1KTKE

Complex of streptococcal pyrogenic enterotoxin c (spec) with a human t cell receptor beta chain (vbeta2.1)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
247
structure length
247
Chain Sequence
GAVVSQHPSRVIAKSGTSVKIECRSLDFQATTMFWYRQFPKQSLMLMATSAEGSKATYEQGVEKDKFLINHASLTLSTLTVTSAHPEDSSFYICSALAGSGSSTDTQYFGPGTRLTVLEDLKNFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exotoxin type C
publication title Structures of two streptococcal superantigens bound to TCR beta chains reveal diversity in the architecture of T cell signaling complexes.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Immune system
total genus 20
structure length 247
sequence length 247
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ktkE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ktkE02
4IEFB 4P46A 2VLKD 3RX7A 1NDGA 1KF9B 4C54A 3IKCA 1E6JL 2WM0A 4Y89A 1C5BH 4YHKL 3FN0H 3MCKA 4JM2F 3TIDA 5HDBF 1CVSC 2IADB 1KEGH 1MUJB 3BWAB 1TVBA 3BD4A 4YXKL 3QFJE 1FZJB 3SPVA 1F3JA 3N1MC 4N0FB 3G6DH 3KVQA 3PWJA 4PRPE 5LXGH 3DO7B 3SDXE 4KKCC 1FYTA 1NAML 3IRZA 4KQ4L 1BQHA 1WIOA 3QPQC 2VDOL 5HY9A 4R96B 4XNMB 1LD9B 3BFOA 4H88L 1MI5E 3DVNA 1J88A 4ZAKC 4GBXD 3AS3A 3MLVH 4R4BB 1DTUA 3TBVB 1IFHL 5D6CA 1ZT7A 3GHEH 4QXGL 5B8CB 2AJVL 2VZTA 3EYQC 3KR3H 5DJ0B 1H3PH 3VE0A 5MEOB 1OGAA 2LABA 1I1YA 1UWEH 1A6TB 1U58B 3KYMB 5IIEB 1WEJH 3NMEA 4HULB 5FHBH 1JNHB 3SOBL 4G6KL 4MZ3A 3VH8G 1YQ2A 3HC4L 5IOPA 3VFNA 4LSTL 1AHWB 2R2EB 3AY4A 3WUWA 5IG7A 5DD0H 4YIQA 3EZJB 1XCQA 2FJGB 3X13B 4OT1L 1SEQH 1W8OA 5BOZG 2ZUQC 1HILB 3IDYC 1NBQA 3CMOL 3IJYB 5ACZB 3RVUC 1PG7W 2V5MA 1CF8H 5EBMB 3OPZL 3D0LB 4RWHA 4XAWH 2AK4B 2ESVD 3P40A 4HKBB 5DUBB 1LDPL 4LRNL 5LGJB 3DOSA 4TNWK 3HR5B 5EBGA 3MOQA 5IMLA 2P8MA 4IOFC 4XAKD 5CBEA 4F3FA 4XVUC 3UYRH 4Q6IA 4D9QE 4TUOA 4PJ8B 3QJFB 2IPKB 5FA3A 3MV8A 5CZXC 4X6DF 3G6JF 1DE4A 1QSFA 3DX8B 1X5XA 4OD3H 1V7MH 1YUHB 4QRSB 4JZJC 4BQBA 1QNZH 3AC0A 2X2YA 5C2BH 4KDVA 4YDVA 3HCVB 4YPGA 5IMMB 1FSKC 4JZNB 2CKNA 3FQXB 4M8QA 1XT5A 1DQLL 4DUXA 1QO3B 5BJTA 4G6MH 3U9PL 3HUJE 4WHCA 4RFOH 2BY2A 4OCYL 5DUPH 3KYKL 4CUCA 2BNQE 4M48H 3AS0A 1EFQA 3LRSB 3L9RA 4OZGE 1SMOA 1JWUB 1BFVH 1I8KA 2DICA 4JVPA 3HFMH 4CJ0A 1T5XA 5INCA 4S1QH 4I3RH 5IGXH 2YC1B 4PRHE 2IGFL 4NNXB 5CD3A 5HI4C 1AIFA 4JFDB 1K8DA 3REVA 4Y7MA 5D96B 4Z7UF 5C0NC 1B2WH 1ZHLB 2EC9T 4KMTL 3S3JA 4YHMH 2R1YA 5FUZH 4FQQA 1T0PB 3GFUA 4OCSH 1J1OH 1KIRA 2C3XA 1CYGA 1XF4B 3E1F1 3LKNA 3ROOB 3LHPH 5TJWK 4PIRF 1L4IA 3C5ZD 1TJHL 1Z0NA 2EKJA 3I2CH 3UTPD 2MSPA 5LAXA 4I8DA 3VWJC 4EVNB 4YDJB 4YHNB 1HH9B 4XTRC 2FATL 3IDNA 1IC1A 4YBLB 3T0XA 3T04D 2AI0H 3INUH 4NQXA 1FN4B 1HQ4B 5C0BA 3U46B 3RI5F 2E27H 3WNLA 1N6QL 4NIKB 5MERB 4P23C 5KSAC 4ZFGH 3MRHB 3SJVB 4OLWH 1ZWIB 3EYSH 1SM3L 3D39B 4U1HB 3I9GL 4LASH 1A9EB 1RK1B 1V7NL 4E5XA 5DD6B 1WCQA 5E08H 5LKNA 4X9BA 1FP5A 3GUTB 1F4XL 4HG4K 1QQDB 5ICXB 1NEZA 1KFAL 2WP3O 4HBCH 1I4FA 2O61B 1LO4L 4O00A 5JO5A 5F3BB 4A6YA 3WO4B 4HK3N 1ZHKB 1Q9KB 3IETA 4RFEA 2F8OA 2EC9U 5DK3A 4PTUA 5FO8A 2QSTA 3LSOB 1U8IB 5K9QG 4I3GA 1MPAL 1I3RB 1QHPA 2IPUK 3DETC 4P9HL 2GSGA 5L6YH 2D31B 2FR4B 1ZOXA 2PCPA 3CU1A 2IH1A 1ZVYA 5TE4L 1T0MB 3UDWA 4FQ2H 2ATPB 1H15B 1OAYL 2P8PA 4PJAE 4WV1C 1QFWL 1EJOH 1YMMB 3PWPD 1ES0A 4OZIF 5F7DA 1T1ZB 5EOCL 1U3HB 3Q6FA 4LHUD 3ULSA 5DVOA 3X14A 4LEOA 4GW4B 4KDWA 3BH8A 4JPKH 4XP1H 4HUUA 1CXIA 1R5IA 1F6AB 1BIIA 5A40E 2AK4E 3C60B 4N9OB 3QRFM 1BZ9B 2Y4SA 3QEGL 2UWEA 3O3DB 4IRJD 3QO1B 3C08L 3IDXH 3D3VD 5IMOA 2JIXD 4EUPG 4UB0H 2H32H 1FFNA 3F6IA 4NSKB 3LEXA 1ITCA 5EU6D 4P59L 1KIPB 2LVCA 3V6OC 4ZS7H 2HP4A 2PXYC 1NUFA 4OZHB 3PE9A 1JNNH 2QBWA 2MQ0A 5CEXB 4LSSL 2JJUA 5C0IB 3DVGB 3TT1L 2FNBA 2V9QA 3T3PE 1HIML 1RQ5A 2DWEB 4JQXA 3O9WB 1ZHBA 5B38G 4XMKL 1OPGH 2BVTA 4JR9L 2C1PB 4YGAB 5D1QA 1PAMA 2IF7A 4L4TB 4CNIA 4F2MA 4WO4A 4JN2B 3DWTA 3BEWA 4WUUA 4RISL 4OUUB 3TBTA 1XGRB 4BQ6A 4JRXA 1XGTA 3UCRA 2J4WL 1RIHH 2XN9B 4JO4L 1KENL 2V17H 3BESR 4KGLA 3P4MB 4KJYB 3A0OA 2YBRB 5ESQB 1KCRH 3L3KB 4P2QA 3VXNA 4ODSL 1IKFH 1KIQB 2H9GB 4MZ2A 1VEPA 4Z7WB 4X4XB 4LNRA 3CDGA 3B3IB 4JFDE 1R24A 2I60L 1DDHB 1EBPA 3OKEA 5KVDL 1K3IA 3AXLA 1PYWA 2A74B 5F7LB 3GSNH 5D2NA 2VQ1B 3OGCB 1OCWL 3KYMA 4P2OD 2QSCH 2Z31C 4XP9H 3SKJL 1JYNA 4HH8A 5E8PB 2AEPL 1J8HE 2NY6C 3IKKA 2GHWB 5TH2A 5FM4A 3HTLX 5CEZE 1TQBC 1EZVX 4UQ3A 1AHWA 3WLBB 2R2EA 1ORQB 1FFOA 1JYVA 1I1AB 1MSPA 1GAFL 3MYZA 3ARYA 4HCRH 1R3JB 5E00B 1TZHA 3ARWA 4NO5A 2X40A 1DQML 1BM3L 1AKJD 5ACZA 1UACH 5AYQA 3FOMB 3WFDH 2KQNA 5J89A 3BQUD 4OLXH 5DD3L 1DEEA 4Y5XB 5DUBA 1L0QA 3KLAA 3QA3A 3V4UL 2X70B 1SVZA 4P2RD 3HMWL 5T1LD 1W0WB 2F8XC 3HG1B 3ZHDA 3AGVA 1BQSA 5ETUB 4OGYH 3NFNB 3D39E 4JGMA 4LAQH 4X9HA 3SN6N 1XGQB 2W0KA 3MRJB 4OZ4A 1NMCC 2NY2D 4L9LC 3QEQD 2Q76A 2PYED 1J10A 1R5WB 4N5ED 2VL5A 3ZE2F 3NPSB 5DO2D 4LHUG 4GRWF 5DRWA 4J3VA 4JQVA 2YXFA 1UT9A 2W91A 2V2TB 4HIJB 5IQ7L 2R0ZH 5KVGH 5ID1B 4Y4KD 1QO3A 2H45A 1VFMA 3KJ4B 4LKCB 4MXVE 2P44B 5F9WC 2PKDA 2Z8WC 4YC2C 1FVEA 3DRQA 2OJEB 2GUOA 2F53D 2B1HH 1HHKB 2IFFL 3MACL 3C2AL 5FO9B 2HMID 1W0VA 4NQCA 4NKOA 4X7CC 4H8WL 4NWTL 4NZUH 4AEHH 4N8CH 3WFCL 5KJRL 4AZ8A 3DMMC 4K7PX 5IBTH 3BI9X 4XRCB 3X3FL 3GBNL 4LOUC 4F58H 3TH3T 2EEAA 5DJ8A 1ZHLA 1KB5H 1OW0A 1R3KB 3RL1B 3LAFA 5DJAB 2PTVA 5GJSH 1P4BL 4G6JH 2J8UA 4I5BA 4LK4A 4RCAA 1MCHA 1XF4A 5FHAH 5EB9A 1MH5B 1WJ3A 5IWLA 1Q0XH 1NFIB 3QNZB 2YUXA 4UTAL 3LQZA 2DQJL 4YDJA 3WN5A 1HH9A 3O45B 4J3XA 4JFFB 1GXEA 1ZA3B 4HXAL 3QAZB 1HEZA 4LMQE 5GGSY 2D0FA 1L7TL 3SKOB 3BSZH 1G6RH 1OD7A 1S9VA 3U4BL 3S5LB 4OLZH 4U1GC 2FYYA 3PXHA 4V1DD 1KJ2H 4JG0L 3OKKB 1YJDH 4PRDA 1IC7H 1A9EA 1M7XA 1XIWA 3IU3B 4HWNA 2W65B 4HHAB 5DD6A 1TZIA 1WGOA 2F54D 5FYJU 4ZFFB 4MX7B 1UM6H 2YKLL 4QHLB 4NO0D 2DLFH 3QHFL 5JXEA 5K59E 2ADIA 3ZSSA 3G5YB 4Y4HD 4Z7OE 4KPHH 2XN9E 3S37H 1AH1A 1CI5A 3PJSB 1N3NB 1ZHNB 1NFDE 2CJUH 5DJCA 5CBAB 4APQD 4JG1H 5HVWA 3L7EA 3TVMB 3NZ8A 1G7PB 1WFOA 1RZJH 4Z7WE 2Q7YA 5FOBA 3EDEA 3MA9L 1KG0A 5IB5B 4HH9A 5KANI 5I8EA 5GRZA 1INEL 5CLWA 5C0AD 1CFNB 3VFMA 1J0HA 5D7IF 3K0WA 3CSBA 1I8MA 2UZIH 4BK4A 3PL6D 4KI5D 2FH8A 2YD5A 4PY7B 1RUKL 5SWSB 2E7BA 1L9NA 1UH3A 3MUGB 1MFEL 4KXZH 1MJUH 3SY0B 1UJ3B 3RVXC 3G9AB 5JLZB 2P5EA 3QUXD 1RU9H 2Y7QB 3FQTB 1RUAH 1T21A 2FB4L 4M7JL 4M7KL 4HPYL 3VXTB 5CJBA 3CXHJ 4DKEH 5J12B 1BZ9A 4QHMA 2FX7H 3U0WL 1Z3GL 3ZYJA 4JHWH 1J0YA 3HG1E 4LAJH 5A2FA 4M1CC 3C5SA 1U8QA 4YLQT 4NO3A 3RTQC 4LGPB 4D0DB 5LBSH 3R0MA 1XF5A 1EO8H 3KXFD 4Y16B 4HZLA 4K94H 3I02A 1BPVA 1KJ3L 3O9WA 4HDIA 3WUZA 3ARGB 3NPZB 3K80A 2H32A 2C1PA 4JO2H 3T0EA 3WSQL 3FTGA 4OCWH 2KZWA 4TSCH 4B53A 5DD5L 4L4TA 4PJBF 2J6EL 4Q2ZB 4S1SL 2D7OA 3D48R 5DT1L 2O5XH 2Q6WA 4LHJB 3LQAL 1CGUA 3QUML 5CJOL 5F3HB 2MJWA 1ETZB 3ILPB 4DGYL 4WEBL 2IPTH 3KPNB 1KELL 3QHZL 4KUZL 4YGVA 1RVFL 4I0KA 1PD6A 2FGWH 3B3IA 5D6DC 2X09A 1BD2D 2E8YA 4WCYL 3TBYB 5DQDH 1I9RH 4F7EB 2DQUL 2CRZA 3MRMB 3R06B 4MA3A 4Q9BA 3LKSB 4G9FA 1AY1L 1VFUA 2HYMA 3U0PB 3MLUH 5E8PA 3UZEA 1MWAL 3DYMA 3RKDD 32C2A 4Q9RL 3BQUC 3LN5A 4PGDB 3BKYH 2DM4A 2AV7B 1NGQL 2BMKB 2HAZA 2VLRA 1I1AA 4NHUA 1A6AB 2PUQT 3D85A 2VITB 1JF1A 4FNLH 1RD6A 2J5LC 3ULUH 4AL8H 2VKWA 5M94B 3BDBA 4GXVH 3GSNA 3DV4A 2OL3B 1K4DB 3L5IA 4JFFE 1JGLL 5T3XD 3U2SB 4IOIB 3OXSB 3KS0J 1NLDL 2NY2C 4HX1A 1DN2A 1AQDB 4LARH 1KTLB 1G7JA 4DZBA 2COQA 3CC5B 3OWEA 1U8HB 3F58L 4N5EC 1R3IL 4NGHL 3S9DB 5DO2C 1YNKH 4K8RD 4L8BA 4HCRA 5E99H 5T3ZH 1QRKA 4KK5D 3NFNA 1HOCA 2XV6B 1MCCA 2V5SA 4UMGA 1N4XL 4ALAL 4PGEA 2FHBA 4FS0A 1X6LA 3GO1H 4NNPL 4UDUB 2OP4H 3CVHL 3RIAF 3WYRA 1QSEA 2BHUA 4I18B 3P73A 4PG2C 3DLQR 3DX7A 1JCKA 2A0LC 1KCUL 5HHVH 1JGEB 1S7RB 3IDJA 5L2KA 4X80L 1RIUL 3B2VH 3H9HA 1VEOA 3RNQA 4XNYH 3BH9A 3FB5B 2GTWA 3T1WA 4YHLH 5KZCD 1HWGB 4OLUH 5D7SL 4WU7B 5I1JL 4G6AD 4WW2F 4NQUA 5F9JB 2FGZA 3MC0A 3VI4E 4H0HB 4OKVB 1WZLA 3BD3A 1U3YA 5E94B 4XRCA 3GMNA 4Q58C 4MB5A 5SWSE 2IC2A 2VR9A 2FL5B 5FYJD 4EDWH 1BFSA 5EA0L 2FZ3B 4X4ME 3RBGA 3BPCA 2VXTH 1FNGA 2FO4A 2MOVA 3IS0X 4PG9A 5ITFB 4E41A 3IAGC 1IQDA 1JF6A 4QGYA 4Q97A 5DMYA 5JZ7D 4IM8A 1UEYA 5HI3D 2BRRH 1U92B 4HIEA 1NGZA 5IROC 3P77A 1OSZA 1SY6A 1KB5A 4WW2C 1MNUH 4XPAH 5GGSB 3WXVL 1A3RL 3NACL 4M9PA 1Z5LA 4XPFL 2DWDA 5FUCE 1ZVSB 2D9CA 4PV9B 1FL6A 3CD4A 4EBQH 4KI5F 4R2GD 4K7FA 3ET9F 2FIKB 4ZXBC 2CKBL 3S5LA 2JELH 4UT7H 1I85A 1CDJA 1CT8B 2VLJB 4Y4HC 1JMXA 2D7TH 3EOBB 3DPBA 1PY4A 5AZ2H 3MQIA 1H5BA 2R0KH 2X4OB 2FWOB 3VG0H 5DK0B 2GT9B 3FN9A 4PRID 1JYWA 2VUYA 3BOVA 1GGIH 4APQC 4PJ9C 1C12B 4ZUTB 1G6RA 2ITCB 2OJZH 4NT6B 1Q1JL 5E6IB 4LPXA 5HGGS 2VDRH 4PJ5B 2IMMA 2E6JA 2IBBA 3PWVA 5DEZA 2B4CL 4P9MH 1DFBH 4M5YH 1LDSA 1KJ2A 1NMBH 3PJSA 1ZHNA 2DYPA 4KI5C 4PS4H 4NRYB 5EBLA 3X3GL 1KPUB 4GG6F 1MY7A 1A7NH 5MHSD 3JWOL 1YN7B 4D0CB 2OTUB 2VDQL 4K3GA 4YHIB 2NZ9D 4RAHA 4FQXD 4OFIA 2QL1A 5CZVL 4KAQH 3MRKB 1N5AA 1QFHA 1RHHA 3QUXC 4I13B 4I77L 4JCLA 3FFCB 4UQ2A 2EH7H 4CU7A 4PJHF 3PDDA 3V52H 1FGNL 4EQ3A 3SDDA 4ACPA 4KROD 1F90H 2YOCA 4O2EB 1JRHH 3QIBD 4PJCE 5ALBH 4HKZB 1S9YB 4NKQB 1UCTA 5JLZA 1WT5C 1JUFB 4K71C 4KU1A 4JFHE 1WCBA 4JB9H 2Y7QA 1QFUL 3X17A 4OM1L 4EI5D 2P7TB 1J1XL 1UCBL 1PY9A 2X05A 3JWNC 4ZPTA 3U1SH 2NQCA 5IW1B 2F74B 3L5XL 3MXVH 2HFEA 1JFQH 2CDEA 1U36A 3FT3B 1KEML 3E6HA 3U9UB 1UXWA 1CTNA 1PGRB 4Q6YA 2IBZX 2LU4A 4HEPG 5DRNA 1FSKB 1M05B 3EOTH 5IW3A 5F7NC 1MIMH 3QWRD 1AFVL 4LGSB 3UBXA 4CMMB 5GS1B 2ADFH 3K2MC 5EO0B 2P45B 2B2XH 4M03A 5HDLA 4R97B 1AGEA 2VAAB 3WFEH 4R7DB 1S5IH 4OSUL 5JNYB 2AJUH 1JGDA 3J8F7 3VDBA 5I1LB 3VXRE 5FCSH 2NY1D 4MNQE 2X1WL 3JV4A 1Q72H 4U6VH 5HYSB 4G43B 1JN6B 3RKDC 5CHNA 5KANG 2VDLL 3SQOL 3ARED 3IAPA 2GCYB 2A1WL 4J4PA 3CK0H 3A67L 1NC4B 3H9SB 1U8NA 2NTFB 3MRMA 1LEKB 5AYUL 1AXSB 5C0DA 3SE9H 3MV7D 3S96B 4G8GD 1PQZB 3D5OF 4GRMB 4XCCH 4ODHH 4XXCA 3WNMA 4RAVB 2I9TA 3ZKQD 3UMTA 2GK0B 1CIDA 1S8DB 4RDQG 1X4ZA 3Q5YA 1LMKA 3MODL 3VJ6B 4K8RC 4ISVA 4Z8FL 3VXSE 5T1DL 2BVQB 3OB8A 2IAMC 4KVCH 5E9DA 1JZ2A 1KTLA 3CC5A 3W5NA 4DZ8A 4E0RA 4CDHA 4IMKC 4ZO9A 3VGEA 4BM7A 5L9DH 1ZANL 1KTKE 1Q38A 2VLJE 3V0VA 3KDMB 5IM7A 2ZJSH 3O4OC 5TE7L 4OF7A 5C92A 2ZUVA 1TVDA 1EXUB 4TVPL 1E4XI 1A6ZB 1A4KB 2X9XA 2VABB 3FHAA 4QRTB 2P49B 1VFBA 4NUGL 2RIKA 1TIUA 1TJGL 3QDGD 1E6JH 2JJTC 2VZVA 1VCAA 4FFZL 1T66D 3EYUL 4IS6B 4YHKH 5KSVA 4FTVE 4G6AC 3FAWA 4GT7A 3GMQA 4YXKH 5FDYA 5JOFA 3QXTA 4M8VA 3MRLA 4PJGA 1MHPL 2A9NL 4U0RC 3CDYA 5HDBE 1IL1B 4KQ4H 2VDOH 4OF5A 2XXMB 4H88H 2CRMA 3ARDD 1C5CL 3FFCE 4WV1B 5E94A 1IFHH 5JZ7C 4QXGH 5HI3C 2AJVH 1J05B 1NSNL 4KRPD 4ZFOB 3WNNA 4HGWA 5SX4H 3UTTB 3QUZC 2DQEL 2FZ3A 4LU5H 3S37X 1D5XA 1MRFH 3SOBH 4RDQF 2DL2A 4G6KH 5JHDB 2X41A 3HC4H 1A7QL 3WFHB 1IC5L 1FO0L 4FQPA 4LSTH 2D7MA 4XH2B 3IDUA 4R2GC 1JPSL 4JVUA 1Y6MR 1FL3A 4OT1H 4EEEA 1MRCL 3EO1B 1B90A 3CMOH 3U36B 2VXSL 4FXKA 3OPZH 2XTJD 4I4WA 1LDPH 4LRNH 4OB5L 6CGTA 3GIZL 3G08B 4UILL 4XZUA 1IAII 2VIRB 3ARBB 4RGNC 5BS0D 5BXFB 3E6FA 5DK2B 2VLLA 3HZMB 2A6JB 5BV7C 5C08B 4G42A 2Y25A 1EHLL 5D1XD 2HKHL 1IGTB 5E1HB 5F9DC 4ONFL 3FT2B 4MAYC 3KNBB 4PTTA 4PJ5A 1IAKA 3GRWA 2NZ9C 4XXDB 3QQ4A 4X6DE 4DQOL 4R8WL 3BZEA 4FQXC 4PJ7F 5D1ZC 1DQLH 3FONA 1R3LA 4RMQA 5HGBB 3U9PH 4OCYH 5EZLB 3KYKH 3BP7B 1DN0B 4KROC 4ZTPL 3MRCA 3VRIA 5I73C 2Z31B 1FVCB 2OTUA 3FO0L 3QJHB 3TC9A 4PUBL 4Z7VA 5DHXB 4XPHL 3H9SE 4LVHC 5EC2B 1H8NA 2IGFH 2AJSL 4NC1C 4EI5C 1MCOL 5IB2B 5D7LA 1GGYA 1FNEB 3S4SA 1KTDB 3RIFK 1YC7A 5D7JC 5I2IA 5IFJB 4YO0B 3T3MF 4KMTH 4U1JB 5AG9A 5DSCB 3NIDF 2CDFB 3QG7L 3WIHA 4XVSL 3IRPX 1AGDA 3TA3A 4QO1A 3TO4D 4KGJA 4L29B 1LEGA 4Z7UE 3SCMB 2ICES 1GRWA 2BXYA 2CRYA 1VDGA 2P7TA 3HA0A 5EOTB 1TJHH 4DGIL 3RL2B 1YY8A 3DGGB 1XF3A 1YPZF 2FATH 2R29L 4HWEH 1K85A 3JTTA 4LSQL 2YPLA 4X9GA 5HHNB 3QUYD 3FT3A 1P7QD 1S7VA 1GGCH 3RUGF 5CZKA 2CDGB 1N6QH 1UZ8B 2QADC 3GMLA 1P7KB 1OAKL 1WFTA 3LVEA 4OGZA 5E1AA 5IBUG 3MZTA 5FYKL 4L8SB 1SM3H 3B6SA 4NFCA 5EO1A 3W0WD 5GS1A 3IVKB 1BEYL 1YEFL 4LLMA 4Q0XL 5DZLA 2NY1C 3I9GH 3OKOB 4P4RB 5GS0C 1V7NH 4PRBA 5IUSA 3E8UL 1BAFL 5HJ3A 3TFKD 1QPPA 1G9NL 4Z5RB 4QEGA 3QDJA 3TCLB 2KZ1B 4LLQB 5H35B 1AD0A 2BY1A 5D9SA 3RPIA 1GVIA 1KFAH 1SYVA 3RZCA 4AT6A 4MNGE 5HGHA 1H3GA 1LO4H 2EO9A 1Y0LB 4DUVA 5DWUH 3B83A 1AC0A 4YBHA 4GRWB 1ZTXL 1B0GB 3EJJX 2DQDL 4X6CA 4XBPB 2NMSA 5BQ7B 3T65B 4IRSA 2EZ0C 2EDJA 1CFQB 5DHVA 1MAML 1MPAH 4OD2A 4XP6L 1LEKA 4KRLB 3C8KA 4P9HH 3O3EA 3NIGE 1U41A 2VLKE 4G6FB 5I1DA 5JHDE 5TE4H 5BZDB 1ACZA 2J1KA 5DC9B 1U2CA 4QCIB 3QIWB 4WTZA 3SKNB 4X6BA 1OAYH 3WMSA 3ZHLA 2GK0A 1QFWH 3HE6B 3G5VA 5GS3A 3VXQA 3V6OE 3HZKB 3F6LA 2BDNH 4EZMA 1N59A 4HMEA 1HSBA 1TITA 5BMFL 2NY7L 5C0RL 3JTSA 4URTB 4OZIE 1G0DA 1NKOA 4HLZH 3QEGH 1IGIL 5BVPL 3C08H 4WI5A 4IHOB 3BIKB 3WE6A 3X12B 4NRXB 4PRPA 4Y1AA 4P59H 3MA7B 3ALXA 5IVZA 1YDPB 3FAXA 4P49A 2YWYA 3CVIL 3OBAA 4AM0B 1HZHL 1C7TA 3U7AA 3S88L 1C7SA 2DQGL 2KDGA 4LSSH 1OY3B 3D1MC 2YEZA 5CJQL 2Q8AL 3A6CL 3VU2A 3TT1H 3C8HA 1HIMH 2BHYA 5F44A 4HUVB 4F15B 8FABB 4OCMC 3WS3A 4XMKH 1FZMB 1PKQB 4JR9H 2AXGA 3MRIB 3WDHA 3DXAD 1KJVB 1E27A 5I74B 4PYGA 1T04B 2XQYK 5HHMB 2XWBA 4H1LG 3MLZL 4KRPC 3UTSE 4JHZA 4PBXA 2AKRA 4HWZB 1OTTD 4JRWA 2V7NB 2J4WH 4P99A 2FJHA 5CS7A 5FO7B 4JO4H 5GGUA 1KENH 2BC4B 5EZOL 2BK8A 1UKSA 5IJVB 5C07B 4POZD 4ODSH 3O8XA 1ERNA 2EC8A 4KFZC 1ORSB 1B88A 4F37F 5C6TL 1J05A 4XAKE 2I60H 5KVDH 1T22A 4X0KA 4WHTB 3UTTA 2I9LA 2DLHA 1OCWH 3KPPB 4NYLA 3BRDA 5DA0B 1NAMA 1I1RA 4GS7C 3SKJH 3Q2CA 3EFDH 2AEPH 3MXWL 4X4YA 3IFPB 2XTJC 4LLYA 2EKSB 3MLRL 4BFIB 1GAFH 5L2JB 1DBJL 3CH1A 3BZFB 4MQ7B 3NCMA 2H3NB 4AEFA 2D0HA 3WIFA 5IB4A 1DQMH 1BM3H 3O6FC 4HT1L 1U91B 4X5WA 4AIZB 3I3EA 4TTGA 4HS6B 5DD3H 2CLZA 5I1HL 3DSFL 1JK8B 4Y2DD 1JE6A 3GSUB 4N1EA 3PWLA 2YN3A 4OD1L 1KN4L 1QFWM 1P53A 5ENWA 3V4UH 4NN5C 4H26B 3ZL4H 1HKLL 2BNQA 3HMWH 4M5ZH 1CE6B 3LMJL 3OHXB 1JV5A 4OZGA 4JVWA 1IM9B 1NCCL 5C0EB 4MB3A 2GY7B 3IDGB 3MRRB 4LIQL 4OCLC 2R4RL 1IEAB 1PSKL 4M6ML 5L0QC 3B9KB 4YR6B 5JXAL 3LDBB 3KPSA 2VC2L 2JB6A 2VZ1A 5IQ7H 2C4XA 4PJEA 5HGBA 3IF1A 3ZE2E 5EZLA 4X7SL 3UTPE 1ODAA 4GRWE 4QRRB 3MRQB 5E8NA 4TTDD 5D5MB 1SQ2N 3EYVB 5F72S 4L3CA 5F97E 5DJYA 2A73A 2IFFH 3MACH 2H8PA 3C2AH 1Q94B 2GSIB 4EDXA 2Y6SC 4H8WH 4NWTH 3VD7A 1MHCA 3VFPB 3WFCH 5KJRH 3NGBB 4GLRH 3GSRA 3HI6L 4MGXA 3X3FH 3GBNH 1EFXB 5D2LF 4AQ1B 5IHZB 2GJ6B 3WFBL 2EDDA 1KTDA 3RNKB 3DROA 3D9AL 3CXDL 1CK0L 4YDLC 2CDFA 3JZ7A 3EJZC 2YRZA 2EE3A 1U8KB 4KI1A 3IFNL 3S3PA 1P4BH 3QUYC 2XFXB 3I3DA 4HS8L 1DR9A 4ZPVB 4XT1C 1LK3L 3V9FA 5L8LB 5MENB 4UTAH 1NL0L 3VFUB 1Q9LB 2DQJH 4U1SA 1A9BB 4HXAH 1KXTB 1WZ1H 4GMTL 4MNHA 2R0WL 2YS4A 1L7TH 1JIBA 2ZUYA 4LGRB 4OCRL 3BKJL 2KH2B 5GQBA 4NZRL 3FZUD 2ILLA 5I15L 3M1BA 3PWNA 4XNZB 3GMMB 1J0IA 4Y19D 4L8SA 4JG0H 3DIFA 4HUXA 4EI6A 4P4RA 2R2HA 1PKQE 2YKLH 4R0LA 2G2RA 1YZZA 4POYA 1IZKA 2CUMA 1T4KB 3HLAB 5K9KB 4L8DB 3RWEB 4XWOD 3QZWB 4PJAA 2OZ4L 2LU3A 5H94A 5EIIB 1YMHB 1NC2A 5C07E 1HQRA 5IVXB 4UUJB 5KS9F 1B0GA 2YZ1A 4NQDA 1W72B 4FQHB 3D3VE 3JV6B 2WQ8A 3FOLB 3MA9H 2HLAA 3ZKMD 4LSVL 5GGRA 1INEH 2X5PA 3WO3B 5EU6E 4ELKA 4Q7DA 3FB8B 3UPCA 5SWZB 1MHHB 3SKMA 3LPWA 5DC4B 7FABL 4YDKL 1RUKH 1F5WA 5A2JH 4K3DL 4QCIA 1MFEH 1XCTB 5D7IE 3R1GH 5HYFA 1YEDA 4O51B 3QIUB 2H2SC 4UAOC 3SGEH 3LN9A 1HHHB 3VWKB 4LCWB 4ZXBB 1A2YA 1FZKA 3ARVA 5FKAA 2FB4H 5DI8B 2WBKA 4M7JH 4M7KH 4HPYH 3IAQA 3PDOA 2BSRB 2VYRE 5D4QA 2WUCL 3C2SA 4F7TA 4HKJB 4A2LA 2IQAA 4JHAL 4PJ9B 4P46D 4YHYC 2D03L 2BSSA 4KWUA 1FJ1B 5BRZA 4CADA 3QDMA 1VKXB 3MGTA 3R0NA 3TN0B 5IMKA 4WFGD 4YHPA 2NY5C 1RJYB 5CSZB 4N0UA 3QO0A 3CFEA 1OTTC 2BOBB 4WWKA 1XF2B 1D5BB 3L3IB 3RWCB 3VXPB 4RGOL 2XWJB 3OR7A 4POZC 3WLWD 3WSQH 3BVNB 5EPMA 5DD5H 1T04A 1WZKA 3RWHA 2GTZB 1G0YR 1LP9F 2J6EH 2E7LA 4S1SH 4QRRE 3UX9B 5D5ME 2NXZB 5DT1H 4ZUSB 3LQAH 2BC4A 1OP3H 5IJVA 3D2UB 3QUMH 5K9OB 1T1YB 4DGYH 5C6PB 4WEBH 1KELH 2EYSB 3QHZH 4KUZH 4P2RE 2HLFD 1RVFH 1U8PA 3PGDB 4W70A 3T08A 4M7LL 3CFCH 4ZO6A 3DHMA 4WCYH 4OFDA 2DQUH 4GMSL 4ODXA 3V4VL 4O02L 4MMZC 3KPPA 2EDQA 3JV5A 2WBJC 1AY1H 1QSVA 1CLOL 2W9EH 4GRLD 5JQ6L 4FFVD 5JMRA 3HE7C 1MWAH 2QR0A 4Q9RH 5A3IC 4N0CD 4MJIB 3BZFA 4MQ7A 3UPAA 5MENE 1EO7A 2I07A 4Z18A 1CXFA 5DRXA 2ARJQ 3VDCA 4H25A 4HIXL 1JGLH 1GOHA 2PO6B 2C26A 1D7FA 4OGAD 1MWAB 1NLDH 3VFTA 2F53E 2E3VA 4MD0A 3F58H 3IFLH 1R3IH 4XC1L 4BSWA 4NGHH 2HRPH 3OHXA 5F6HJ 4L4VD 5DEFA 4NN6C 1IM9A 1ZK9A 4O4YL 3FQRB 4QY8A 1ITBB 2GITA 1N4XH 4ALAH 1TZGL 3RDTD 3WJLA 1R5VA 3P4NB 4TTDC 3CVHH 5CGTA 1N2RB 3N1GC 3QFJD 4YR6A 1L0XA 3C6LA 5DURB 1UWXK 1GHFL 5FYLD 2BSTB 1IGYA 2C5DC 4XMPL 1KCUH 2FCBA 4X80H 5IR1B 3CUPB 1RIUH 5IVXE 1AR1D 1MI5D 4HIHB 1S78C 1AP2B 2PW2B 5HHOB 1HK6A 2BZDA 2BNRD 3CVHB 5BCAA 4K9EC 5D7SH 4Z95L 5I1JH 1A1MB 3FQUB 1MLCA 1OB1B 2C3HA 1X5JA 3BWUC 5SWZE 5IESL 4X8JA 4JO1L 2DM2A 4V1DE 3IXTA 5EA0H 4IDLA 2BNUB 4PJXF 2IAMB 4U2YA 1P4LB 3N1QC 2F54E 4TUKL 3UJJL 2A6IB 2ITDA 2XKNB 4PJDF 5DXWA 5I9QC 3F7YA 4MXWL 3MV9D 2XFXA 1XR9B 2Z35A 1KCKA 1RJLA 2VXQL 5GGQL 1D6VH 2QJDA 3V2AR 5TDOA 1WVZA 3B5TA 3FRPA 3FZUC 1QEWA 1IKNC 1WBYA 1A3RH 4X9IA 3MBEB 1KLUB 3NACH 3CX5K 3SE3A 2F58L 1CQYA 1LO5A 1IGFL 1FVDB 1NFDA 1S7XB 4Y4FD 3WHXB 1D9KB 2OK0L 1P6AB 4DN4L 4MHHI 5C0AE 3O41B 1XAUA 5F1OB 4ODUB 1E4JA 4J2XA 4S2SA 4U3HA 4XWOC 4LF3A 2EIEA 3E2HC 4KI5E 1VFOA 4LCCA 3MLXL 1AD9A 3VXMA 4JY5L 1PZ5A 3A6BL 3V5KB 3SDAB 4P4KD 4G8IB 3SO3C 3U4EA 2B4CH 3IFOB 3L6FB 3V0WL 4R6UA 3HAEH 5DYOA 4KJQC 4QHNB 3JXAA 3QUZB 3GIVA 4I0CC 3X3GH 4YE4L 3JWOH 3VFOB 4PRHD 2VDQH 4FXLA 3O4LB 5CZVH 3T8XA 1IVLA 4I77H 5DRZB 3HAEB 2DTML 1NBYB 2Y72A 3GB7B 1FGNH 4A6YL 1WBZA 4JFEB 4MMXC 5C6WH 2RCSH 2K7QA 3KXFE 3NN8A 3UYPA 4LPTA 5DMGC 5ITBL 2HJLA 4FOMA 4IBLT 4U3XA 3LN4A 3SDCA 3PWUB 2GY5A 3QIUA 4P46C 2WQRA 3VFWB 1QFUH 4JKKA 2Z8VC 4MJ5B 4RGNB 1S5HA 4OM1H 4X5LA 4CW1B 3L3DB 3OR6A 1J1XH 3ZE0E 5BV7B 4QRPB 1UCBH 3AAZA 2JB5L 1A3LL 4K8RL 2VDML 1T89A 3L5XH 2N7BA 4MAYB 1BOGA 1KEMH 4RMSA 3WLWC 1DUZA 4AY0A 2Y36L 3HS0A 5F1IA 1BD2E 4W4NA 4OFYD 3P4OB 4EN3B 4LVOC 5D1ZB 3D18A 1AFVH 2NZIA 1MHEB 1CICB 5IFAL 1G7MA 2J2ZA 3QXWA 5FKPB 5EBWA 4TNVK 3BZ4B 1PX4A 3LIZL 3KPRA 4RMRA 3KAAA 2Z8SA 4OSUH 5DJZA 2HLFC 2Y5TA 3ES6B 1SYSB 2MPAH 4LVHB 2V9RA 2NY3B 2OTWA 5HHOE 2J12B 3OQ3B 1FG2B 2A38A 3AY4C 5F89B 5T3XE 1G7QA 2J3SA 3Q6GL 3CLEL 4QRQA 4GRLC 4KJPD 4M3JA 1T1YA 4FFVC 5D7JB 1K2DB 4RFNB 1BBJB 1QR1B 2VDLH 3SQOH 5F7FA 4HSQA 1IC4L 5HVHC 4R7NB 5J6GA 2C7UA 5E24E 3PGDA 1OWWA 1KIUA 4N0CC 2A1WH 5FYJL 5IVNA 2EICA 2J6EA 3A67H 3NCJL 5B3JE 3VFGL 5ILTL 5B39B 5CJ8A 1KJMA 2EDXA 2NX5B 5AYUH 3QHTC 5E2UL 4ONHA 4UIKL 5J1TC 3QUMA 4WJ5B 4HLJA 4CVZA 4WNQB 2X1OA 1EEYA 4NBZB 5I76B 1MVUA 4Q6IC 5T5NF 4JN1L 1RK0B 1C8PA 4NBXB 1PX3A 1SJHB 4PGBB 2AK4D 3MODH 1YN6A 2YD1A 4Z8FH 1EDQA 3UEZA 5IW6B 1QVOA 3Q5OA 1WWWX 2QADB 2ZOLA 2FSEB 5T1DH 3MUZ1 4PJFA 4PV8B 4PJ8D 3RDTC 3TZVA 4UDTB 2ED9A 4HPOL 1A4JB 1ZANH 4TPRL 1A21A 1M71B 5E2TH 4JFYA 5TE7H 2GW5A 5T1KB 4HWBL 4PLOB 2N4IA 4TVPH 4IMLA 5HHPA 2GAZB 1AR1C 1YEGL 3KJ6H 3PHOB 4NUGH 5AWNL 3QI9B 3PNWB 3JV0A 1CDIA 3MOBL 1TJGH 4M6OL 1JMZA 2WINB 3DI3B 4FFZH 1JHLH 3EYUH 1D5ZB 3GGWA 3F7VB 4X4MA 1MCJA 1IGCL 1QRNA 1RZGA 1NUGA 4I0PA 3CUPA 4G5ZL 2XICA 1FAKT 2PW2A 1MHPH 4OZFH 2A9NH 1MJJA 1J0KA 4JFDD 3WXWL 1NGWA 2HJKB 2JJSA 4L5FH 5MEPB 2PW1B 1C5CH 5KSBA 3GSVB 2HG5B 3H9ZA 1AGBB 4JFEE 4AH2A 5GIRB 3HUJF 5DJXA 4GSDL 4C55A 2DQEH 4OZFB 2VRAA 3JSSA 4PRIE 3TJHD 1UA6L 1EEZA 2EDEA 3T2NL 5C0FB 5DA4A 1A7QH 1IC5H 4P57A 4X4ZA 1FO0H 1K3ZA 4LLAA 4RGNE 3OB0K 3D25B 4Y4FC 1JPSH 4RAUA 3QNYB 1RZ8B 4NZJA 3AS1A 1MRCH 4ELMB 3LV3B 4RRPG 5C86A 4XI5C 4CVUA 5IBLD 3G5ZB 2VXSH 1SMAA 2J8HA 2GFBB 5C0CA 1YEIL 3SJVD 5MHSE 3D39D 4OB5H 3MRPA 3GIZH 4P4KC 4UILH 1QR4A 4U6XA 1ZV5A 4P5TB 1CXEA 2FECI 2RBLA 3ARFB 2BRQA 4UU9B 1KB9K 5DEGB 4DUWA 2W60A 1EHLH 2K9UA 3FFDA 2HKHH 4XNQA 2UWEF 4U33A 4ONFH 1KCSL 3CZFB 3OKNA 3HMXL 1ONQA 2JLLA 3V5DA 3T09A 1TVHA 3B9VA 3WDJA 2CKBA 4K3EL 2VISA 4W68A 4ZUUA 4DQOH 4R8WH 3UDWC 4R9HA 2X4NA 1JHTB 4NC1E 4NQEB 1J5OL 4ZOAA 5EO9B 2CO7B 1Q8MA 2EIZB 4ZTPH 2NXYC 4WI8A 5CINL 2AEIT 2YPKA 3AMLA 4OBSA 4PJ7E 4U6YB 3DJ9A 1XH3A 3FO0H 4PUBH 1W0YT 1UB6B 4BKLB 1B0RB 3UPRA 4XPHH 3CFKB 1F4AA 3P9LB 5EG6C 4JRYB 4K3HA 2ZG3A 4TUJA 1FZOA 3U83A 2AJSH 1YMMD 1H8OA 1I7TA 1MCOH 1U3HD 3O6FB 4TYUA 2MHAA 3UJIL 3V6ZB 2A83A 2WSKA 3GMPA 1U3ZA 1V5JA 3O11B 3QQ3A 4AMKL 3MRFB 3QXAA 5IQ9B 3QG7H 4QOKB 3C60D 2NYYD 3KYOA 4XVSH 5IK3A 1OSPL 3G6AA 4QT5A 4ERSL 4LSDA 3LKPA 4UIMB 3NIDE 3PHQA 4DGIH 4QRPA 4OV5A 4L3EB 3OZ9L 3CNKA 1NCTA 4WIQA 3RU8L 2R29H 4WO4C 4LSQH 5L0QB 4D94A 3LPGA 4MNQA 4MHHG 2P8LB 3O9WD 2MFNA 1OAKH 2WIMA 2ZOKB 1MREL 3EZ8A 3B5HA 2CRIA 5FYKH 1NCNA 4G8GE 2HT2D 5EN2B 1BEYH 1YEFH 4OAWB 1MIEL 4WUKL 4Q0XH 4DKDC 5B8CC 3RUGE 4F7CB 3BZ4A 4JJHA 1HXYA 4KJPC 4U49A 5ICYB 5CD5C 3E8UH 4KXZI 3QXDA 1BAFH 2XN9D 1T1WA 2P5WB 5IT2L 4UTBL 4M4RA 1G9NH 5AUMA 3QULB 3HNSL 2V5YA 2APXA 2EE9A 2OQJA 2V7HA 4WU5A 4WTWA 1I7RB 5F88A 1AHWC 1FG2A 4ZYKB 1CZ8L 4U6HA 1YNLL 1MCRA 3MJ7B 5IJKA 4LVNC 1NGYA 3VXSA 4X7TB 1ZTXH 2DQDH 5JW4Q 4R3SA 4FQJL 5DJDB 2X7LB 4LVEA 4C83B 3T77A 3BP5B 1WBXA 1MAMH 4XP6H 1I1AD 1I1CA 3STBA 5ANMB 4N0YL 5K93A 2F5AL 2NY4B 4GBXB 4N8VA 3VGAC 2M1KA 2LAGB 4PJ8C 4PJIB 3QDGE 3LKQB 4JDVA 1D5MB 5E4EC 1GZQB 5D2LB 3P0YH 5EUOB 4LSUL 1T3FB 1NMAL 4PGCA 4ZAKA 1ND0A 4AENB 3HG1D 1RZFL 5BMFH 2NY7H 2YUVA 4JQVC 5C0RH 4HBQA 3FCTB 1IGIH 5BVPH 2C1OB 5FF6A 5JOEA 5IKCA 4X7EC 2IALB 1KN2L 4JM2A 4WWID 5ISZB 1C5DA 2CO6B 3MO1B 4LQ1A 5F8RC 3VD9A 3CVIH 5EFIA 5I8CA 1HZHH 3S88H 2DQGH 5IEHB 1JNLL 5CJQH 2Q8AH 2GAZA 3A6CH 1N0XH 5LQBL 1CWVA 1ED3A 3QI9A 1DZBA 2JK5A 3UTZA 1FDLL 1CVRA 4U6TA 2H6PB 3BGMB 4LLVB 2IMNA 5C0JB 1TCRB 3F7VA 3O3BB 5I1EL 3H9YA 2MQCA 1OW0C 3W5MA 5CEYB 3V7MA 4NQEE 3W11D 2BVOB 3MLZH 2QQKL 3N1FC 3TBSA 1W8NA 4LPCA 5IV2A 1DBKL 2EE6A 2DD8L 1PLGL 3V6BR 3L3GA 3P9MB 3VW3L 5EZOH 2XTJE 1DQDL 3TJHC 5IWLC 4U1MA 2DQHH 2ICEB 3RWGB 3WN5C 4UAOB 5DMKB 5C6TH 4JZJA 3I6GA 4U2ZA 1MFDL 1ZT1A 4OZFA 4PP1D 5J1AA 1H8SA 1BX2A 5KS9B 2ZUSA 5IBLC 1MLBA 4QOKE 3T2PA 5GSVB 3UZVB 1CU4H 3MXWH 5C0FA 2X4QB 2R8SL 5CWSB 4JFFD 1WWCA 3MLRH 4ETQA 1DBJH 1TCMA 2SEBB 2CIKB 3PQYB 2AGJL 4JPIA 1S7UA 4L3EE 5ADOL 5KVEL 4HT1H 1YEKL 3WJJA 4X6DA 4NKDA 3G6JA 5CP3H 4XP4L 3MRGB 5I1HH 1F13A 4OCXL 2W0FA 3DSFH 3AROA 5B38B 3GSWB 3C6SB 4BELD 4OD1H 1KN4H 1DBAL 1FO0A 2DIJA 4FFYL 5INDB 8CGTA 1CFTA 4WY7L 4QRUB 3C9NA 3LMJH 5I17A 4GAYB 4LLWB 4XWGL 4NPYA 4J8RB 1NCCH 3WO4C 1TJIL 1V3KA 1FV1B 2UUDH 4LIQH 1MFAL 3BHBA 2R4RH 5C0GA 1IGJB 1M6OB 3DRTB 4MSWA 4BFBD 1PSKH 4M6MH 1VFAA 4MAUL 3VWJA 3VDAA 5JXAH 3M8OL 3UTQB 1FBIL 2VC2H 3TVMD 1UM5L 4OZHF 1NUNB 3F5WA 2VERN 2YD2A 3MJ9L 4OM0H 5CMAB 1KYOK 2BVUA 3KYNA 3LS4L 3OMZA 4X7SH 1G9ML 2APWA 3BD5A 3GSOB 1A47A 1J1PL 2WBJB 1U3HC 4P23A 5E2VH 3VH8A 5KSAA 1ZA6A 3GNML 3Q3GB 2MCG1 3HE7B 2AABL 2CK0L 4XCNA 3BP6A 3P11L 5SWSD 1CE1L 4BKLA 3BUYB 3C60C 5J4MA 2NYYC 5I16B 1E4XL 5MI0B 4D9LL 2X89A 5ANME 5MEQA 4Z7OF 1JVKA 2IG2L 2YD3A 3HI6H 3KPQB 4I48A 4JANA 4M43L 4PLJC 4PD4K 2DKUA 5ALCL 3WFBH 3I75A 1KPVA 1J7VR 3L3OA 3O11A 3D9AH 1A1OA 3CXDH 1CK0H 1C08B 5IQ9A 4Z7WF 4RWYL 3OF6A 5D2LE 1AO7B 2OSLB 3EGSB 5EUOE 3IFNH 1HH6B 3EHBD 4LCUA 3EYOA 2DJ4A 1KC5H 1QHOA 2ED7A 4HS8H 1PFCA 3O9WC 1LK3H 3CPLA 2WWMD 1JZ7A 3BW9A 1NL0H 2EDFA 3LKRA 4H5SA 1OTSD 4BH7A 2QTEA 1LE5B 1EIBA 1U95B 4N5UA 4GMTH 2R0WH 5TQ0L 3QRGL 5ISZE 2XT1B 1FAIL 4CMHB 4Y16D 5JORA 1GCFA 2P8LA 4OCRH 5FM5O 4MD4B 1JPST 1OLZA 3ARGD 3IGAA 3BKJH 4DGVL 3JUYA 2ICWA 1TMCB 4NZRH 3TO2B 3BIAX 3HNTL 5I15H 3OL2A 3MFFA 1ZAGA 1P2CB 4LLUB 4Z0XA 3QB7C 1CFBA 1EZVY 2AJZA 2AXFA 4GH7B 5J9PA 3EFFB 4HIIB 2EH8L 3O3AA 1EAPA 5DDHB 3L5WA 4QF1A 4ZMAT 2VLKA 3RWIB 1FGVL 2A9ML 4BUGA 4MJ4A 3FRUA 4CVXB 3GJFH 2OZ4H 3WNOA 9CGTA 3OGOE 3LS5L 2Z8RA 4ZYKA 1I1AC 1T83C 5C8JB 2G9HB 3MJ7A 3V6OA 1I8LA 1DUYB 1IZJA 1UFUA 3T2QA 4LSVH 3VD5A 4C83A 3BP5A 1YA5A 4Y5XC 3GJFB 3SDYL 2FEEL 1RZIB 3CAFA 5KS9E 3DTXA 3VGBA 4YK4B 2DMCA 3EOAB 3M17B 1KNOB 4NN7C 3T0AA 4GBXA 7FABH 4YDKH 1D6EB 4K3DH 3LKQA 1EEUA 3PQYE 4XCYA 5E6YA 1OGTA 1Y18B 5E8EB 1XR8B 2X4TB 1A0QL 2V2WA 3RGVB 3ULUD 5AD0B 1BZQK 2WUCH 3TT3L 1DQJA 4OI9A 3KJ4C 5SWQA 2JCCA 2DM3A 5KN5A 4JHAH 4JKMA 4K7PY 1GZPB 1KACB 4JFOB 3SO3B 3MO1A 1DQQA 3RWDB 3NFPB 4U1NB 3BMWA 4GW5A 2ESVA 2R1WA 4ZUWA 3W11C 3SHSA 3TNNA 3BE1L 1I3VA 3T1FB 4GW1A 5HYJB 3D87B 1U93B 5F7EH 3FQNB 1TCRA 2EEBA 1A7OL 4RGOH 2HVJA 4X98A 3VXUB 1BFTA 4RA0C 1F2QA 5I1KL 1T7WA 5FDWB 1CTOA 3L3JB 2AK1L 1AI1L 4PP1C 5DS8A 2XA8L 3X11A 2N1KA 3KPOB 1VADB 1EEQA 1X5LA 1LP9E 2I27N 4MLSA 4DFHA 5C71A 5JR1L 4L9LA 1Q9OB 2V9TA 4EXKA 3O81A 3IKCB 4RIRA 4GMSH 3V4VH 4O02H 5D71L 1GIGL 4RNRA 1CLOH 3MCKB 5JQ6H 5GSVA 3TIDB 3OKDA 1X5GA 3UTOA 1I85C 1AO7E 1JGUL 4EUPA 1TVBB 4JHBA 4NC2B 5C09E 3SPVB 3VI4F 1F3JB 4CU8A 4MD5A 3PWJB 2R1XA 1FYTB 1BQHB 3DBXA 4HIXH 5HY9B 2XZZA 4LVOB 3DVNB 3MRGA 1OM3L 4XPBL 2VLJD 1K4CA 5B38A 1UB5A 2Q86B 1VGEL 5D6CB 1GPOL 1ZT7B 3C5ZA 3PGFL 4XC1H 3UROR 1YJDC 5DJ2B 3G04A 3VE0B 1I9IL 2YD7A 4KKCD 1OGAB 1I1YB 3LY6A 3QFDA 3TVMC 2CUHA 3QPQD 5E6ID 3P3YA 4O4YH 4UBDD 1OT2A 4FFWC 1F4WL 2DMKA 1JPTL 5CP3A 3LOWA 1BQLL 4FTVD 1TZGH 2LTQB 3DRTA 5IOPB 3VFNB 3VXOA 1YEHL 5IG7B 3WUWB 5I0ZA 4YIQB 1O7VA 5FK9A 3UJTL 1XCQB 3VG9B 3BGAA 2G75A 3SDDC 1J86A 5GGVL 1QYGH 5I1CL 4XMPH 5FECA 3MNWA 5CMAA 2ATKA 1RZJC 3BEVA 2OXGA 1UJ3C 3GI9L 4KKNA 3RWFA 3I85A 4NOBA 3FFCD 2X4UA 1DLFL 2W1NA 4IDJL 3QNXB 4KHXL 1DJSA 4Z95H 2P8MB 2AJXL 4F3FB 5HGAB 4Q6IB 3RVUD 5FA3B 3MV8B 5IESH 4M61A 4MCZA 2Q3AA 1DE4B 1QSFB 4JO1H 3FL7A 2YMXH 2K7PA 1A1NA 2WWMC 4Y19E 1JWMA 3PGCA 2X6MA 1MOEA 4YDVB 1CGXA 2X9YA 4YPGB 4M8QB 3H3KA 3UJJH 4GOSA 2D0GA 3MLSL 1G1YA 1HH6A 5I1AA 4MXWH 4Y16C 1G7LA 1EMTL 2VXQH 5GGQH 4PJXE 3L9RB 4Y8DC 4BSVA 1CLYL 2XWTA 3PWPA 4PJDE 3WIHL 3FMGL 1U95A 1T5XB 4JO3L 4LHUA 5INCB 3RJQB 2F58H 5BZWA 5CD3B 1IGFH 1M4KA 1EHXA 3BZDA 4K94C 4DOHB 2OK0H 1K8DB 4KTYA 3REVB 4DN4H 2A2QT 3ZE1F 4IRJA 3I6KA 3NAAL 3D3VA 1P2CA 2JIXA 2R1YB 1GGTA 3NA4A 4FQQB 3MLXH 3MJ6A 4JY5H 5EU6A 3A6BH 3QR2A 5I71B 1KIRB 5HI4D 4P5KA 1MCNA 1F02I 3LKNB 4FQLL 5GZND 3ULUF 5E0QA 3VXUE 3IDMA 3V0AC 3V0WH 5ABDE 5LAXB 1NLBL 1B4JL 4CVXA 4LP4A 2VR5A 4HZAA 5D7IA 3IDNB 2EEDA 1DVFB 3JVGC 5I8KL 2EDYA 5C8JA 3TWCL 4CKVX 1NC4D 3J7HA 3H9SD 5C0BB 1DUYA 4YE4H 1J11A 4FRWA 1IQWL 3I84A 1JZ5A 4AYFA 4ESKA 1XFPA 4WFHE 4XTRD 1RZKL 3GJFA 3O3UN 1RZIA 2OZ4A 2DTMH 3RIAK 4PJGF 1VGKA 4WFGE 4A6YH 4E5XB 3RFZC 1FFRA 4FA8A 1UYWL 3BRFA 1D6EA 3ULUC 1NPUA 1RJZA 4K7PH 5ITBH 3BXNA 1NEZB 4P2OA 1I4FB 5E8EA 4CAGA 5JO5B 1DBML 4I18C 4OLEA 1JL8A 3VFSA 2YSSA 1H0DA 5KOMC 4C4KT 4A6YB 5TDPB 1UH4A 2CLRA 4MDJA 3IETB 2JB5H 1T7ZA 5D6DA 4RFEB 1A3LH 2VDMH 2EYRA 1EVUA 4PTUB 5FO8B 5C9KA 1P69B 3MGOA 3P0VL 3QCUL 1AKJA 1OGAE 2XZQL 2ENYA 4P3WA 1RY7B 3RWDA 2GSGB 3BQUA 5H8DA 2PCPB 2Y36H 4PJBA 5EUKA 4PBVC 4D8PA 4Z76A 2G5BA 2P8PB 4P2RA 4AIOA 5T1LA 5FYLL 1CFVL 5IFAH 4UINL 5EC1A 5F7DB 2NXYB 3Q6FB 3LIZH 3ULSB 3X14B 5J11C 1D3CA 4HGMA 2YPVL 1QFWI 4HUUB 3QEQA 1BIIB 2PYEA 3WL9A 5F9OL 1HXMA 3L1OL 4IIQA 1KLGA 2P47B 1IARB 5IMOB 4Z6AT 1AGFB 4JJ5A 1FFNB 3Q6GH 3CLEH 1VADA 3UTTD 4Y4KA 2RGSA 3MV8E 2GI7A 3BGFC 3O6ML 1Q9OA 1EGJL 1IC4H 1QSFE 1FC2D 4PB0L 1TXKA 3NCYS 5FYJH 4HXBH 5IB3A 5JHDD 4L4VE 1CG9B 4PG2A 2MQ3A 5F96L 3TPUA 3NCJH 3VGGA 3VFGH 3TYGL 5ILTH 3STLB 2VE6A 5E2UH 2P48B 3L7FA 2VH5H 3NBNA 1OF2A 1ZHBB 2ZCKL 4UIKH 5GRVL 1X4XA 3C8DA 5HYSG 4PLKD 1BWMA 4GKZA 5D1QB 2PXYD 4JN1H 4CNIB 4F2MB 1M7IA 1F4YL 4O2FA 4WO4B 4CVWA 2UZYB 3BEWB 4WUUB 3BMVA 4HUMB 3TBTB 1IILE 4JRXB 5FYLE 1XGTB 1CS6A 1WLHA 3BN3B 1DCLA 2VZSA 5ESVB 5E6IC 1HHJA 2BCKB 1NANI 4UBDC 2ADJA 3ARBD 5E8DL 3GSQA 4P2QB 3VXNB 5T5FL 2DQCL 1T1XA 2BNRE 2Q86A 3I50L 2FX9L 1F8TL 4LPYA 5C08D 4LNRB 4UT9L 4WTZG 2IH3B 3CDGB 1UZ6F 4HPOH 1R24B 3OKEB 2IANB 4NJAL 1XGUA 3AXLB 5DJ2A 5DMIL 4TPRH 1H3TA 5FA4A 4LKXB 1PYWB 1LEIA 5D2NB 4OLVL 3OXRA 4HWBH 4JY4A 4MA1B 3FO2A 5TH2B 5F6HI 4F57L 4S1RL 4UOW0 1OL0A 4UQ3B 1YEGH 5CP7A 4KJWC 1FFOB 1A6WL 5AWNH 2AEWA 5IROA 3MOBH 4MJ6A 4LVNB 4M6OH 3DUSA 1CDUA 1TZHB 4V1DA 3UTSD 5I1GL 4NO5B 3MV9E 2Z31D 4JFXA 1Q9WA 1IGCH 2LFGA 3UXFA 2NY6D 2JTDA 2L0DA 4ODVL 2F54A 4G5ZH 4RMVA 1DEEB 4NO0A 3KLAB 3QA3B 1ZGLM 3MLTA 3QNXA 4UOW1 4Y4HA 5FEBA 3VGAB 3MNZA 2F9BT 1PG7X 5E5UB 3WXWH 5HPOA 4M7ZB 5HGAA 2IBZY 3MYJA 4ODWA 2JJVA 4P3DB 2VWEE 4KKBD 4APQA 4OZ4B 4M93B 5E4EB 2O5ZL 1HI6A 2Q76B 3NVQA 4IRZL 2VL5B 4IJ3B 4GSDH 4LBEB 1I8IA 4HGKC 3SCMD 2MCPL 4OQTL 5DRWB 5C0AA 1UA6H 3T2NH 4MQTB 3T4YA 3DARA 3PL6A 1ZSDA 2ARWA 5GS1C 4G9DA 4S0SD 2RB8A 1FVEB 3DRQB 3P4LA 4LPUA 2GUOB 4R97C 4NNYA 1W0VB 4NQCB 1K6QL 3QUXA 4NKOB 1P9MA 1YEIH 2NTSP 1MCSA 4LCYA 4Z0BL 4ZS6C 5GZNC 2EO1A 3FQWA 2FD6L 3D69A 1U8JA 4GLRI 5DJ8B 1WT5A 4PRAA 3PABB 5F7UA 3NABL 2BERA 3DMMD 4I5BB 2J8UB 1KCSH 4GG6A 2UYLA 4LOUD 3HMXH 5EZJB 4O58L 5GZOD 1IBGH 5GS2H 1KEGL 3HI1A 2GIYA 3KXFA 4K3EH 3LQZB 2CUIA 5IP4A 3WN5B 2UWEE 1DBBL 2NY0B 1DVFA 1HEZB 2VOTA 4PJHA 3MMEA 1OTUC 1S9VB 4DAGL 5CINH 4HUKB 2VLMD 4G6FD 2FYYB 4MCYA 3K46A 3QIWD 4XGZA 1KGCD 2VNCA 4PRDB 4I2XB 4EIZC 3TIEA 3HE6D 1XIWB 3BPNB 3HC3L 4H20L 4ZO7A 5A1AA 1IM3A 1TZIB 5DTFA 4KKAD 2P24B 2FDBP 3OKMA 1M7DA 4ZDHA 3UJIH 4HW6A 1YECL 3UZQA 3LZFL 1BD2A 2ADIB 4AMKH 4NQSA 3GMRA 4CN6A 4Y5VB 3GM0A 5TF0A 1NAKL 4ZTOL 1OSPH 3I6LD 4WTXA 4ERSH 3K4ZA 1U42A 5DJCB 4P2QE 3L7EB 5TDPA 1OARL 3NZ8B 3CFBA 4YHZL 2Q7YB 3NIGF 1FRGL 3OZ9H 4MS8D 5FOBB 1KG0B 4HH9B 5I8EB 3ZYOA 1HYSD 5E8OB 2F8VA 4FXGB 3GI8L 4HS3A 2DI8A 3VFMB 4NUJB 1I8MB 2PTUA 2QHRL 3V7AG 2APVA 1MREH 4X99A 5DF0A 2EDKA 3N1PC 3O8XC 2B5IC 2GJZA 4WUKH 1MIEH 2P5EB 2HN7A 4I9WE 5F8QC 1T21B 5GISL 5C2BL 5C70A 1CD8A 4Z9KB 5IT2H 4UTBH 5FGSA 4P5MA 3SGEI 3HNSH 5C07D 1DSFL 4QHMB 4IMKA 2E7HA 1E28A 3EBAA 3RWJA 4PGJA 2LVEA 3RVXD 2RHEA 1L6ZA 1WC7A 3PHSA 4D9RE 1AGFA 4C56B 2V6HA 1YNLH 1ZGLA 3C5SB 1U8QB 4S11A 5GSRB 4PLKC 2M2DA 3GBML 1G7HA 3OV6A 4N68A 4NO3B 2WZPD 5CEZL 4FQJH 3UP1A 5C7XL 3S3SA 1XF5B 5FFLA 3BPLB 3BYYA 4N0RA 3MLPA 1BZ7A 2XIDA 1CG9A 4ZD3L 3KPTA 1T5WA 4HZLB 4XCEA 3I02B 3STLA 1JTPA 2W9DL 5DC0A 4HDIB 4D0BA 4M1CD 4N0YH 5EIVA 2H32B 3ARDB 2F5AH 3ARBC 4XVJL 3C09C 3T0EB 1EA9C 3FTGB 3MOAL 1CD1A 3RTQD 4Y8AA 4OCSL 5TPWL 4GKSA 3SGDH 4W6YB 3S7GA 4X7FC 1X6NA 2Q6WB 5ESVA 4LSUH 3SBWC 4NQCE 5IBUB 3VGDA 1NMAH 2BCKA 4RQQA 3T0VA 1JPFA 1G7IA 2ORBL 2DLEA 2DMBA 4TOYL 2UVFA 3ZT6A 4YGVB 3T0WA 3RVWD 2IH3A 3OKLA 2IANA 1A7RL 4LKXA 1KN2H 1RJCA 1CL7L 4MA3B 4QGTA 1YC8A 4G9FB 4Q9QL 1SJEB 3B9KD 2BVEA 2HVKB 32C2B 3IXAA 3LN5B 5E03A 5F1NA 1JNLH 3O2DA 3B4NA 2J8UE 2BSED 3KHQA 1FFQA 1QBML 2UY6A 2VLRB 4Z7QF 5LQBH 3F8UB 4NHUB 5K33A 3D85B 4MWFA 1JF1B 1FDLH 4UZGA 2DBLL 2M26A 4QRRD 3GSNB 3DV4B 4DCQA 3S98A 4HG4J 3MGAA 3VRJA 5I1EH 2OX5A 4KKBC 4HWBA 5LGHL 4HX1B 1CR9L 1VACA 2QQKH 1G7JB 4DZBB 1X7QA 1DBKH 4NN7B 5KW9L 2DD8H 4G8FA 1EFXD 3ILQD 4M6NL 3SCMC 3VW3H 4L8BB 1G84A 2GJ6D 2X1XR 1DQDH 3SJVE 1HOCB 3GBLA 3OJDA 4P3DA 2VQUA 3ZYZA 4PGEB 2A77L 2ARJA 2APBA 1MFDH 1QSEB 4LBEA 3P73B 4FQXA 4W6XB 3DX7B 3QH3A 1FC1A 1T2QL 5MEND 5JDJA 1WFNA 3IDJB 5L2KB 2R8SH 5F7YC 3ARQA 4L8SC 4EXPX 3H9HB 5AZEL 3RNQB 5J7CC 3BH9B 2GTWB 1KBGL 3QIBA 1AQKL 2AGJH 3PG2A 4QHKJ 2A0LD 4D2NA 5ADOH 5KVEH 1P5VA 3EJYD 1YEKH 4G7VL 1F42A 4XP4H 3TNMA 4OCXH 1I7UA 4UB0L 4EI5A 3GMNB 1DBAH 4FFYH 4ENED 4WY7H 2ADGA 5GZOC 2AVGA 4XWGH 1F3RB 1RV6X 2LQRA 4G8EA 1SY6H 4KK6C 4QTHA 3EO0A 3EDJA 1GC1L 3BPCB 1FNGB 2FO4B 4E41B 4PJ7A 4PG9B 1TJIH 4XVTL 1YMME 3PABA 2D2OA 5KTEL 2P5EE 1FORL 2VXUL 1IQDB 1GGBL 1MFAH 2YD8A 3AS2A 1LO3H 5CCKL 3D6GA 2IEPA 4MAUH 5EZJA 1MQKL 4HIEB 5DVKA 3M8OH 3QWRA 5J0BA 1NGZB 1FBIH 1UM5H 4L9DA 3P77B 1OSZB 1CD0A 1KB5B 5H37H 3QIWC 2ID5A 3MJ9H 2DKMA 4U1IA 1J0JA 1Z5LB 2DWDB 3LS4H 3TP4A 1VERA 3HE6C 5CAYB 1YNTB 1FL6B 4OF3A 1MCEA 1G9MH 4G7YL 4KKAC 5E4IA 5SWZD 1J1PH 4K7FB 4OZHE 3HMXA 3GNMH 2AABH 4X6FB 2CK0H 1NJ9A 3K8MA 2PYFA 3P11H 1CE1H 4XMLL 1H5BB 2JJWA 2VUOA 5ID0A 3GSXA 1E4XH 4D9LH 4I2XA 2IG2H 4M43H 5DVMA 4P2YA 3VWKD 4LCWD 1G6RB 2QSCL 2P24A 3AREA 3BIBX 4M00A 4ZXBD 1I9EA 4U31A 4L4TE 3PWVB 4KK8C 1YEJH 4MS8C 2DLTA 1YPZA 4YNYA 5I1IL 4Y5VA 1HYSC 3TV3L 4RWYH 4YUEL 3MV7A 4G8GA 4NFDA 3U6RA 1KJ2B 3RAJL 2DYPB 4J23A 3RUGA 4F15C 4PJ9D 4NQVA 5EBLB 3OAUL 3WFZA 4OLXL 5I74C 4QKXB 3VD3A 5E8OA 3TN0D 2QKIA 4FXGA 1QLFA 1N5AB 5TQ0H 3QRGH 1RHHB 4F37K 5L7XL 1FAIH 4NUJA 4G9FE 4UQ2B 2RQ8A 2HTKC 2R56L 3SDDB 1LE9A 1BLNA 1IT9L 3HNTH 2ZCHL 5HHXL 4LRIC 4F80A 1WCBB 2H41A 3GMOA 1KLFA 4X6EA 1N6VA 2NXZD 2X4RB 1N8ZA 2EH8H 1G9EA 3KPLA 3D2UD 1FGVH 2A9MH 1B6UA 1B3JA 1II4E 4ZPTB 3QDGA 2LV4A 1TLKA 1QA9A 1NQBA 4C56A 2HFEB 2CDEB 2R15A 1V3MA 2WWKT 3E6HB 5GSRA 1UXWB 3STZB 1Y6KR 5DRNB 4PP2A 1FCGA 1JZ6A 1MAJA 4QYOA 4LSPL 1WQVT 2FECL 2NW2A 4J1UA 3UBXB 3ROLA 3SDYH 3QZWG 5D93C 3HRZA 5F1KC 1CGSL 4MJID 5D5MF 3ARDA 1AGEB 4ZSOA 4DFIA 5L2KE 2YUZA 1JZ4A 2VZOA 2PO6D 3RVWC 4G6JL 5DJ6A 1JGDB 3VI3F 3WJLC 1WZMA 3PIQA 1FE8L 2NNAA 2Z0BA 3JV4B 3B9KC 2C3VA 3HPLA 3LDBC 1QBBA 5CHNB 2XRAL 1U9KA 4UNUA 3FKUS 1R3HA 3TT3H 3WIIL 1J12A 1PEWA 4AK1A 3ZTJG 4KRMB 4WDIA 1U8NB 4WGWB 5C0DB 3BP4A 5BVJA 1A6PA 1SJEA 4LLDB 4U1KA 3SEPA 4DVBB 4N8PA 2HVKA 2I9TB 3NGBC 4RMTA 2X1QA 5BS0A 3BE1H 3IJHA 4QNPF 1ZLWK 2FLRT 3ILQC 5JPNA 3WDIA 3O0RH 2MWCA 4ISVB 5HHOD 4M4PA 1JF5A 1A7OH 4NM8L 1YY9C 2I5YL 3QEHA 5D1XA 3EUUA 5JIIA 2VDPL 4OF0A 5E9DB 5FV2A 5I1KH 3FB6A 2BVPA 2DBJA 4DZ8B 4H8WC 4E0RB 3KWWB 5T33L 2AK1H 1AI1H 2W38A 2XA8H 4F7MB 2AAVA 3V0VB 4MQSB 5IM7B 2ZPKL 3T4AA 2UV3A 2IAMD 5A16A 3S34L 4BQ8A 4F7PB 5CILL 4H0GA 4HMDA 1VFBB 3SE3C 4M1DL 4OV6F 5IVXF 5D71H 1GIGH 4LDOB 2BHZA 5KSVB 3EJYC 2PTTA 1FFPA 4UI2A 1JGUH 3H7BA 4KDTC 3GMQB 2XOTA 4ZFZA 4XNZC 3TESA 3TBWA 4JDTL 5JOFB 5F6IB 3MBED 4ENEC 2NW3A 4LCCC 2QLVB 4PJGB 3MRLB 1ZXQA 2FHCA 1MCWW 1NBVL 1D9KD 5KSUA 1JPGA 1IAOB 3MCG1 2NCMA 3O2WL 4P3CL 3TO4A 3NCFB 1OM3H 1L7IL 4XPBH 3ISWA 3ZTNL 4Y88A 1VGEH 4OFPA 1VESA 1N6UA 4YFLI 1GPOH 1N26A 3PGFH 2AJ3A 4HGWB 5J11B 1I9IH 1YYLL 5I66A 1OWRM 5B4MC 3SDAD 3FT4A 2AERT 1D5XB 1BVKA 5JPMA 1JPTH 1H9VA 1P7QA 1BQLH 1XZ0B 4OLYL 1YEHH 2ICCA 4R26L 1FL3B 1S7TB 3QUZD 4HJJL 3N06B 2HFTA 1P84K 1UVQA 3W0WA 3BGFB 1XEDA 5GGVH 5I1CH 2EYTA 5I19L 2Z91A 2WK2A 4FXKB 3MRNA 1T6VN 3O4LD 3SDCC 3GI9H 4I4WB 1YNTA 4ZUVA 3QIUC 3V6FA 4NRZA 3VWKC 2CSPA 3GRWH 1SVCP 4XZUB 1DLFH 4IDJH 4M9OA 3H0TA 4X6FA 3E6FB 4JFED 3ULVD 1NCUA 2AJXH 2VLLB 1EAJA 2A6DA 5TFSL 3VFVA 1WAAF 1AC6A 1K8IA 1ZT4B 4G42B 3IDIB 3BO8A 4LSRL 3MJ9A 2BJML 5EORL 1T89C 4QTIL 4CBPA 2OL3L 5FGBC 1ZGLP 5I30L 3IB4A 3MLUL 4PTTB 1IAKB 4RGND 3QQ4B 4ZOCA 1AR2A 3BZEB 2X10A 3TN0C 4QRPD 3ESUF 4X83A 1QOKA 1S9XA 3MLSH 3FONB 1R3LB 4FNLL 4AL8L 4MJ2A 1EMTH 5IB1B 3DNKA 3BN9D 4MAYD 1T80A 3MRCB 3VRIB 4JDZB 4P2CG 4XC3L 1CLYH 3K4AA 5KVMC 3VFRA 5HHQA 3WIHH 3FMGH 2Y23A 2FJFA 2Z92B 4Z7VB 4EN3D 2HFFA 3CLFH 4JO3H 5D1ZD 3DO3A 5GHWL 1CICD 2NXZC 4XBGA 5EH1A 5ESAA 5D7LB 4OIAA 4Z77A 3S4SB 4U7KA 5DLML 5I2IB 3NAAH 4QHUA 5EU3A 2BVYA 3ZE0F 4F33B 3SQBA 4F9PA 3TA3B 1AGDB 2NY3D 1BVLA 1RUPL 5BW7C 2X4RA 3ZE1E 1LEGB 4FQLH 5CIPH 5HHVL 2CH8A 5E9DE 3LQAC 4N9GA 1SJXA 1YY8B 1Z9LA 2VDNL 3BRGC 1NLBH 5D7JD 1B4JH 1XF3B 3O2VL 1GH7A 3EYFA 2AXHA 2LE9A 2OTPA 1K5NA 4CGTA 3JTTB 5I8KH 4GFTB 3ULUE 3TWCH 2YPLB 4W4OA 4KTEL 3DXAA 1S7VB 2NX5D 3Q1SL 3STZA 5LGKA 4U7MA 1IQWH 2Y06L 3GMLB 2PO6C 2L7JA 5E1AB 5TQ2L 5JUEL 3B6SB 5EO1B 1RZKH 4LLMB 2YN5A 4PRBB 5T3ZE 1UYWH 2C3WA 4WW1A 5KG9A 5HJ3B 3QBTB 3MROA 3W82A 2QADD 3QDJB 1DLHA 3E3QC 1AD0B 5DHVH 4PJGE 5D9SB 3RPIB 3RZCB 1SYVB 4AT6B 1HHIA 2VMFA 5HGHB 2ZWLT 3B9EA 1C16A 4B7LA 5CSBA 5GS0D 3HAEG 5B3JF 1DBMH 1AJ7L 3NZHL 2DJUA 4DEPB 4X6CB 3OAZK 5T1KD 4IRSB 1QLEL 1O5DT 3KPMA 3P0VH 5DHVB 4YEEA 4OD2B 1ZLSL 2XZQH 5GGRY 3QI9D 4HFWA 3C8KB 5TDNA 3O3EB 2C4FU 4LLDA 1NGPL 1ZMYA 4M6AA 4DVBA 4Y2DA 5CGYD 5I1DB 1LP9A 4NBYB 4X6BB 2EZ0D 1HSAB 3G5VB 1CFVH 3OJVC 3VXQB 4UINH 3TYFA 1U3JA 1WUNT 1QTYT 3WKNA 1N59B 3CDCA 1HSBB 2YPVH 1EVTC 4XPGL 3N85L 5TGBA 3JTSB 4JY6A 5F9OH 5KVFL 4JFPA 1WTGT 4YX2H 3KWWA 3L1OH 3H42L 1BF2A 3WE6B 2XTLA 2D9QB 1UG9A 4XX1G 1DL7L 4PRPB 4F7MA 4Y1AB 5JA9A 3SDXB 3CFDA 5IVZB 3VMOA 2VKXA 2APFA 2YUWA 3PV6B 3O6MH 1EGJH 1EHNA 2CLVA 4PB0H 3MBEC 2YEZB 4F7PA 4HJGA 3FB7A 5F96H 2EH7L 1RUQL 4PJ5E 4RX4A 4XNUL 3TYGH 3B43A 3H3BC 3WNKA 3WS3B 2ZUWA 2ZCKH 1D9KC 1XMWA 4EJ1C 5FCUL 2AXGB 1CLCA 4LP5A 1E27B 1NUDA 1X9QA 2XWBB 1F4YH 4RZCA 4ZODA 2AKRB 2HFGL 3ULVF 1NEUA 1IEBA 1NAMH 2FJHB 2NPLX 5GGUB 5B39G 3SDAC 4P5TD 1IAOA 1QUNA 2EXWD 4L4JA 5E8DH 1T0NA 1TTUA 35C8L 3ARFD 5L88L 5T5FH 2DQCH 2B5IB 3O8XB 4GUPA 2FX9H 3I50H 1F8TH 4UT9H 1KT2A 4NJAH 1T22B 5DMIH 4X0KB 2I9LB 4OQ1A 4NYLB 2I26N 4OLVH 1NAMB 5I0DA 3ZDXF 2DLGA 5EOQL 4X4YB 5DHYA 1UZ6E 2B4CC 3VCLB 1XZ0A 4F57H 4S1RH 4LLYB 2XKUA 4HKXA 1A6WH 2E7CA 4G3YL 4OI8A 3CH1B 3FO9B 4NQED 4ONGL 1S7TA 3ULVC 3WIFB 4F8TA 4Y19A 1FQ9C 1UC6A 5IB4B 4X5WB 3LD8B 3HRPA 1F58L 5FUOL 3JWOC 5T1MA 3B9AA 2CLZB 4ODVH 1S7WA 3BKCL 4LQFL 1UKTA 3PWLB 4JRYD 5E95B 5ENWB 3R8QA 3SGJA 1VENA 1F45A 2BNQB 3B2UD 1TNNA 4PJXA 3C09B 1JV5B 4OZGB 4AEIL 4PREA 3O6FD 2VQTA 2E9JA 2CIIA 2NLJB 4LEXL 1ZT4A 3SE4A 3IDIA 1UWGL 4Q9CA 1S9WA 4F9LC 2HKFL 4QOKD 1N0LA 2O5ZH 3BN9C 3W39A 3LCYA 4K3JL 2MCPH 3KPSB 4OQTH 3MJGX 4OJFL 2JB6B 3UYOD 5ECJE 4EN3C 5FV1L 4PJEB 4L3ED 5HVFB 1FCCA 3IF1B 3M07A 1CICC 1WWAX 5IB1A 1HYRC 2Z93A 5E8NB 4JDZA 1ZS8A 5IF0A 4L3CB 5DJYB 2A73B 3GHBL 2H8PB 1U8OA 3P30L 4FN0A 1K6QH 4OZFG 5DQ9B 4HUNB 2Z92A 4EDXB 4NC0B 1MHCB 3PF2A 2NY3C 4Z0BH 3GSRB 4NKMA 1T20A 2FD6H 1QPXA 3DROB 2P5WD 4RFNC 4GJTB 4F33A 2Y6SD 3NABH 2J7LA 1S3KL 5FYKD 4O58H 4YAQA 2Z9TA 1VSCA 4G80A 1LNUB 4ZFOL 3NFSL 4U1SB 1DBBH 3EJZD 3DURA 1BF8A 3H6JA 5E70A 4MNHB 4RA3A 2R39A 4Y1AE 1S7SA 3CZJA 1B0WA 3RHWF 4DAGH 2E6QA 2NY4D 5CIPA 4M62L 2AV1A 3M1BB 3PWNB 4AJ0A 4MDIA 5GRVK 2R0LL 1RHFA 2QEJA 3DIFB 3QQ9C 4HUXB 4EI6B 3HC3H 2R2HB 4H20H 4LU5L 2ZUXA 3UC0L 4JM2C 3CFJA 4R0LB 1MRFL 2G2RB 1YECH 4XBEL 3LZFH 1F4XH 1NCWL 3QWOA 4NCDA 2WIIA 1TPXB 4PJAB 1NAKH 4ZTOH 4GRLA 4L1DA 3QQNA 1W2KT 3QI9C 5H94B 1NC2B 1HQRB 5EU4A 1CQKA 5AAMA 5CGYC 5ISZD 1OARH 5JQHC 1WSST 5JDSA 4F8QA 4NQDB 1BGXL 4YFLF 3WEXA 5JA8B 4YHZH 1FRGH 4BFEA 2HLAB 3AM8C 5GGRB 1Q0YL 5D70L 3WS6C 2E5EA 2GK2A 4ZNEE 3UTTE 4ELKB 3GI8H 3KGRA 3CU7A 1ZLUH 3L95A 3QEUA 3QG6A 3SKMB 2A6KA 2QHRH 1NGXA 3G5XA 4ELMF 4K23L 1U6AL 2X44D 4WFFD 3DX6A 3MRDA 1TTGA 1YEDB 1HSAA 4PPTA 2QQQA 4L4VA 5DD1L 5EOCH 1A2YB 1FZKB 5GISH 4L8CB 5FKAB 2VJXA 2B1AL 3RDTA 3PDOB 1M1SA 1DSFH 3MR9B 4AEEA 1SEBA 3QFJA 3B9DA 4F7TB 1A8JH 2IQAB 2H2SD 3ARRA 3SDXA 2BSSB 4ZQKA 2GEEA 3BDXA 5C08E 5BRZB 3GBMH 3LRHA 3QDMB 4CADB 3MGTB 3PV6A 4KKLD 2WMPA 1MI5A 5CEZH 3K3QA 4NHCL 3WJJC 5C7XH 4YHPB 5IMKB 4NCC2 1A7PL 2BNRA 4ZD3H 4N0UB 3QO0B 3CFEB 1KPRB 4LCIL 4WWKB 3DV6A 2W9DH 2AP2A 3KPSE 1VPOL 3W9DA 2X4PA 3PQYD 3UAJD 4P5TC 4XVJH 2EXWC 1MF2L 2L4OA 3OR7B 4PJEE 3ARFC 3MOAH 5EPMB 1MCIA 3RY6C 1F11B 1J8HB 3RWHB 1EGJA 5TPWH 4RISH 3VA6A 1FH5L 1CD9B 4AQOA 1FIGL 3DX9B 2ORBH 2H2PD 1FNFA 4JAMA 3MV9A 4TOYH 4HWEL 2RFXA 2YZ8A 1U8PB 4NO2A 4GQPH 5HGDB 1A7RH 5HYQB 1GGCL 4ODXB 1CL7H 2R23A 4YXHL 1YEEL 4Q9QH 2BY0A 3V4PL 2QR0B 2GQHA 1ADQL 4FABL 3VCLA 4Y4FA 4GKNA 1QBMH 3U7YL 4HJ0D 2R9HD 3V7AE 3FO9A 1TDQA 3B2UC 2I07B 2DBLH 5DRXB 2WBJD 4H0IA 3MUHL 4H25B 3HE7D 4LL9A 4Z7QE 5LGHH 3L3HA 5A3ID 5JW5A 2XI9A 1HDMA 3VFTB 1CR9H 4P4KA 5D93B 4MD0B 4UT6L 3HUJA 3HNVL 3QXUA 3QSKB 5DWUL 5KW9H 4BSWB 2F19L 4M6NH 1CN4A 1BFOA 4PRNB 5DEFB 3IYLW 2NLJA 2QSVA 4QY8B 1FIEA 2GITB 4J7RA 2R2BA 2A77H 1JHKL 1R5VB 4ORGA 1AO7D 5LCVL 4PRHA 3U7WL 4DJMA 5ICZA 2O93L 1IE5A 3MREA 5D7KD 3V95A 5C09D 3C6LB 4J6RL 1A6VL 3RGHA 4YQXL 1T2QH 1IGYB 3R8BB 5E5MB 3D0VA 1WISA 3T2OA 4A2MA 5AZEH 1V3LA 4QXTA 1KBGH 2BDNL 1AQKH 4NQDE 4X5XB 5HXMA 4NM4L 1ZLUK 5DQ9A 4OQTA 4G7VH 4PJIF 1MLCB 3SGKA 4X8JB 1CXHA 2E9BA 3F62A 5CFHA 5EUOF 2VLME 1S78D 4JZOA 3IXTB 1KGCE 1OAXL 1I8LC 1GC1H 4TQEL 3OKYA 2RR3A 4XVTH 3ZYIA 5KTEH 5F1SA 1G9NC 1A5FL 4GAJL 1FORH 2VXUH 1GGBH 2ITDB 1ZVHA 2EIDA 2HT4D 2JCCF 3F7YB 5CCKH 2Z35B 2EDWA 4OFYA 1RJLB 2IADA 1BECA 1MQKH 1MUJA 3BWAA 5EWIL 1GJIA 4NOFA 5CKAA 2NY4C 5TDOB 4GBXC 1RZ7L 1FZJA 1QEWB 5JW4N 1LNUA 5SV4A 3I6LE 1WBYB 2IWGA 4N0FA 3DO7A 3EKCA 1ACYL 4G7YH 1NFDB 1LO5B 2P46B 3QDME 5BRZE 1OAZL 4R96A 4XNMA 1LD9A 3U4BH 4HF5L 3KS0H 1G6VK 1UM4L 1BREA 5F7WC 4R4BA 4LNVA 3TBVA 4S2SB 4N0UE 4XMLH 2VL4A 3KLSA 4LF3B 5B8CA 4LCCB 4RRPA 5DJ0A 1S7QB 1AD9B 3JWDC 2CXKA 5D72L 3P0GB 4HD9A 1PG7L 1PZ5B 3VXMB 5MEOA 1A6TA 1U58A 5IIEA 1UEMA 2O26U 3PP4L 3RP1A 3EFDL 5HHME 5CLTA 1JNHA 3U4EB 3QHFH 3QXVA 1BIHA 2ERJB 3Q48A 3RGVD 5I1IH 3TV3H 2IFGA 4YUEH 5DYOB 2FJGA 3X13A 1UWXH 3T0DA 3CSGA 3RAJH 3ZO0A 1HILA 3KHOA 3GIVB 3OAUH 3IJYA 4OTXL 5EBMA 3D0LA 4YZFE 1Y6NR 5LWYL 2AK4A 4HKBA 3T8XB 2X9WA 5LGJA 5L7XH 1RURL 1JNJA 3ZL4L 3HR5A 1G1CA 4KJQD 5I75C 4M5ZL 4CRPA 3ARXA 2R56H 4DKAA 1WBZB 5HYJD 4PJ8A 3QJFA 2IPKA 3K8KA 1IT9H 3NN8B 1OD9A 2HJLB 4KRNA 3LN4B 3SDCB 3DX8A 3E0GA 2ZCHH 5HHXH 4HUWB 3VXUD 1YUHA 5GXBB 4QRSA 3MCLL 4NKIL 2BP3A 2YD6A 4HFUL 4L8CA 4DVRL 3HCVA 1S5HB 4WRLA 5IMMA 2E9IA 4JZNA 3FQXA 4U0QB 3BYTA 3OR6B 4KKLC 4PB9L 3CXHK 3MR9A 3NH7L 3AAZB 3EAKA 5DMGD 3U0WH 1PEZA 1Z3GH 4CJ1A 1URLA 1JTTA 3A6OA 3LRSA 3Q5TA 1T7VA 1JWUA 4RSVA 1BOGB 1HHGB 3UAJC 4WFHD 3K4DA 43CAB 5JOPE 1DUZB 3HS0B 5F1IB 4UNVA 4LSPH 3TH2T 4FP8L 2YC1A 3D18B 2X1PA 4NNXA 3QCVL 1KPRA 4KC3B 4YHOL 4JREB 4JFDA 1G7MB 1KJ3H 5EBWB 3C5ZC 1CGSH 3OAYH 3KPRB 5EOCJ 2H2PC 3L5JA 1FYTD 2ZSVB 1F11A 1J8HA 5DJZB 3U4AA 2Y5TB 4NFBA 3S36L 2OTWB 3ROOA 3Q0HA 3DGCR 1FE8H 4YH6A 1G7QB 4QRQB 4EVNA 4PR5B 5CJOH 4C58B 3DX9A 4OF6A 4YHNA 2QHLA 1OGAD 5HTSA 2XRAH 1WZ1L 3HZYB 3VI3E 5J6GB 2C7UB 1L9MA 4HJ0C 1FN4A 2R9HC 3WIIH 2GJ6E 2FIRT 5HGDA 1HQ4A 3U46A 5HYQA 5DQJB 3ZT7A 1KJMB 1LWRA 4NZDA 3H3PL 4ONHB 5MERA 1IEHA 3MRHA 3SJVA 5CJXA 3QUMB 1ZWIA 3D39A 4CVZB 4U1HA 1EEYB 1MVUB 1NGQH 4HC1L