRTA 1ODZA 2Y62A 4NQVB 2YCLB 3MREA 1GOIA 4F3FA 3CHPA 4XZMX 4AG4L 5BPPA 4DCQB 3VFRB 1KIRB 3BKJL 3TO4D 1BM7A 3J27A 1B4JL 3KVPA 5DEFB 1C3FA 4UV7H 3E49A 1QNSA 4OKVA 2OXNA 1D8CA 1HOCB 2XN9D 1NL0H 4NZ5A 4WDTA 5C9UA 2XU9A 3E6HB 2A6DB 2AMXA 2WTPA 3W7JA 3MACH 2K7QA 1R1CA 3TCSA 1P2CA 2ZCLH 3RWJA 1T5WB 4X5WB 4NXSA 4Y2DC 4Y1AA 3ULUE 5D4HA 2P80D 3NFUA 2GK1A 3V5OA 4GIPD 4AQ1B 4X8CA 4REQB 2DKSA 1F90H 1Q9KA 2CLRA 3FQRB 1YRKA 2IG2H 3M7SA 2VDML 3ARED 2B0SL 4XODA 2JJSA 3UJTH 1E4MM 2QGEA 3KJ4B 1JDDA 1SQ2N 3TPUA 2H9GA 4IG2B 1NTHA 4KZEL 2OMUA 2EZ0C 3BVDB 2H90A 4XD6A 2ZKYA 1KOAA 1DDHB 4JPVL 1Y18B 3LPPA 3LZ5A 5HJXA 5IOBA 3A6OA 5C2CA 5I3DA 5DD1H 1XL4A 1C93A 5CN2A 3IDXH 2FEJA 2WZTA 3N9SA 1L9NA 3RCMA 2RUSA 3RTQB 1D5BA 3GI9H 4ZZKA 2P5ED 2VLKB 3ARZA 1T0NB 5KSUB 5L8LB 3E80A 1P5VA 4PBFA 1HQ4A 1I31A 3K2GA 2Y85A 3QEQD 1K2DA 2WMPA 3RWEB 1Q94A 1LM1A 3A47A 4PTXA 1XGRA 4GAFB 3SSJA 2EYTA 3WMPA 4KQ4H 1T5AA 4Z78A 3GVRA 1KB3A 1QHPA 3W1AA 4AEHH 3AQZA 4FC3E 1CBJA 2FEEL 1U8PB 4XNDA 2C9VA 3ZK0A 1R3RA 4G9FB 4Q56A 3WELA 1B88A 5DDHA 5LGZA 4NP7A 3GHUA 1W0WA 1R2SA 3KCLA 2YGVA 1YKWA 4P05A 4ZDHA 4U49A 4GXVH 1TZAA 2GBAA 1PNDA 5JQ6L 3LCLA 4Z9KB 1XDMA 3NZ1A 2WWMC 1F4AA 1DQXA 2QR0B 3UBPC 3M1BA 3LQMA 4RNHA 1N0LB 1TTFA 4XP5H 1TTGA 4US6A 5CPMA 5I02A 2P5WE 4FQQA 4BK9A 2XN2A 4IZGA 2ZF9A 3H54A 1SMOA 5E94A 3BZGA 1VRSA 3FB6A 4QNPE 3HTWA 2PUZA 3L08A 3PULA 3REWB 1RIVH 1TR7A 1MAMH 3QUMA 2BBFA 3CEUA 3CPLA 1NCUA 1JVOA 3NQ8A 2IAMB 4YYCA 5C2UB 3AALA 1OQFA 2IPTH 2K9UA 3Q8BA 2P5WB 1O66A 2ZA1A 1F42A 2B7OA 3MJYA 1K72A 5C08D 1J5IA 2EIJB 1YDYA 3FA5A 3HGJA 3KLLA 2VW7A 3LZNA 3GDTA 2WM1A 4D8PA 1I8LA 3M1ZA 2I7GA 2V5JA 2AHIA 1EEYA 1ONQB 4AD3A 5LNDA 4N22A 2BGSA 3T8VA 2DT1A 3WK3A 3N6YA 4POCA 4ZE5A 4JDTL 3MB9A 3Q4DA 5TIMA 5CLZA 2HROA 1FP5A 5AZEL 1UJTA 1RPXA 4GMTL 1JPGA 2HTKC 1BOYA 3ZT6A 1S9YB 5H35A 2OP4H 2YC1A 4NYYA 1ZVHA 4EQ3A 3VXME 4KI5C 4F27A 1XBXA 2PCFA 3V6OA 3QNZB 1RV8A 3U30B 5EEZA 3RZWA 3VFVB 5GGTH 1KCSL 4Q4OA 3WTVA 4QOKE 1V08A 4JLRA 3V0WL 2FYMA 1TQCC 2A74A 1TRDA 2TRSA 2H41A 3JT0A 2BW4A 4LSUH 3Q6FA 1FC1A 5CSGA 1M2VB 4WKZA 3WLNA 3QOKA 1GTNA 4P2QE 1MELA 1XGPB 4DVBB 2DQJH 2Z92B 4A3QA 3CZLA 5B38B 1AR2A 4DI9A 2WAHA 3FT4A 1F07A 1W3HA 1ZDQA 4N26A 1IC7H 4YHMH 1V0NA 4QOKB 4Y8AA 3RITA 2ZX9A 2V8MA 5DS8A 1GHFL 3GF8A 5HXMA 3G5VB 3LNFA 1G6RL 2PTVA 3M6YA 4OY9A 4P2QB 4F2TA 4Z3FA 4O2CB 2HT3D 5F8QC 1LO3L 1U6AL 2X1OA 1BD2D 1NDZA 3MRJB 4G8GD 3MLSH 2NZ9D 4PWFA 2ZP8A 3V5KB 1P7QD 3HTLX 3L4WA 3H2EA 4G5ZL 3CM4A 3FUDA 3MRHB 1AZ2A 3UZQA 3A3WA 4K9EH 5J12B 3LIZL 2WO5A 1M3JA 4KEVA 1M1XB 2LLEA 1YNTB 1FE8L 4O19A 2YBRB 2DI8A 4FMKA 3ZE1E 3WFCH 2WXOA 5L6YL 4P23D 3ONCA 4MZ2A 3DRQA 3I7SA 3ZT5A 3UWVA 5CILL 3WQGA 1Q72L 5C0AB 4JRWA 2FE0A 3D30A 2PC8A 2A1WL 3IPBA 5MI0C 4WSJA 3S35L 2GTWB 3D4GA 1E5NA 4PJ5B 2DV0A 4NQSA 2HXUA 1P48A 4ZXOA 3C3NA 2J8TA 3W7NA 4AIOA 2QGHA 1T3FB 3RUBL 5JDSA 4FD0A 3AYRA 2ESVB 3FUMA 1PKOA 4NPJA 5TE6H 1A1MA 1HX0A 4LSDA 3F2LA 4JGDA 1B4RA 4C56D 4QXIA 4K2SA 4HNNA 3BSZH 3VIHA 4DQOH 2MTPA 1CFQA 1EGVA 3VG9B 2NY6D 3GDLA 3U9UA 5F97E 3TNBA 3SDDD 1Z9LA 3VRLF 3C0JA 2HT2C 4L4VB 1R3KB 4XD5A 1NOAA 4W88A 1NJJA 3O9WD 2LHAA 3PP4L 4HHLA 1SXBA 1KNWA 3OAZH 3RWIB 3MRRB 3E0FA 1XIFA 3OC5A 3LSOA 3GJFB 2VN4A 1VYPX 1GMIA 1FIGH 3EOEA 2IFGA 2HWZH 1LGVA 4JX0A 5D1XD 3BANA 4QRTB 3SQLA 3P0GB 3F04A 5D2YA 1U91B 3MREB 3VA8A 3CEPA 2ZKHL 1F5WA 4QXUH 2NLYA 4PU2A 5GS2D 4Y1AE 3SIKA 2Y0FA 4UTAH 3HE6C 4KKCC 4WU5A 4YHEA 4LAJH 2ICWJ 2PP0A 1KYDA 5GHWL 4B7IA 3IJYB 5TDPA 1Q6LA 2BVTA 4WO4C 4Y16A 1XF2B 4IGBC 3G08A 3SCMD 1TQUA 4DZ8A 3QJOA 1P2CB 1SO6A 3W22A 3C87A 3ARWA 1DZ0A 3RBGA 3DFHA 2GK1B 3IM1A 3L5HA 4BFGA 1JTPA 4ERAA 4X83A 1XW8A 1V7ML 1RLWA 2F8IA 1KFBA 1GTFA 1WS8A 3NCFB 4O10A 5GSVA 3FCTA 2C9AA 4B5TA 3U0TA 4DP0X 1RP9A 3MSGA 4HH9A 4ZW7A 3LSBA 5B3NA 4I5XA 3UPAA 1TPH1 2D9CA 1HKWA 5C0CA 1S5IH 3ABZA 5F7FA 4M9PA 4UV4H 2IFFL 1RBLA 5GJSH 5DLMH 25C8L 3QGKC 3M8OL 1YEJL 2J7DA 3MWCA 3FEQA 3MCOA 1AQ0A 3UBXI 2FH8A 4IU3A 2YD3A 1MFDH 2HT4C 4GXUN 1N6VA 4QHKI 5K1NA 3BLEA 1K2DB 4PJFE 2WMPB 1X5XA 3QH3A 1S2CA 1K9TA 4C58B 2XX0A 1ZTXH 3RNQB 3FCSA 1TFHA 3W75A 2EYTB 2R9HD 4Z78B 4ERSH 3BLOA 4UC5A 4ODHH 2X70A 2IGFH 3QDMA 3FO9A 3EOBA 4JUSA 4JFSA 4NSBA 4FYRA 5IROC 3WKYA 2IQAB 5KZ6A 3QQ9D 4R34A 5DDHB 1I7TB 1JHKH 4D6JA 4IMKA 1W0WB 3CK5A 1KR0A 3LX9A 2YWYA 2G5WA 2ADGB 3BUDA 1NIAA 5CG7A 5I16B 2A2IA 3O6FD 2F54A 5HHVL 3AMDA 3RCYA 3EYUL 3QFJD 1O5RA 3M1BB 5KSAC 2XH0A 2F74A 3DOHA 2ZNWA 4JS7A 3QE5A 2JELL 2XH4A 3DKJA 4F9DA 1AO7B 4L1TA 4FQQB 1YXCA 2ITFA 3R7RA 4BR1A 5E94B 4HX1A 1B3YA 2VDKL 4KUZH 2GI7A 4UT6A 3NVQA 2GCYA 4TN9A 2WLIA 5BZXA 4WUKH 3CPLB 3TT3L 1F18A 1QA9A 5D30A 5TK4A 5I19H 4FFVC 4LP4A 3SDXF 1LO2L 2Y69B 4JM2A 1AIZA 3KDMB 3S3JA 3LS9A 1DHPA 3FFCB 3IWUA 1LMIA 3ROOB 1JIBA 4HWEL 3QUZC 5C0ND 3GBMH 4GVGA 1AJZA 2GABA 3MMTA 1A14L 4LVHC 1GSMA 4D8PB 1GGIH 4J3SA 4C6PA 4RBPK 4KO5A 2VDHA 5CGBA 4PJHF 5LXEA 3T0BA 3V6OE 1EEYB 4K23L 4RLIA 3FC8A 1AP2A 4URKA 4GG6A 2X42A 2D73A 2YCEA 4JFYB 1VEOA 5D9OA 4PA8A 2YD5A 2FSEB 1XXXA 3NJJA 1GQIA 4UANA 1R38A 2Z7GA 2FYVA 4JBRA 5KZEA 2JFEX 4Y2LA 4GP4B 3UCCA 3EFOB 1XQLA 1JPGB 4MMZC 1HO4A 3MYJA 1IGML 3HURA 4GZEA 5H35B 2YC1B 2H3NA 1KYUA 1NFKA 1MEXL 2CPCA 5FYJL 2OL3A 4FX5A 2D0HA 2PCFB 4ZD3L 5F93C 1A7BA 2GGGA 5HGAA 2X38A 3DKLA 3GH7A 3TXAA 1T96A 3ZJAA 4PW4A 3QXVA 2EE9A 4ZNEE 2A74B 3TWYA 3PU7A 4OECA 5J5DA 3Q6FB 3ZVHB 4WKZB 4KNSA 2DIAA 1KCRL 1GSKA 3TYGL 2CZDA 4XMVA 3BMVA 1KBJA 4ZMOA 4N9OB 4UZGA 2BOCB 1XISA 3KTCA 3T42A 5I78A 2DVTA 4N9GA 2XGIA 4PRIA 3FT4B 3PG9A 1UWTA 1VFMA 4JE0A 1W9BM 1NLBL 4AEFA 3T7VA 2QEZA 2A9NL 4PMVA 4ERGA 5DS8B 4ZFZB 3HZKA 3GG1A 4DYKA 5FV1L 3S2LA 1FI8C 1DSYA 5D7IF 4O2EA 4XNZC 5FHAL 4OIIH 2ZXGA 3CFTA 3MCLH 2YPIA 4NNPH 1KXTA 3AVEA 4IT1A 1XLIA 1B54A 9XIMA 2J77A 3W11C 2FYYA 3UZQB 1A7RH 4NDMA 3NZSA 3LS4H 1KFJA 4TX9A 4OTXL 4CKQA 4NHCL 3V4BA 1RQHA 1T8QA 1U3HC 4X6CB 1XF1A 4ANVA 3PBWA 3HIZA 1Q66A 3GPEA 3RVVD 1PSKL 3AITA 3RX5A 3DRQB 5CR1A 2EO9A 4K55A 4PJCF 1ZTMA 4QE4A 3TIEA 2WWKO 3O3RA 2FLBT 1OE1A 3B3IA 3W2UA 3GSNA 4CBZA 5CKAA 4JPSA 3L5XL 5MEQA 3O4OB 2ZUTA 1IZCA 3UTSE 1OQXA 2Z8WC 4GQ0A 4HQQL 1BX2A 1B4TA 5JDSB 4BSWA 3O6LH 4PWJA 1EIBA 2IV8A 3GHRA 4LLVA 2V67A 1V03A 1A1MB 1QSFB 4FABL 2TAAA 3W56A 3MI3A 1GTHA 2CLZA 4KKLC 4MXVE 3CHSA 2PN5A 1A6WL 2XYLA 4HFWA 4FZ8H 4GMEA 5EYWA 2L7EA 1M7IB 5DJAB 3MHZA 2PWGA 5JIKA 4DP1X 1EWEA 3ANUA 5D02A 4DT2A 3LRLA 3FU0A 4ECNA 3HI6H 3M0YA 3MU7A 3JUYA 1BZOA 1WG3A 4LARH 3FO1A 2BIMA 2DYRB 2PYEA 3OZOA 4F0KA 3LSOB 4NP4H 4R7XA 2VR3A 3RUGF 1KV3A 4WLCA 1KXVC 2K78A 1DCEA 1KC7A 2OK0H 3TW9A 5AUMA 1QXLA 5FEXA 1KIUA 3GSXA 4S2CA 2XI9A 3A4EA 4AJVA 4HC1H 1EPFA 1EX0A 1ZK5A 1M7JA 2XACC 2R6OA 3OVPA 5I6XC 3L7EA 3PJTA 5KN5A 4LPCA 4OCSL 1DANT 3NQAA 1ZA6B 1Q8MA 1IE4A 2NQCA 5HUOA 3GIVA 4HU8A 1Y07A 4BF7A 3CXDL 5FDYA 3FSOA 2VZ1A 1EQWA 4J8QA 5I74C 4JR9L 4Y16B 1Z5YD 7CGTA 4N6QA 1IFGA 4DZ8B 1Q1JL 5FUZL 5CCJA 1AH1A 1OHLA 2YMOA 4C5ZA 4JN2A 3T08A 4HH8A 5D72L 5KZDA 2J75A 5C0CE 3WEMA 5ABTA 1E4KC 4QT5A 1TJ1A 3ZZSA 2G4JA 1OP3H 4X50A 1DVFA 4FXSA 3ARPA 1KKRA 3GSMA 1M6JA 4N8UA 3RJOA 5AZ2H 3VKDA 3ORWA 1NFIB 3FCTB 5GSVB 4IUGA 1KGXA 4KCUA 4O1DA 1CLOL 5JOPD 4S0TD 2C8NA 4YCPA 4N42A 4P2CG 1EHKB 5EBLA 3NOYA 3PGFH 3G3LA 4JREB 5JMOC 5C0CB 4IDJL 3NSYA 1GOFA 3GNXA 3P8JA 4PG9B 5F7MC 2YB4A 2KKQA 2VGLM 1CWVA 1JE6A 2NLIA 2UWEA 4HWBL 1XP3A 5IBTL 4C83A 4ZMZA 1N3NA 5LBVA 3BARA 2HSAA 3QH3B 4XXDA 2XG4A 1ZAGA 4E2DA 1KNOA 3GTNA 3FCSB 3W9DA 2F54E 5CEZD 1KWKA 2AK4B 3FOLB 3W1TA 4A2MA 5CJXC 1HKIA 4Y5YC 5DVMA 3QDMB 3FO9B 3R0MA 3EOBB 2NZ1A 1ED3A 4TQPA 4UZSA 3GUFA 1GGOA 1AJ7L 4GD0A 3T0DA 4PR4A 4OZFB 1XYCA 1RPUA 4PW3A 4OU3A 2IKGA 3THCA 3D4CA 3EYVA 2VSDA 4LU5L 1SZNA 1NLDH 4J6RL 2GJLA 4MCZA 2WBXA 4GAJH 5LIXX 4JHUA 4I88A 2D2GA 5KVDL 2F54B 4A2SA 2VR4A 2WYHA 1RZJL 1D9KB 3QZBA 3B9KD 1TZ7A 4Q8NA 3ULVD 1B6UA 2YO3A 2XJ7A 4U1GB 3LTVA 4PLNC 4ZAKA 4OZHB 2WQXA 1XI3A 2WZPA 3KLHD 4ONFL 5AC6A 3QR3A 4JO5A 2WXKA 4HX1B 5K59F 4BRVA 2XSBA 4HZ8A 2C26A 4EDXA 4MBRA 2REQB 3SB0A 2WLIB 2V17H 2YCKX 4E5TA 1QWHA 4FPSA 4PG2C 3WTYA 1RCQA 3MLXL 4HS8H 1UR3M 4KVPA 1QA9B 2E5DA 1N18A 5DZAA 4LYPA 4GG6E 4AX7A 3JZYA 4JM2B 3DX7A 1VZWA 4TMBA 2EPOA 4Y5XA 3DMMC 1IXOA 2L3BA 4E9VA 2WSQA 4S3GA 3WH6A 1PS3A 3FN9A 2JH2A 4K3ZA 2XWRA 3U1QA 3C0SA 4ES4A 2HTLC 1BEYL 3L3OB 2V37A 3LCHA 1UGKA 1AP2B 4JXCA 5ADOH 1H11A 5A3IC 4N8PA 3NZ8A 2D69A 3G5EA 3UPRA 3E1ZA 2W5PA 1FFPB 5CGQA 5LAPA 2ALAA 2IOIA 4NO2A 4ODXA 2IMRA 2CRMA 1K6AA 3QDGA 2Y2WA 5E4AA 3QXUA 7TIMA 1HIML 5B7YA 4HU4A 3LOWA 4CL7A 2HVKA 1U8JA 2X9YA 1BKSA 2OL3B 4GQBA 3CC1A 5ACMA 1Y5XA 4NU7A 4OBSA 1FH5L 4PRIE 3W84A 4PJEA 4LL9A 3RRQA 3NK4A 4KRMB 2BP0B 1F4XH 1QTPA 3VNMA 4XOCA 2C9UA 1ECYA 4Z7OF 3IK4A 2LFEA 1QFHA 3W23A 1A6TA 3H3PL 2KDYA 4U6YA 3C6LA 2Z1XA 1H8SA 5ANHA 2WKLA 2WLNA 1A7OH 3JU2A 5EL1A 2AJXL 2NQJA 4KK8D 1TNMA 5LXXA 3UXIA 4BCZA 4KVCH 3V7MA 4PTTA 1BQCA 4S39A 5JO5A 1Z9NA 1D2PA 4OCWH 3NTYA 4GRWH 3HQNA 4UOW1 4BQ6A 3F4DA 5FF3A 2EEBA 1JPTH 2FIKA 3RY6C 1B57A 3HZKB 1XLKA 3U2SA 4E2BA 4ZQMA 3WMQA 4GEJA 4AQEA 2VMJA 2NXYD 1U8HA 1YJDH 4O2EB 1DBMH 5JXAL 5K9CA 4FF9A 4G8EA 3WTUA 2J1WA 1PZDA 5DWUH 5DR5H 1K03A 4BFKA 1MNUL 4XCCH 1U8LB 3ZTCC 5AD0A 4PYGA 1CTOA 2YK1L 1F4YL 2H8XA 1XGUA 5GGUA 2FYYB 2PDNA 4NDMB 5BS0A 1GK8A 1NUGA 1D3GA 3QZPA 2DQDL 4WIWA 3IFNL 1JUEA 3K8MA 2Q8ZA 1TZIB 4POUB 1TWWA 1YNKL 3BW2A 1D5MB 5H1WA 2VE6A 3KLQA 3HI1A 4KC3B 5DF0A 2Q8AH 2CITA 1T83A 5C0BA 1N8ZA 5L9DH 2IMNA 3ZMNA 4AD4A 3S36L 5DQPA 5E08H 3ERXA 1CDHA 4RNIA 3PGDB 3TIEB 4ZXBA 4YHYC 3ULUF 3GNOA 4WK2B 5M95B 4XISA 5I6OA 4DP9X 3TU9A 1ACCA 1E4NA 4ZENA 3GSNB 3PNZA 1NGXA 4NX5A 2D3NA 5AG9A 5MEQB 3NL3A 4Q58C 4DUXA 5A2LH 2Y7QB 3R18A 2BNRB 1GG1A 1BX2B 1M5WA 1TKKA 3HB3B 4DZBB 1J8VA 4BSWB 2BX5A 1TWIA 3EEZA 4W7UA 5EB8A 2FZBA 3IFPA 1DP0A 1MW2A 2YKKA 5D6DC 4RBPH 5DHVH 4XX1E 4X4MA 3DX2A 2PGRA 2CLZB 2WLZA 5GGTA 1IAII 3RHGA 1H0IA 3ZUCA 1YEYA 4HJJH 4HFWB 2H9AA 5EZJB 5I6LA 4TVPE 3NBNA 1PCKA 1MSSA 1DLHA 1UGNA 4JTKA 1H7RA 3UFIA 2FUTA 1IBZA 3V10A 2J20A 3L9BA 3C8FA 3JWNH 3BLBA 5BZDA 2FGZA 2QTVA 3FO1B 2AS5M 2DI9A 3MMEA 4HKBA 2PYEB 1CXKA 4HD5A 1FH2A 4DVOA 3WBDA 1D5XB 4I77L 4BZ2H 1U83A 1RJRA 2ZRUA 3SYQA 4PJXA 1TE6A 2H47C 1I53A 3V0JA 3IJSA 1UKSA 5I3FA 4MNMA 4CDGC 1KIUB 3GSXB 4FQ2H 1OABA 3BJLA 4LANA 3MPCA 1UM6H 4HUUA 2P5NA 3L7EB 2WKJA 1XPYA 3VIOA 2DDQL 1PKLA 5A6BD 5EULV 4K7YA 4L1XA 2VDPH 4ILDA 1HJQA 3GIVB 1F1AA 4PMXA 4ZUSB 4YHOL 2PGEA 3WL9B 3WS6A 3N06B 1JZ7A 1XR9B 4L05A 3UR2A 1BVNT 4HIQA 3T4AA 3GG8A 1X38A 5HI5C 4D9QE 3VWKB 1UOWA 4JN2B 1KTNA 4KROC 1PLGL 3QY6A 1XH3A 1MHCA 3KPTA 4HP5A 3ZR4A 4NKCA 1TPB1 3D5HA 3VM5A 3VZYA 4PJCB 2BRQA 1A9EA 3NQEA 7FABL 4C47A 5CC5A 2VT0A 4KCTA 2VC2L 4X99A 5EBGA 5BV7B 4HU0A 2UWEE 3GSVA 4PUNA 1LK2A 3HC2A 4LB8A 2A9CA 4AK2A 5ACZB 4N4PA 1VLWA 3CNKA 4KITB 5EBLB 4A8IA 5EO0B 3EBVA 1S3RA 2B7DT 1EIXA 5DQ9A 1CF1A 1IAIH 2NY3B 2UXGA 2DM4A 2CBTA 3UABA 4LFHD 4UYQA 4ABQA 5IVZA 3MMWA 3BSZA 4F8NA 4XC3L 4X5PA 3GLCA 3HFML 1U93B 3TT1L 3D18A 3ENEA 2UWEB 5RUBA 4Z7NE 5FYKH 4KRPB 4KFPA 4JHAL 4X8GA 3VIPA 1QI5A 1RY8A 2HRGA 3R8HA 4XXDB 2KL6A 2XG4B 5FEWA 4AY1A 3GHEL 1KFAH 5GNXA 1XLFA 3VXNB 1BFVH 5H8DA 3O63A 2C7FA 3WKQA 5DT5A 4OM1L 2ISDA 3WHE0 3JRKA 1MRFH 1OP4A 3IIXA 3BUBA 4UILH 3ZKMC 4R33A 1HKLL 2OWWA 1JGVH 4O15A 4F0SA 5J13B 3FUEA 4MCZB 2D03H 2GZXA 3DI0A 2GQ8A 2A0LC 3OJMB 5DZOA 4LTSA 1EOKA 3E0WA 1MZRA 1I4NA 4UTAA 5CLXA 3N2XA 1QD0A 5ECJE 4GBDA 8FABB 2QV2A 3CAKA 4ZAKB 5CN1A 4J3OH 4NWTH 1ZIBA 1FFTB 1KRAC 1GG0A 4CD6A 2ZWYA 3U7BA 3J7HA 1UMYA 7A3HA 2XQYA 5C86A 4V2BA 2I9TA 4Z2JA 3W7RA 1AE6H 1PW3A 1MFEL 4IPPA 3NFNB 3W6YA 3UYRL 2BP5M 1Z8AA 4WEBL 4FFZA 4EE9A 4KZDL 3DX7B 4C60A 4LP5A 1UD4A 1JGIA 4OFYD 4C4KO 4DPBX 3POCA 2EH7H 1AY1H 4HKJA 4NQEB 4U0QB 1NFDA 3QDGE 4GJTB 3RWFB 1NDMB 4JE4B 2OJPA 2Q7NA 4PSPA 2X3BA 4YHPA 1XIHA 1A7NL 4OJYA 4GH1A 3STFA 2R0WL 4MWAA 4PJEE 3RE0A 5HPOA 4M7SA 3MR9A 2MQ0A 3AAZA 4ZPTB 3EZ4A 3NZ8B 4YXKL 3BCJA 1A49A 2D7QA 4Q89A 3QEGH 1MCOL 1W0YT 3US9A 1GEHA 3OAZK 1BLIA 4NO2B 4ODXB 4F58L 4ACZA 3P11L 5A2BA 4D3CL 5F2FA 3MX0B 3HAEG 4S1QH 3ESOA 3KW7A 2NWRA 2HVKB 4N2NA 3KOYA 3AYTA 1JXFA 4UFLA 1GKOA 1A6PA 5GGSB 1S3KL 3N43B 4MHBA 2ATSA 2VDNL 1W72L 4X4KA 2YW4A 3APMA 2OMZA 1C16A 3TQVA 1TWDA 4QRNA 2PO6D 5FF6A 1A6TB 1ITQA 4U6YB 3C6LB 5H37G 3EH3B 1K4DA 2COVD 3TBWA 3QUXA 4IBTA 2EYSA 3ARBA 1P9MC 3U8GA 1W1YA 2IBBA 3KJ6L 3D05A 3GTIA 4HK0A 4AAJA 3K7UA 3OKNB 3CLFH 4Y4FC 4PTTB 2QXWA 1JHTB 3G6JB 4F15B 3P0WA 1W3TA 5LWYH 1H6UA 2K6YA 2VLME 1XQKA 5HDWA 5BS0E 3TC9A 4RFEB 4Y4KC 1IIKA 2FIKB 4ZTOH 2XWEA 1NWTA 1T66C 4AQEB 1TV3A 4HTYA 3L4UA 5C0BE 3F00A 4YTQA 3KNBB 5HGGS 3R79A 5IDZA 5AD0B 1MF2H 1XIBA 3VNIA 2MCG1 5GGUB 2ZE0A 4CC0A 3BW9A 4FQLH 1PBYA 5GGRY 5BS0B 3NACL 2VJ8A 3KPRA 4GC4A 3QC0A 4IEFA 3V52H 1C08A 5G4WA 4B60A 3SI9A 1LEIA 3VD5A 3IIZA 2GC4C 5C0BB 1N8ZB 5HANA 3RGVD 3J07A 5CCGE 4UR8A 3BRDA 1JXKA 2CO2A 5C71A 2WPGA 4Z7QE 1VBRA 3LSCA 4ZXBB 2OZ8A 1KGCE 4N2LA 2QKSA 2QKFA 4X4ME 4E5XA 2B4CL 3UBXA 3AFBA 5LA2A 3QNYA 3M88A 4PUBH 4KX9A 6CGTA 4MJ5B 4UTBA 1V93A 1H3UA 4C1NB 5JTWA 1J6PA 2PRLA 4H9UA 1WAPA 1UP3A 3WY1A 1NM9A 5IF0A 1BFSA 3P3YA 2QBWA 5AKQA 5LLIC 1NP2A 4IW4C 1G7QA 1UR4A 1AAJA 3IFPB 3TQKA 2JWYA 1OPGH 4F8TA 4Z7QB 2LE9A 4XO3A 1GGCL 1KULA 4H0GA 5H8UA 4X80H 2KAUC 4M56A 3BV7A 3KLKA 2YX0A 1PTAA 4AXKA 1S5TA 3APYA 2H9AB 2H2PD 4Q9RL 4H88L 3TN0C 1AFSA 3VJ6A 1VPXA 3SSZA 1MVUA 3PUCA 4M02A 5EU7E 3VIIA 4K94C 1E4HA 4MMYB 1CDCA 3IB4A 1IUZA 2C9RA 3UH8A 4NUQA 4KKXA 3MMEB 5L0QB 3S5LA 3BJSA 1OAXH 3PFUA 2VCAA 3EJJX 3CAVA 3HGSA 4BRJA 4N0UA 4PJXB 4QE5A 3BGFC 2DORA 3IJSB 3DOSA 4FS0A 3GI8H 2XT1B 4DUOA 5ID1A 4HUUB 2MKLC 1IGWA 5J6SA 3W53A 3VXSA 3T71A 3RIFF 3WIHH 1DSWA 4JZNA 5DS1A 2E9IA 3HG0A 5IB4B 4RPQA 1UA6H 3RPDA 1G9ML 5F9JA 3KPQA 3ERPA 4OQ1A 1M4KA 4U4BA 2VLRE 4UINH 1F3DJ 2FHBA 1QOKA 3ITGA 5BVJA 1CBVL 4JTAA 1BVZA 4JIPA 4NKMA 2WZEA 1L0XA 1F4HA 4HJWA 1JXDA 4DW2H 4OQTH 1L0YA 1FCQA 4WXZA 4RZKA 2HEJA 4OZ4A 1XH3B 2IQ9L 3SDCD 1MHCB 4GP8B 4ZO8A 4B9KC 5K1VA 2VGBA 2PA6A 3BUYA 3VE0B 2NUPA 5T1DL 4GUOA 3UX9B 2XWTA 4MLIA 5IMOA 1ITUA 1KB5H 1JHLH 3GMPA 4X99B 1JNNL 2FO8A 2C9XA 4OCRH 2OWCA 3N04A 2I07A 2J2ZA 3GSVB 3UO1H 2OLDA 4AIXA 1QI2A 1LK2B 2X1XR 4AVFA 5K39A 1H7WA 3I65A 2UZIH 2E6AA 4LS2A 4LB4A 2E6YA 5DCEA 5FO7A 3ZKXC 4H20H 7XIMA 3STEA 4TLUA 5DQ9B 4F9LA 3T4WA 4OD2B 1CVRA 3GO2A 4KRTA 2F6KA 3CIXA 1WOBA 1DSFL 1GTEA 1JXGA 3N85L 5B22A 3QI9B 4GY0A 2Z0UA 4LFYA 3LJ3A 4F5CA 3EHBB 2K6WA 4FA8A 1TR1A 3KVDD 4WDIA 3KAAA 1H3XA 4WV1A 5AOMA 3R4DA 4W8LA 4PJFA 3U0WH 1T20A 4WQ6A 2GFTA 3T2PA 1YUHA 4LPVA 4QHMA 4OV5A 3KL3A 3AS2A 5E8DH 4HZAA 3KRSA 4HEME 2ALWA 4HC1A 2R2EA 2QVKA 4JM4L 2WOYA 1YEEL 3S96A 1IILE 3C60D 3CPUA 4HPOL 4Q4SA 4V33A 1CICC 4D0BA 1REIA 3Q44A 5IEKA 1SJHA 2LAAA 5TFSL 2W88A 1PZAA 4INFA 4DEPC 1O5PA 3LHWA 1KBKA 1J9CT 2WC4A 1OIOA 5JZ7D 3N6QA 3RZCD 3T44A 5J3HD 2VVSA 3AU2A 4B6ZA 2A1YA 2I9TB 1HILB 2F5AH 1NFDE 4X6CF 4C6CA 2Z4QA 5DJZB 1GYLA 4Y7MA 2QV4A 5E95B 1AC6A 1FNSL 4O1CA 2J55A 2DN7A 1QHOA 2VN7A 2OS7A 2R1MA 4MWAE 3S0PA 2WVVB 5HVFB 3Q1EA 1ESOA 4RMSA 2WLKA 1AXSA 3WFZA 2IUZA 2W9EL 2N7AA 4HKJB 2PTTA 4U1SA 4KKBD 4LBAA 4A2DA 1NFDB 3PNUA 5FCZA 5LN8A 2E6FA 1AACA 2HQAA 1ZTXE 3US0A 2ZOWA 5KSVB 1IBDA 1GONA 3N4AA 4YHPB 2DZVA 3FVMA 1XGYH 2AP2A 2DQFA 4HA0A 3QEHA 3MR9B 1A25A 3AAZB 4YTUA 4I8DA 4JQAA 2EEFA 4XC1H 1UTDA 1SOQA 1J5HA 4LESA 5E2JA 1BLNB 1A53A 4LCUA 3V9CA 5CZSA 1HL8A 3BESR 4ACZB 1XCTA 3G3MA 2XSAA 3QJAA 1T5XA 1XH0A 4FFYL 2FECL 4CGTA 1QUPA 4W68A 5ALBH 3WEAA 2HH0L 1LP6A 3HMWL 4OV9A 5J57B 3T55A 2QVNA 3W7HA 4AZ8A 3VXMB 2WBWB 4JTGA 2XN1A 4MXVF 3U4BL 1L8PA 3WU1A 2OMZB 2XA8L 4ADUA 3JUZA 5FF6B 3HE7D 4A2HA 2NW3A 4ZS7H 4LO9A 3UYCA 1ISWA 2PI6A 1MJ7H 4OGZA 1E5CA 1I8IB 1K4DB 4ZNEA 2NY4D 1IJNA 4X6EB 3QUXB 3WSQL 2EYSB 1M2OA 3ARBB 3WE6A 3LBOA 2VDRB 3IYLW 4FQ1L 4OFDA 2Y7FA 4HK0B 2CCVA 2ZUQC 1XKYA 3LHVA 4FHAA 1V6TA 3WHXA 3S6OA 4OLVL 1VFOA 2JI2A 4ZQTA 4WK0B 3RWGA 1N0XH 3LRSA 1TEYA 3TH3T 4IBWA 5E1GA 1B0IA 4KERA 2B2XH 3KPRE 3A4DA 4CNIA 4NNYA 4HNCA 5GS0C 1OP3K 3W7IA 4YHKL 3G9AB 4ZEPA 5DRCA 1WBYA 1RZFL 3DUUA 2QTEA 3NPZB 1P4LB 2QS8A 3SDOA 3VOCA 1VFBA 1NKOA 2AL2A 4IMGA 3BWUC 2A9AA 1RY7B 1OOAA 3CIQA 1WAEA 1N2RA 2C14A 4QRPA 5AL0A 2Z27A 3H2WA 4IEFB 3VABA 3HA0A 3HMJG 5AHNA 1C08B 4QO1A 3L66A 3FSTA 2ZKMX 4BDVB 1J8SA 1HXJA 2QCLA 1EQPA 2NQ5A 4KK6C 4R0LC 3STCA 1S5NA 1CLVA 3W4RA 1RIHL 1BG9A 1LUCB 5D93B 3NQCA 1XGDA 3H9SA 2WXQA 3UBXB 1MCBA 3ZE1B 2WIIB 3B2MA 3AWFA 2Y3AA 1RAMA 2DIJA 1FYTA 3VVWA 5I8OH 3SO5A 5FWQA 3WFBL 5MEND 3SN0A 5DD3H 4M00A 3TVMA 3TWAA 1IQDA 5J8LA 3IETA 1Q9WA 3FSUA 5I09A 4H0LC 5C09A 4YZWA 4UCGA 3UTSA 4OM0L 5BU6A 2OR9L 3QWQB 4CBPA 2C15A 4YPJA 2WAQA 4NILA 2YIHA 2QUVA 3A3YB 5L2KA 3K6DA 4DSYA 4N0UE 1H5BC 4B27A 2RQ8A 5KW9L 4FNSA 1KPVA 3VJ6B 1MVUB 1SSGA 3WFLA 3QZAA 3L7FA 1WDQA 4AQAA 4MB3A 3HZMA 3VFWA 5KYUA 4O57A 3PZVA 5T5FH 3JWOH 3VXSE 4XP1H 1HYSD 3WAKA 2POZA 3UMNA 1CTMA 4F3FB 5J7CC 1IGJA 4OZHF 3MBED 4HHMA 3UZYA 4H6QA 4S3BA 4DP7X 2WBJC 3S9IA 4G82A 2FUQA 1RJLA 3FS9A 2RD0A 4OKVB 5ID1B 2VZ3A 5BUGA 5CZRA 1DWHM 2G60H 1S7UA 4K7FA 4GBXC 5T33H 2X87A 5KUMA 2QSVA 1SY6H 1MIEL 2HX9A 3RWJB 4WY7L 2DRUA 4G5AA 5F9JB 2W0UA 4JM2F 3KPQB 3K2UL 2ETWA 4Y1AB 4AEEA 4F66A 4GRSA 1OYBA 3L9EA 4Q0XL 1HJVA 1Z6KA 5AALA 1Q9KB 2CLRB 1J8HD 3W9EA 2VX6A 3V35A 2FO4A 2XJKA 6A3HA 4U6XA 3IJEA 1TPWA 1MZZA 2YYTA 1AIFA 4U3AA 3TPUB 4F7KA 3BUYB 2H9GB 2OMUB 5E5RB 2C1HA 4GG6F 5JMUA 2XWTB 1ZLSH 3BSMA 4RDBA 1G4TA 3GMPB 1OM3H 1KZQA 4N90E 2J2ZB 5F9WB 2ZX8A 4XHQA 5FHBL 2XVNA 1Q0XH 5K39B 2WHJA 1UM4H 1MIML 2CD0A 3CWGA 4F5CE 1D5BB 4QDMA 5E5LA 5FO7B 5J11B 3AC0A 1YEGL 1P5VB 5DHVA 3R12A 1HQ4B 4WW1A 4DJEA 2J24A 1TV8A 1RULL 2FB4L 1NARA 3C2EA 1Q94B