1KTKE

Complex of streptococcal pyrogenic enterotoxin c (spec) with a human t cell receptor beta chain (vbeta2.1)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
247
structure length
247
Chain Sequence
b'GAVVSQHPSRVIAKSGTSVKIECRSLDFQATTMFWYRQFPKQSLMLMATSAEGSKATYEQGVEKDKFLINHASLTLSTLTVTSAHPEDSSFYICSALAGSGSSTDTQYFGPGTRLTVLEDLKNFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exotoxin type C
molecule tags Immune system
source organism Streptococcus pyogenes
publication title Structures of two streptococcal superantigens bound to TCR beta chains reveal diversity in the architecture of T cell signaling complexes.
pubmed doi rcsb
total genus 20
structure length 247
sequence length 247
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ktkE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ktkE02
4DGIH 4PP2B 4QRRB 5A43C 4P9ML 4KTEL 1VFBA 2Z4QA 3QDGB 5DMKB 3STLB 4WW1A 3KJ4B 5B8CC 2XA8H 3IETB 3MA7B 5E8NB 1IGCH 3QEQB 4OCRH 3VW3H 3MGOB 1T22B 4EI6A 1EJOH 2DTML 5IFJA 4WI8A 1DQML 2GTWA 1OY3B 2BOCB 5F9JA 3BZEA 2XXMB 2VSCA 4CRPA 4N68A 4QRRA 5GS0H 4LPWA 1AI1H 4NO3A 2R8SL 3O4LE 1MLCB 2CJUL 2JCCE 1BVKA 1JGLL 3RKDD 3D18A 3Q6FA 4JPWL 2ZNWA 3FB6B 4UV4H 1BJ1J 1INEL 4OAWB 2QQQA 2BNQA 2YPLE 2WQRA 4W70A 4LAQL 1YEGH 1VGEH 4DKEL 1R3IL 4M48H 4DN3L 4S1SH 1PKOA 1CDUA 2YS4A 3MXVH 4LSRL 4JM4L 3ALXA 1BFOB 1JHLL 4NWUH 5B38G 2DJSA 4HSQA 3BN9C 4JQXC 3QI9B 5HGBA 4XVJH 5DURB 1EMTH 4I18B 5CILL 1WF5A 4PRAB 5JNYB 2ILLA 3DIFA 5KSBE 4YK4B 2YPLD 3MOBL 1QG3A 4NO5A 3PP3H 1H3PL 2AJUH 4NRYB 3CFCH 4K7FA 1SJHB 1CLYL 5KS9B 1JRHL 3TT3H 1B6DA 1UM5L 3OKDA 4YZFE 4MA8L 1RJZA 3WFHB 4Q2ZB 4ZYKA 1SJEB 3LMJH 2VH5L 2VLRA 4JDTH 4DGVL 1LE5A 4YR6A 5ADPL 1VB9A 3UPRA 4DZ8A 3DIFB 4D9RE 1I75A 2NX5D 4NBZB 4FFYH 2OXGA 3FFCD 1OP9A 3VJ6A 4L3CB 4CW1A 2DJ4A 5DJZB 3VWKD 5GS2D 1N64L 4XI5D 5JPNB 3BGAA 2W38A 3WFHA 4N0UE 1MFEL 4TRPL 2EO9A 2AKRB 1VFAB 4F8QA 1MVFA 1LO5B 3MYJB 3BH9A 1I7TA 3CCHA 2VDLH 5E8OB 5T1LA 2Y07L 2ZZUT 2CPCA 3ARBB 5KW9H 5CZXC 3RNKB 4P2CG 3FFCE 3UJJL 4NUJB 2ERJC 3WE6A 4L8SA 3V5KA 4U6VH 4RFEA 1SJXA 3CZFB 1VESA 3FZUD 3BPCA 4UTBH 4IDJH 4OFYA 3P30H 4QHNA 1VFAA 4RGOL 4LCIL 5ALBH 1GPOL 5F7MC 1CL7I 4ZFGH 2VQUA 1JPTH 2VDOL 3F7RA 4UU9A 2KZWA 3WHE1 3HC3H 3RNKA 2FX7H 4KV5E 1JTPA 3HLAB 1AD9B 4QYOB 5BQ7A 1ZSDA 4RBPH 3HNTH 3KHOA 2IALB 4GRWF 3V5KB 1CDJA 3KPLB 4CJ1A 2R0ZH 2KDGA 4OI9A 2W1NA 4KZDL 3ZE0F 1BD2D 3CLFH 4XP5H 1XGQA 4OZHA 2FR4A 3BJLA 4JVWA 5CIPB 1HNFA 4OUUA 5H37H 1BAFH 4HKJB 2WIMA 3UTOA 4L3ED 3VRLF 3LN4B 2DWDA 4MB4A 4JKMA 5E4EB 3GSWA 1AGEB 3JTTA 4JB9L 1FORL 4KUZL 2IALA 4I9WD 3R0NA 3B83A 4PV9A 3H9SE 3N1QC 3EYFA 3P2TA 4Y4HD 5DVMA 1ZLSL 3EOYG 1YEIH 5TE6H 1UKTA 4OBRA 5IQ9B 3C60B 4O2CB 1T3FB 1CGXA 1C1EL 4LBEB 4OZIA 1OTSC 3GI8L 5ERWB 4P4KA 2W0FA 5HHMD 5C0AD 3D0VA 1MFAL 4NKOA 1UFUA 5BOPA 1J8HA 3V6ZB 2Y5TB 4WRLA 4X5XB 3V8CA 3X13A 4WO4C 1F2XK 5CD3B 4NO3B 4HWBA 3ARXA 3G5ZB 1FL5A 4JKPH 2J8HA 1TVBB 3MNZB 1QFUH 5D2NA 3SE4C 4Y5YC 3FB6A 1NDGB 3WNPA 1XGYH 3GJFA 4B0MM 1F2QA 4DUVA 3N9GL 3NIDF 5EORL 1NCNA 2GJ6B 4JZOA 4PJDA 1QRND 3TCLB 2FECL 2FX8L 2EH7H 4BZYA 3ZKQD 5LGJA 3PG2A 4L4TB 3PXHA 5IJVB 2IPTL 4ZS7L 4K3GA 4PRPA 5EC2B 1CGTA 4HQQL 3MV8E 2EDBA 5HGAB 4HHAB 1FRGH 4C56D 3FB7A 2W07A 5DD6B 2BNRE 4E42A 2YN5A 3VFRB 5H94B 3EKCA 4NO0D 3ULUC 4UBDD 1E4WH 4WI7A 1FP5A 2YRPA 4B7LA 5EORH 4O51B 3OG4B 4I3RH 3I3EA 4FXLA 1Q9KA 2C3WA 3T0DA 2NY3D 2DQHL 1YMHA 5FK9B 3QFJD 4U0RC 1E4KC 1DBML 1FFRA 3UPAA 4J12A 1AC6A 1IL1A 5H2BB 4GRMA 3GSOB 3EAKA 1C12B 5FGBA 1M6OB 3L3JB 5CEZE 3WXVL 1OAXL 1I3UA 5BV7L 5J4MA 1GZPB 1KTLA 4IOIA 1ZHKB 3BN9D 4NC2B 1C5BH 4U1KB 5IMLB 4L8DA 4NQXA 3U1SH 1S5HA 4OLZH 5C09A 4FZEH 4E5XB 3V6OA 2BSTA 4PPTA 3O45A 5HVFB 2J8UB 4V1DD 1OGAD 3RIAF 3GJFK 2HYMA 3KXFD 3E8UL 2HFEB 1V05A 3B6SA 2ERJB 1S7VB 1BMGA 1SM3L 4XMKL 2IPTH 4PJ7F 4HJGB 3THML 1BJ1H 2YOCA 1U8OB 2X4QB 3TA3A 1KLFA 5JOPD 3KPSD 4ODVL 2Q8AH 4HT1H 3T0EC 4C83B 6CGTA 1OW0C 3IXTA 2EH8L 3MV8D 2DQGL 4ZS6C 4F33B 2FD6L 1NL0L 3P4NA 1P69B 5GJSL 3SDXA 4OF3A 5I1GH 2H45A 3NABL 3TBWA 3B2UC 5F88B 5JHDA 1FZMB 3IXAB 3D3VD 1T6VN 5DUML 3SGKC 1YC7A 1I9RL 4WIQA 5KN5B 2VXTH 3BGFC 2Y36H 1CU4H 3E6FB 1GC1L 1ED3B 4NIKB 1ONQA 1CWVA 5C92A 3NPSC 3SDDC 5B3JE 1IGYA 1L7TH 5SV3A 2YEZA 4KGLA 3P11H 4WFFD 3KR3L 3N50A 1X5YA 3EYVB 1CE6B 2FEEL 4Y5XC 3N1GC 3DBXB 4LU5L 2O93L 4L4VA 5E7FA 1HINL 3DHJA 5FUCC 3DGCR 4RWYH 2GUOA 3QQ9D 5DEGB 3WSQL 2YUXA 4Y2DD 3H9SD 2DWDB 3PWVB 3ROLA 1GIGL 2Q6WB 1IGYB 4M5YH 2V2WB 3CZJA 4Y7MA 3GMLB 3DUUA 1GGIH 1QA9A 1YECL 4LPTA 4WV1B 5CLWA 4JVUA 3DX8A 2OZ4H 5TE6L 3HE7B 5EO9A 5MHSD 3VXTA 4RDQF 1P4LA 2BXZA 5BV7C 3BP7B 5CWSA 5DTFB 4OZIF 5I2IA 1A6PA 3D85A 1JGDA 1OLZA 2MTPA 1UVQB 2AERT 2YSSA 2DI9A 1T1YB 2QSCH 4FTVD 1PG7L 4O9HH 5CP3A 2KQNA 4OGZA 5C0EA 1QFWI 4XCFL 5ADPH 3KJ6L 3RU8H 1KB9J 2Z4QB 2XNAB 1TJIH 3GDBA 4KROB 3R06A 2X70B 3PIQB 2P8PB 3GMLA 1CYGA 1CGSH 4PG9B 1H5BA 1IEAB 2W60A 2QJDA 4WFGD 3C60C 1R0AL 4FG6C 1WSST 2Z93A 3PP3K 2OZ4A 3LIZH 4R7NA 4QT5B 4X7DC 5JW4N 5HSFA 3SKNA 1FPTH 5J1TC 3O3AB 1KB5A 2PETA 5DDHA 5B22A 4LLQB 4N0FB 5JDSA 3MCKB 5EC2A 1P2CB 4G7YH 4YWGL 1FFNA 1RHFA 5HGAA 5DEFA 1N8ZA 4IRZL 3UZEA 1KG0A 1GZQB 4H25B 5IMMA 5DD6A 4GW1A 5F6IC 2G5RA 2FIKA 3EHBD 4JAMA 3SPVB 3MRDB 1IEAA 2W60B 3T3MF 1RZ7L 4XP6L 3ALWA 1S9YB 1ZV5A 4WHTB 1SBSH 1FIGH 3BEWA 2CDEA 4JQXA 4N5ED 2FJGA 4G6KH 4B5EA 2XA3A 3KLAB 1DFBL 5B8CA 2BRQA 4HUWB 3PWPE 3HZYB 4AEFA 2P4AB 1T0MB 4MJIB 1FFNB 4R4FH 4DGVH 1R5WA 2R9HD 4JVPA 2G5BB 1WAAE 2FLRT 4KRLB 1JV5B 4LU5H 1AI1L 4KQ4L 1J05B 3FOLB 1A4JA 3L3DA 4NNPL 3ZYZA 3BEWB 3KXFE 4POZC 2Q20A 3SHSA 5IMLA 2EDLA 2H2SC 3JVGC 3L1OH 2P5EA 1BFVL 2BMKA 4G9FA 1MAMH 4QTIH 1CU4L 1IZJA 1KELL 3JXAA 1G9MC 3IFOA 2FEDC 2R2EA 1U8PA 2XTJD 3HI6L 5IVXA 3DMMA 1DBJH 2DICA 3L3DB 4ZUWB 1Y18B 3MV11 1PSKH 4P46B 4IRJA 3G6DL 2W91A 5GJTL 3OKEA 3SQOL 1ZS8A 5FYJL 5IHUL 5ILTH 4ODVH 5CJQL 4DK3A 3L3OA 3O2VL 4Z0XA 5DHVB 4PGCB 1VERA 4E0RA 3P4OB 3T2PA 3BQUC 3QBTB 3DMMB 2JIXD 2QSVA 5DS8A 1BECA 2R23B 4ETQB 3B2VL 5E9DB 3SGKA 4LLMA 4IRJB 1LVEA 4Y1AD 1CGWA 3BI9X 1R3IH 1U3HC 4M48L 4GRWH 4MHHG 2AK1L 3HKFA 5C0CD 3PF2A 3A0OA 3DWTA 1AXIB 4D2NA 2A6IB 1A3LH 4MDJB 5DR5L 2NR6D 3TYFA 3MXWH 3VWKC 2ORBH 3WNKA 4GO6B 1A7OH 1LO2H 1AP2A 3V0VB 2EZ0C 3SJVD 5GGSA 1DBMH 1MJ7L 4ETQA 1X4YA 5J12C 2D7TH 2XY1A 4PJ8D 2BK8A 5F7HA 4PYGA 1GYAA 1UACL 1N3NA 1B0WA 1CICD 3AFLA 3X17A 4F57L 2H26A 1N59A 5HDQH 1DL7H 2IANB 5C0IA 5H35A 2C1OB 4XBEH 2HFGL 4LPUA 1MIML 1HN1A 1EJOL 5DJYB 1ES0A 3AS1A 1T83A 4X5LA 1U8KB 2GSGB 3VFTB 5HHPA 2B39A 4XBGA 2DQFA 2YSSB 5DJCB 1JVKA 1A9BA 3BZ4B 5HDBE 1J1XH 3T65B 5A2FA 5EU7E 2NZ9D 4G3YH 1I7RA 1VKXA 1RUKL 3C5JB 5KS9F 5KANG 5TPWH 1BVKB 3DYMA 4JFYA 2WSKA 4OCSH 1K6QL 2CDGB 5F8RC 1FZKA 3IU4L 4KDVA 2VXQH 3EJZC 2H8PA 1H5BB 1RZGB 3T09A 1HIMH 3S7GA 5ITFA 3MRQB 4CADB 3FQTB 4HWUA 4R7NB 3ULSB 3FZUC 4I1NB 1I9JH 2VTFA 5FUOH 3C8DA 5C6TL 4EDWH 4U7SA 2B1AL 2UZXB 5EZIL 2AEWA 1NBZB 5HJ3A 4IOFD 1FZJA 4QRQB 3GMOB 4NZJA 4X4YA 1N5YH 1X5ZA 2EDXA 2YPLA 5A3IC 3W5MA 4GMSH 3MRQA 3ARFB 4OLWL 3QPXH 4XZUA 5IM7B 5FGBC 1A9EA 2PCPA 3UBXA 5F9JB 5FYJD 4BZ1L 3QEQE 4KDTA 3QJHB 3RVTD 3W11C 4ZUTB 4ZTPL 2R1XB 4YC2B 1S7QA 4NC1E 1K2DB 2CUMA 4ONGL 4QRQA 1ND0A 3L7EA 1O0VA 3U83A 2HT2C 2N1KA 4ZO9A 3MRJA 1FO0H 4CKVX 4U3XA 3NCJL 5D7IF 1A6VL 3HE6C 3MLWH 3I50L 3MYZA 5BVPH 4OFVA 1MQ8A 1D5BA 4RMWA 1XIWB 3QG7H 3P73B 4BSWA 4KXZH 5EU6B 4IJ3B 2DAVA 5E2UL 3UDWC 1QPXA 4N90E 5ALBL 1Q0XH 2H32A 3E1F1 3BZFB 3OSKA 4KHXL 3EDFA 5AG8A 2RCSL 4G6FD 4PJEE 1SJVA 4XAKE 1C12A 2NY6D 2HTLC 4X9HA 5HI5D 4TSBH 5IB4B 5FDYA 4L9LB 3ZDXF 1I9IH 5DWUH 3P4MB 4KKCC 4S0SD 5T1LB 1AQDA 3ARGC 3MR9A 1R3HA 1J0IA 4LVOC 1K5NB 2WBJC 4DVBB 1ZVSA 3CZFA 3GHBH 5BS0E 5IGXH 4X9FA 5GS2H 3KJ6H 5MERB 4MWFB 2XQBL 1KIQB 3G6JF 2BSED 5CKGA 1Z6JT 5CJOL 2X5PA 2N4IA 4UINH 1D5ZB 1NFDA 2PR4L 1EJ6A 5F96L 4OF8A 1G7QB 4HWEL 2ARJA 5IK3A 4ESKA 4R97B 1MFNA 1ZA3A 2YD7A 2V2XA 5KSAD 4NQDA 1XF5B 3FL7A 1YPZF 4WUUA 4YDVA 4JKWA 4MDJA 4PJAB 4MJ2A 1LD9B 5FO8B 3BP4A 3H42H 5I0ZA 3BXNA 1BIIB 5JW5A 5GGQH 4CMMB 5DZOA 1OTTD 3MV7B 5EA0H 5GRYA 3V0VA 4BH7B 4C4KO 1I3GH 1LO5A 4HEPG 3V6BR 5D1QD 5C3LD 5TFSH 4BK5A 3FN0L 2VOTA 4GFTB 3F65A 1AGEA 3HG1A 2O5YL 1L7IL 1CR9L 2ZOKA 5D7SH 3FOMB 5I17B 3T0ED 4D8PA 3GK8L 3EYVA 4ORZC 5JHDD 3V6FB 3IFNH 2A74B 3NCFB 2I9LA 3LB6D 5GRXG 1KV3A 3CVHB 2A6DA 4G6AD 4P4KB 4R7DB 3SCMD 2V17L 4G8GE 3MODL 2PTTB 4OQTH 3N0PB 4G6JH 1PKQB 5C07B 1GOFA 2OSLA 3U1SL 3UTSB 1NUDA 3HLAA 2R2CA 5F70A 3CX5J 1PKQE 1HKLH 2YPKA 4Z78B 4GQ9L 4HCRA 3EOAA 3KPLA 3I3BA 1HHGB 5LWYH 1BIHA 4QF1A 2JJVA 1QTYT 5HDLA 1L6XA 3S34L 4Z7UE 3IRZA 2GCYA 1JGDB 2WBWB 4JFEA 4JM2B 3SE3A 4RA3A 1DLFH 4N8CL 4KU1A 1PKQA 3QUMH 4X9BA 1P9MC 1MLCA 3M17A 2Y7QB 4PV9B 1NFIB 1XT5A 4E42B 5LVEA 4Q0XH 4GAJL 1EFQA 4PRBA 3TO2B 3QQ3A 4ZAKA 1CN4A 2EDNA 2F19H 3MUGA 1L4IA 2XA8L 3U30C 3BX7C 4F7EB 1BLNB 3WKMH 4XNXH 1P2CA 1RULH 3Q1SL 3MLTB 3CUPA 4D9LL 5DEFB 2XQYK 3MLUH 3Q6GL 3KPRE 4I3RL 4M4RA 5HGBB 3VD9A 3WN5B 1RY7B 4AM0A 5I76A 2BX5A 1LK2B 4JO4L 4OGAD 4K3DL 4I3SL 3TZVD 3WSQH 5F3BA 4P2QA 3BP5A 1JWSA 2GI7A 3PQYA 3AU1B 5DC0A 4BSWB 4OSUH 3VE0A 3PWPB 5C09D 5BS0B 2B0SH 2EIEA 4L8DB 2NY2D 4J1UA 1OSPL 1AGDB 1RMFL 1WT5C 4FXKA 2K3TA 1ZLVH 5T3XE 2ZG3A 4J6RL 3C08L 3RKDC 4H26B 1HH9B 5DMIH 1BM3L 3PP4L 3O3EA 5CMAB 3VXSA 5F9DC 1X5FA 2CMRH 3LS4H 4A2LA 5H94A 1XCTA 5JORA 2G2RB 4LLYB 1F13A 4HJGA 1F97A 3P4MA 5SWSD 4OM1H 1MHEA 3UC0L 1NLDL 4U6YA 5HD8D 4ONFH 1K5NA 1WZ1L 4BH8A 4K94H 4FXKB 1YEJH 3IFPB 2Z9TA 2ZJSH 2JJUA 3D2UA 4LNRB 4KGJA 4XCNA 3VMPA 3FT3A 1FLTX 4N0CD 4YDIL 5AWNH 3CFIC 3GSOA 5INDB 2ICWJ 1K3ZA 3D1MC 5FHAH 4L9LC 3C2AH 2W9LA 5E00A 4WW2A 3CVIH 2Z8WC 4NN7C 3OKEB 1J1XL 2P5ED 2FZ3B 4JREC 2OS7A 4ZPTB 4BH8B 5FUZH 4H8WC 4DEPB 4XTRC 4HIXH 3ES6B 3BH8A 1I4FA 3BP4B 4WU7A 4PJCA 1F11A 4MLSA 3FT3B 5ETUA 4QXUL 2IAMB 4ODWB 1OAZL 1AGCB 3NPZB 3QCVL 4HKBB 3ORJA 3M8OH 4S1QH 3MOQA 1B6UA 3NGBB 2GTZA 2VR5A 2X89D 4DGYH 1UXWA 3S35L 3KPMB 1HHJB 5BZDB 4WTZA 2CLZB 4HKXA 3NIGE 3BYTA 4XP4L 1KF9B 4G9FE 1FH5L 2ENSA 1PAMA 2XKSA 2PO6A 5DQDH 4DKFH 5EO9B 1LP9F 1ZHNB 2A0LD 4JG1H 4M9OA 2UWEA 2F54B 1RIHH 5DTFA 3CSPA 1LQSR 2AV1B 2WUBH 1CXLA 1T03H 2M26A 1MY7A 1NFKA 2DQIL 4RAVA 2DL9A 3QUYC 4PJHA 4HS8L 5AZ2H 5HPMA 4W81A 4ZXBC 5TE4L 3QXAA 4PJ9C 1MHPH 1EEUA 2BVOA 2E9IA 3J7HA 2NW2B 4PD4J 3T2QA 5DJYA 3VXSD 1FL6A 1GOGA 3IGAB 1UM6L 2XFXA 4HV8B 4R96B 3X14A 5TDPB 4I0PC 2V9QA 1HWHB 1AO7D 5ERWA 1QR1A 1UCBL 4Z95H 4APQB 2OM5A 2Q8BH 5C0GB 3Q5OA 1FSKB 2GITB 1J5OL 5C08A 2C7UA 2VXVL 3MCKA 5F44A 4CVXA 2HTKC 4M3JA 4NHCH 2AK4D 5D1ZB 2VLJD 3C09C 4IJ3C 5HYSB 1WVZA 4XPAH 2HWZL 2HN7A 5DI8B 4QRPA 1BVLA 1GZQA 4H25A 3RGVA 1HWGB 4F37K 1NC2D 1MFDL 4N0YH 2QLVB 3O6ML 3UAJC 3G6JE 1LMKA 3HZMA 4IRSA 2CDEB 3O6LH 1N4XH 1G9ML 1OM3L 5A40E 5I2IB 4Y1AA 1UXSB 3O8XA 1Q1JL 2XOTA 5GRWA 1CD8A 1TVHA 4Z8FH 4U6XA 4NYLB 5DFVC 1FO0L 2IBGA 4EOWL 4GKZA 1A5FL 5HJ3B 2G60L 1AXSB 1N26A 3QA3A 2WBJB 4Z7QE 4PBVC 4HC1L 4MAYA 2XQBH 5D2LA 5E08H 5CJOH 1KNOB 1J1PH 2R56L 3IRPX 4K94L 4KJYA 1YMMB 2NY1D 4TVPD 1UXSA 5GGUB 3RWEA 1F3JB 2VZUA 4NO2A 4PJ5B 2XKNA 4RRPA 3SDAD 3QA3B 4D3CL 4Y19D 4P9HL 2W9DH 3C9NB 4PJ9D 1HILB 4OLYH 3QIBB 4UT6H 4NFBA 4F80A 1JN6B 2DRUA 1ZA6B 2VWEC 3K4ZA 4PRIE 3U0TB 4Y16C 4HDIA 1A02N 1XR9A 3QI9C 1ZHKA 3CMGA 3QZWA 4ONOA 2IPUG 5ENWB 5F7FA 1G6RA 2AJXL 4NJ9H 1HXMB 4AT6A 1DTUA 4Z0XB 4M7ZC 5B4MC 2B7DT 3VH8B 2E27L 2IBBA 4LIQL 3FAXA 2ATKA 5FOJA 1UJ3C 2HRPL 3H7BB 4LQ1A 1MNUL 4G7VL 3MJ8A 1B0GA 4QRTB 4Z7WF 3BKYH 3U0TA 2EDFA 3QNZB 4PRHA 4L9LA 2F54E 3DXAA 1KB5H 1OW0A 4OIAA 1RIVL 1F6AB 2VC2H 4HUUB 1MCOL 3ES6A 3HR5B 5MERA 1JZ5A 4OZGE 3MLVL 1U2CA 1X5JA 1AQKH 1N5YL 1IKFH 1XGPA 4EXKA 2VLLA 1AGCA 2R15A 2X40A 3QJFB 4HLZG 1KGCE 1GIGH 2MMXA 3O6LL 3D25A 3RHWF 5I19H 3FFCA 3O3BB 4ODSL 4X8XA 1EEZB 5INCA 2X05A 4YPJA 4Z7NF 5E2VH 4LLUB 3Q5YA 5ECJE 3DX9A 3LQAL 5EOQL 1T7YA 1IAMA 3BXNB 1P7KA 1MJUH 1U8KA 3IDUA 3G6AB 2X42A 2WZPD 3D39A 1UZ6F 4Z7WA 3ILQC 1KPVB 4TSAL 3LOWA 1U93B 4RNRA 4HWZA 5EU4A 2DQEL 4NDMA 3W0WD 2WWMD 3VH8G 3QXDA 3ARGD 4ELKB 4LSVH 1N6QH 4YH6A 3DX8B 4JM4H 2Q87A 1IGFH 1P7HL 3VG9C 1DL7L 5FYKU 3ARDC 3SDCB 4XNQB 1HSBA 3DSFH 3CVHA 1LHZA 5DA4A 3NMEA 4GXVL 4JG1L 2XTJE 3OHXB 1AHWA 3GMMA 3LN4A 4XNXL 1CD1B 4LSQL 3TJEL 3VFWA 5E2VL 2H26B 5DRNB 2XNAA 3GMNA 3QDAA 3AAZB 4IS6B 4R26L 3FO9A 2I60H 4ZFGL 4PJXE 5HYSG 1ZGLA 2NY4C 1GHFL 1S8DA 3D39E 4EUPH 2GK0A 5IFHL 3RWCB 1D9KD 2PTVA 2AJVH 5EUOB 4JO1L 3PABB 2W9DL 1A6UH 5JPMB 3D0VB 1U8HA 5C0RL 4PGZA 3RTQD 3WFEH 1GAFH 2VDML 1KBGL 4NNPH 4PTUB 4WUUD 1S7QB 2OTUA 4OZHE 5E2WL 1DN0B 1U8NB 4FFZL 4LP5A 5J6GA 1P7QB 2ZCKH 3EFFA 3AREC 5FM8A 5IHZB 1XF4A 2UVFA 3BRDA 4N0CC 1J1PL 4EIZC 1VENA 3Q48A 5FCUL 2W0LA 4YXKL 4WHTA 5FHAL 3RI5F 3O2DA 3MUGB 3T3ME 1MUJA 1OLLA 5JPMA 3VFPB 4JQVA 3WNOA 1RUQH 5AG9A 5MP6H 4R4BA 4F3FB 1J0HA 1IT9L 3PDGA 4M02A 4L3EE 3V4UH 1PSKL 1RULL 3Q1SH 1S7UA 2QADC 2KBGA 1TENA 1MQKH 1QR4A 3DI3B 1QSFD 3X3FH 4DEPC 4KHXH 1KJ2L 1HOCA 1JCKA 2VLRB 1HYRC 1RJLB 3FOLA 1I1AD 3GGWA 5JXED 3P40A 3QCTL 4LHQB 1XR9B 3SCMA 1B2WH 3WIIH 4GQPH 5BZWA 5ID0B 4U49A 4NSKB 5J3HD 2ADFH 4IIQA 4BK4A 2R1XA 3V5HB 3OPZL 5FA3A 1A6TB 2B4CL 4U0QB 4XAWH 2DIAA 1QRKA 2I5YL 4J7RA 3WUWA 4XH2A 1F4YL 1I7TB 2XI9A 4BFIA 4P46A 2OLDA 1GH7A 1GZPA 5FKPB 4KAQH 4P3CL 3PWUA 4EN3C 2BSSB 2F53A 2LVCA 3WE6B 2CRZA 3MCLH 1ORSA 3QUMB 5ID1B 5DWUL 3VD7A 3IDJA 4OTXH 4ZO6A 3T77A 3I6GA 2DJUA 4XC1L 1FNEB 3SN6N 3T0EA 1II4E 1OAYH 3BZFA 5IG7B 2YA0A 4Y4KA 4MXVE 3REVA 1FN4A 2R23A 3FQWB 1A6AB 4MD4A 1F4YH 3ARSA 4JPWH 4HX1B 2UY6A 2QL1A 3CC5B 1WT5A 4IHOA 2YD3A 4JR9H 4ENEC 1MCLA 5JTWA 1RZIA 3S36L 3EYUL 3VFOA 4WWID 4MA3B 3RPIB 5ID1A 2VZ1A 2B1HL 1U8LB 1I8MA 2VAAA 4PJHE 4QOKE 4H88H 2HKFH 1CGSL 3S9DB 4MD5A 1V3JA 4FA8A 1NFDB 1MCDA 2PW2B 3BT2L 4JFPB 4F15B 3TZVA 4ZFOA 2FL5B 1K3IA 5K9QI 1G7QA 4O58L 1JNNH 2BNQE 1ZA3B 4OD3H 4NQVA 3FO2A 4OZHF 4RNRB 4Y4FC 1MI5D 4YHNB 4MA1B 3FJTA 5C08E 1CFSB 2V7NB 2VN4A 3VRJB 4PJDE 1RJYB 3SGJC 4EZMA 4NFCA 2ZUSA 2FCBA 1T3FA 5EUKB 3F6IA 3V8OA 3MX0A 3FN3A 3NCCB 5EZIH 2W0FB 4EDXB 4JG0H 4Z76A 1LO3H 1SYVB 4TNVK 1RHHA 2NCMA 1EIBA 4LCYB 4J8RA 2X4OB 1X44A 1MJ7H 5ANMA 2Q6WA 1DZBA 2NXZB 3STLA 3D2UD 4RFOL 1FG2A 5DRZB 3ILQD 1YY9C 3MJ9L 3S35H 3QEQA 1FZKB 4KFZC 1A1OB 2X7LA 4QGYA 4OV5B 1CLCA 1WCQA 5SX4H 4FQIL 4Z7UA 1EGJA 2XYCA 1WC7B 4AYFA 1S7WA 1BHGA 1NC4B 5IUSA 3KR3H 4LCCC 4PB9L 4PRNA 4MJ6A 1CXHA 4JE4B 4Y5VB 4UDUA 1YEFL 4FABL 1G7IB 5C07A 3MRPA 4P48A 5ANMB 2JCCA 4LLDA 5FUZL 4F9PC 5FHBH 1KJ3L 1FZJB 3ME0A 2P8PA 4JFXA 4LSQH 1QHPA 3TJEH 4P9MH 3WN5A 3HNSL 4J3OC 1JFQL 2A1WL 4YIQB 4P2QD 2ESVE 3ARUA 1PG7X 3FT4B 1EA9C 5EU5B 1K6QH 3MV9E 3RVWC 1OD7A 3MLUL 3Q6GH 3GSNB 3I9GL 1KJMA 4JM2A 4X4ME 1Q94A 1EEYB 4MD0A 1NSNH 4MXQC 4QLRA 1WZMA 5I74B 4F3FA 4MJ5A 3VXOA 1SM3H 4XMKH 1I7ZA 4ZTPH 3QO1A 4HUVB 3QQNA 4NM4L 3REWB 1IGJA 4XX1G 5AYUH 3KPSE 3UMTA 1RZKL 3DO3A 1JZ6A 4LK4A 2HTKD 1RUML 4JY4B 3GUTA 4JAMB 3SPVA 1OP3K 4HS6A 2ZUQC 1MJJB 1A3LL 5DR5H 4U31A 4P2QE 2MKLC 2Q7YA 5J06A 1EO7A 2IGFH 4ODHH 2SEBA 5CP3H 1OGAE 3ARED 4XCEB 3QEGL 4C56E 2I9TA 5JO5B 5I66B 4NSKA 1B4JL 1FJ1A 3WFBH 2RBLA 1S5HB 2HJLA 3GSQA 2B8OT 4PJGB 2R0WL 5BV7H 1OB1B 2VKXA 1IQWL 1IGJB 4OLVH 4YBLC 4PRPE 3NFNA 3P0VL 3A6CL 1GGBL 3FAWA 4Y5YA 4PGJA 4MNQB 3ZYJA 4ZFOL 1HIML 2C3VB 2L4OA 4LRIA 5I19L 5I1CL 3MBXL 3ZTNL 1HHKA 2VXQL 4KRPB 2ADGA 5A1AA 1QKZL 4MZ2A 4P99A 4L3CA 2YPVL 3MLVH 2EECA 1BQHG 2Z31C 4K2UH 4XPGH 1UH3A 3G5VA 2XTJC 3KPNB 4JGUA 2ITDA 5IOPA 4G3YL 3KYKL 1HYSD 3MRLB 1U58A 4MA7H 1BD2B 5DMYA 2IAMA 1VFMA 1FN4B 4JFFD 1EUUA 4QRTA 2H1PH 5JORB 2CGRH 2F15A 3LN5B 3VXMB 3FN9A 1VACA 1K8IA 1I7UB 5DT1L 2BHUA 1FPTL 2YRZA 1KTDA 4HBCH 4HKXB 2CLZA 1DQTA 3F7PC 4XNMA 2YPVH 4KJPD 3CMOH 5F1IA 1K4DA 2Y06L 3P4OA 2B1HH 1E4KA 2GW5A 1ERNA 2BCKA 4Y4HB 1U91B 1CTOA 2VUYA 5GZNC 2NY4D 1AY1L 1PFCA 5DS8B 3PDDA 2PW2A 3UZQA 3C60D 2AV1A 4P2RE 2JELH 2W59A 4MGXA 4GAFB 4JRYA 4AMKL 3VXQB 4XCCL 2VQTA 1NBYA 4DUXA 5H37G 4XNMB 3LEYH 1XGUB 2V2WA 3KYOB 3OKNA 2DBLH 3CFBB 5L2KE 3QEUA 4GT7A 2XWBB 3WLBB 3MBEB 4PJEB 1FO0A 2YA1A 1W72L 3PNWB 4X7SH 4M5YL 2I9LB 1LDPH 4U2ZA 5GGSB 4PJAE 1U8IB 5J13C 3BIAX 4IRSD 4MNGA 1KEGH 2QKIB 1QO3B 1BOGB 2PW1B 3P9LA 1KTRL 3OKLB 4JHWH 1ZLWH 3LVEA 5IV2A 3MLZL 4RIRB 5ACLA 4AENB 1PZ5B 3HRPA 5D5MA 2HN7B 5DI8A 3QEUB 2MPAH 4CVUA 3TV3L 4LIQH 2MCPL 4EBQL 2P43B 3NTCH 2QBWA 2GFBA 1WFOA 2NLJA 4Y5VC 4MVBC 4U3HA 4ERSH 4HFUH 4X4XA 3F7VB 1N4XL 1RVFL 4XVSH 1HQ4B 3O8XB 1A7RH 2APVA 3DGGA 5E4IA 1C08B 2CIKB 2NY5C 3BD4A 1TPXC 4N0YL 3PGFL 2CO7B 5I71C 2CUIA 5HY9B 5EZOL 2AXFB 2NXZC 2OJEA 4YHKL 5JOFB 5DMKA 5I73C 1N7MH 1IAKA 1TVBA 4L5FH 2FO4B 5HHOA 4JFDD 5D8JL 4WWKB 4EI6B 5LGHH 1WBYB 5I74C 4OGAC 4YIQA 1NEUA 3MMEB 3F7VA 1FV1A 8CGTA 4LLAA 4UQ3B 2FECI 3ZE0E 1T66C 4PJDB 3KLAA 1A7QH 1X5IA 1FDLH 5F7NC 2M8XA 4ZOBA 5HY9A 3WS3A 4WTXA 1T0MA 1AR2A 5GS1A 3DX6A 3VD3A 3G6JA 1JWUA 5D5MF 4OJFH 3LPFA 1D9KA 4HMEA 5FYJH 1QNZH 1WBYA 3U0WL 4ZO7A 3RP1A 2DLHA 3ZL4H 5L7XL 4GKNA 4UT9H 1FLRL 2YMXH 1BBDL 4WENB 3O6FC 4OZFG 1TVHB 1AGDA 2RFXB 3RWGB 3ARFC 5KSBF 2DL2A 2HT4C 4YUEH 1T2QL 5T5FH 3GZKA 1OTUD 2AJYH 5SWQB 4Y16D 4GRMB 2NR6C 1W8OA 2X10A 5L2KB 4MXVF 5GJSH 4LLYA 1T89A 4L4VE 1D5MB 1T0NB 2DQGH 1N6VA 5HPOA 3LS5L 4M61A 3C8HA 4PRDB 3T0VA 4EI5A 2P24A 1RZFL 1S3KH 1RUKH 4NO2B 2P46B 4U0RB 2KL6A 1FNSH 4JRXB 5C0BA 1AC0A 3RU8L 3MRLA 2OMBA 1P84J 1IC1A 1BFSA 3L95B 1CFBA 1BD2A 1LWRA 4XPBH 4MQTB 4PJGE 1FGVL 1JHLH 2CXKA 3L3HB 2DD8L 1JBJA 2C26A 1VACB 3CSGA 4JJHA 4GMTL 2X1WL 2EYRA 4BM7A 2DQJH 2FLBT 1KTDB 1T4KA 2C4XA 1HXMA 5DK2B 4UOW1 3IDJB 1QLFB 5D2LF 3MRMB 5KVFH 2XACC 1YY9D 3AUVA 1FVEA 4QY8B 3RIFK 1QFHA 1OTSD 1V7MH 4P5TD 4NRXA 5HHOD 4K3HA 1B0GB 5EC1B 1MRCL 1A2YB 5DJ8B 3T2NH 3TVMA 4GRLD 3O2DH 1WAAA 4S0TD 1XCQB 4Z77B 3D5OF 1DQMH 1F4XL 1RK0A 1LO4H 3A67L 4NZRL 2OX5A 4RFEB 4I77L 5T1DH 3CFBA 4GG6E 5T3ZD 2CGRL 3TT1L 5CEZH 3VWJD 3PNWA 4MD5B 3VFTA 5AYUL 4OF6A 2E7CA 3MNVB 2APWA 3QG7L 3NABH 2HFGH 1I1CA 3IDMB 1BGXH 2X9XA 4MXQD 4RAVB 5IBLD 1FYHB 2MFNA 1MCFA 1DQQA 2MJWA 3Q3GA 3H9HB 4G8EB 5GJTH 4JFYB 4M7JL 2WLZA 4PV8B 2BVQB 1WIUA 3MGOA 2GFBB 3MRKA 3RIFF 1EBAA 1S8DB 3WLWD 3LB6C 1VGKA 2XFXB 2VRAA 3HC4L 1TETH 3O9WC 1SVCP 4Z9KB 2ZJSL 4WO4B 3WEXA 1FYTA 3ZKNC 3PABA 1FAIH 2A6DB 1W72H 3MRNA 4GG8A 4WY7H 1U93A 1OGAA 4ZS7H 3GSWB 1B4JH 2OTUB 4WI3A 1KYOK 2LABA 5I1AB 4BZ2L 3LKOA 2D7PA 3W82A 5ACZB 5IHZA 2JB6B 4NFDA 1P53A 1T1WB 1EO8L 3NBNA 4PREB 3W2DL 1C7TA 3DVGA 5KVGH 3KPSA 2CRYA 4OAWA 5IBUG 4O02L 1I9RH 2X4SA 3HPJB 1J8HB 3MRNB 5DHXB 3V6ZA 4N0FA 1G7IA 3QJHA 3TWCH 2GEEA 4YDLB 4MS8C 1C5DA 2OTWB 3GMNB 5T33H 3EIFA 5BW7A 1C8PA 4LEOA 4BSVA 4S11A 5D2LB 4P23C 2CRMA 2G9HA 4LHJB 1RQ5A 4A6YL 1BGXL 5GZOC 4ZSOA 3FT4A 5BRZD 4UTAH 3OXSA 3IDGA 2E6QA 5GGRA 3U9PL 3AGVA 4OF7A 1F3DH 3HPJA 3T1WA 4NKQB 3MUY1 1KPRA 1UB5A 1C5DB 4HQQH 1A4KA 3QO1B 4PJCF 1WFTA 5LAXA 3G5XA 4A6YB 5C9JA 5I1KL 35C8L 1QBMH 4ODXA 4HS6B 4EQ2A 5D7LE 3RHWK 3TNMA 4HAGA 4DZ8B 4JHAL 2LTQC 1MCWW 25C8L 3QZWB 3HNSH 1AJ7L 4IRJD 4J3VA 1QFUL 5EPMA 5J9PB 1J12A 5C0CB 1IM9A 1TTUA 2AQ1A 4H26A 3ROOB 4ODSH 4Z0BH 2RAMA 3IFOB 3MRFA 4JANB 3D3VA 1LP9A 4UDTB 3LKPB 1ZK9A 4U1NB 1E6JL 3MJ8B 3BQUD 1XGTA 5IBUB 1HH6A 4Y2OA 3P4LA 5F1NB 2F9BT 5KVMC 4HPOL 1NH6A 2YRLA 2EE2A 3VGHA 5IHLB 5ID0A 4F2MA 4I3GA 4Y4KC 2VC2L 1F6AA 2XRAL 4YWGH 1BZ9A 3N06B 4G6MH 4GBXB 4OLXL 2UVEA 4U1IB 3K80A 3RVWD 5IOPB 4LHUB 3QO0B 1MH5A 4W4NA 4Q9QH 1OAUL 5JA8B 4OFDA 4OCMC 3PL6C 2MNUA 1KENL 5TDNB 4HUXA 5H8DA 2CK2A 5C6PB 4XH2B 2VR4A 3QG6A 4G9DA 4WW2B 2OI9C 4JZJA 3HG1D 4N0UA 3VFVB 3CNKA 3ARWA 5SWZA 1OWRM 1EAPB 4F7TB 4KI5C 4LGSB 3R8BB 5I71B 1JTTA 1N7ML 4NOFA 3RDTD 1QSEA 1ZANL 2AQ2A 3CDYA 1FNEA 1JNNL 2CUHA 2FR4B 1CDYA 1TNMA 2J8UF 4P5MB 1E28B 1A1MB 4GXUN 5KN5A 3QG6B 4G9DB 4P9HH 4H88L 1T66D 5IKCA 3MRBA 2HFTA 4KK6D 3NCJH 4PJ7B 3VFSB 1DN2A 4UTBL 1HHJA 5BZDA 4G9FD 2L0DA 2MCPH 4QRUB 3VRIB 1DQDL 5ITBH 5F7DA 12E8L 3RGHA 5I1DB 2H32H 5CUSH 4GG6F 3WHXB 3C5ZD 4LSVL 4Y88A 3H3PL 2PNDA 3WXWH 4MLIA 4I5BA 4ZPVA 5EUOF 1A22B 5TGBB 2RIKA 1LDPL 2AJ3A 3JWOL 4FFZH 4GMSL 4OLWH 5F6IB 4K94C 3NPSB 1UKSA 1IAOA 3GHEH 1T80A 3NAAL 4N9OB 4AEHH 4CU7A 3N85H 5L8JB 3TIEA 3WNNA 2AJZA 3OHXA 3QUYD 4OLZL 5D6CA 4LSRH 2P8LB 2FWOA 2NQCA 4P2OD 3VRIA 3VFMA 1FCCA 5D70H 3M17B 3GNML 4P0DA 3ALPA 1ZGLB 3SDXF 2NTFA 3Q5TA 5IBLC 1F3RB 3P9WB 2B5IB 5CWSB 2BNUB 4NKMA 4DUWA 5J7CC 2VERN 3D0LA 4XP4H 3ULSA 1ZTXL 1NUNB 5A3ID 1N0LA 5F3HB 3NOIA 3S88H 1EV2E 5D6CB 1NGXB 1ZHLA 4HIJB 4V2BA 2ZSVB 5T5NF 4HHAA 5I9QB 5DZLA 5F72S 4CGTA 2CIIA 2X9YA 3B43A 3OB0K 4QXUH 1OAUH 2O5ZH 4JCLA 3WKML 1DE4A 3HI5L 5E8EB 1S7WB 4FQXD 3S5LA 4PJBB 1IGCL 4OCRL 1FNHA 3DECA 3OXSB 5GPRA 3SE4A 4QT5A 4NQEA 3BAEH 1S7RA 2JF1A 4Q0XL 3UJTL 1JYNA 2OZ4L 3QNXA 3CVIL 5JW3L 2ZSVA 1G84A 1E4XI 5IEHA 5KG9B 2AP2A 1BX2B 1F4XH 1KG0B 2O26U 4LGPB 4ZNEA 4OFYD 1JGEB 2XZZA 5JW4R 1I8IA 4YDJA 2EXYC 4PRID 5EOCJ 5C0AE 1HHKB 4EKXA 1CT8B 2ZCKL 5EPMB 3R4DA 2C9AA 4KKBC 5DQ9B 4LARH 3WFCH 2MOVA 2B2XH 4Z7VB 5KTEH 3OGOE 4EUPG 1R5WB 2EZ0D 5DJ6A 3WDIA 2VXSL 3TJHD 4HPYH 4YDJB 1FQ9C 4J4PD 3UPRB 3KPRA 1ZLSH 1DVFA 4RCAA 4JFQA 2SEBB 3MR9B 4UOJA 3MRIB 5E99L 1G6RB 1KJ2H 1Z9OA 4ISVB 1FJ1B 4DVBA 5MHSE 2ARJQ 2XPGA 3GBNH 2DMBA 3I6GB 3U9UB 5I75B 1F11B 5JXEC 1CR9H 5F88A 5JHDB 2P49B 5JIIA 1W8NA 1X5HA 1KIPA 2IQ9H 4JZJC 1NCAL 2ADGB 1G7MB 5HI4C 2EE3A 1PLGL 5C0BD 1XGUA 4H20L 1KELH 5ICZA 1X9QA 1S9XA 1ZANH 1JPSL 3VI4F 1T5XB 4HPYL 5DFTA 5DJ2A 2UUDK 1ITCA 3H2WA 4PJFA 4BH7A 3SOBL 1C5BL 5SV4A 4G43A 3DXAD 4JO1H 3VA2C 3MRBB 4UU9B 4R4NC 5DD1L 2F58H 3ULUF 4KV5F 3KYAA 5HXMA 1CLZL 5IB5A 2D03H 2ICWB 4Z7VE 4R6UA 1Q0YL 4CDGC 2QQNH 3L5WB 4D8PB 4MXWH 1DBKL 3QNYB 1MHPL 3RX7A 3MRGA 1G7JA 3ELAT 3ZYIA 5HD8C 4P23B 4WHYG 3D85B 5C08D 1AKJA 4EOWH 2QV2A 2WNGA 5IROA 3D9AH 3SGEH 2FSEA 3RL1B 2X1OA 3IDMA 3E3QE 1H5BC 2R0LH 4MB3A 32C2A 1GC1C 4Q9RH 4OGYH 1RIHL 2YPKB 2HH0L 2PXYB 3CPLB 4OD3L 3SDAC 4JPIB 1BQUA 4X9GA 5H35B 1ORQA 4FXGB 3U82B 1MFDH 5EDXA 2NY0B 3FMGL 5FYKL 3CVHH 4Z7NE 5T1KB 1X4XA 1JZ7A 3BKYL 1FYTB 4P23A 3ZT6A 1M05B 3KDMB 3QAZC 3TEUA 3TT3L 25C8H 4JFEB 5AUMA 4WCYL 1TVDA 3W9DB 2EICA 5BS0D 3W0WA 1U3HB 4R8WH 3KAAA 4U6VL 4OZFB 5KJRL 3DRTA 5D7JC 5KANI 1IJ9A 2AW2A 2C4FU 2JJSC 4G8GB 2FNBA 2CLRA 5IBTL 3JV0A 4RAHA 3FO9B 4FXGA 2HVKB 2YD1A 2VLKB 5KSAA 5CINL 4XAKD 3CU1A 3QQ3B 4ZAKB 5ICYA 2JJSA 1MFAH 5JQ6H 1MCHA 3GNMH 2XKUA 2R29H 5SWSB 1Q94B 3SDYH 1UM4H 4HUWA 1T0PB 1IAIL 2EXWC 2JB5H 1YNKL 3JWDC 3C87A 3MRHA 4PJ5A 4S2SB 3U7AA 2RFXA 4LMQE 4HFWA 2YD4A 1VGEL 2ZUTA 5F96H 4OTXL 4IDLA 3I6LE 2IH1B 2FO4A 4PJEF 1MELA 4NN5B 5FOBB 3VFRA 3MJ6A 3KVQA 1TTGA 1X7QB 5D7LD 2XZQL 1I3RB 4RISL 4ZFZA 4YDLC 2WINB 5I8OH 5ENWA 3TH3T 2ADJA 2AV7A 5BS0A 2P24B 2P5EB 4WW2C 5CSGA 1KSRA 5D2NC 4HUMB 3T1FA 3ZKMC 3GSNL 2CDFA 1Z9SA 4PGBA 1R0AH 1ZT1B 3QEQD 1MCKA 3UTSE 2K7QA 1U8PB 4ALAH 4RGND 1NUGA 4A6YA 1J0ZA 5C9JB 3H7BA 3HNTL 4PRHD 5FGRA 3MROA 1T2QH 5T5FL 2VO5A 2VXTL 5FUCE 3CDFA 1S9VA 5HHME 4YXLL 1ZS8B 1GGTA 3MRIA 2MKWA 2ZPKL 4XVTH 4IM8A 4U6YB 4KK8C 3RUGE 2V5TA 3U36A 3VFUB 3IFPA 4OGYL 3P30L 3RWJA 1ROWA 1FBIL 4DFHA 1RURL 3D3VE 3P77B 1YECH 2ESVB 5HDQL 5HGHA 1H15A 4UBDC 1XGTB 2HJFA 3SKJL 3QJFA 5L6YH 5L2KA 4Q74A 3MV7E 4LLMB 1JGUL 4XPHH 3QWRA 4FTVA 2XT1B 4KVCH 1DBKH 2VL5A 4PB0H 5E2WH 3NN8B 1DSFH 2V6HA 2DB8A 2HJKA 3T77B 3T08A 4UQ2B 1KIQA 2QSQA 3BMVA 1T5XA 1OSZA 1F4WL 1QD0A 4K3EH 1P7KB 4R3SB 4M00A 2BP3A 3OF6D 4L3EA 2DLFH 2OXHA 1EHNA 1T1XA 4UT7H 1YNLH 4JZJB 2I60L 4AMKH 2F53D 4JRYB 1GC1H 3T4YB 1WBZA 4A2MA 2B0SL 3NA4A 4L8SC 5IB2A 1KCVH 2HG5B 5E6IB 3V6OE 4NQDB 2X4RA 4JY5H 2D7QA 1A7RL 4XPAL 1A1NB 2DQTH 5DF0A 1MQKL 5C0IB 5C0CE 3HE6D 1CE6A 3MRKB 4P4KC 3BYYA 5GHWL 2QQKL 3WEXB 4CMMA 3INUL 3EUUA 3NGBC 4NM8L 2F5AL 2J6EL 3UYRL 1Z3GH 3IDNA 4NQVB 1PJ9A 1NAML 2GHWB 1HQRA 3RWDA 4F37F 3IDYC 2FHBA 2PXYA 2XTLA 3G08B 3U4EB 5E8NA 4GAJH 4AZ8A 3ULUH 1QA9B 5E99H 1TJHH 1MSPA 1WUNT 3WS6C 4QTIL 3W2DH 3VXSE 4X7EC 5FYJU 5A2JH 4C55A 4UOW0 3VXTB 4XPGL 3NIFF 1AFVH 1NAKH 1CQYA 3N9GH 4NQCB 1JPST 4CL7A 4XNYL 5I8KL 1A6UL 1WCBB 3ARBD 2XN9B 2D9CA 3TIEB 3QDJD 3VA6A 3RZCA 1NMCC 5EBLA 5EFIB 1U3HA 3MBXH 5L8LB 3O3DA 2OTWA 3RA7L 4JFDE 4LARL 3WFCL 4ZXBB 5GGQL 1J9CT 3R06B 3JSSA 3H9HA 4G8EA 3U4EA 3V0WL 4KXZI 2MWCA 3VMNA 2G9HB 1G1CA 2J7LA 1UH2A 1K4CB 3HZMB 2ED7A 1TZHB 4Y8DC 2VDPH 2BY2A 3W0WE 3QUYA 3QEGH 4M6OL 3CFKA 3MLYH 2FX9H 2H3NB 4X7CC 5DMIL 4D0BA 1ZHLB 5E8PA 2Y25A 1UKQA 5GS1B 3S37H 4DAGH 3HS0A 4OD2A 1TIUA 5FECB 5EIVA 3U4BL 4GW1B 2V9TA 3C6LB 2LVEA 4MQ7A 3MV9D 4YC2C 3DVIA 3GGWB 4TYUA 3OJMB 4PRBB 4N0RA 4HIHA 1RFDL 3KS0H 1BLNA 2P5EE 4NRYA 3B9KD 3ZLQC 4KUCF 1I7ZB 4KMQA 2JE8A 4GAGH 2FDBP 4FQHA 1SEBA 4X6FB 4D0CB 2Q1EA 4HUVA 2H32B 1ZT1A 4QCIB 2G5BA 4JANA 4ZSOE 3TBTA 5I1IH 3RY5A 3S4SA 1QSZA 2IC2A 2AEPH 5I76B 4WNQA 3H9SA 3BKCL 4NP4H 5C3TA 2XY2A 3D87B 5CJ8A 5GGRB 4PJBF 3KPTA 3PQYB 5JO5A 3TFKD 4HFUL 2AK4A 5BVPL 2DYPD 1ZVSB 2ZUYA 4X9IA 1A6VH 5D4QA 5C8JB 3G5XB 3QIBC 4XPBL 1B90A 1CXEA 2O5XH 1V3MA 3WIHH 1EPFA 2AKRA 4YDKH 3TNNB 1R3JB 4O2EB 4Z7OF 2GJ6D 1TQCB 4M7LH 5JZ7C 2ARJB 4PJIE 3GM0A 3KS0J 1FZOA 1QBLL 3HNVH 4XMPL 3GMRA 4JPKL 1F58L 3PDOB 4IEFB 4HLZH 4ZODA 3VXRB 2G60H 1IM9B 3HR5A 4C56B 5FA4A 5CJXC 2BNQD 1JFQH 1E6OH 3CK0L 4HF5L 4RMVA 4XP9L 4TUJB 5HHQA 3KPRD 5I30L 1V3LA 2NZ9C 4FQ1L 4O2EA 4XPFL 3T2OA 3GMQA 1CFTB 5EU3B 1SY6H 2FL5A 4M6NL 5D93C 2V5SA 3IVKB 1K8IB 4XVUD 4KRMB 4LPXA 3GMRB 5IB2B 3QIUD 4M93B 4QRRD 3GIZL 3PDOA 2BHZA 3DTXB 2KPNA 5F1IB 1PD6A 4EEEA 1CFSA 2V7NA 5E5UB 4PB9H 5DMGC 1LEKB 3BH8B 5FA4B 4Q97A 1Y0LB 4HWNA 3QO0A 1JPFA 4P2RD 1LK3H 2EDWA 3RVXC 2J1KA 4HKBA 1JHKH 5D72H 1EZVX 3MNVA 2P5WA 4I13B 1RZ8A 4U05A 5MI0C 1LNUB 1NANH 4HC1A 1OF2B 2XZQH 4LLVA 4U1JA 2H1PL 2VLME 2YUVA 3UTPE 1CLZH 2HLAA 4NNYA 5EU4B 3OGCA 1XZ0B 2DQDL 4YE4L 3G08A 1NC2A 4DN4L 4I0PB 2ICWI 1MCCA 4MB5A 1IFHH 4HPOH 5LCVH 1JF6A 2FX9L 1YEGL 1QBBA 1DQJA 4HJ0C 1J7VR 1BWWA 1P9MA 1G6VK 4NQEE 1J1OL 4P2OC 4UV4L 4XNUL 4YO0A 1OAQH 1YN6A 4MCYA 3O3DB 3N1PC 3CXHK 1XZ0A 3OGCB 5F7DB 4TQEL 4ZTOL 3IETA 3LH2L 1QFOA 2ZCLL 3QHFH 5MENB 3WHXA 5I1JH 2P8MB 4Y19A 5DVOA 4RFNB 5T3ZH 1T1WA 2F58L 3QI9D 1WIPA 2IWGA 1AR1D 1P6AB 5GGRY 4XC3H 5J6HB 3VGEA 3DSNA 3TIDA 2HFFA 4E9LA 1UCBH 1KJMB 2CLVA 5GGTH 2A6KA 4CN6A 4S1RH 3VMOA 3W9DA 2GT9A 1S7RB 2Y4SA 2FWOB 5CHNA 5DVLA 5JOFA 1MPAL 2UWEE 3WJJC 5BVJB 3BIBX 5FECA 1Q9LA 3EFFB 4LSUL 3RGVB 4HXBL 3Q6FB 5DK0A 2R0LL 4Q9RL 1NGPL 1H3WM 2NTFB 4JZNB 5JR1H 3SO3B 2DQIH 5K33A 5F7EL 1GGIL 5EULV 3LEYL 2R29L 3VFPA 3FONA 1V8HA 2B1AH 3MRHB 1NGXA 1ADQA 2J8OA 3WD5L 2AXGA 4KDWA 5FM4A 5CCKH 4FQHB 3L7FB 1KJ2A 4XPTH 3K74B 3BKMH 1R3LA 2NY7L 2E9WA 4I18A 5IT2H 3FQNA 5B3NA 4WTWA 5KJRH 3C5ZC 3VU2A 3WCYA 4U1HB 3IF1B 4JFQB 4W4OA 2D0HA 3P0YH 4NO5B 4APQC 1HCFX 1L7TL 4PJ5E 5DC9B 4IIQB 2Z35A 2QADB 3KYNA 2X4TB 3AM8C 5IW1B 2JLLA 2COQA 4OI7A 3O45B 3MRFB 2JELL 4R26H 2XG4A 3QIBA 4P49A 4XPHL 1MREL 3H6JA 5F1KC 5F1NA 3P3YA 4P46C 5E00B 5L88L 3BW9B 1X5KA 3MO1A 4LRNL 4YHZH 1QSVA 1WTGT 3RTQA 4PS4L 4PRDA 4EI5B 5IFAH 4R2GD 4PGDB 5GRVK 4F33A 4GBXA 3FO1A 4NN7B 4C56A 2BDNH 2RR3A 1I1YB 2D7MA 3WFZA 5FO9B 4LHUA 1FG9C 1MCSA 1A21A 2NY3C 1B0RA 3IXAA 1UA6H 5F93C 1HK6A 1M1SA 4IRJC 1CFTA 4KMTL 3FRPG 3VG9B 2BRRH 3F58H 3G04B 3MGTA 4TSAH 3KPMA 4U1SB 5DJAB 1S9KC 3WNLA 2IGFL 2ICEA 3QR2A 4ODHL 1MHHB 2NXZD 3FO1B 1BZ7B 3V52H 1BM3H 4PJAA 3QNYA 1JPFB 4AEIH 4M62H 5FUOL 1XGPB 5IVOA 2E3VA 1KFAH 4RISH 2Y07H 4W6YB 3LD8B 2EKSB 5CGMA 3VGAC 1AE6H 1JE6A 2A38A 2MSPA 3MNWA 5KAQG 3CDCA 1NSNL 2J8UE 3U7WH 4M93C 1PQZA 4QOKB 2YWYA 5ACMA 5ITBL 2HLAB 1MI5E 3GI8H 4OM0L 3SQOH 1D5XB 1AFVL 1BQSA 1NAKL 2DQJL 1AQKL 5GSRB 4X6BA 1RJYA 3NIGF 4Z8FL 2LU7A 1FL6B 4K9EC 5FGCB 4OCXH 5DJ2B 4MAUH 5EUKA 3BPNB 1S5IH 1A7BA 3D39B 4MJIE 3L3KA 4P46D 3PWJA 3QPQC 1GJIA 5E5MA 3MGAA 1YA5A 5K9OB 2CIKA 1SYVA 3O9WA 3UYRH 4C57C 4XCYA 5FB8B 4J8RB 4FG6D 3VI4E 2DLFL 3EO1A 2O5ZL 3VFMB 3I2CL 3KXFA 3K8KA 1MNUH 3J8F7 5CJQH 4ZDHB 3EYFB 1IKNC 1D5XA 4LVEA 4F7MA 4JDZA 3RZCC 1ZOXA 2JIXB 3CFCL 3RUGB 3GBML 3C09B 1ZLVK 2GCYB 4NQCA 1IKNA 2X1QA 5C0DB 3O9WB 3AREB 3BVNA 5CD3A 1FNLA 1JYVA 4LLDB 4HIJA 1UZ8B 4OZ4B 1YNTB 1AXSA 1ADQH 5HI4D 2AVGA 4HZAA 2JB6A 2YD2A 5BCAA 4K3EL 4LNVA 3QT2A 2GJ6E 1QNZL 2I27N 4E41D 3S5LB 2WUBL 5EB9A 1M05A 5GSVA 1F5WA 1FVCA 3FONB 4UINL 4WW1B 2H3NA 5T1MB 3GBLA 4JQIH 1MIEL 5D7IA 1ZKAA 4L4VD 1OPGH 2IAND 3TN0C 3CUPB 2L7JA 2J88H 2AABL 5K9QG 5IJKA 4QNPF 1HILA 1R3LB 2JTDA 4KHTH 4V1DB 1I9IL 2HRLA 1A4JB 4UIMB 5I18H 1LK2A 4P5TC 3SJVA 4I4WA 1CS6A 3SDCC 4U1HA 3EFDL 1U92A 2RCSH 2FEDD 1CT8A 3BHBB 2VISB 2X89A 4NJAL 3FT2B 1TTFA 4PY7A 3RVVC 2Z35B 2DWEA 3QUZD 3O6MH 1JPTL 2H41A 4GAYA 3UTQA 4WFED 3TC9A 4H0GA 5CGTA 5E2UH 1PLGH 5FIEA 3EO0B 3TYGL 1JF5A 5EZLB 3QUXB 2FHFA 4I48B 4D3CH 3HB3C 2CSPA 4PLNC 1UENA 4EBQH 3WUZA 3ET9F 1DVFB 2R2BA 4KH2A 4KQ4H 2VISA 4L1DA 4PGDA 1NMAH 3GB7A 2FYYB 3K1DA 3L3OB 2NXYB 4H1LH 2CDFB 4OZIE 3UTQB 3EYSL 5CJBA 4BZ1H 1QRNE 4JFZH 2VZVA 3LRGA 5A16A 2EXYD 3QDMA 4ETYA 1OAYL 4Y2DA 4G80A 3FRUA 5TH2B 4JHBA 4M7KH 5HYIA 3S37X 3SDXE 43CAA 2VZTA 1RK0B 4IMLB 1CE1L 4YAQA 3GO1L 4OCLC 4MSWA 4PRHE 3L5XH 4LLUA 2ICEB 3X11B 2VLJA 5CGYD 4K9EH 2IADA 3AY4C 1S9XB 3N1FC 3NACH 4Q6IA 4WU7B 3K1KC 1I85C 2OP4H 4BYHA 3D48R 5EWIL 4Y4KB 3QDMB 1UGNA 2HH0H 5I15L 1SMOA 1NEZA 2JJTC 4X6CE 2K1MA 1L6ZA 1EHLH 2PYED 4MA8H 1WWBX 4AIXA 3CC5A 4HX1A 4XXCA 5EG6C 3V4UL 3O8XD 4N0UB 5GS0L 5KVGL 3I50H 4FTVB 1NLBL 3PL6B 3SKOA 4FNLH 1EO8H 1EFXD 5C9KA 4HWZB 5DO2D 2X9WA 2ICWA 2Q86B 5I1KH 2YEZB 4KI1A 5DT1H 2HJKB 5D1XB 3MBEA 4ONGH 3UTTB 4ELKA 4G6FB 3MYJA 2PO6B 5D93B 5CZVL 3K2UL 4WO4A 4YHML 2A6JB 1NEZB 2ZOLB 3S37L 4DAGL 1RZ8B 3SO3C 1PX4A 4PJ7A 3ZHLA 2XZCL 1AHWB 4BUGA 6FABH 1OF2A 4LLVB 4U1JB 5EFIA 1ZWIB 1TZGL 4LSSH 1BAFL 5E95B 3WUWG 3QWQB 1SBBA 3T8XA 5I1DA 4KPHL 3LKOB 2A9NH 3LAFA 2J4WL 2XWJA 4AG4H 1T7ZA 3UTTA 4JDZB 2YD5A 5CSZA 1F4AA 4RMRA 5MI0B 1MJ8L 5KBNC 5L0QC 2PYFA 4TVSa 2GTWB 5ITFB 3PXJA 2HT3D 4LDEB 1IAOB 3TBSA 3V0WH 1IQWH 2BOCA 1RUAH 1NCAH 4OLVL 5C0DA 2C7UB 2XWTA 4QHMB 1ZWIA 1NEZG 1URLA 4L29A 1GPOH 4OZHB 1D6VL 4OD2B 1FG2B 4MJID 4OUUB 4PJXF 4QRPB 4LEOB 4BSVB 1OAZH 1DEDA 2BSRA 2EDOA 2X7LB 1XF4B 1UQSB 3DNKA 4POYA 3K46A 3KLHC 1J8KA 2YPLB 3AXLA 1FGVH 4D0DA 1JZ8A 4UQ3A 1MUJB 1UYWH 3AS2A 2IF7A 3EYOB 2EDYA 5B39B 5DDHB 1YJDL 3QEHB 4ZD3H 3WS3B 3P9MB 3L5IA 5FYKE 2RJMA 4ZUTA 1S7UB 5D7IB 2ZSWA 1MIMH 4Y4FB 4MX7A 4GKZB 1IEHA 3JZ7A 3BWAB 5BO1H 3INUH 4MAYB 3DSFL 1NCBH 5FOBA 2XTJB 3G6DH 3MRDA 4ODUA 5FV1L 4WNQB 5HGGS 1G7LB 1TCRB 2WIIA 3X13B 1I3GL 1U36A 4HGKC 3VCLA 4XMLH 3CIQA 4H8WH 4HJJL 3CFKB 5D7IE 3HZVB 4ONFL 4NQEB 2BC4B 2LQRA 5FHBL 2DWEB 4JFHE 4MJIA 4O4YL 3L7FA 5KOMC 5LKNA 5KOVC 3L1OL 4NKDA 1F90L 3G9VA 2EEBA 3CJJA 5EOTA 1JGEA 4P5TB 3PJSB 4RGMC 1MJUL 2JKXA 3NCBB 3PP4H 2NXYC 2F74A 2LU4A 3IAPA 3F58L 4PJ8C 1P5VA 4L1HA 3PWUB 4KUCD 3VGFA 1S7SB 3O6FB 4KKBD 1MRCH 2CXGA 3BEVA 4EVNA 5DJZA 4Z7VA 5IGXL 5GISL 3K4DA 2ZUQB 2HVJA 4EN3B 5IVXB 3B2UD 5AZ2L 2VIRB 4TVPL 4FNLL 4Q9BA 2C3VA 1RK1A 3HCVA 2GY7B 1OARL 1NDMB 1SMAA 4JREB 2VITB 3ZKMD 1MCRA 5SWZB 1ULVA 1H3TA 4I0CC 4ISVA 2BFVH 4IRZH 4HUUA 4RX4A 2CKBA 4YHMH 3OG6B 3MRCB 3O4OB 3BPCB 1KCSL 5TQ0H 4PP1C 5DUPH 4LCIH 5KVEL 3ZE2F 4YFLF 5D70L 4KRPC 1E28A 3L5HA 4XVUC 3S97C 2P5WB 4HF5H 1KCUH 3HCVB 5HHVH 2Z31B 3VFSA 2EDJA 1O7VA 1FFPB 2MPAL 5D8JH 4RMTA 5D9SB 3EW3B 1F58H 5DMGD 4YX2L 3FOMA 5MEOA 4YUEL 1S7VA 3S36H 2E7MA 3LKQA 4TNWF 3OKMB 1V3KA 2APTA 4JFDA 4YDKL 1KULA 2OR8A 4TUJA 1MEXH 5CIPA 1JP5A 4U1LA 4EJ1C 1PX3A 4NWUL 2NNAB 4K8RC 4WWKC 4M5ZL 1A5FH 4M6AA 1OCWH 5K9JH 4G5ZH 2Q76A 4OKVB 1VHPA 1RZ7H 4XP6H 4ACPA 3MCLL 1TQBB 1YNKH 1NGPH 3V79C 1JNHA 3DTXA 1DCLA 1A64A 1INEH 3BUYB 5ABDE 5GSRA 1LEGB 3O8XC 5KSUA 1Y0LA 4EDWL 3SY0B 1YDPB 3ARTA 3LD8C 4OKDA 2VDLL 4Z7UB 2VB5A 3EGSA 1PDKA 1TPXB 4X99A 1FDLL 1QRNB 4LKXA 2B4CH 1JYWA 2MQ0A 4QHKI 5T3XL 3UTTE 5EOCL 3O3UN 3NZ8A 1VKXB 4PJGF 4N90D 3ZE1E 1T2JA 3AB0B 2OK0H 5JHLL 3F12B 2AABH 3MNZA 1EERB 4AY0A 1BWMA 2BSRB 4HLJA 5DK0B 4RA0C 1RV6X 3H9YA 3WJLA 4OLXH 1BD2E 3JV5A 4P3DB 3RWHA 4LSTH 5D7KE 3ROLB 4NJAH 1EEYA 1VADB 2NY0C 5JOPE 3MUZ1 2L7UA 5EU6D 1U3ZA 3BIKB 3FTGA 4LCCA 7FABL 4YHPB 3TPUB 4WI9A 1NBVH 4F7CB 5I18L 2FD6H 3D9AL 2CR3A 3KHQA 1IFHL 1P4LB 2WAHA 4GSDL 1PYWA 2M1KA 3DV6A 1EEQA 2WLYA 2AK4E 4WTZG 2VLKA 1AXTH 3FKUS 1YQVH 3MMEA 1KEMH 2NY6B 1SQ2N 4M1CD 3RBSA 1G9NL 4O51A 4QXGL 4ZNCD 2I9TB 2D03L 2X70A 5DD1H 5CKAA 3B9EA 3F7YB 4NPYA 1BREA 4HIEB 5E6YA 2R0WH 5IW1A 3QXVA 1SEBB 1Z2KA 3H9ZA 3QPQD 4GBXD 1QBML 4GXUM 5ELIA 1OT1A 2E7BA 3VXSB 3S4SB 1F90H 2EIDA 3MRJB 1HE7A 4M6OH 2BY3A 1YZZA 3ULVH 1HI6B 5CS7A 3C2SA 4YLQT 1QVOA 3HZKA 4ZFZB 3ULUL 3RZCD 5EU6A 3KPOB 4NQXB 2AK4B 5D1ZD 5IVZB 5IW6B 3RA7H 1UH4A 3W39A 2ITDB 1OQOA 1QYGH 3D3VB 1NGYA 1X5GA 4WFHE 5EZLA 2EC8A 1QSEE 4NBYB 3FQNB 3WUWB 3UP1A 2ZUXA 1D5MA 3THMH 1KLGA 3HZYA 5HYJA 5DXWA 2E5EA 5D1QB 2FZ3A 2IFFH 1P4IH 3T04D 1DDHB 2Y5EA 4CN4A 1S5IL 1BZ7A 3P4NB 4U1IA 1NFDE 4JEGB 3T3PE 1QLRA 1Z0MA 3MXVL 1X5XA 3T0EB 2BJML 1EZVY 5A16B 3ULVL 3L95A 2XZAH 1L7IH 3REVB 2WWKO 4RAUA 1E4JA 3UAJD 5TDNA 2FHCA 4QHLB 1INDL 3IFLL 2NY1B 1ZLUH 3AY4A 3ZTJH 3MLSH 4FZ8L 4Y2DB 2EKSA 2J2ZA 3MO1B 3QFJE 4J6RH 5E24E 2R2HB 2LE9A 3BESR 3L3GA 2F8OA 3T0EE 1KPUA 1I8LC 1XH3A 4IMLA 4PB0L 2GYSA 1XR8B 4OFIA 1YEHL 4O5LL 2BVTA 1G7PA 4XWOD 3BKJL 1KN2H 2B4CC 3SKJH 4D94A 1NGZB 1VFUA 3V52L 4QHLA 3CMOL 4U6HB 1T1XB 4Y5XB 4M8QA 1MCEA 5DEGA 3QDHA 5HHOE 3V9FA 4CN1A 3IYLW 2WBKA 1FBIH 2PW1A 4LSDA 5DHVA 4HS3B 5GIRB 4KROD 1E4WL 1C16B 4R0LB 2R39A 32C2B 5E56A 4U1SA 4NNYB 4POZD 2AGJH 1A1NA 1XR8A 5D5MB 4HK0B 4O00A 3LEXB 1ZGLP 1WITA 4YBHA 1KUMA 2F5BL 4X98A 4M43H 3QP3A 1YYLL 3LRSB 3PV6A 3MC0A 3BGFB 3PHOA 1NUFA 1IC7H 2EH7L 1BOYA 3EDKA 5I1EH 5D7JA 3WHE0 2GITA 1S9WA 2GJZA 4P4RA 4M9PA 4HIIB 2PTTA 3ULUD 3AREA 2C3XA 1XGYL 1NBQA 2X4NA 4NJ9L 4OD1H 1HHHB 1YNTA 4K8RD 5ICXB 3VXUB 2I07B 4G6AC 3FB5A 1C5CH 3TFKC 3S98A 4PV8A 3ZHDA 3BD3A 4P2YA 4OV5A 1AH1A 3PV6B 3VXPB 1WQVT 4XPFH 1WBXB 4OT1H 3E6HB 1Y6NR 2HFFB 2VAJA 4Z7OE 3MFGB 1WCBA 2OMNA 4P57A 4UT6L 5I8KH 3LSOA 4UILL 1DANT 1UWXH 3SKNB 2A6KB 1CL7H 3MCG1 1FVDB 4QHMA 1BQLL 3LQZB 4DVRH 3BIKA 3FTGB 4WV1C 3GHEL 2DYPA 5BVJA 3N85L 3HE7C 1JWUB 3ULVC 3QUZA 1YJDC 4JFXB 5C71A 1IE5A 1PYWB 3BDYH 2X4UA 3JV6B 3O11A 3RUGA 1RUPH 3GSXA 4QXWA 5JIKA 1Z3GL 4D0DB 1MFEH 2O5YH 2Y72A 4G6KL 3VRLE 3HPLB 4X6DB 4PGEA 3MA7A 3QEHA 4OI8A 1KN4L 3BVNB 4JFHD 2DQCH 4YFDB 4OLUH 1FYTE 5GRJL 1M71B 1Q1JH 4NHUA 3K8MA 3SDYL 4CU8A 1JV5A 4KTDH 1HI6A 3JUYA 3NZHL 2EYTB 1I8IB 2UZIL 1T7VA 4KAQL 4RGNE 4JKLA 4KKLC 3GSXB 1ZVYA 5M7QA 3GSUA 5F3BB 2YD6A 4M61B 3C6SA 3V4PL 3VI3F 1RZFH 4J1UB 5E0QA 5I1GL 4M1GL 5C0BB 2Y06H 1VCAA 3MLPA 1U8MB 3DMMD 1MFBL 5HHXH 4FQIH 3TBTB 2ESVA 1H3PH 3NFNB 1ZLWK 4MHHI 5E9DD 1AIFB 3PJSA 2HJFB 3MJ9A 5KW9L 1PG7W 4LLWB 1KCRL 1REIA 5TE7H 4Y1AE 1ZT7B 3GSUB 3DXAB 3RTQB 4PYHA 4CVZB 1MHEB 1K2DA 43CAB 1CD9B 4L4TE 1DDHA 3RDTA 3L7EB 4MDIB 1T89C 1I9EA 5C8JA 3OB0H 1KBGH 4Y2DC 3U9UA 1M7DB 1NPUA 1CLOL 1UG9A 2P7TA 4HCRL 2BHYA 1AGFB 1IM3B 2IMNA 2LTQB 4R97C 4RZCA 1BP3B 4TVPH 3UPCA 4C4KT 1BF8A 5EC1A 1R5IB 3JWOC 3D25B 3TVMB 1YPZA 3K3QA 5F7KC 3W5NA 5ESVB 4HGWB 2AJSL 2FIRT 4HXAH 5DD5L 3HAEA 3LCYA 1FZOB 1VEMA 5EH1A 2PF6A 3I85A 3GB7B 2ZWLT 1RJZB 4HMCA 3BT2H 2NY5L 3LIZL 1TQCC 3MXWL 5FCSH 3NCMA 1U6AH 1JUFA 3OAYK 3BRGC 4YZFF 4RZCB 4LOUD 2ZOLA 1R24B 1M7IB 2E7HA 1MCQA 4MNGE 1CICA 3IU3B 2Z31A 1CFNB 1CG9A 5J1AB 3QIUC 3VFVA 2AS5M 4N5UA 5A2LH 1FFPA 2KH2B 3EOTL 5D6DC 3HAEH 3KYOA 4XI5C 2VLJB 3L5JA 4PFEA 4G8GD 4GKOA 1CL7L 2NZIA 4RSVA 5F6HJ 1F4HA 4M3KB 1VSCA 4LVHC 5IHUH 2V2XB 4M5ZH 3ZZ1A 3BN3B 3TBSB 5GRVL 4XCCH 2QKIA 5K9KA 4QTHB 1X6NA 5E1HB 5EBLB 3QDME 3CX2A 1HHHA 1PZ5A 3OJ2C 2BY0A 3F6LA 3QXAB 3U4AA 1RZJL 2HA1A 2WP3O 1MF2L 4LQFL 5HDOA 1ORQB 3KPQB 1RZGA 3DETD 2K7PA 2R1WA 2J4WH 1DQJB 4XP1H 2H9GB 1TQBC 5C0GA 4D9RD 5DYOA 5E03A 6FABL 3UJTH 2DM4A 4N1HB 5B21A 2Y36L 2W9EL 1UZ8A 3EOBB 2DM3A 1D7FA 2A74A 2VDKL 3SDAB 1INQB 4PG2A 1AR1C 2P8MA 4Y19B 5KVDH 5CZVH 3U30B 2HAZA 2VZ3A 3ILPB 5B38B 3QIBD 4ZUVB 3BOVA 1G7LA 1TCRA 2WIIB 3VI3E 3VXUE 2YKLH 5GGVH 3CFJA 4NGHL 5HI3D 5DQJA 4KI5D 1HEZA 1MCJA 3QIWC 3KWWB 2BC4A 4GLRI 4QHUA 2ADIA 3AROA 5F9OH 4AIZA 4U6XB 2VDRH 1UC6A 4QRPE 2X1XR 5ESAA 4L29B 5EIQA 2XQYG 3EOBA 1BFOA 3G6JB 1KXQE 3ESUF 4MXWL 3BGMA 3ULVF 5E2JA 2AJXH 1IAII 3VXME 3K0WA 3IJYA 5JNYA 1PY4A 3AXLB 4ZAKC 5CEZL 4PJBA 2E7LC 1XMWA 1D5BB 3OX8B 3BHBA 3G5ZA 3RWEB 3AS0A 5J9PA 1FCGA 4ZQKB 3NA9L 5JZ7D 1SJHA 4EQ3A 3QQ9C 5K59E 3ZTNH 4MX7B 1KYOJ 5AYQA 5IB3A 1BQHB 3CGTA 1BX2A 1EHAA 2NY6C 3LKPA 2X4PB 4U1NA 2YA2A 3O81A 3JWOH 1SJEA 2ZUUA 1NC4D 1ZA6A 4NUGH 4MNQE 5HYEA 4HD9A 1T20A 2R2BB 3TCXA 4PRPB 5E08L 1R3HB 4K9EL 3BSZL 2R0KL 4CW1B 3TN0D 1V5JA 3PE9A 3VWJC 5E6ID 1VA9A 3VXRA 5JR1L 1L9MA 3U6RB 2EE9A 2B20A 2N56A 4OF5A 1RIUL 2OR7A 5DD3H 5I9QC 1TJHL 1CGUA 4J23A 3TP4A 4P2QB 1A14L 1D5ZA 2D0FA 1N0XL 4GBXC 3WNMA 2EE6A 5CINH 2A9MH 4NM4H 1VPOL 5EU3A 4CNIA 5KZCD 5ISZD 1T20B 4FMFA 4YK4C 3RVVD 1ZMYA 1S3KL 3VG0L 3OAZK 1ACZA 3TH4T 1XF5A 4FQJL 4HC1H 3HC0B 4HWBH 4N8PA 3ECBA 4NKIH 3MRMA 4V1DE 5HHVL 3U6RA 1U8LA 1I8MB 1U6AL 4FQXC 1QP1A 4OCNC 1OSZB 5CZKA 4OIBA 1IGIL 3M1BB 3HMWH 5EOCH 1AKJD 4P4KD 4QHNB 4RAUB 3MJ7B 5D1QC 5C86A 3I02A 2ZCLH 4L8BA 1GL4B 3QCTH 5TQ0L 4JM2F 1CFNA 1CG9B 4K23H 2VDOH 1CQKA 4BKLA 4OKVA 2VITA 1DFBH 2NY3B 5EIIA 5L6YL 1CF8L 1IC5H 4QRUA 1W72B 4XCNB 1GGCL 5IIEA 2Q86A 1S78C 4LVHB 5D6DA 3L3IB 5INDA 1T21A 1NCDH 5FDWA 3LKSB 5LCVL 3FQXB 3X3GH 3TBVA 1FGNL 1SVZA 5CJ5A 5I0DA 2R9HC 1FNFA 2Q8AL 2WP3T 3UO1H 4Y5XA 1PVHA 5DQDL 4ONHB 5FYLH 3MNWB 4K23L 5LG1A 2EDEA 2DI7A 1WWWX 4Z78A 4G8FA 5F7LB 4CVWA 5C7XL 1E0OB 2IH3A 4G7VH 3SDDB 5MEOB 5I6XB 1U3JA 1QOKA 4X98B 1JI1A 4M1GH 4JFFB 3FQXA 3MV9B 2D7OA 3MV8A 2NNAA 5DHVH 5TQ2L 1MCPL 2H9GA 3EYUH 1JGVH 1ZTXH 1E6JH 5TF1L 2XN9A 1UB6A 4S10A 4JR9L 3LKNA 3OXRB 5HHNB 1NCTA 1EHXA 4X4MA 1CF8H 1IC5L 1JPSH 4X5XA 3M45A 4G7YL 3HFML 3MRPB 5I73B 4PBXA 3EO1B 1IZKA 3B9KB 4ZXBA 3JTSA 3PWNA 4H8WL 5D2NB 4OCXL 2HKFL 4NHCL 5D71H 3MUJA 5EU5A 3CFEA 4M6MH 1NCCL 4PJHB 3T3PF 1EDQA 2FBOJ 2PXYC 4MD0B 5HHNA 2APXA 4ZUSA 4JPKH 4HUNB 1IEBB 2CR6A 5D2NE 3TWCL 4PTUA 3QNXB 4GOSA 4WI2A 3RAJL 2NW2A 4ODTH 5JDJA 2DYPB 1KEGL 3MBED 3DRTB 4HIXL 5F1SA 3REWA 4Y16A 1NGWA 4WJ5B 1FRGL 1IQDB 2D2OA 4I9WE 4EUPB 4U6TA 1T7XA 4M62L 1CFVL 4RQQB 3V4VL 3UTPD 4OV6F 2NYYD 1MJJA 2NW3B 1W0VB 3AM8A 2DDQL 4U1MA 3WN5C 1NKOA 4L8CA 3MLRL 3VE0B 3IDXL 3HZVA 2D4FA 1FAKT 2IPKA 2FGWH 4XHQA 1KPRB 2QHRH 5ALCL 3ZKXC 5IVZA 5IW6A 5T33L 3D18B 4PJGA 3C08H 5CBEB 1A4KB 4FOMA 3EYQD 2BNQB 4WFHD 3QIWD 4Y5YB 3ZT5A 1KC5H 4P59L 1X3DA 3LZFL 1A6ZB 5HYJD 5JW4Q 3QDGD 1UM5H 1WGOA 3LDBC 3KPRB 4HULB 3SBWA 4IRSC 4DGYL 5BZWB 1RU9H 1OTUC 3TO4B 4OQTA 1KB9K 1BJMA 1G0YR 4BZ2H 1LO0H 3QUZC 3MZTA 1MRFL 5SX4I 1XF1A 3WYRA 1OL0A 1KNOA 2BZDA 3OAZH 1U58B 2Y9RT 3BPOB 3VW3L 1LP9B 2JJWA 3MV01 2FB4L 3BP6A 2DLTA 1I1FB 3QUXA 3F62A 2YBRB 5JUEL 3B6SB 3TNNA 5GZOD 4OB5L 1RK1B 3Q0HA 2EDKA 1NKRA 4XBEL 1L9NA 2VXUL 5IF0A 1IBGL 4S1DC 3MLYL 1DEEB 2FBJH 5F9AC 5T1DL 2DS4A 1TZIB 2DQUL 3O6KL 4XP1L 1GVIA 2HLFC 5DJAA 3LEVL 5C0ND 3RWJB 2YKLL 1WWAX 4PS4H 1MVUB 4MQXD 4PTTA 1YEHH 1LE5B 3QHZH 4LRNH 1EGJL 1MF2H 3DVFA 4LQFH 3MRRB 1YEJL 2ITCA 4X5WB 1NGZA 1I1FA 2C1PB 5CBAB 4U33A 1UWEH 3GRWH 3NH7L 4P5KA 5EO1A 3MA9L 4AT6B 1H3GA 4HGWA 3OR6A 2Q7NA 3IJHA 1INDH 3ZHKA 3FFDA 4NQUA 2YN3A 4KKLD 1EAPA 2VDQH 4WEUD 5TF0A 4IDJL 4B50A 2AAVA 1T2XA 1NMCB 3STZB 3P0YL 5T5NG 4OQTL 2X6MA 1FE8L 1UJ3A 2UWEB 4TSCH 4MNGB 3FQUB 4OF0A 3ZT7A 1T04B 3QRGH 5DO2C 1OP5H 3QWOA 3OKLA 4QNPE 1CCZA 3PWVA 5DRWA 5CUSL 1NMBH 3EO9H 1XH3B 4RMQA 1H3VA 1JNHB 1K8DA 4TUKH 2F5AH 4X6EA 1NC2B 3W9EA 3ARDB 2I07A 4OCYH 5BO1L 3VRJA 1LDSA 3BSZH 1G7PB 1C7SA 1I8KB 3FFCB 1J18A 3LZFH 4BQBA 4X99B 3UX9B 3E6HA 4QYOA 1AD9A 3B8YA 4U6HA 1QR1B 1UYWL 5AUMB 5C0EB 4FRWA 3M07A 2HKHH 1OAQL 1ACYH 3PHQA 5J12B 2P8LA 3DVNB 4X83A 4R0LA 5AZEH 3UBXI 3RWDB 4FQQA 3ARPA 1BBDH 5F97E 4D9QE 5DZNA 3EFDH 5D7KD 1R5VB 4HKJA 4PG9A 2ZCHL 5F7UA 3LPWA 1N3NB 4GRLB 2PYFB 3CFEB 4TOYH 1OSPH 3OMZA 4Y1AB 2FJHB 1XFPA 2AJYL 3TPKA 1JZ3A 4LL9A 4KRNA 3RFZC 3BZDA 3BPLC 4QWWC 2IANA 4ZS6D 4S2SA 1IEBA 4NYLA 4JO4H 5CHNB 4PJ9B 2QADD 1ES0B 43C9A 3C60A 2HRPH 3VWJB 1JHTA 1C1EH 1R3KA 4JO2L 4AQOA 3SJVB 1AGBB 4PLJC 5KSBB 1A7PL 2FJHA 1ADQL 5GGUA 1MY5A 3EYOA 1A3QA 5D1ZC 1MOEA 3HC3L 1OTTC 3LV3A 2DMCA 1Q0XL 4HIEA 2CDGA 3OKOA 3SKUD 3DRQA 2AI0L 1KJ2B 3LDBB 1MCIA 2BVUA 3DUSB 3VWJA 5EZJB 2VDNH 2WK2A 1JN6A 1IGIH 2W65B 5FM5M 2EEAA 5GRJH 3MROB 1A6ZA 2DLGA 4LLWA 1MFBH 2CK0H 1EH9A 1P84K 1XIWC 3SO5A 1MLBA 3IKCA 3MTRA 3WKNA 3DMMC 1DBAL 2HJLB 4M7LL 2ICCA 4KJWC 2QR0A 2ICES 4NKDB 1BQHA 2ATKB 1NGYB 5ALCH 5LWYL 5C0AB 3S96B 3QPXL 4GUPA 1A3RH 4P9HC 1Q9OA 2NY4B 4DK6A 1Y18A 3ZKND 4R4BB 3DUHA 4K71C 1ZEAL 1Z0NA 3PWLA 1U95A 3CXHJ 4M7KL 1JMXA 5K93A 1J8HD 1OCWL 1TZIA 3GEWB 1UM4L 3LQAC 4QWWD 3RZWA 4YAQB 3TYGH 5I8CB 1QSED 3QI9A 4JN1L 4Z5RB 3TH2T 1V7NL 1HOCB 2IBZX 1QBLH 3HNVL 4ZNEE 1YQ2A 4P3CH 1WTLA 4NCC2 5CP7B 2HVJB 4EN3A 4K3JL 1TMCB 5C2BL 5C0AA 3S96A 4R3SA 2ITCB 4X5WA 3B5HA 3U48A 1AIFA 3WIHL 4L4TD 3P73A 4FMKA 2CK0L 5LBSH 4F58H 2OYPA 4CNIB 4GAGL 3VDBA 3FN0H 4WCYH 5CSBA 2HG5A 5E6IA 4X6DF 4HZLB 5E9DE 2H2PD 3VXRE 3DLQR 4WI5A 1UM6H 3RJDA 2DMKA 4FQXA 5CP7A 4DFIA 2VR9A 4X6CB 2E9BA 5DUMH 3DXAE 4PJ8A 3NIFE 3RWFA 5DHYA 1JGVL 4KKCD 3DI2B 4MNHA 2IANE 4NRZA 4MA1C 1A7PH 3RNQB 3IVKA 4BJLA 1RUQL 1C16A 3ISWA 5DRWB 4MWFA 1G9EA 5D9SA 5B3JF 2HT3C 3TZVC 5C0BE 3JWDL 3W9EB 1B4RA 1LEKA 2ATPB 3OKMA 4MD4B 5FAAA 1R6VA 3LRSA 4JFDB 3O4LA 4WWKD 4IHOB 2GSGA 4WGWB 1YMME 4JRYE 3L3KB 1U8IA 1JRHI 2CD0A 1WZKA 3DX7B 3VFOB 5DJCA 1CDGA 4N9GB 1LNUA 4J4PC