1KTCA

The structure of alpha-n-acetylgalactosaminidase
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
388
structure length
388
Chain Sequence
LENGLARTPPMGWLAWERFRCNVNCREDPRQCISEMLFMEMADRIAEDGWRELGYKYINIDDCWAAKQRDAEGRLVPDPERFPRGIKALADYVHARGLKLGIYGDLGRLTCGGYPGTTLDRVEQDAQTFAEWGVDMLKLDGCYSSGKEQAQGYPQMARALNATGRPIVYSCSWPAYQGGLPPKVNYTLLGEICNLWRNYDDIQDSWDSVLSIVDWFFTNQDVLQPFAGPGHWNDPDMLIIGNFGLSYEQSRSQMALWTIMAAPLLMSTDLRTISPSAKKILQNRLMIQINQDPLGIQGRRIIKEGSHIEVFLRPLSQAASALVFFSRRTDMPFRYTTSLAKLGFPMGAAYEVQDVYSGKIISGLKTGDNFTVIINPSGVVMWYLCPKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The 1.9 A structure of alpha-N-acetylgalactosaminidase: molecular basis of glycosidase deficiency diseases.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Hydrolase
molecule keywords alpha-N-acetylgalactosaminidase
total genus 140
structure length 388
sequence length 388
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2002-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1ktcA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ktcA01
4PODA 2NWSA 4DO6A 3A22A 1C8VA 5AYXA 2YA1A 4MOZA 3EWUA 5CXPA 1G94A 1SFLA 4JGDA 4K7YA 4K39A 4OWGA 4CQ9A 1WOBA 1AQHA 1EA0A 1PCKA 3WNNA 4JTLA 3QFEA 3QPZA 4J3VA 2XVLA 4K37A 5DXYA 1W5NA 4O1BA 1ME8A 4Y90A 5FEWA 3WNKA 4WUIA 1DHKA 1H1ZA 4AMAA 2NT1A 1WQ5A 3PB2A 4TX9A 1OX5A 2Z0IA 2PURA 1A5AA 4KMQA 4M7SA 5BRPA 4A29A 3VSTA 1PPIA 2TSYA 4J3UA 3TR2A 3BSHA 1MFUA 5E93A 3W7GA 5E1QA 2PRHA 1CXFA 3W2LA 3TXVA 1JD7A 2EHHA 2VRKA 3WELA 1ME9A 3BARA 3S1XA 1IIHA 3CB8A 3TDFA 1JXKA 4HOXA 3HIJA 1QI3A 1XCXA 2DZSA 2WNQA 1TV7A 3I7QA 5I3GA 1H5YA 1ZJIA 4MFEA 2QCGA 4JYEA 1EP3A 3R2GA 1MW2A 1RZMA 4WSJA 4CVWA 1EB3A 1VLWA 1VJSA 2V8ZA 4IXHA 2Z1BA 3P67A 3DX3A 2Z6JA 1HWWA 3M44A 4QAWA 4OIFA 2B0MA 3W71A 2F7PA 1XH2A 1JULA 2X2GA 3FJLA 4LS1A 2GJPA 3S5YA 2FJKA 1TPUA 5DXXA 3TONA 2ALDA 5AC7A 5D09A 5C2XA 4JEQA 3G1XA 3KOFA 1AVAA 1R2SA 2ABBA 2A6LA 2V3FA 3BAIA 3CZKA 3KEHA 2A5HA 1VS1A 1WZKA 1G4PA 2BWGA 3O06A 1K7FA 2W0UA 1SW3A 1Q6LA 3TXZA 1JI2A 3BLKA 1ZS2A 3SSJA 3DGRA 2EQDA 3OVPA 3B0UX 3TC6A 2WKLA 2ZZ1A 5F2IA 2ATMA 2RHGA 3T7VA 3P84A 1WO2A 5DCDA 3BCFA 3GTNA 2D3LA 4MLJA 2E5DA 4Z1DA 3HQ1A 1AK5A 4GI9A 5A2AA 3TFCA 3BGGA 3CWOX 3SW6A 3HZ3A 3BPWA 3AXIA 2QUTA 4XKYA 3TW6A 1KCLA 3LTYA 1J0JA 4IPIA 2YJQA 4H8UA 3TFXA 4Z1BA 3A23A 1WPCA 3BH4A 2WNNA 3HJZA 3NGJA 1Q45A 3CC1A 2VFIA 4HNNA 4XB3A 1XUUA 4JICA 5HINA 5HXMA 4JTJA 2YPIA 1AMKA 3LTSA 1QO2A 1HL9A 1TTJA 5I3FA 1UD5A 1DJQA 4UMCA 4Q32A 4A3UA 3BK0A 3MI6A 2GVLA 4KWUA 1KFBA 4JL2A 1QDSA 4NXKA 3CLMA 5DCEA 2WSYA 3WK1A 3UPWA 1KXHA 4CCEA 1LWJA 1PZ2A 1I2NA 2EAWA 3MHFA 1H50A 4M19A 1YDVA 2ZRUA 1T8XA 5HR7A 2R8WA 3NQFA 3DHFA 1D3CA 2Y2WA 4QSHA 1UB3A 1ZNNA 2NSXA 2VEKA 3G0UA 4JTGA 2YGYA 3HGSA 3KXQA 1ZENA 4XUGA 1JCMP 4UTWC 1PAMA 3GXTA 1JRBA 1NF7A 2F7QA 3FAXA 5EKYA 5EBUA 1CXEA 3M5XA 1OJXA 2BXVA 3HPSA 4DPQA 2BTMA 3L5LA 1OT2A 2C14A 1OF6A 4N4QA 5D05A 1B4KA 3HMJG 3M7WA 4QISA 1BF2A 2OSWA 1W5OA 2AAMA 2F1AA 3A6OA 1SSDA 2CLIA 4O17A 1BG9A 1GZGA 1KCKA 1FXQA 3STEA 4N6FA 2E6FA 3P62A 4FLSA 1AMYA 3SI9A 1UH4A 3N9RA 4Z1AA 1AG1O 3HF3A 1F2JA 2ZRWA 3N2XA 5F2LA 4JTUA 4LQ1A 1Q6OA 3E0IA 3QRHA 1S3HA 1UD2A 1QAPA 4AHPA 3AXHA 1TIMA 2NUYA 1OF8A 2WCSA 4DXVA 1OFQA 4O50A 3WK0A 3T55A 3FLUA 9CGTA 3L65A 2F2HA 3I65A 2V81A 1M7PA 2CXGA 1FDJA 3GXFA 3DFPA 2X16A 4FNPA 4UTTC 1JCYA 1GPWA 1WAUA 2ZBTA 3PR2A 4UOZA 1FWWA 4GINA 2NXIA 1L2UA 1IXQA 3UWZA 1GYLA 4LVFA 3B8DA 2D0GA 1D9EA 3G1DA 2VRQA 4NU7A 1SW0A 4BI5A 1BSIA 2VFDA 1G7VA 1GVSA 4PC8A 3O63A 1UOKA 2YXGA 2H8ZA 1NEYA 1OG0A 4FHAA 5EYWA 1LDCA 3EXSA 4KFNA 5HDRA 3CQ0A 3STFA 1EA9C 4WX2A 1QI4A 4NUWA 3QPYA 2WJZA 5H91A 3WK2A 1MEIA 3TX9A 3VNZA 3CU2A 5CZTA 1CPUA 4C1KA 3IIZA 1GVOA 1IF2A 3AO0A 1WZMA 3NQAA 1H61A 3G1YA 4BR1A 1OT1A 3WN6A 3W6YA 3G0SA 4PSRA 1IZJA 4MUZA 1R47A 2QMKA 5BNKA 4IX2A 4ALDA 4H8VA 2ZCGA 1G69A 5HR6A 1LP6A 1YTDA 4NJIA 1ME7A 3W1QA 1QWNA 5D2VA 3HGOA 4JTEA 3W7DA 2ZUWA 3I7SA 3PB0A 2EPHA 1FDZA 3W75A 1M53A 1VLIA 3LCFA 1SPQA 3D0CA 3M16A 5DY2A 1HL2A 3TQ0A 2A7PA 1UD3A 4H4IA 3BUPA 2QPUA 1SZEA 2VEMA 1CXKA 3OG3A 3L68A 3WY3A 5EMYA 2ZXDA 1PCWA 1KFCA 3W1MA 4TMCA 1KB3A 3NQDA 1R30A 1E3ZA 3ZS4A 4U33A 1LWHA 1CX9A 5DELA 2NUWA 2NZLA 4U4MA 1OYCA 5LKYA 1RQEA 4OBTA 3W37A 3P5ZA 3TK7A 4GI8A 3L0NA 2ZWZA 3WNOA 3STCA 1KTCA 1WZLA 3U6WA 3TOPA 2NLIA 5DLCA 2Y7GA 1PZ3A 1KLZA 1WX0A 3V75A 2D0FA 3ZFHA 3R13A 1CXHA 1SU5A 3LCXA 4JDYA 2Y88A 4O1AA 1B2YA 2A6NA 3P8IA 3HBLA 3FAWA 4LW7A 2PWDA 4GUIA 4IMDA 5D2YA 2CLOA 3LPPA 5CPOA 2A0NA 4WD0A 2QV4A 2V30A 5DY3A 3UWQA 1F6KA 3P5YA 4QNWA 5EPDA 2V2CA 3KVLA 1BAGA 3IGUA 1OABA 1TTPA 1HTIA 1TTIA 1THFD 4UTMA 1CGYA 5TQLA 4JX4A 3M47A 4DF0A 4H2CA 3I7RA 5HUOA 2NX1A 2VKZG 3O07A 3EDFA 2H8XA 2ALWA 1JJKA 3ZT5A 4ORIA 4JDBA 3ANYA 2HTMA 3VMNA 3GBDA 3QZEA 2DZVA 3TAOA 3NVTA 4RZ4A 4QAIA 3K8MA 4IQLA 4FEZA 3ZSSA 1G7UA 3STGA 3W7RA 3WJYA 1UKSA 3PF3A 3RIKA 4NZFA 5A6MA 2OJPA 3DI1A 3BO9A 3A5VA 3UG4A 4O12A 2XWDA 2P0OA 1E51A 1V3KA 1CGXA 2OYLA 3WY4A 1XXXA 3UNDA 3NPWA 4JFVA 1A5SA 3L4UA 2KZHA 2QAPA 4Y9AA 3CGTA 3TU9A 1KGWA 5DO8A 3PBWA 4O19A 4UR7A 5EA9A 5G4EA 4J9JA 7TAAA 4LY8A 4LVAA 4GUGA 4LUIA 2VUYA 1QPOA 3NDOA 3QMTA 2DH2A 3W07A 5CPLA 3TC7A 4K7VA 3L2LA 2D0HA 3ECQA 2WANA 1YLVA 3S1WA 5CSSA 2H90A 3N14A 5KZMA 3PWAA 1KBKA 2B4GA 2C8NA 1R33A 5CGTA 1DHPA 4ADSA 2ZUUA 3CZSA 5K3VA 5FF3A 4O4VA 1ZALA 4NT0A 1XC4A 1F05A 3MYOA 4JTIA 3MP5A 4CQ8A 4HT3A 2W79A 3B0PA 5AC6A 2QCFA 5CPNA 2EKCA 2PRMA 5G1YA 3BG3A 4PEKA 4BF9A 2BY3A 2DP3A 2QCHA 2EACA 5A2CA 2QR6A 1GJWA 2CHNA 2C0AA 1RPKA 4HN4A 4L4LA 1EP2A 2NUXA 4JTFA 4R53A 1TYGA 3NL6A 1BVZA 1FWRA 1XSJA 4O15A 1PV8A 1OVDA 3BVUA 2QEZA 1HTYA 1QO5A 1XFBA 4UFHA 1LROA 1PJ9A 4HNTA 4M5PA 2WVVA 1HFBA 4WOQA 1CDGA 3C2OA 4HP5A 2CZDA 3GXDA 1JDCA 2NX3A 1O4UA 3R5EA 5KSWA 2FYVA 3L66A 1UA7A 1BEUA 2QDHA 2QJIA 2CZEA 4ZQMA 1KV8A 4ORMA 1HT6A 1JQXA 1YXYA 1FY6A 4OQVA 1TPH1 5BRQA 1JCJA 2ZA3A 3P7YA 4OKDA 1LTDA 1PVNA 1WOAA 5L6UA 5FESA 3DX0A 2GQAA 4XZ9A 3ABRA 2YCEA 4LOCA 5I3HA 1RVGA 4I7WA 1UUOA 3LGEA 2VELA 3H54A 3K1DA 4MPQA 3THQA 4GJ1A 3C6CA 4O53A 4DF1A 2JGQA 4J3XA 4JFTA 3Q94A 1SZGA 4XTDA 1ZCOA 2ZA1A 4IMGA 3QC3A 1O5KA 2E0PA 4HPJA 5F1VA 1KM0A 4AEOA 4ZZ9A 3BMWA 4PCTA 5D02A 1BVNP 5DBTA 3T4CA 1J4EA 3GXIA 4Y8FA 2ZRVA 1DTUA 7CGTA 1F7BA 3DFSA 2NWRA 3C56A 4CGTA 1M7XA 1PS9A 3C61A 2W6RA 3NQVA 3CEPA 3LRLA 3DX4A 4M56A 3WDIA 3UCQA 3K8LA 1L9WA 4W93A 1AQMA 3ZOAA 3GXNA 1Z42A 3KL3A 5K9XA 3W1NA 3VNDA 2FDSA 4N9DA 2ZA2A 3W1AA 4UNKA 3EXTA 3LHYA 3W38A 4HKPA 4UTLA 1PEZA 4UTHA 3NNTA 1PHQA 2ISWA 3NL2A 4RKAA 4MLRA 4N2YA 3LERA 1DBTA 4LRSA 3W74A 5IBXC 2YA0A 3VFLA 1IXOA 3BC9A 4MYAA 5AOUA 1DL3A 2Y6ZA 3A4AA 4GI6A 3BLBA 1SMAA 1KM4A 1VQTA 4O28A 1G6CA 4IPJA 3WENA 1G4EA 3GBEA 3NR0A 3W1XA 3NA8A 3NL5A 3W7OA 5A5WA 2ZDRA 5G2IA 2B7NA 4GKLA 5I3JA 3D52A 1LRNA 4JXCA 3CIXA 3PBUA 1CXIA 1TJRA 3VO0A 4UC5A 5G2HA 1ZHAA 5D2WA 1Q6RA 2OSXA 4FLRA 1LORA 3GB6A 4TO8A 4FNQA 4KWWA 4JYDA 1Z44A 1PL9A 3CZGA 1KBBA 3FIGA 1K3UA 4TU1A 2RDUA 3EEGA 1WZAA 3ZWSA 1S5WA 1G5AA 3TV8A 4MZYA 4KKXA 4DELA 3O1NA 3W1UA 1RD5A 4OGZA 3DENA 2EO7A 3IK2A 3NAVA 3PBYA 1E43A 2GOUA 3N34A 4UR8A 1OFBA 3BGJA 5HULA 4NXSA 1TRIA 4LVDA 2X1UA 3G1AA 3GDKA 2GJNA 3BVWA 1XD1A 1SZNA 2CPUA 2BXZA 1TJPA 2FH6A 4YWIA 5LNVA 3R89A 2Y5EA 1G1YA 3GXPA 3IGSA 4POCA 2V2HA 4QQ3A 5LHEA 2C15A 4RX0A 4FLQA 2I14A 2OCZA 3MI3A 4R33A 2DIJA 2F1BA 1GQNA 2GQ9A 3DH7A 3HGRA 3A47A 3W1PA 3KLKA 4UTTA 1D3GA 2Y24A 2VC6A 1JVNA 1X6UA 1U5JA 4UZSA 4FX7A 1AL8A 3EJTA 3GIYA 1V7YA 2G97A 1UKQA 4CN1A 3DHUA 3NQMA 2OYMA 3WY2A 3UWWA 4TMBA 2X1SA 5LNRA 3BVTA 1LBMA 1ICPA 3S8HA 2YYTA 2R14A 3UY8A 3NQ6A 3W72A 3TJXA 2J9ZA 3KLLA 2QPSA 3W7EA 1JRCA 1QPRA 4O0KA 5BMWA 1XGZA 2D73A 3Q37A 3UZJA 1V3MA 1VCGA 3OVRA 5HQEA 4MJZA 1DEDA 5BOOA 4AHQA 1P1XA 1TPB1 2WVSA 1W31A 2C1HA 3QMRA 2DU2A 4LT9A 3EX4A 1X1OA 5LHFA 3LHTA 2J27A 3BAKA 3R8RA 1G4SA 1QWUA 4E2BA 3HB9A 2ZX6A 1VC4A 4RXGA 3OLGA 4O8RA 1TQUA 1JG9A 4UFMA 5D38A 2OSYA 2RKXA 3G22A 2X1TA 4ZQRA 3EDEA 3BCDA 3TE9A 2PWEA 3UD6A 2PWFA 3LTPA 4Z08A 4NJKA 4UQBA 3C2EA 1SSGA 1GVRA 1K7EA 2QAFA 2ZZ6A 1U83A 1JDDA 1R2RA 1A5CA 3EX3A 4I7VA 1ML1A 4DEFA 1JUBA 4FNSA 3P8JA 1AW5A 3W1RA 4FO4A 3SGZA 2WSQA 1K8XA 1T0OA 3L0KA 3I6RA 4GUJA 4GC4A 5KEZA 4CCDA 1LOSA 4JD4A 3G8EA 1J0IA 3S2CA 5A8GA 4O18A 5BW6A 1JD9A 1ALDA 3G0XA 3GK0A 2FTPA 2C18A 3CZEA 1EHAA 4TVUA 4O13A 2B7QA 5EY5A 4HA1A 1H1YA 3NG3A 6TAAA 5D30A 3TJLA 2FHFA 2CZ5A 4FLOA 2XIBA 4J27A 4FNTA 4AWUA 4N6EA 5CPMA 5F4WA 3D4ZA 4A21A 1HNYA 1N55A 2QCDB 2ZTJA 2JKAA 2XIIA 4JX5A 4UFJA 2YFOA 3L4WA 5G5IA 2Y61A 1PIIA 4HIBA 1MVYA 3BW4A 2DZPA 4CNOA 1T96A 4EIVA 1YPFA 1JF5A 2ZXQA 2DJLA 5C55A 3W7IA 5MHBA 3WNPA 3JR2A 1YXDA 4GWEA 1SQ7A 4UMBA 1TPVA 3CPUA 1TQSA 1JUEA 5G4WA 5CZ0A 1X7FA 3TAKA 4AHOA 3ZR6A 1HX0A 4P2VA 3TQVA 1YADA 3DBPA 1N7KA 3CTTA 3DX2A 3UPBA 4PEEA 3L21A 3N73A 4UCFA 1GJPA 3G1SA 2E8YA 3LXAA 3BMVA 2R94A 2ZE0A 3PULA 2QCNA 4AF0A 5KITA 2CLKA 4M8UA 4O0ZA 3RMJA 1R46A 1PE1A 4E0CA 4O52A 3W7PA 3IJ9A 4UNIA 4UQ9A 4FX6M 5I5RA 4NNAA 3AJ7A 3LHZA 3WNLA 5GVJA 1FDYA 3GAKA 3DDFA 1C9DA 4OU1A 3T44A 1QHOA 3DDGA 1KM6A 1AL7A 2BLEA 5F4XA 2ATSA 3FYPA 4FXRA 4LNYA 5LNSA 3MHGA 1OFAA 3F4WA 2H6RA 2R91A 3W87A 3VM7A 1H7RA 2J9XA 4A22A 2V82A 2V5LA 2G3MA 3CPRA 4MZ1A 2Z1KA 5LNWA 3UG3A 1VPXA 4PL1A 3UZ5A 4HNVA 3MJYA 1Q4NX 1NF0A 1P5BA 3KVJA 8TIMA 4BA0A 3VGBA 3V1PA 5I23A 2QKFA 1TQVA 1MO0A 3G3DA 4WSKA 1LZOA 2CLFA 3VX1A 1CW2A 3GX9A 2WV8A 3WJWA 1B9BA 1TPFA 1TV5A 2PWGA 2BY2A 4OV9A 1BKSA 3S42A 5I0DA 1ZFJA 2RDWA 2E5CA 1O60A 2YYUA 2E6DA 2E09A 2QUUA 4HHPA 3DC0A 4WZHA 4N4PA 1TMQA 1OGSA 3MW7A 1F74A 3BLPX 4GE8A 4J3TA 3LM7A 4K38A 3PBVA 1CGVA 2YW4A 3AMLA 1TTQA 1H7XA 5AB3A 2B7PA 1BWKA 1OX4A 4HSNA 4MZ8A 2NX9A 4H6KA 4GO8A 3F1QA 1F5ZA 1B4EA 2FB2A 3M41A 1H51A 3UEQA 5I3IA 3EXRA 1W8SA 4B9ZA 1VYSX 4MVAA 1NSJA 3FOKA 4MAZA 3NQEA 3TTYA 1N8FA 3GR8A 3ZR4A 1LM1A 3CM4A 2WCGA 1WE5A 3W84A 3M0ZA 4LXFA 2E9BA 1EUAA 1E3XA 4MY1A 2DZXA 3QMSA 4IOTA 2E1DA 1JAEA 5C54A 1YPIA 1EO7A 4JS3A 5FEPA 2NV1A 3DFNA 4GXMA 4GRSA 2Y7EA 4O54A 3CZNA 1WXJA 4Y96A 3O15A 1NVMA 5HWMA 3VSUA 3ABQA 4R34A 4DO4A 4DPPA 3UY7A 3QM3A 2O7SA 1UASA 1LCOA 2WOQA 4NZJA 3DFOA 4JX6A 4M6QA 4NX5A 1RP9A 4KFOA 2VEPA 4IMCA 3CHVA 2C13A 3CZLA 4JY9A 1T99A 1TCDA 1QNVA 3WJSA 1WBJA 2BHYA 3IIOA 3TSMA 4E38A 3DI0A 1DJNA 1YDOA 4QM1A 4X22A 3NPVA 1HUVA 1X1ZA 4GQRA 4Z0JA 1VRDA 3BG9A 3A21A 1D3HA 3QSTA 4B9YA 1JIBA 1QR7A 1WV2A 1XCWA 3KWXA 2J9YA 3UERA 5KMYA 3LRKA 3VGEA 4LRTA 5AHNA 4ZQOA 2DZTA 2G96A 3IEBA 4AAJA 2ZZ2A 3PUEA 1E40A 3D51A 1U33A 2XVKA 1TB3A 4P61A 3NPXA 3M6YA 3C8FA 3MBFA 3LLFA 4NNBA 3ZO9A 1BLIA 1O95A 1EWEA 4Q33A 3EDDA 3O16A 1TQTA 1XD0A 2NXGA 1P6WA 5AFDA 3L0GA 1H7OA 5F2GA 3KE0A 1ICQA 3O6YX 4S2CA 4L4MA 1GT8A 4XWUA 1FWSA 3LX9A 2OYKA 2ZRXA 2DH3A 3M1ZA 3FJ6A 1MXSA 3NYZA 4N9BA 3TMQA 2IQTA 1YDNA 4LPCA 1W3NA 3W3OA 1ZAJA 4O16A 3W76A 4QIUA 4PTNA 1XSIA 1A47A 2ZXBA 3BAWA 4K8HA 1ONRA 4RZ6A 5HWJA 5KZEA 1QPNA 2YW3A 4K6AA 4CN6A 4R7JA 1OK4A 1XL9A 2F61A 1SR9A 1TQXA 4JTTA 2V5BA 4J3WA 5EMUA 4O10A 1UH2A 2TRSA 4GUFA 3M43A 2X1RA 3IIVA 4DBDA 4NI3A 3LCGA 1EUNA 4N9CA 2WO5A 3F03K 3BAYA 3EDKA 4A2SA 3L2IA 3M07A 2QUVA 3W7CA 5J5RA 4ADUA 3EJSA 3W23A 3O6CA 1V5XA 2CLEA 4LTSA 2GVGA 1XKYA 4YXGA 1MEWA 3T40A 1FUYA 4GO9A 3NZ1A 3UWVA 2EAEA 3LV6A 2OW6A 3OHIA 2ZZ7A 2CWNA 5HJLA 1MW3A 1RV8A 1JL8A 2BY0A 3TSDA 3LI0A 4BI6A 4IWWA 3W7JA 2CLHA 2UV8G 3TW7A 3DXIA 2GVJA 2A4AA 3NQ7A 4HPXA 3PSVA 3S5NA 1GOXA 1LOQA 2XN2A 3TKFA 1A53A 1W3IA 3GVGA 5LNUA 4PSPA 1QWGA 3TSBA 3UQNA 1W1ZA 2D3NA 3HG2A 3W2NA 3GR7A 1TCMA 1TQJA 3LBMA 2I1OA 1ZAIA 4UMAA 5DN1A 4GUHA 3D4YA 1PHWA 3L4VA 4IMEA 4JTHA 1VIWA 3ABSA 3LHWA 3B4UA 3M5ZA 4JR5A 3GYEA 2EJ1A 3MMTA 4HOWA 2F7OA 5CKSA 3B05A 2FIQA 3GNNA 3BVVA 1KM1A 3IV3A 1LRQA 2QCEA 2C19A 2GUUA 2Y4SA 3TQKA 2HS6A 3ZQ9A 3IIXA 3RU6A 3RLUA 1VCFA 1HXKA 2AGKA 4M7TA 4ZL1A 1ADOA 2JGYA 5FF4A 1R75A 3ZSTA 3C2RA 4Z0SA 3PUDA 3SY5A 4JFWA 5LZLA 2AMGA 2QLYA 3GDLA 3LXBA 4UOQA 2FB3A 4I9AA 1UD8A 2F84A 5K4ZA 3C4UA 1F73A 3JS3A 3CWNA 5HMSA 5EL1A 2TPSA 5FI8A 3DFQA 4AMWA 3LCIA 5TD4A 3EB2A 1D7FA 3DKLA 1KFJA 4XTIA 4XBSA 3W7KA 3EX1A 4YCPA 4K36A 2JKEA 3F4NA 3EJRA 3Q2DA 1CXLA 5U7SA 1UBSA 4XKYB 4UQCA 3RLVA 1H7WA 3KHJA 5AN7A 5E0FA 1FCQA 1KA9F 3MI2A 4RXFA 1VFMA 4U2ZA 6ALDA 2WKGA 3VM5A 3KL5A 1I4NA 3QW4B 4JFSA 2CU0A 2YIHA 4AXKA 3LHVA 2O7QA 1RP8A 1SO3A 3MHUA 3NQCA 1QCWA 2DJXA 2QJGA 4WJEA 5TIMA 1JI1A 2PRLA 1GVQA 1HO1A 1XUZA 1ZY9A 2ZZ5A 2H3DA 1EO5A 3W9ZA 3TH6A 8CGTA 1L6SA 2ZIDA 1CIUA 3W7NA 4HSOA 3L4ZA 5IM51 2RH9A 3EWZA 4CKQA 5TBOA 5KTLA 4JCMA 5F1UA 2P10A 4RZ5A 4BZYA 1S5TA 3Q58A 1Y0EA 3EX6A 2A7NA 1I8JA 3W2UA 1J0KA 3OLEA 4DQWA 5LGZA 3C0JA 3OLDA 4IJBA 4U28A 3WMSA 1XV8A 4RR4A 3WK3A 3BAJA 2RFGA 3CV5A 3OLIA 1S5VA 3KFTA 3IVSA 4MYXA 3HPXA 4W9TA 2V3DA 4WOZA 4MY9A 1G4TA 3UWUA 1W9XA 4JN6A 1XH1A 5DCBA 4BWLC 5SWUA 3VSVA 5LSMA 1XSKA 1VYRA 4BFAA 1I2RA 2GJLA 3FEMA 2ZX7A 3YPIA 3P61A 2CW6A 1UD4A 1BWLA 1MSSA 3EWYA 1EIXA 1H7PA 2ZX9A 4E2OA 2VOMA 2VT0A 3W70A 1Q6QA 3GXMA 1NOFA 4AYSA 1JUKA 1UA3A 1ZAHA 1MW0A 4JTKA 1PIFA 4UNLA 2TAAA 1DQXA 3QQ1A 4MIMA 2Y7DA 2WSKA 2PE4A 4PH6A 5G2WA 4UXDA 2WPBA 3B04A 3LCHA 2DZWA 2E5BA 3P82A 2ZWYA 3MO7A 5IBXA 3N19B 2E4TA 1U2YA 1K03A 1BPLB 3TCEA 2BSLA 6TIMA 3OIXA 3QEZA 3VE9A 2FHBA 5K9CA 1EWDA 3MWAA 4QITA 2JK2A 4K8EA 1AW2A 2ZQ0A 3N2MA 4Q4KA 5FF7A 3II1A 1G67A 4AEFA 1KXTA 2FGZA 2GUYA 4JTSA 3WDJA 3IJ8A 4FMVA 3A5FA 1FWTA 1UCWA 2E6AA 3L2MA 1KM5A 4JNMA 1TMHA 2OT0A 3W2MA 1WDWA 3H55A 3L9CA 5E9AA 3BLFA 6CGTA 3LLDA 4JIQA 4HOZA 2VFGA 3AMKA 1QFEA 1Z32X 3W73A 4ONVA 2D2OA 3MP3A 3H53A 4JY8A 3CLWA 3FFSA 2WPGA 1SW7A 3NL3A 3BSGA 4FNRA 2E68A 2QCCA 1KLYA 5D03A 3W7QA 3LXCA 1OHLA 3L4YA 2V2DA 3DU0A 1OX6A 4O57A 2J88A 3ZT6A 1JQVA 1TPEA 4JFUA 2BX7A 2XFWA 4M6VA 1VGAA 3BAXA 3U2OA 3VE7A 1OYBA 3GZ3A 5AHFA 5AHLA 1QHPA 3SR7A 2Y89A 1V3LA 3NEVA 4DF2A 1OFEA 3WY1A 1JGIA 3S5OA 1GG1A 2A2IA 2V9DA 3QW3A 3VGDA 2G95A 3WFZA 5I24A 5D2TA 1FBAA 3EJUA 2NV2A 3BV4A 4A2RA 2X2IA 1VFOA 4GNJA 4O1CA 3VI2A 4G1KA 2WNZA 5KZDA 2FFCA 2J25A 2XN0A 7TIMA 2BZNA 2E6YA 2Y85A 2BHUA 1OFDA 4X0NA 3VCRA 4D2JA 3EWXA 5FEZA 5HPOA 3ZR5A 1TV8A 3W2KA 5LGXA 2WSRA 2JKPA 4FIQA 4O14A 4AYGA 1OYAA 3HJEA 3NM3A 2OW7A 3JRKA 5E0KA 1MXDA 4DO5A 4AVFA 1F6PA 3BVXA 2WVVB 3WDHA 3BVJA 1J0HA 2LLEA 3W22A 1KW1A 1OB0A 3PG8A 3M5YA 4HPHA 4DBEA 1GWJA 3OVQA 3SFKA 2CLLA 3PY2A 3L4TA 2I9EA 3B06A 1WBHA 3G3MA 5D04C 5K7JA 1VJIA 5D37A 2FE0A 2YA2A 4S1FA 2CFFA 2AAAA 3VGHA 1ZJAA 1VHNA 4NJGA 4FXSA 2WVTA 5FF0A 2A1YA 2XVGA 3QQ0A 3P60A 3GKAA 4YLWA 3B0VC 3O6DA 4MB1A 3ATYA 3CTLA 1XBYA 2C6QA 1VAHA 4AEEA 1Z48A 5AC8A 3DKJA 2YOCA 4MKNA 1UH3A 3L5AA 1FWNA 2BHZA 2F7FA 1VYPX 4TR9A 4MFDA 2GJRA 1O7DC 3K30A 1I2OA 4RLIA 1QOQA 1CYGA 2ISVA 3M9YA 1JCLA 4FNUA 5I3KA 1YYAA 5DFAA 4UZUA 1MZHA 4M6PA 4CN4A 3LB0A 5CGMA 2ZZ4A 2WNWA 3BUQA 3ATZA 2ZICA 4Y6GA 2BY1A 3IRDA 4UFLA 4J28A 3TNOA 3W85A 4X9YA 3W2JA 3WJZA 2WVUA 4ATWA 1EX5A 1O94A 2ZUSA 1W5QA 2Y62A 5CZSA 2VNCA 3PG9A 3C2FA 4X2RA 1XBXA 1SMDA 1DKWA 1A50A 4LV9A 1QX1A 2QCLA 3IGXA 2G3NA 4U31A 3M5VA 4ML9A 4N02A 5D2XA 3OEXA 1I2QA 1TSIA 3PUOA 5AHMA 3K8KA 3WEMA 2YX0A 4AB4A 3RNDA 3CIWA 3AJXA 3W1LA 4EF8A 1NAL1 4AIOA 1XBVA 5CGQA 1WYIA 1FCUA 3IVUA 1K8YA 2RDTA 3FA5A 2YFNA 3TROA 4WXYA 2Z2UA 3N9SA 3WJXA 2FPYA 3VMPA 4E2DA 3LPOA 1CGUA 3BUDA 2YZRA 1K7XA 1XI3A 2TYSA 2Q3OA 1VCVA 4X9SA 3GDTA 1UJPA 3LDVA 4YCOA 3L5MA 3G18A 4WQ6A 1RR2A 4LVGA 2QJHA 3BG5A 1DV7A 1H62A 3B03A 3PAJA 3W7HA 3CT7A 1JXJA 4BK9A 4O1DA 3G1FA 1L6YA 3QF0A 2Z6IA 4HNUA 5K2ZA 3LHUA 1CI1A 3EX2A 4WY0B 1VFUA 5A6LA 3RF9A 1NM9A 4EWND 5BMXA 4ZMGA 3W83A 5FF2A 5HUPA 3TIMA 1KGXA 1U30A 1LBFA 5CLWA 4LC6A 4TIMA 2VFFA 3UG5A 4PCSA 1MEHA 4WY0F 3THAA 1CGWA 4UTWA 4QNEA 3EKLA 1PS3A 3BUIA 1TPC1 3GKFA 1HL8A 3HG4A 4NJHA 1CGTA 3VU2A 3MUXA 4JCLA 4RJEA 1H7NA 2QF7A 4H3DA 1TQWA 5BRBA 2A7RA 5FEXA 1K02A 4ICNA 1LLZA 4RV8A 1RQHA 2VR5A 1TREA 2OMAA 1GTEA 3IIPA 3NPUA 4I7UA 2EEXA 5ABTA 2ZYFA 1W5PA 2YSWA 4WLCA 1IGSA 4BI7A 1HO4A 1R2TA 3G1HA 3GNDA 1KXVA 2J6XA 4NQ1A 2NT0A 5CZJA 4OT7A 1P4CA 2F7RA 3A24A 1TO3A 1XDLA 3DFTA 2XWEA 3BUBA 3LI1A 2VXNA 2Q3RA 2Y7FA 1HVXA 1WA3A 1GEQA 1F76A 1IIGA 4UQDA 1W56A 1GG0A 5AHEA 1LYXA 2C16A 3GDRA 3NXFA 1KM2A 3W7LA 1UD6A 1W3TA 3DX1A 4PCFA 4PA8A 4PFMA 1KFKA 1M6JA 1C8QA 5T26A 4IUOA 1ZJBA 1KFLA 5CLTA 3NQ8A 1XH0A 5CSRA 2EADA 4FB7A 4B5NA 1JCNA 3FKRA 3GAYA 4YMZA 2A85A 3MP4A 1EEPA 2PC4A 4RCXA 5F4SA 2WQPA 2A21A 3R12A 1R34A 4UUIA 1L6WA 1QI5A 5E6YA 3C2VA 3TUUA 1VH7A 5U4NA 3G8RA 3P80A 3VMOA 3SGUA 1W37A 3KL0A 1EPXA 3RK8A 3IJ7A 1WP6A 2DORA 1X8FA 1FCBA 2H3BA 1SO6A 3HG5A 1H63A 1C29A 3EKZA 3HG3A 2GQ8A 2P1FA 3LBCA 2ZTKA 4LU0A 5AYYA 3DHPA 3KVMA 3D50A 3DAQA 3RFAA 1IZKA 2PCQA 3A9IA 3S0CA 4GFSA 1V3JA 4AW7A 1IV8A 2J24A 4UTKA 5G1TA 5AHIA 2WKJA 3KRUA 1Y7VA 2X30A 1JFHA 1VB9A 3L67A 4UTIA 3LRMA 1EH9A 1DQWA 4UIOA 4UFIA 3INPA 1MXGA 5D33A 1VHCA 4O11A 1W5MA 3O8AA 1BTMA 5C6MA 1JR1A 2HSAA 4WF7A 4NJJA 3E49A 1UKTA 2NXHA 5KINA 1FX6A 1TPWA 3PM6A 1QOPA 1IXPA 5C5YA 2WC7A 2ZRZA 4O4WA 5A2BA 4BWLA 1H60A 1NFBA 1OK6A 4FIRA 3EJQA 3VX0A 1SO4A 1J5TA 5E70A 1H3GA 4ZQNA 4JYFA 1M7OA 4FX8A 3ABOA 4IX0A 1SFJA 2EGZA 2V3EA 2BXYA 3UWYA 4UCGA 1MFVA 5E6ZA 1I2PA 1UUMA 2FQIA 4UTJA 2XN1A 1FXPA 3SECA 2G5WA 2CZFA 1W0MA 2Q8ZA 4ZQCA 1TRDA 3IVTA 4X3ZA 1ODUA 1VR6A 4J3SA 4MY8A 2FHCA 3FW6A 4XQ6A 4IMFA 1QMLA 1KWKA 3HO8A 2Q8LA 4U3CA 3W88A 1HG3A 4OJYA 4AWTA 3QYQA 4N9EA 3GDMA 4CNNA 1RQBA 1OFPA 1EP1A 3ELFA 1LLWA 4Z1CA 3W1TA 3W86A 1FQ0A 3PS7A 2OT1A 3E9AA 1MWOA 1YXCA 4QJ1A 3QH2A 2ZFAA 2EABA 3E96A 1GCYA 4CQAA 2CLMA 3MYPA 3LOTA 4GBUA 1W54A 2VFHA 4ADTA 4J7RA 1RPXA 4UQAA 2ISSA 3BW3A 4RK8A 1MW1A 2WSPA 2DIEA 3NO5A 1DOSA 3E12A 1A5BA 5H2ZA 3USBA 3VGGA 1K8ZA 3FYOA 1JCXA 2HS8A 3EWWA 2EF9A 1KM3A 2JBMA 3TMLA 3CEUA 2DZUA 2GVYA 4IXXA 4GIAA 3ZWTA 2VFEA 1AW1A 1JF6A 2ZX8A 4LC8A 3WNMA 1CLVA 3SJ3A 1JDAA 2FPVA 2Y70A 1SO5A 3WEOA 4KWVA 2AQWA 1OX4B 3T78A 5HNRA 3NZRA 1QW9A 3BLEA 1I75A 1O5XA 4CNPA 1ICSA 3L4XA 1FCVA 3S5ZA 4YL2A 5CG7A 3S6DA 2QDGA 1KBIA 1B0IA 1G9HA 4U2YA 2Y63A 3S1VA 4OHQA 4H8HA 2FH8A 4AIEA 4EOUA 4KFPA 4OE7A 3G1VA 1B3OA 2PWHA 4GQQA 2ZRYA 3N3MA 1KGUA 1KTBA 1P0KA 3UXDA 1XM3A 3S9YA 3PSWA 4EVZA 1GVFA 2QMJA 1DVJA 2C3ZA 3GLCA 5K4XA 5AYZA 2ZUVA 4LV4A 4WXZA 1Z41A 5DBUA 5F2MA 4LWWA 1M5WA 1B57A 2FPTA 3HPZA 4CCCA 3HOJA 5HWNA 3FS2A 3EWBX 4OV4A 2YDAA 3C3NA 1DORA 1SZFA 1QPKA 3ZT7A 3KVKA 1KTNA 2FLIA 3QGVA 2ZX5A 3C52A 2E8ZA 4LS2A 3P81A 3QJAA 4PL2A 2HMCA 3NQGA 4ZVJA 4H7VA 3PVFA 3HGJA 4CLMA 1KWGA 3EJPA 3RILA 3NOEA 4UFKA 1YTEA 2YR1A 3OBKA 3QSRA 1IXNA 2X2HA 1J2WA 3SZ8A 2E77A 2ZXAA 4JIPA 1L0PA 2OZ0A 4FF7A 4MJMA 3UYCA 2F18A 3KRZA 4JL1A 4XBKA 3G24A 1LRTA 1PIGA 2VENA 1LOLA 3I68A 5J5DA 3WFAA 1XBZA 1GYNA 3DZ1A 1XDMA 2B7OA 4AF0B 1OFRA 1KFEA 5K9DA 3FKKA 3O05A 2X2JA 1KXQA 4S2BA 4LS0A 4LUJA 1QPQA 4UQEA 3UXAA 3BLIA 5L9FA 5F7UA 1KBJA 3S1UA 4AH7A 2VEIA 4ZQPA 1VZWA 4NX0A 2V0TA 2TMDA 3OA3A 1S46A 1OSEA 3EDJA 3MBDA 3PC0A 1SUXA 1I45A 3LCLA 1XCFA 2YKKA 1GVIA 2ZUTA 3KAOA 1Q3NA 1TPDA 3TA6A 3VKJA 3SIZA 3E02A 1QW8A 2IGTA 3TTSA 3VGFA 4IGHA 4AWSA 3VNYA 2OX1A 3LCWA 1YTKA 2ABAA 2ZZ3A 4C1LA 1OFOA 1KV5A 2GPTA 2QCDA 4UTUA 3DHDA 4AMXA 3BW2A 4NVTA 4LVBA 3NQ2A 3W7MA 3LV5A 3NM1A 4WY0A 5D32A 3KX6A 3KRSA 4EF9A 3P74A 1LBLA 1P0NA 1GTHA 2QCMA 4NNCA 3U8GA 2C7FA 1GJUA
chains in the Genus database with same CATH superfamily
4HDIB 1MI5A 4KPLA 1GRWA 1IGJA 3OMZA 2DSUA 4ROQA 1YECH 5DD1L 3RA7H 3PPHA 3P11H 3FK3A 4MOZA 4XPTH 1EHLH 5TDPB 1G94A 2FJGB 4G6JL 5BOZG 3K2MC 3MLSL 1GZPB 1LNUB 4CQ9A 2KLTA 5HDBF 1JYWA 4LDCA 4L1BA 4TTUA 3D3VE 4JTLA 1F8TH 4F7KA 4Q8PA 3BN9D 4JDVA 4LLQB 4HFUL 4ASTA 1UP2A 5FK9A 1EMTH 2XVLA 1TZHA 1KCRL 1N7MH 2HLAB 3T0AA 3APYA 5DMNA 2NR6D 5A8OA 3OMAB 2J73A 4OJCA 3U83A 2PLMA 5I74B 1MJ7H 5IVOA 3STLA 3WNKA 3A3HA 4HTYA 2CGZA 2R0WH 1H1ZA 3JVAA 3HZYA 3NPSB 4Q6XA 1BM3H 1UGKA 5E9DD 1AD9A 1SEQL 2H3XC 4Z0XB 4TVPD 1UM4H 3L3IA 1G6RH 4PJBB 4IS6B 1GW1A 1AR2A 4MA8L 3P80A 5HHME 1OK0A 2FEDD 5D7IB 2Z0IA 5A7BA 1R19A 3PAZA 1PNDA 2OR9H 4GSDH 1HHHA 3ROLA 1E4XL 3EMQA 3PK7A 5J6GB 3TN4A 15C8H 4M7SA 1OARL 4WJG3 4KZEL 2RIKA 4FKHA 2WNGA 1NAKH 1NFDE 3OTRA 1D8CA 1GIGH 3HB3D 3TR2A 5IV2B 4NZRH 3L1OL 3GSVB 3U25A 3C3UA 5E8NA 5E93A 4WFFD 3G5XA 4XHQA 4KKNA 4HFWA 4JNZA 2J2ZB 1LD9A 5KYUA 1DANT 5IT2H 1ECQA 2WMPB 1EGMA 2WCPA 2EHHA 4C6KA 3LKOB 3TWAA 1W8OA 3GSUA 4OV5B 3E6EA 3WFDH 1IIHA 3CB8A 5I2IB 3RVTC 3E2HB 4RDYA 3U9UB 4HOXA 4KZDH 1QI3A 3WEXB 2PCFA 3NCFB 2A38A 2IPTL 4LCIH 3I7QA 1ILUA 4P4RA 5IJVA 5I0WA 1QJWA 2YD9A 3FT4A 3IN0A 4E5XB 3UC0H 1EP3A 1MW2A 3P4OA 3HV8A 4LAZA 3MREA 3QAZC 4UIKL 4MGGA 4LF1A 2DDQH 2YAHA 5T1LD 1VJSA 2AVGA 1VLWA 3SB0A 3NIFE 3P67A 3DX3A 3FU8A 3LDBC 2BHFA 4O4YL 3SE4A 4PRWA 3C2SA 3F58H 4OIFA 1TG7A 1RIVH 2XWBB 3FSTA 1XH2A 3I6SA 4WJ5B 1JULA 3RTQD 3FJLA 4NZ1A 2OX5A 4DZ5A 1PXGA 1E6JL 2PTTB 1NMBH 1TPUA 5DXXA 2FZ8A 2QZQA 2ALDA 1HZHL 3HBPA 1DQLL 2G2RA 3HPJB 3QE5A 4M93B 3AYTA 1LO4L 2EIZB 3QFJE 3V4VA 1TZGH 2ABBA 2A6LA 4JFZL 3U7WH 1GGOA 1K5NB 3KEHA 2A5HA 1Q9WA 4DWSA 1CGSL 4C83A 5IIEB 2V6HA 3TTEA 3B9KB 2HG5A 1CGSH 4WKFA 4XWGH 1MLCB 1MHPL 4PP1D 5D5MB 5F7EL 5AW5B 3PJLA 3ZLFA 1AR1D 1J9SA 2EDFA 4LVOC 4QXUL 3SSJA 1M2VB 4H8NA 4MSWB 3SE6A 4MKTA 3QYCA 2WKLA 3DRQB 3QNFA 3WJLA 5LNDA 2ATMA 2ZZ1A 1PG7X 1WO2A 4JN2A 5DCDA 1ZJHA 3W0KA 1RCOB 2D3LA 3SEPA 4MJ4A 4Z1DA 4XVJL 2WZTA 3D4GA 3ALGA 3L3GB 4KO6A 2BOCB 4LUTB 2V7NB 3KHOA 5GGUB 3B3IA 3BPWA 4OTKA 3AXIA 3BH9A 3O2VL 5DVOA 3CUZA 3RLHA 1KCLA 1YPZA 1KTLB 4H8UA 2DI7A 1GYVA 3OIHA 1G7PA 5MENE 3QO0B 3OHXA 3SE3A 6REQB 4LHUG 1RHCA 4MWAB 1NEUA 2R0ZH 4D6HA 4FXGC 3HURA 1AIZA 4WEBL 5CEWA 2VFIA 2CLZB 1G84A 2FMOA 3ARBD 1KIRB 4KJWD 5I1IL 4IKLA 1WICA 3EYVB 4PJXF 3DJTA 4D8OA 3ASOB 5J12B 5EO1B 5L7XH 1XGTA 3F5JA 1WISA 5HXMA 2XC8A 3S35L 5LO7A 3LTSA 1OCWH 5E1HB 1DJQA 1TZIB 3KPNA 4PCYA 4UMCA 2CK0L 4Q32A 5E00B 1KCVL 3WF1A 3OQEA 3UA3A 3N06B 3WAJA 3MODL 2Y7NA 3SRFA 2K6YA 2YZ1A 3RVWD 3CFNA 3E38A 1IEWA 3KP1A 1PUDA 1XLKA 3I6EA 1QDSA 5HVHC 4HAGA 4QMEA 3I6KA 4D2NA 2QDEA 3CASA 4HF5H 3M0KA 3U36B 2WYZA 2WSYA 2YAFA 3QZBA 4HPOL 2R27A 5F6HI 3WK1A 1L3NA 3UPCA 4AEIL 1KXHA 5IEKA 5CLXA 3HHSB 4GRWB 4JIRA 4AX7A 2QHRH 5M5DA 1LWJA 3QWOA 1U8CB 5A69A 5DLMH 4LCVA 3ZTCC 5IMLA 1PZ2A 2D7QA 2EAWA 1NBVH 1P2CA 4AOFA 1H50A 3GSNH 3VAEA 1YDVA 5A6KA 1CENA 1D9KC 3QEQE 3BOXA 2RAGA 3QQ9D 3RUGB 2Q2LA 2A3BA 4HJGB 2VH5H 2D7MA 4YE4H 1I7ZA 3JV5A 2PWVA 5HHMD 1HWHB 4PUMA 1UB3A 2PI6A 3ZDXB 3KD4A 3T4YB 2I60H 3KWSA 3FQXB 3ZTNH 1OCBA 1ZENA 1YHPA 3SUWA 3C2YA 1G01A 3UR8A 5C09D 5M7QA 1ODAA 5CUSL 1JRBA 1T0NB 4KWSA 3TO4A 1KSRA 3FAXA 1ZV9A 1KMGA 3EFFB 2R59A 5FWRA 1CXEA 1GOWA 3M5XA 2BXVA 3ATFA 4HU4A 3DV6A 2R23B 3HPSA 3GNPA 4OIAA 4DPQA 2AEQH 2B9BA 3OKEA 4NP9A 5EBWB 4LYQA 4N0CD 2BTMA 4M1CC 3N15A 1QATA 4DP2X 2PTVA 2WXFA 4GXVL 5D05A 3N2TA 4JPIA 4HKJB 3AM8A 4PB4A 5T1LA 2NY4B 4OFIA 1EQCA 1T7VA 2G8ZA 3A6OA 1W5OA 2AAMA 2ZKHH 4PCNA 3N42B 5A16A 3UADA 4YSTA 1XF4A 1WRFA 2EDEA 3BP4B 4DEUA 1U5VA 2PP0A 2DV0A 3EYPA 4CJ0A 3K1KC 4ZPVB 3FCSB 2E6FA 6XIAA 1OGGA 3VXQB 3QIBB 4K07A 1NIFA 1IBYA 1PLGL 4FLSA 4MBOA 3QHOA 1AMYA 4L2YA 1PY4A 2IH3A 3I6GB 4Z1AA 1LILA 2O9TA 3RX7A 3HF3A 1PWLA 4MMZA 3N2XA 5F2LA 4MZ3A 2R1XA 4JTUA 1TO5A 1T04B 2XXGA 4U6HA 4YSUA 1U21A 1TTUA 1LHZA 4P9ML 4WTZA 4RESB 2DQEH 4WUKH 4OAWA 1QAPA 4DP1X 4N4YB 1A65A 3DJRA 1MCWM 2I25N 2LFEA 3PE9A 3L3JB 2P3ZA 3KPLA 3MYZA 4KTGA 2GFTA 2NUYA 3FSZA 4PJXA 2FDBP 2PS2A 1V77A 2W07A 4DXVA 3OXRB 4JTAA 2YQGA 3CUHA 2A4EA 3V0DA 4OOZA 2OLDA 1ZTXL 2WLZA 3T55A 1K72A 1DQJB 3QHZL 4JAMA 3UTZA 5ABZA 9CGTA 1A9VA 6PTDA 4FR1A 3VFGH 3OGOE 2GSIB 1C8PA 1E1CA 1M7PA 2OTUA 2V81A 2G0LA 3GXFA 3IM1A 1ND0B 2OVLA 4W9KC 3VFOA 4BEIA 3DFPA 5GNZA 2X16A 3QEGH 4FNPA 3FDKA 4UTTC 4P5TC 5FKPA 1EEZB 1XL4A 1V3IA 2ZBTA 2RGSA 3V5HB 5TNVA 5EIIG 1A4BA 4GJJA 1IGML 1RLCL 4E9YA 3GS7A 1YAZA 2CLRB 1L2UA 2NXIA 5CMAB 3KUMA 4NQVB 3WKML 3HZVA 3BGMB 1GYLA 2ZCZA 4BCZA 3B8DA 4LVFA 4PV9B 2MQ0A 4M3PA 2GFBA 3E9UA 4AIXA 1MIMH 3D2UB 4XGZA 1H7XA 1ZPTA 3G1DA 3PAYA 2WHJA 4MLIA 4U1NA 3EOBA 3D8MA 3PQYE 2VFDA 1D7CA 4XP1H 5I75C 3MRNA 4IOSA 5E95B 4R3SA 4HK0A 1XGUA 5FC9A 1AXTL 4ODVH 3NURA 3EO9H 1OG0A 2WTPA 1F11B 3FKUS 1U8LA 2EXSA 2ZOTA 4J4PA 4U0RB 4XP5H 3K3QA 4FHAA 5EYWA 2YGPA 3IPEA 3OZPA 3EYUL 4TN9A 4N5UA 4XN7A 1VERA 1EA9C 2OCCB 4NUWA 4WX2A 3MYJB 4OCRH 2WJZA 3QPYA 1BQKA 1QSVA 3JSSA 4M1DH 4PRIE 5HGHA 1MEIA 1NDWA 1JP5A 3FO0H 3FXYA 4P7QA 3SKJL 1TJIH 1T22B 2C3GA 4RRPA 4F7PA 5C92A 4XOEA 1P6FA 2VDQB 4PJGE 2YC1A 3KH3A 4IBYA 4F0SA 4ANWA 3OR6A 4W7UA 3H9YA 1EVUA 5BRZD 2Z28A 1YEEL 2NXZD 3H8NA 4LOFA 3LZPA 4XX1E 5CHNB 3ALFA 2ZP8A 4EKXA 3G0SA 3LKQA 4MNLA 5EWIH 3RGVD 4CAGA 4NO5A 4BCEA 5HA7A 1IB5A 2YBRA 1T0PB 1BKHA 3VPLA 2O6FA 4Z76B 3GG8A 4ALDA 2ZCGA 4I7ZC 2MPVA 5FDYA 3SOTA 1K4GA 5HR6A 2NLJA 1KJMB 3O3BB 1YMHA 1K9TA 4DN3H 2DQIL 4EI6B 1YTDA 4QQUA 3W1QA 5B7YA 4V1DA 2X70B 2Z8RA 4JFHD 4N24A 2WZPD 4I18A 3WSQL 3HGOA 3FB5B 1RVFH 1TPXB 3K2UH 5DK3A 5C0IB 3WIHL 2QW5A 3G6LA 4AYFB 3APCA 3W75A 3JVGA 5JXED 1QXLA 4N2OA 5DY2A 2BBFA 2OQJB 2ISFA 1U8MA 1BQLL 3HMXA 5CSBA 2A7PA 3ABXA 4A35A 4ZMOA 1S2UA 2PDMA 5FO8A 3LMZA 4H4IA 3BUPA 1SZEA 2XQYA 2VEMA 3PZVA 2H3KA 2J44A 1PGRB 3OG3A 2OMXA 5LB1A 1N3NA 1SN5A 1BJMA 3L68A 1TCRB 3AT0A 3NCYP 3KPOB 5D71H 4LP8A 4UUJA 5DD5L 5DU7A 5EMYA 2C1IA 4OCYL 3EJYC 4PFEA 1JZ5A 1XLHA 3X1GA 3KXFD 1E9IA 2WXDM 1RJLB 4E9WA 4F1ZA 3MRJB 1CK0H 3OJ2C 4JK0D 2CDEA 4XXWC 2IMRA 1E9OA 2PUQT 3CDFA 3DSNA 4YIQA 1I7TB 5DO2C 1F3JA 1J8KA 4OB5H 3KWWA 1F07A 4N86A 5HDLA 1MDAA 1UZ4A 4XI5C 4KS0A 5HHOB 4OBTA 3W37A 4V1YA 5EU9A 5LNWA 3Q8BA 4GI8A 1GGUA 1A8JH 3PZUA 2FRGP 3WNOA 3T3PB 1NKGA 3VTTA 1F41A 1KTCA 1FYTD 2NW2A 3DJ9A 3GK8H 4LSVL 4YHKL 4XVEA 3RCYA 4O1FA 4RGNE 5C97A 4H4NA 4L4OA 3APNA 3GK8L 3KYMB 3CN2A 4GRLA 3BWUC 4YDMA 2NLIA 1RU9H 4HWBA 5C0AE 3U7YL 5F7KC 1WX0A 4HXAL 2VM8A 4RDWA 3R13A 1F02I 1SU5A 4Q8UA 4JKKA 4WWID 1YSOA 4TNVF 5AW1B 1G5GA 4DGYH 2A6NA 4L3EE 4OZ4A 4WK0B 5TPWH 2CESA 4CILA 1N6QL 2ADAA 5F4WA 5FYJD 2H6PB 1XLAA 4KUCD 1EJ6A 4JO1L 4LZKA 3PHOB 3AU2A 2D7TL 4MDOA 2P5WE 4GFIA 4M4RB 3QPQC 4KHTL 3E0FA 3PWJB 25C8L 4MJ6B 4V33A 4AEHL 4IRZA 2P7TB 1JPTL 1ORQB 4HK3J 1TTFA 4JFFB 4PJIA 5JPNB 4H04A 2WYTA 3KVLA 1KN4H 2Y23A 1BAGA 3IGUA 1OABA 4NN7C 1A3RH 2XY1A 4UB0L 2MQCA 1THFD 3RTQC 3VK5A 2EPNA 2O5XH 4UB9A 1S9KC 4JX4A 4J6RL 5I66B 1VHPA 1EGJL 4FQCL 1F4YL 3I7RA 3RX8A 3FT1A 4NIRA 5HUOA 3C09B 2OCFD 4XN5A 5GGSB 2NX1A 3O07A 2ALWA 4J1UB 5LXEA 1KZYA 1E5CA 4QRSB 4AJVA 4HFUH 2FEDC 1AYOA 1N2RB 3NYKA 5I1AA 3FQNB 3VMNA 1R3HB 5I18H 3F5WB 3ATAA 3W39A 3DTXA 3NVTA 4RZ4A 4QAIA 5LIWX 4FG6C 3IGAA 3NIFB 1MFAH 1DDHA 2PP8A 2DQTH 2ZG2A 1LLOA 4IQLA 3SN4A 1VSCA 1G9NC 1UKSA 1ASOA 4NWTH 3KPRA 2VD9A 4AQ1C 2XXFA 3GWJA 3KNBB 1IO4C 3B7YA 5KETA 1BECA 1ZA6A 3CH1A 4FQQA 1N9PA 4XO9A 1DQMH 4PJDF 4V1DE 3FCGA 2GWNA 1A4AA 4NT6A 4Q2ZA 4PS8A 3QUYA 4FG0A 1DQML 4C57C 5BZDB 2R2CA 1V3KA 3BKML 3FHEA 1I8KA 1QOXA 4XCYA 5CPOA 2P49B 3SBPA 4FTVD 4M3HA 1QSFB 2IALB 4CVUA 5B1CA 3L4UA 3HB3C 1A5SA 4A2LA 1JSYA 2KZHA 2QAPA 2XIJA 4Y9AA 3TU9A 5DO8A 3THUA 5EA9A 4ZQKB 4IMKA 3UBFA 3CIAA 4L29B 4F58H 3O4OB 2OZNA 4KJYA 1KR0A 1QPOA 4LUIA 4WO0A 3NIGE 4Y8DC 1K2DA 3M17A 3MZTA 4Y1SA 5EZLA 1NAMH 5INDB 4FD0A 4UMSA 4XHJD 2YLLA 3RDJA 1OALA 3R7RA 4CSZA 2D0HA 4AVFA 4LB3A 2Y5TB 4TSBL 4BWUA 5GGTH 1RA5A 2DUAA 2HQAA 3HTLX 3FU7B 1WTLA 3CVHA 1NANH 5C9JB 1S7RA 4OIIL 2DLTA 4DERA 1KTKE 3BEWA 2AXWA 4EK7A 2M2DA 5I73B 3R19A 4ILSA 3QRGL 1IM3B 4NZTH 4OGAC 1N5AA 1GYAA 3JVGC 5GISH 3RMEA 4QR7A 2D2CC 1NGZA 2JJUA 2NY3B 3TBVB 2JELL 4JTIA 3QR3A 2F5BH 3NTCH 5HP5A 1U8HA 5J9PB 4JPKH 1NWPA 4QHPA 3BZ5A 3FK4A 3EXLA 4TOYL 2DUXA 1Y5WA 1PNCA 3FY1A 3VFPA 4PEKA 5FIPA 2BY3A 4LAQH 4EO5A 2DP3A 5HVGB 3Q2VA 1OVZA 3WN5A 2QR6A 1BX2B 5FHBL 2CHNA 4L1XA 2NW3B 1ZXKA 1MRCH 4HN4A 1I1FB 4PB0H 4Q97A 2L7JA 4NUJA 4HEME 4OZGA 1CFNB 5HJXA 2BVEA 2NCMA 3TH4T 4JTFA 3UTOA 1FLRH 4C4KO 3U4FA 4PS4L 1BVZA 3N40P 1VPQA 2C26A 3MRBB 2QSQA 1PV8A 3MGOB 2QEZA 3LQAH 1HTYA 3LB6D 3PIQA 4J2PA 2X9XA 4A7TA 5L4JA 3CZ8A 2RFXA 2DYPD 2PPGA 2GSGB 4CGUB 1X7QA 1YEGL 5LBVA 4AQOA 1QP1A 3WF4A 3L7EB 2L8AA 5KANG 3BQVA 2NX5D 1GC1L 1S9VB 5D7SL 1QRKA 1OLZA 5K9KA 2H2SC 3O0RH 3K6SA 1MJ7L 4L6OA 3JWOH 2CZDA 3KDMB 2VE6A 3WS6C 4F2MA 2J6EH 3NEEA 1LEIA 5HHPB 1AMXA 1ZTXE 1D2KA 4LSSL 3R5EA 5D1ZB 5F3BA 1JGMA 5C6MA 2SEBB 2VR6A 3L66A 3H6JA 3V4LA 3D39B 3TPKA 2QDHA 4KKCD 3UTPE 2LFGA 4WWKB 2DJMA 3FSWA 4LO9A 1QFOA 3ARXA 3ZDZF 4O58L 4JDZB 5I1KH 1F3TA 3LZNA 3CAWA 2ZPKH 3WQPA 2NDFA 1R24B 3C75A 2PC8A 2NTSP 4M1GL 4D8AA 3GHEL 5I77A 1JCJA 4JO3H 5AKVA 3VQ2C 4JJ5B 3X1FA 1AODA 1R3WA 5TE4H 2ZA3A 4PFHA 7REQA 4OKDA 1PVNA 2YQBA 3FONA 2EDWA 2DV6A 5CFAA 5FESA 4EDWH 4R5EA 5DR5H 1W3JA 2GQAA 3ABRA 1V6TA 3RZCA 2YCEA 3T6WA 1P7KA 4IRJA 4RISL 2AEPL 4DQOL 5BUGA 3FT2B 3LGEA 1XPGA 1XGQA 2VELA 2X0HA 3H54A 5D6CA 3BZ4A 3L5JA 4N25A 5KJ4A 4OZIA 4NRSA 3LN5A 1FG2A 3THQA 4JZNA 5DHMC 3LS5H 5AVQB 3S46A 1ROCA 3C5ZB 1LJYA 2JGQA 4J3XA 1CD9B 3HNSH 3V4UL 3VVVA 3UC0L 1ZCOA 2I5GA 4MWAD 5BW7A 2BZCA 2X7VA 2WLIB 4L0PB 4MJ5B 2E0PA 1C7SA 1NGXB 4PD4K 4RMTA 1C08B 4X0KB 2DICA 1EXGA 4PCTA 4JZJA 4D0DB 3FA3A 1J1PH 4UDTB 4XVOA 4YHYC 3OKLB 3I9AA 1H0DB 3IN2A 3L9RA 4JO4H 4WFHD 4Z95H 5MEOA 3GIPA 1EJ7L 4Y8FA 3VXUE 4G7FA 1EBGA 4OLYH 3GGWB 4NM4H 4R7LA 3DFSA 3T07A 1XS2A 4CGTA 2A1WL 2ITFA 1PS9A 4PJCB 2W6RA 4U5KA 2Z1WA 3DX4A 3JTSA 3AQUA 4Y8EA 1K3IA 3RKPA 3LQZA 3K8LA 4XCFH 4W93A 3ZOAA 1L9WA 4MF4A 4IGBA 3VNDA 1BZEA 4QBXA 1GGYA 3SQOH 5FYJU 3UEZA 5FYLD 4P8XA 1T5KA 4KZEH 4JS7A 3Q9PA 4FQPA 3VRJB 3EXTA 1ZLSL 2J88H 4BK5A 4UTLA 1KGCD 2CQVA 3M8OH 3QORB 2PDGA 3W6MA 4BQ5A 4UTHA 1H41A 2B8OT 5XINA 1QRNB 3QI9A 4KK5D 1G0XA 4N6RB 4JIIX 4OZGF 4RKAA 1KRCC 1NC2A 2HFEB 1CT8B 3HC2A 3LERA 3W74A 1U8OB 2OBGA 3GXUB 2YA0A 3VFLA 3QR0A 2UXFA 3CJPA 3DI3B 2COQA 5JYMA 2AV7A 3B83A 4MYAA 5AOUA 4PMNA 4GI6A 1O6VA 1SMAA 1YMMA 2DF3A 1SJXA 2CRYA 3O3RA 3UTTB 3VW3H 3QGAC 3WENA 4PJ9C 3ARGA 3RWEA 4LRNL 3D3AA 2PW1B 4FFYA 3GI9L 2WP3T 4OZFB 3SGKA 1UZ8A 2LTQB 2OMZA 2QVMA 3EUDA 1DIEA 4B5XA 3W7OA 2N59A 2FYYB 3CVHH 2V8LA 5F7NC 2EVJA 1KRAC 2B7NA 2IVFC 2IFFH 4XBMA 3TA3A 4XHJC 3UYOD 3O2DL 1E50A 2QPFA 2Z35B 3CVHL 3IDGB 4JXCA 3CIXA 2R29A 1NKOA 4EN3D 4HJIA 1Q90A 1NOUA 1TJRA 1CICA 2IQ9H 3VO0A 1I9IH 1MNNA 1VP5A 1DVFD 2GUBA 1E9LA 1CB4A 2YBVA 2WB1A 3TNBA 1TV4A 3CBWA 4M4PA 4PJEB 1T83C 2W66A 3NJIA 4Q9BA 1NMBL 1NSNL 2K45A 3A4DA 4KK9C 2ACUA 2C1GA 4FNQA 4DP9X 3QHNA 2QVNA 1Z44A 1NWOA 3BW9B 4PTDA 3ZKQD 4HIXH 5HANA 3HE6A 1WFTA 2K7PA 5I18L 1MCSA 3RPIA 5ICZB 2RDUA 4A3QA 2QKIC 4TLTA 1XLGA 5AG8A 1VFFA 4XZIA 2KBGA 1JNDA 4GRLD 2IXVA 4QEEA 5DZOA 4MZYA 4KKXA 3DMMD 1DWGM 1PKNA 4KBXA 4QTFA 1FFOA 3DENA 4W7WA 3SADA 2XPZA 1A0QH 2HK0A 3MQTA 1FIGH 5CC7A 3PBYA 1UZ6F 5HD8D 2GOUA 1YN7B 2PTDA 1EKOA 3ZJKA 4X9IA 3I3DA 3G6JE 3ZE2B 5D9OA 1AAJA 2D4DA 1NLBL 3PABA 4HUUB 4CU7A 1A6ZB 3BVWA 3T2PA 1TE6A 4RNRB 1DQDL 1TJ1A 1GCFA 3V8OA 3P9MB 2BXZA 5I1LB 1NU5A 4XN4A 1AZVA 2Y5EA 3O6FC 3E3QC 3RB7A 4XBEH 1D5BB 4J12A 3HE6D 2PDJA 1HSAA 3PG2A 1FHGA 5SWZA 3DO7B 4IBTA 4XVSL 4RX0A 3NJHA 5IB3B 4YAQA 4Y5YC 5HNNA 1E0VA 3CO8A 4DYJA 1D5MB 2F1BA 4HHAB 5E24E 1NC4B 1GQNA 2A9CA 3BGFC 2XJLA 5FA3B 4MQTB 2X6CA 3A47A 4YHIB 4IEFB 1VKXB 2FTYA 2AEOA 4OLVL 1EEYB 1MFDH 1WK0A 4NQEA 1JVNA 1DVSA 2PYEE 1XMWA 3WJLC 4UZSA 9RUBA 4IH3A 3B8YA 5I6PA 1AL8A 3NVDA 2ESCA 4DIAA 3CFIC 1Z9SB 3GJEA 1ETZA 1OW0C 4Q58C 4GBXD 3RWHA 5E6RB 4YFLF 2G97A 4D3CL 4PJDB 5HMFA 3D85A 1KENH 2Z1SA 3DHUA 1HNGA 1H2JA 5ABAA 3UWWA 1S3TC 4NP4L 4QRRE 4A39A 1NMCC 2X1SA 1KFGA 2YQ2A 3P73B 3NIFF 4JGMA 5XIMA 1XX1A 3S8HA 4L9LA 2YYTA 3MDUA 4U7KA 3UOAB 1XR9B 1XF5A 1WIUA 3ARDB 3FRPB 4HWBH 5LAXB 1AJZA 3R25A 4PJHF 4XO6A 3TJXA 3KLLA 1HOCA 2ICES 2X1OA 3ELQA 4PR4A 5E2TH 2QQQA 1LEKB 4X5XB 4MNHA 1QPRA 5JDSB 3QJSB 4M7KL 2D73A 3UZJA 5GSVA 4FYSA 1VCGA 2EILB 2Y2YA 5T9BG 1OZUA 5IMOA 3LIZL 3CFDB 4MWAC 3ULUD 4K3EL 4ANUA 1OF0A 1WGVA 3OJDA 3EHBB 3RGVC 1P1XA 4R88A 3ZDYB 1W31A 5DD3H 5FKAA 3QV7A 3ZIYA 2BMKA 3K2GA 1GGBL 4G9FE 5LHFA 3MNZA 3RDTA 1JPSL 3SD2A 2ASHA 3FYIB 2VZOA 2H0PA 3C60A 4NN6C 3WHXB 1GC1H 3BAKA 2J27A 3ZYJA 3MO4A 5L88H 5K9QG 2A99A 4A6GA 1QWUA 3APTA 1H3UA 3HC3L 5EF3A 3AWEA 2ZX6A 5IBLC 4RXGA 4X7FC 2BC4B 1TQUA 1NBYB 5CJXA 4AI7A 2CMRH 3HMXH 5FB8A 2YGOA 1IM9A 3UGVA 1UOWA 3L4CA 4FXKA 5ERWA 3MKCA 2OSYA 5E5UB 5AALA 1T8QA 2XPKA 1D5ZB 3EDEA 1FTXA 4PV1C 3NOYA 4NHUA 3UBXA 4JN1H 3IPWA 2XYCA 3MOAL 1NOWA 2PXYC 2PWEA 4QWWC 1OZQA 4XMKL 1SJEB 3H9HA 3WTVA 3OF6D 3WQ4A 2X1WL 3T65B 4A7SA 4FL4C 3BZEA 4NJKA 4Z08A 4C5YA 1F4XH 3DTDA 1MNZA 2DQCL 3EYOB 3QDGE 2ZZ6A 1KNWA 1U83A 1UYWL 5JXAH 2GIMA 1JDDA 3S8WA 3TJ4A 3ESMA 3MT1A 3E0LA 3VG9C 3NAAL 4LLWB 1NANI 5E1IA 4L4TB 1UWGL 3TBTB 4K3GA 4AY1A 3EYUH 4DEFA 1DXFA 4DGYL 3QC5X 1MY5A 1C5BL 1KBVA 5B39B 4JG9A 2VGGA 4IRSC 3ZE1B 4F9PC 4FO4A 4BGLA 5ECVA 3SGZA 3U4BH 3WKNA 4QYOA 1T0OA 4Y16A 5FJPA 1UJQA 3QUHA 5G5DB 4GUJA 3H2FA 3ORJA 1LYQA 1P7BA 1FZKB 4D7BA 4DKFL 4KRUA 2CO6A 3QUZC 4EBQL 1H3VA 2H9AB 5DURB 2FTPA 3KW7A 1EHAA 5LG1A 3VRIB 2Y06L 3VXTA 4HVBA 3WEBA 3QR2A 5DJDB 3TLQA 4HA1A 1FZJA 4LLDB 4LPTA 1H0GA 3MANA 1XXDC 1I60A 3BIKB 1EIBA 1EGJH 3QEGL 5D30A 4EIUA 1PVHA 1G6VK 2CZ5A 4FLOA 3SFWA 3EJZC 4W89A 3ES6A 3XINA 2ZONA 5FHAL 2EIKB 4N6EA 1IGIH 3EO0A 2V4LA 3F4VA 1SDYA 4NERA 1XFCA 2VX4A 1HNYA 1N55A 1NDYA 1NH6A 2VC5A 5HI3D 3C6LC 5DD6B 4HUKB 2LT9A 3L4WA 4JX5A 4UFJA 2XWRA 5IHSA 1PY9A 4Z7UB 2J74A 3MRKA 3MOQA 3HAEB 2E4FA 4HIBA 3WKQA 4QLWA 1MKFA 3WTTA 1FGNL 2DZPA 1OCOB 4GPVA 1WTGT 2E75C 3O3AB 3VA2C 3TV3L 3N6QA 1JF5A 4YU1A 3WEZA 1TIUA 2X42A 5CEXA 1W9BM 3L3OC 2XVPA 3GNXA 3MNVA 3N9KA 1IBGL 2WWNA 3KS0J 4HKXB 4RE0A 3W7IA 3QCTH 4LNVA 2W5PA 2XA8H 3NCCB 1RK6A 5CJMA 4ZMQA 2XYLA 4P5TB 1TQSA 2C4FU 2IV8A 2OX4A 2EUXA 3KTCA 3VFVA 3FOLB 5T9CE 1YX1A 4YSRA 3TCSA 4NI6A 1IC5H 4P23D 3CTTA 3V6ZB 4JRYB 1PB0A 4KEZA 4Y4FA 3L21A 3T9PA 1M65A 4GISA 1DQIA 5CF3A 5KG9A 3N73A 4DZAA 2A0LC 2Z31C 3LXAA 3OC8A 4UNUA 4W9GC 5GRJH 4E41A 1N6VA 4DCQB 5IKCA 2QCNA 4AF0A 5KITA 1B3VA 2X89D 2X89A 2ZOOA 1KYDA 3OHMB 5MP6H 4YSAA 4PY7B 3QHMA 5GHWL 1DCLA 1TENA 2DWXA 1FAIH 3WL9A 1Q6DA 4OZGE 2VC7A 3L5WA 1CF8H 5CEZD 4EPBC 1KPVA 2DD8L 1SXZA 4ZW6A 2BP5M 1CJYA 4AGOA 1GHRA 1HGYA 2UZXB 2Q3AA 4YVUA 3N44B 5AOIA 1B4TA 2VXTH 5E2WL 1SYSA 1OPOA 1F3DH 1KIQB 3USZA 3OKOB 3LNGA 2AQQA 1XG3A 1FDYA 2PDLA 3GAKA 1ZT7B 4P59H 4ZTOL 4YXHL 2VCAA 2J4WL 1JUFA 1BZDA 1B4RA 4LQFL 3QG7H 5KAQG 4F2ME 5FCSH 4MA1B 4WW1A 4ZFOB 1EPFA 4AENA 1KCZA 4FXRA 3KGUA 4ETYA 3RKDC 2BW4A 3ARYA 3B8VA 1AD0A 4MNMA 2H6RA 1Y6KR 4B9FA 5HBFA 1QUPA 3MCMA 3P9LB 2V5LA 4QXIA 3CK5A 4MZ1A 1F4YH 2Z1KA 1IGFH 4PS4H 3UG3A 4JQ3A 3E2SA 4RIRB 1L0XA 5DHVA 4OTXH 4Z77B 4MMXB 3NQBA 3NFNB 2HJFA 4X60A 3S5LG 4X61A 1P5BA 2BX5A 3KVJA 4KRPB 3P0VH 1E4WH 1NGYB 2P5NA 2Z7WA 3PHAA 4LK4A 4ABUA 1TQVA 4EI5A 2QKFA 4IMLB 2AJ3A 1KC5H 4D72A 1Y5VA 2AQVA 4HYRA 5CINH 4GEIA 3MUAA 3KW3A 5KVDH 4ABQA 5A8MA 1EDQA 3JWDC 1B9BA 3I4EA 3WBDA 1YY8B 4LVOB 3BP6B 4PRDA 5B1AB 5I19H 2PDWA 3T8MA 5BS0E 3NEXA 1TQBB 2UY6A 3F00A 3VXUB 4DOHE 4HWNA 3N42F 5KVEL 4LHUD 4LHUA 5I0DA 3I3EA 4GBXB 1ZFJA 5JBEA 3IETA 1HILB 3KWUA 3WCYA 2E5CA 2YYUA 2NV9A 2E09A 4DWSD 3UZQB 3T0EB 1Q8JA 5EOCL 2R69H 4P5RA 3JUGA 1OGSA 3ARBB 3ZDYE 1NP2A 2UYLA 3OAUH 1A9BB 2VISB 1L6XA 3TM6A 4TUKH 4DP7X 3I6LD 1RURL 2DB8A 3ARBC 1V6VA 3IUIA 4K38A 4MYPA 3PBVA 4X5PA 3C5SB 2OL3L 1K6AA 3TN3A 2CNZA 4P46B 4P4KA 1H6TA 4W9FC 3GG1A 4HC1H 1DP0A 2PLKA 5EBAA 1J2BA 4NOBA 5D1XC 3PZGA 2FX7H 4NSKA 5KVEE 3TH2T 4NCC2 4ML4A 4N2AA 2NX9A 2BNRD 4GO8A 4XNZC 3F1QA 1F5ZA 1B4EA 4RSYA 4M7LH 3W1ZA 2VDIA 5HI4C 1L4IA 3M41A 3UEQA 3DRTA 1WFUA 1CBVH 1LWIA 1NL0L 1TNNA 2K6ZA 4XMLH 2ICEC 1IAOA 4TM9A 4LUSB 3W28A 2VL5B 3CCHA 4YDVB 3X12A 2JIEA 1WE5A 2YO3A 4GAGL 1C5CH 1SLXA 4GW4B 4PGDB 3D4CA 4HXBL 4E9LA 5E94B 3U0WH 3UPRB 5I0YA 5J1AB 3SCPA 1G7IB 2BWDA 1E3XA 3CXFA 4C56D 1J5CA 4MY1A 1FWEC 1YJDL 4DVRL 2E1DA 4IOTA 1GPOL 1JAEA 4HG4J 2OJZH 1OSYA 4XPHH 3W5MA 1ADQA 4G42A 4NZ8A 1EJSC 4HUXB 4M8QB 5KBNC 4PJEE 4Y9MA 3IWVA 3WQOA 3LAFA 1WXJA 4X4XB 1JGUL 3RWJB 1ZWIB 3KPMB 1XIGA 1M1XB 1BEXA 3ABQA 5CC3A 3NZUA 3FO1A 3VQ1C 5KS9A 4F0HA 1O7VA 2R4SH 3CN4A 4R83A 2O7SA 5TQ0L 1XTLA 5I71B 2GGEA 4NX5A 1WC7B 3OAZH 2R1YA 5IJBC 5DMJB 3TBCA 3VNJA 3OWRA 1U93B 3IT8D 1E7UA 2VLRA 4HCIA 3L12A 3NEHA 4ZW8A 4N28A 4PREB 4U6VH 4MDJA 1AQFA 3IU3A 1T1WB 1I8AA 2YEQA 3FH7A 2R1PA 5D5ME 1AXSA 3SCMD 4AJWA 3JTBA 4EI5C 4YUEH 1IBFA 3IDJB 5CBAB 3Q8EA 5JTWA 1DJNA 1YDOA 4LKCB 3DI0A 4QM1A 1CECA 3MFFA 4WNQB 1FP8A 4U3SA 5IT2L 2R8SH 5I78A 1DVYA 3O41A 1NDMA 1ZV2A 1AO7B 3G6JB 3QNZB 2QJJA 4ONHA 4Z0JA 2IF7A 4YFDB 1VRDA 1W72A 3RYSA 1X39A 1P5VA 3H9SA 1H3XA 3EH4B 4OCXL 2FT7A 1JIBA 2NY4C 4P57B 4JREC 4GYBA 4CC4C 2FUTA 4AQ1B 3WNIA 3WD0A 2I17A 2DZTA 3GTHA 2LU4A 5C6WH 3IEBA 3HR5B 2NUPB 1U1JA 3ARTA 4IP5A 1B1YA 3ISRA 5BMFH 5DRXB 3D2UD 2ROXA 5E99H 1UVQA 2E46A 1J6OA 2ZOLB 4MWAE 2VDQL 1BOYA 2ENSA 4KITB 1U33A 1WAPA 2XVKA 3MRCA 4RRPG 3KP0A 4FOKA 5E2UL 2Z65C 2VR3A 5C0ND 3UWEA 4XNYL 1TO3A 4X6BB 4Y9FA 1IEBA 5C0AA 2G9HA 1BLIA 5KSBE 1PKQB 2WMKA 1EWEA 5F7FA 1A1NA 3AAMA 1MFBL 1OTUD 3AROA 2ZD0A 4JHVA 5DRCA 3QIUC 1P4LA 2JQAA 2OMYA 5GS2D 4P99A 3ZL4L 4KWOA 1A3ZA 1MCOH 2JXMB 4IRZL 4MXQD 4INFA 4QE1A 3DOSA 4DZIA 3KPSE 4QHNA 5F2GA 3ECUA 4WTQA 3RGTA 4AUYA 4ADIA 1ICQA 1JNHA 1HHHB 5IB4A 5D7JA 1GT8A 3RURA 1XW8A 4BJHA 5FYKE 1JZFA 4UZGA 4F80A 2EC9T 2YD1A 4P5KB 4PJ8B 2OB3A 1TVPA 3CAFA 3OKYA 4YGVA 3NYZA 3TMQA 2EE3A 1E27B 3BN9C 2BG5A 3W3OA 4DZHA 9XIMA 1V0LA 4N0UA 2PCYA 4L80A 4HIJB 3LENA 1MQKH 2CO7A 1J1OH 2DMCA 1P1ZB 3UCDA 4CEXC 3X1BA 1DQDH 4LLYB 5D2LB 5HWJA 3WQFA 5EUOA 1Z9MA 2EDNA 2HVBA 5I09A 3BSMA 2YW3A 4BH7A 1XP3A 3ANVA 1JVOA 1W0WA 1XL9A 3MGAA 5SWQA 2F61A 2Q6WB 1GGCL 3RUGE 5KJRL 4YZFF 2YOAA 4JNXA 4ZK8A 1HEJC 1F18A 2V5BA 3GMPB 4J3WA 1COBA 1NCTA 1Z3GH 1UH2A 3MA7B 4ODSH 5AVXB 3ENLA 3M43A 4DM1A 4CW1A 4ZNEE 2X1RA 3QLDA 2YD4A 3IIVA 3AQXA 4NI3A 1NBZB 3LCGA 4YHGA 4DBDA 4YL9A 4DNHA 3MREB 4JVPA 4NJAH 4WW2C 1UR1A 3MVTA 1IQDA 3EDKA 5DLLA 2PLCA 1HSBB 3J27A 3M07A 4YDNA 3TL5A 3TQPA 2QUVA 3EHBC 3NCMA 3WFDL 2EVIA 3EJSA 4UU9A 1BWWA 4PVBA 2HB0A 3I74A 2V38A 1FWDC 1V5XA 4N1EA 1Z66A 2AJYL 2JNZA 5L2KA 2PDQA 3CFCH 3CMFA 4MHBA 1IBDA 3COOA 3VACA 3D34A 4YXGA 1JPFB 1MEWA 3PTDA 5B38A 2V5MA 2FVNA 3IJHA 1ES0A 1GXEA 4HH9B 3QJFA 4BKLA 4F33A 3WUFA 4NPYB 3SDAD 5HVHB 1GQKA 1JHTA 1IC7L 2X5PA 4IJ3B 5DUBA 3Q7JA 4HISA 3GHTA 2CWNA 2D2GA 3GU1A 3DFYA 5HJLA 3SCTA 2BY0A 4Y0GA 3K4WA 4K8RH 1IKFL 5J04A 4EXKA 3FFCD 4AUUA 3LI0A 4YSEA 2DPKA 1KLGB 1I3GL 4JPVL 4M7JL 1YUKB 3KLDA 4OIBA 5D93B 3V0JA 2GVJA 2UV8G 4V1XA 3RWIA 4Y9NA 3REWB 1VFTA 4HZ6A 3RCMA 3T3PE 5SWSE 4MCZA 3WMQA 3QV8A 1GTFA 3IVKB 1ZHNB 4Q22A 4HT1H 1RIHL 4RVBA 2DWDA 1TA3A 1WDDA 3L3GA 4PTWA 3N1GC 3WQWA 2J8OA 5BUPA 4ZSOB 2K6WA 4NKOB 3MKKA 3OPUA 1A53A 5LIYX 4FNLL 3E6FA 3TT3H 3GVGA 4JZ5A 3GLEA 4PSPA 4XAZA 3TSBA 1Z5LB 3AREA 1WF5A 3EFOB 4YXKH 5EMKA 2Z1XA 3T8VA 1TQJA 4L3EB 4XPAL 3LBMA 4EJ1C 4X4ZA 5IG7B 5KSAC 2W4XA 3SCNA 4C6IA 2AK1H 3D4YA 3L9EA 3OKKA 4XXDB 1RY8A 3L4VA 1TJ0A 3IARA 4KHXL 4KX9A 1NP0A 3LHWA 2J8TA 3N0PB 3M5ZA 4JR5A 4JJHA 5JNYA 1KD0A 1VF8A 4DYKA 4ENEC 3GINA 4JFFE 1OGBA 4MNGE 2ADGB 4EE9A 2XZAH 3BVVA 3OKNB 4M9OA 3SQMA 3O2WL 2QCEA 2JV6A 4ECLA 5D9SB 4HGXA 2J57A 3FFOA 2IH8A 2Y4SA 5D70H 2WHKA 3C0SA 4YDIL 2W60A 1OEPA 4FQ1L 5IOBA 4M61B 5FACA 3TLLA 5SV3A 4PJ8D 5IUCA 3NCWA 1HEHC 3UTSB 2XBTA 1JE6A 3QJRB 1R75A 2B16A 3ZSTA 3PWPB 3RIAK 5DZ9A 3PUDA 1NUFA 5IEKB 2QFRA 3B8WA 3GDLA 4X8JB 3LXBA 1TR7A 4UOQA 5ANME 2ZKYA 4DTGL 5KS9E 3Q8FA 2F84A 2UY4A 4Y5XA 3WMBA 3TN0B 1YMYA 5K4ZA 1F73A 2M8XA 2O5XL 3RGVA 3BGAA 2C9RA 4J6RH 3DBXA 3QNXA 4LSUH 3JS3A 4P3CH 3TIDB 2XJ7A 3NO3A 2TPSA 4G8IB 4G82A 4TL5A 4AMWA 4ALAL 2WD0A 3ARPA 2QTEA 4M6NH 5IVXA 3SUVA 1NDGA 2CBPA 2JLPA 3ESNA 5HY9B 3DKLA 3EB2A 2HTLC 3PLYA 1H8OA 2VN5A 3MU3A 2EZ0D 4LBAA 2YUXA 3O9NA 4BQ8A 5JPMB 3MMUA 4L4PA 4XV0A 3NPSC 2VL4A 1FGVL 1PX8A 3FQXA 1FH7A 4LL9A 4DP8X 3JZUA 4GVFA 3PDDA 5LIKX 1W1VA 3KGTA 2Z4GA 2EKJA 4Q4SA 1UBSA 2FZ3A 2F5AH 1HH6A 4XMWA 1MRFH 5FJJA 3CK0L 1A7BA 4RXFA 5LXGH 1GORA 5EBWA 4GXPA 4KDTA 4U2ZA 7FABL 1X7SA 2HAZA 5F1NA 3WYRA 4BH8A 2VDGA 4Z7QB 3QW4B 5IJCC 3EGSB 3TA4D 2BH0A 5MERA 4URKA 2QGBA 2HVKA 3UJIL 4DK3A 1NDVA 4FFWD 2O92A 3VFCA 2X40A 3OGCB 2DSWA 3LHVA 1RP8A 4M81A 6XIMA 1JTTA 1QCWA 1JRHL 1JI1A 3QDMA 4P3DB 4R4FL 1GVQA 2PRLA 1NAML 1DXIA 3BZFA 1RCYA 2P80A 5KTEL 3AOFA 4POUB 1ZHBB 4HETA 5DJCB 1X5YA 5SWSA 1A1OA 1U4EA 3TH6A 1JK9A 3GHBH 3NJMA 8CGTA 4LAMA 4DI9A 5IBTH 3W7NA 3CD4A 2DEXX 2O72A 2A6KB 3FB8B 4CKQA 4YTQA 1CURA 3ATBA 1OD7A 2Z24A 1MFDL 2A6DB 4AYBA 5F1UA 2P10A 4U6HB 1S5TA 1BMWA 3Q58A 2BRRH 3PGCA 1WBZB 3P0YL 1FWIC 5CIPH 2TSAA 3C0JA 4GG9A 4IJBA 4Z3EA 2B4CL 5F3HA 4L48A 5J12C 3P2BA 3WMSA 4S1SL 1XV8A 1UB6A 4U1JA 3R0DA 3NIYA 4I1RA 1MQPA 4LYPA 1CLXA 4G56A 3VKCA 3CV5A 4UTAA 2ICWA 4U1KA 1PZBA 4DGIH 1X9RA 2LR4A 4AQ8A 2E3VA 3N1QC 3ULUE 3QZNA 2XINA 3IVSA 2F74A 1ZD6A 4W9TA 4RNHA 2AI0L 4KI5C 4CVXB 2BNRB 3SO5A 1XH1A 1FL3A 4BWLC 3RPKA 1NIUA 3SYPA 1LVEA 4XPBH 3VSVA 3FTGA 1IAIM 4WI7A 4QLJA 3QPEA 4Y5YB 4DZBA 1HCYA 3G08B 3T0EE 1VYRA 2GJLA 3WI9A 3EA1A 4JM4L 5CILL 5AYIA 2ZX7A 1JWUB 1T03L 4LCQA 4WWOA 3IE4A 3WKZA 1XRSA 3LQGA 2POZA 1DEEA 3UP6A 4YH6A 1UD4A 3D2TA 3RFZC 1TEGA 3U4EA 1CD0A 3MFGB 4QDGA 4NILA 1ASPA 4R0LB 1ELSA 2ED9A 3ALWA 3GXMA 2H4EA 1RPQA 1NOFA 4FG4A 4W86A 3ZDZE 2WIIA 4PJ9A 4APQA 2GYSA 1ZAHA 5DJXB 3HFTA 1PIFA 1XQLA 3SKNB 4IGSA 3CXHJ 4UNLA 1WS8A 1DQXA 4MIMA 3SI9A 3Q2WA 2Y7DA 4GY4A 5CPTA 1A6TB 4IIGA 4C6NA 4PH6A 5FFLA 1K8DA 3MYJA 2DZWA 2E5BA 1P0EA 3II2A 3EA3A 1A6UH 3UVAA 3U1SL 4JY5L 1XLCA 1UBPC 4C90A 3A4EA 2PYFB 1T20A 1CTMA 2E4TA 3CSPA 4LCWD 2Z7YA 1MCLA 2K7QA 3QI9C 5DEJA 2YC1B 4YHZL 5HYSB 2LAAA 1W16A 2A9BA 4YR6A 3TCEA 6TIMA 5AD0A 3MBED 1OCNA 4NS0A 4YXLL 3VOFA 2BASA 4FMFA 3RPTA 5IK3A 5JOFA 3VD9A 3GI8L 5HGBA 3LKQB 1ANUA 2JK2A 2VKXA 1URIA 2FX9L 3VFSA 1AW2A 4I5XA 4K8EA 1IVTA 4NAEA 4WUIA 4G8FB 4AEFA 5D8WA 1UWXH 4PJHA 3IJ8A 1MVUA 4MJIB 4KEUA 2I27N 1TITA 5IROD 4JMXA 1TMHA 4U3HA 1QUNB 3H55A 2VZUA 2DDQL