1KTKE

Complex of streptococcal pyrogenic enterotoxin c (spec) with a human t cell receptor beta chain (vbeta2.1)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
247
structure length
247
Chain Sequence
GAVVSQHPSRVIAKSGTSVKIECRSLDFQATTMFWYRQFPKQSLMLMATSAEGSKATYEQGVEKDKFLINHASLTLSTLTVTSAHPEDSSFYICSALAGSGSSTDTQYFGPGTRLTVLEDLKNFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of two streptococcal superantigens bound to TCR beta chains reveal diversity in the architecture of T cell signaling complexes.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Immune system
molecule keywords Exotoxin type C
total genus 20
structure length 247
sequence length 247
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ktkE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ktkE02
1YC7A 3CU7A 4IIQA 1T4KB 2JCCE 5GS3A 3MLYL 4FXKA 3PIQB 4AL8L 3MTRA 1T03L 4Y88A 4LCUA 3PWJA 1HHIA 1M71A 3EO0A 3CX2A 3EJZC 4FTVB 4MVBD 4NKDB 3ZKMC 1FJ1A 4K3DH 4R26H 1BFOA 3TCLB 2GAZB 5C0CE 3GUTB 4NKIL 3U0WH 1RULL 3VMOA 1AGBB 3NGBB 4JEGB 4HIXL 4KK5D 3BEWB 4PS4H 2XA8L 4HLZG 1VPOH 5EBLB 1GGCL 3QZWB 2P5WE 4LLVA 1SJEB 4UDUA 1S7WB 5T3ZE 4IRZL 1VFMA 1T83C 3WKML 4XBGA 4HSQA 4U3CA 3ARYA 4JRYA 3PHQA 5I19L 1KPRB 1CFTB 1E6JL 4M1GH 4JGMA 3RAJL 1Z0NA 4QYOB 1P5VA 3FONB 1LMKA 4X5LA 2DQDH 2WLYA 4OGXH 2YZ8A 4ODXB 4YHOL 4OLXL 2YD1A 2YA0A 5I71C 1FGNL 3F5WA 2D31B 3D3VA 4Q9BA 3QIUC 5IMLA 4K3GA 4ZG1A 3GUTA 3SY0B 4HUUB 4XCCH 4TOYL 4K94C 1QR1A 4XGZA 5GSVB 1ZHLB 4HIJB 3QBTB 2IPKB 1BZ9B 4LSQL 4RGNE 3TIDB 3TV3H 2VDOL 5DD1L 3QULB 1NC2D 2VN4A 5DJYB 1AQKL 1BX2A 4JANB 3BD3A 4WHDA 4XP4H 2YZ1A 4L8DA 2OR8A 2J5LB 2X4RB 2V9TA 4HS3A 4ODSH 5CJ8A 3K8MA 1DFBH 2QL1A 2ORBH 4APQD 1PKOA 4WFEE 3HNVL 1WFNA 5JHDE 2J7LA 4OV5B 1J18A 5EUOA 4OBSA 1S9KC 2WBKA 4P4KA 1NCBL 4KDVA 4L4VB 5IG7A 3QUMA 4NQED 5KVFH 2AEPL 3QO1A 4G8IA 3MNZA 3KYKH 1JZ8A 2IALB 4AYFA 5DYOB 4I5BA 1DN0A 1F4XL 3HE7D 5JA8B 1LE9A 1GSMA 4ZQKA 3BVNB 1JVKA 4QWWC 5HHQA 1OWRM 3UTQA 4ZAKD 2FBJL 1EGJA 4U6VL 5EO0B 2FSEA 5JW4M 2HT2D 1E4JA 5JW3L 1RFDH 3L3DA 1J1OH 4R4BA 2VDNL 4YE4H 5K9JH 1B90A 3BKJH 4CDHA 2ADIB 3DROB 3V0AC 1NGQH 3HC3H 1BBJA 4OZHA 1PD6A 4Y1AB 3MRIB 3RJQB 4PGEA 1WT5A 4TSCH 2X89D 1NUGA 2APBA 4XX1G 3RWJB 4K3JH 1X5FA 2BZDA 3GRWH 4GAYA 4PRPB 5GZOC 3BWAB 4I48A 1ZT4B 2RJMA 3VG9C 1G0YR 1JUFB 4O4YL 2XV6B 5HI4C 3PG2A 4HUNB 4FXLA 3P4NB 3D3VE 3ECBA 3FONA 2OTUA 4QHUB 3QIUD 2QHRH 3BPCB 1AD9B 4NFCA 5I1CH 3LQMA 3ZT6A 3IXTA 4OT1H 1ZHBA 4MZ3A 4RAVA 1QZ1A 1WAAE 1QYGH 4LSQH 4JLRA 3HC4L 1A7QL 4NUGH 4M7KL 2VLJD 2YOCA 1ETZA 5M94B 3MJ7A 5C08A 3ZTJG 3IGAB 3D2UB 1IGIH 1I1AB 1HQRB 4EN3A 3K4ZA 1G6RA 3NFSL 1BX2B 4JHWH 1CDYA 1FL5B 1F45A 4Z7UE 4ZS7L 5D2LF 3MRBB 4AENB 3BUYA 1P4IH 2KZWA 3OKKB 4M3JA 5GS1B 1TQCB 1XR8A 2DIJA 4UBDC 3CVIL 2COQA 3RDTA 5TH2B 3GI9L 4KU1A 2OTUB 4QHUA 1MCRA 3HC0B 4AQ1B 4P4KC 3I6KB 1FRGH 1W8OA 2X4SB 4X80L 2HLFC 3MRRB 3S36L 1XGRB 1XIWC 2IFFL 3QEQE 4LL9A 2DL9A 5F71A 5IIEA 4U1GC 4OJFL 5DQ9B 4JO2L 1K3ZA 4PJIA 5DUBB 3TBWA 3NFPB 1CFVH 3FKUS 2FECI 3WHE1 4M48L 4NQXA 3CPLA 3DHJA 3RNKA 25C8H 2GT9B 4PGDA 3QIBA 4I3RL 3JTTA 4R9HA 5FGCB 3P9MA 3BYTA 1WEJH 1QYGL 3S37X 3HE6D 3WEXA 4BH7B 4ZOEA 3LRGA 1NMAL 4JY6A 4PRAB 4OGYL 1I4FB 3C8DA 4Y5VA 2VXQL 3O4LA 4JPWL 4JFEB 4DKFL 3DURA 1F3DJ 4K2UL 3TFKC 1ZLUK 5EZOH 2WW8A 3K74B 3ARBB 3FN3A 5FV2A 3PQYA 2L0DA 4RWYL 1I9RL 5E6YA 4O51A 5D2LA 5JHDD 3GJFB 5GJTL 2EXWD 2OP4L 4PJ5A 1CS6A 3IAPA 3LB6D 1MLBB 2EDYA 5E2TL 1A22B 4DTGL 4TULH 2X7LA 4KDTC 2GYSA 2YKLL 5KZCB 4U6HB 1QG3A 4P3CL 1OSZA 3UDWC 1O7SA 2B8OT 5I16B 3U1SL 5AYQA 1HXMA 4MX7B 2UY6A 1T7YA 5C0AB 5DVMA 2MNUA 3DGGA 2HG5A 3L6FA 2DQIH 1MY5A 4WDIA 1TJHL 1BQLL 1JPFA 3QPXL 4JN1H 1LK2B 2FBJH 3QSKB 3W2DH 1KFAL 3WIHH 4LVEA 5C08E 2ADGB 4QHNB 5CBEA 4GMSH 2IPTH 3OXSA 3Q48A 4OF6A 5DMKB 5GGTL 2AEPH 4X5XA 1NKRA 1B2WL 2I27N 1AKJA 4OCLC 4CADB 1IQWH 5ACMA 6FABL 4XXCC 1F8TH 1HNGA 1S5IL 5F93C 1BFOB 1XF1A 4PJ7A 1DBJL 1KXTB 3WUWG 3BE1H 4XPBH 4KRLB 4X7FC 3E6FA 3HNVH 2R2EB 4Y19A 5C07E 1OD9A 4C83A 4EDWL 3QWRA 2AJXL 4NNYA 1FZOA 3MZGB 4HH8A 1AFVH 2NY6D 3U82B 3QIBC 4FZEL 4G6JL 4YPGA 4PBXA 4WTZG 4LLWA 3OAZH 3ZE1F 3MRQA 3QEUA 1EERB 2FNBA 4PLKC 1VA9A 5D7IE 2VDRH 1ZS8B 4PJ5E 4DGYL 3U0TA 1FYTE 2ZUVA 3H9HB 1HXYB 5KVFL 3QNYA 4JY6B 5DQDH 4HD9A 1FGNH 4JDVB 1GYAA 1AXTL 4YGVA 2EDKA 4OM0H 4Y4KC 3IDGB 1V8HA 3FAXA 2OMNA 3DVNA 1XGQA 4NRXB 5IWLA 3FQXA 3G9VA 3RAJH 4OKVA 2EIBA 4ZD3L 1DFBL 3D39D 3LB6C 4X6CA 3BPOB 5EU5A 4YHLH 5HGGS 1MRFL 4Y4KB 1P9MA 4WFHE 4PJ7F 5CEYA 5F7YC 1X6NA 4D9QD 4HV8B 2X5PA 1QTYT 5IP4A 3MXVH 2HLAB 4PJFE 2RHEA 2XQYG 5JA9A 3CLEL 4RZCA 5ESQB 5JNYB 2VZ3A 1B0RA 1YQVH 2FGWL 1M7XA 2EDFA 3LKQB 3D18B 4OD3L 3LPFA 2BP3A 2HTLD 5E4EC 2ICWA 1AIFA 2E6JA 5JW4Q 4CMHC 1K3IA 4YEFA 3UYRL 2NZ9D 2OQJB 1R6VA 3HZKA 2AK4E 4OGAC 3OX8A 2YRPA 3HI5H 5HD8C 3TIEA 4KUCD 2AXJA 5EU3B 4YEEA 1KJ2H 5DURB 3ROOA 1LE9B 5FEBA 2PO6D 4MA8H 2YPVH 1GZQB 4FNLL 2FSEB 1IGCL 3QJHA 4ZXBB 4PLJD 1IM9B 1W72H 2HKHH 1ZT1B 5LAXB 3RZWA 4OCNC 2XZZA 1NCCH 4XH2B 2AV7B 5IMKA 3SHSA 2P46B 3PWVB 5L88H 1HI6A 1MPAH 4GLRI 4HFWB 1G84A 3N50A 4ZDHA 2JJVA 3RX8A 3S35L 4Y16D 3KPTA 3OPZH 3EOTL 4JRXE 1K9TA 1MLCA 3EO9L 1WTGT 4K3DL 4MD5A 4PGDB 1NAMH 4N0UE 1M4KA 2CIIA 5BOZG 4X7DC 4J4PA 2IFGA 3BDYH 1EO8L 3HR5A 3R06B 5EN2B 3GDBA 3OXRA 1CF8L 3WE6A 1HHKB 5IFAL 1KCRH 3KPRB 3GRWA 1YN6B 4QTIL 1DBAL 3S5LA 3O2WH 4QOKE 4NC1E 3CCHB 3P4MA 2E8YA 5SWZA 3F12B 4JFFA 2DJSA 3CLFL 5EU6E 1YEFL 1NBVH 4FG6D 3ELAT 3TNNB 3FL7A 1DUYA 4OTXH 3NTCH 4LEOB 3CFEB 2AJZB 1LDPL 2G2RB 4ZTPL 3GI8L 4XCFH 2XKUA 4XBEH 5C0RH 1HQRA 2R4RL 4EOWH 3P0GB 3PDOB 1IGTA 3EBAA 2P43B 1HCFX 1P53A 2E6QA 3U9UB 3EJYC 4ODHH 1HINH 1EFXD 3LZFH 1AGDA 3DMMD 1W0VB 3BZFB 3VMNA 4WWKD 3FQUA 3M17B 1MWAH 4H5SB 2YMXL 3DUSB 2EIEA 2NXYC 2VDRL 4C59B 3QAZC 5HGBA 1MCEA 4HWNA 2FJGB 1OP3K 4PY8J 3WNPA 3IETB 5HHOD 3EYOA 1N4XL 3T0ED 3V5DA 5I1DB 4BFBD 1WWCA 4JFQA 4NM4L 1AGBA 1F4WH 3KPQB 1QD0A 4UV4H 3RUGA 1QEWA 1MJ7H 1T3FA 5HHPA 3L95B 2JJWA 1PG7H 4JVPA 4X4ME 1YJDH 2FYYA 4K71B 2BVTA 5F3HB 3T2OA 4LSSH 3S3JA 5JXED 3DX6A 5I6XB 5D5MA 5ECJE 1WISA 3EDJA 4R7DA 1UB6B 5EZLB 4M62L 5HY9A 5JDSB 3ARBA 4LLUB 1WCBA 2VE6B 3LN4B 1N5AB 2HVKA 1HINL 4P9ML 1A3RH 2EDLA 2V2TA 5J9PA 3E6HB 2EEBA 1YNLL 3BZEB 1G9MC 1KFAH 4BFIB 2NXZD 4PJEA 4JFFD 3TJEH 5IJVB 1G9NL 1I7RA 2F54B 3D48R 4D9LH 1CFQB 5I30H 2E7LC 1UACL 3G9AB 4FN0A 1FZMA 4S1DD 2EDWA 3CH1A 3DVIA 1AR1D 1T1WB 2J6EH 2Z4QA 2EKSA 3BP7B 3KLAB 43CAB 5DA0B 4LRIA 4UB0L 3AB0C 1OCWL 2GHWB 1HHIB 1M71B 3EO0B 5J3HD 2L7JA 3HUJB 4C57C 2VLKA 1C5BL 1FFPB 2QSTA 2R0ZL 5JDSA 5ILTH 5KSBB 2HH0H 2C4FU 5EOQH 5GRUH 1UM4L 4HGMA 5C9JA 4JM4L 5GZNC 2HFFB 2QADC 3F6LA 3DXAA 5EOCJ 4R0LA 4Y5VC 1DBKL 4YNYA 4E5XB 1F4YH 1M05B 3SO5A 2VQUA 3DIFA 5KVGL 4FP8L 1KJ3L 2DYPD 4IEFB 3RVTD 2LAAA 4NZRL 1CD1B 3S35H 2VXQH 3GGWB 3VXQB 4U1KB 3GM0A 2XN9A 4KMTH 3ZKSD 3KYOA 3CH1B 3SGEH 1JZ4A 3QUXC 4FQJH 4L8SA 4TTDC 3RGVA 4Z5RA 2YBRB 5KSVB 3VGDA 1D5MA 3G08B 3BH9A 4E0RA 2ICWI 1L0YA 5JXEA 4RMTA 4PJXF 2ATPB 4D8PB 3WBDA 4NO0B 4JY5H 1WLHA 4K55A 5D2NE 3FQTB 3AMKA 3G5XA 5TFSL 1G7IA 1T2QL 2OJZH 3IDXL 1JL8A 4HUXA 1HXYA 3VH8G 4OF7A 3UTTB 3O3BB 4L3EB 1CLYL 2IADB 4JN2A 4ENEC 3EDKA 4QRPE 3BKCH 1H3XA 5CP7B 1G7HB 2D9QB 5DT1H 2BNQB 4NQTA 1QSEE 4KK9D 4MD4B 1E4KA 1YN7B 1ZHKB 4XAWH 4OD3H 2VISB 2BC4A 4OD2A 3W39A 3EW3B 4FTVD 1RAMA 1C08A 3BXNB 1MRFH 4GAGL 5IEKB 1INQB 4F7TB 3FT3B 1AXSA 5IHUL 4ZO9A 1RIHL 1YY9C 4DJMA 4GBXD 5I1IH 3ZMRA 4P2QD 1CFQA 2NY6C 4G6ML 1TZGH 2NY4C 2XZCL 1ZT7B 1KJVA 1EHLL 1L7TL 1CWVA 2DQUL 3B83A 1GAFH 2ITDB 1P1ZB 4PJEF 4TNVK 2W9DH 3NCBB 5DYOA 4JRXA 1EXUB 1WWAX 3OMZA 5IHLB 4J1UA 4EBQH 1EEQA 3GO1L 4GW5B 2HJLB 1AP2A 4IM8A 4AEIH 5HI3C 1PKQA 5I1EH 5KSBA 2V7HA 3HE7A 1SVZA 5JW5B 5F9WC 3P2TA 1YMHB 1XF2A 2BJML 4ZAKA 3GSWA 1F13A 3MXWL 3PDOA 2DDQH 4DGYH 4XPGL 4Y2OA 4XPAL 2OXHA 3FFCB 4M61A 1FC1A 2EO1A 1P7KA 3S7GA 1LP9B 3P4OA 3C08L 2WINA 3OGCA 4NQCE 3VRLE 4DN4H 2MTPA 5TDNB 5J0BA 5BJTB 3CPLB 3RNKB 2ARWA 3U36B 1NFDE 1NCAH 4JFEE 3U9PH 2PW1A 2R15A 2BOCB 3MCKB 4PJ8D 2R2BB 4L9LB 2O61B 1IFHH 2MQ0A 2W9LA 4YBQC 1U95B 5KS9F 2X09A 4QXUL 4Z77B 2IQ9H 1Z3GH 4HGKC 4YX2L 4FFWD 4RMUA 5I0DA 1QEWB 5HHPB 5DWUL 1RJLB 3IXTB 2X4UA 3FFDB 12E8H 2FDBP 5SWQB 3AGVA 5I66A 4WI9A 3VD9A 3NOIA 5SX4I 1FAIH 4OCWL 2JF1A 2JJTC 3O6FB 2ICES 1P7KB 4TRPH 5DEGB 2KUTA 4B5EA 2EE6A 1EAPB 2ZUWA 4FQQA 5LGHH 2W0LA 4XP4L 1KENL 4QXTB 5F9WB 5GRZA 4AEFA 1MCWW 4XP5H 5C3LD 1DBBH 1YDPA 2PO6C 4R8WL 5ESAA 1NCDH 4QOKA 3MBED 3P73A 1I3GL 2VH5H 4PLJC 2BERA 3OKOB 2HFGH 4DOHE 4P2RE 4TULL 5DVNA 1D5IL 2HTKD 4DTGH 2FHFA 1XF3B 4MNQA 4P23C 5DRNA 3MRRA 3BPNB 4GBXC 4HH9A 5I2IB 2JK5A 4LEXL 2Y72A 1QP1A 2PYEA 2PCPA 1IM9D 2AJ3B 1Z5LA 3V6ZA 5HVHC 1SBBA 5IIEB 4QHKJ 4DKEH 3VD3A 2JIXB 1FZKA 1EZVY 5TE6L 2LTQC 2DQHH 1U91B 1HEZB 3OKMB 4N68A 1QO3B 5BVJA 1FFPA 3O3DA 2IMNA 4MSWB 1N7ML 3ARGA 1Q9KB 1LP9F 3GSNH 3UEZA 2C7UA 3QG6B 4K2UH 2H2SD 2XTJD 3VXUD 1J05A 2OI9C 4WU7B 1FNSL 2MPAH 1GPOH 4XGZB 5J11C 2V7HB 3PP4L 4RGOH 3ARED 3DJ9A 4MNQB 2RCSH 4L3AA 4NKIH 4FG6C 4S2SA 2JCCB 3JV6A 1VKXA 1BFSA 2WWKT 2DTMH 3CU1A 4NJAH 3IJHA 4L5FL 4K71C 4HKZA 4QRRB 4JO2H 1AHWC 2A73B 3QNXB 4XNMB 5E9DA 4MNHB 3G08A 4E0RB 1UC6A 4YBQD 2MSPA 3IDYB 4PJCE 3V79C 5A3ID 5EBGA 4NT6B 5D96C 3D2UD 2DKSA 4JPVL 1JYNA 3GI9H 4Z77A 3JVGC 4Q58C 2CDEB 2PW2B 2NXYD 3ESUF 5FCUL 4R2GD 2OJEB 3VDBA 3VFTB 3KPNB 1A7QH 4NUGL 3MUGB 4XPFL 3BGMA 1FZJB 2DIBA 2XI9A 1GPOL 1ZANL 3GMRB 4JZOA 5HTSA 4P5TB 1EDQA 4CADA 1K4DB 3LS5H 1IE5A 5TH2A 1BF8A 4PJ9B 4R4BB 2R56L 3IXAA 4ZFOL 2HTKC 1AKJD 1A6TB 4NGHL 1GHFL 1SQ2N 1B3JA 1IC4H 2BX5A 2D7TL 4PP1C 4Q6IB 4Y4HA 4ODBD 1FH5H 3QUZC 4CW1B 3G04A 1LK3L 1ED3A 5J13C 4TSCL 5I8KH 3FOMB 1VEOA 3QWOB 4TVPL 4WI7A 5ALCH 3KYOB 4ZNCD 5J6GB 1RHHB 2DM7A 4U1JB 5BVPL 4XVTL 2YSSA 4U6YB 1QFWL 2CIKB 5E8PB 4P4RA 3QDJD 2AKRB 1RZGA 4FFYL 4APQB 4A6YA 3VD4A 4F7MB 1A6VH 2D7OA 1QO3A 5BVJB 3HC3L 3B8YA 4U0RB 1T80A 1UCBH 4H0HB 1XF5A 3MRGB 4G8FA 3U7WL 5FHBH 7FABH 4JQIL 3E2HB 3EO1A 3QXDA 4Z7VF 4UV7H 1HDMB 4AIOA 3DRQB 3G5ZA 1K85A 4GRLA 2R0LH 3KJ4C 5BCAA 2LVCA 5I1EL 1G7LA 1PEZA 4AK1A 1RK0A 3UJTL 2O5ZL 5F44A 1RI8A 2ITCA 5EZJA 1H3VA 1KTLA 5FYKH 3ZDYF 3TBTA 1P7QA 4ODSL 2CO6B 5E9DB 3BP6B 3IJYA 2XZCH 1HOCB 4PJAE 4G6MH 3KPSA 2N7BA 3A6OA 1ZA3A 3UTZB 4Z7QE 1UQSB 3DLQR 1JGVH 3LEXA 3O8XA 3KS0H 4R2GC 1OTUD 1AQKH 4YHPB 1F2XK 3FFDA 1WBXB 1TJHH 1MFEH 4LHJB 2XA3A 3IYLW 5TQ2H 4HAGA 4PR5A 5FF6A 3D9AH 5E7FA 2VNCA 3DX8B 3MV7E 5KSBE 3RWDB 1R24B 1MY7A 1CL7H 4KQ4L 4QRUA 5ID0A 1IKFH 2ZUUA 5DFWH 2ZZUT 2PO6A 3GSWB 5TQ0H 3UYOD 4LMQI 4HK0A 4JY5L 4QRPA 1U8JB 1A6ZA 2XQYK 2ZOKB 1TLKA 4KZDH 1T1ZA 3UROR 3SE8L 1QFUH 1T4KA 15C8L 4HS6B 5ABDE 3IB4A 3V5DB 4C4KO 4PS4L 4RAHA 4JFOB 1J86A 1WAAA 1U42A 4NM8H 4XNUH 1QSFA 4B7LA 4MLSA 3PGFL 1MNUL 5IKCB 4WW1A 5T33L 2YA2A 2RFXA 4JJ5B 4XBPA 1QFHA 1HHHB 5SX4H 3CFBA 3LS4H 4P46D 1XGUB 1KLFA 2IANB 2V2XB 2V9QA 3ZHDA 4FQIL 5GGSA 3MLZH 5IROC 2H41A 3VFUB 3OJVC 4MXVF 3SDDC 3KPSD 4ZXBD 1KPVB 5E1AA 4PRBB 5E8OA 1JJUA 2I07B 4YFLI 3QIWD 3RWJA 4F80A 4IS6A 5SWZD 5A43C 4QHMA 2NXYB 1Y6NR 1JUFA 5GISL 4JFDA 1IAIM 3QUKA 2R9HD 3LKNB 5TE4H 3P9LA 4U6TA 1UGNA 3SKOB 3DRTA 3HG1E 3NH7H 1ZGLA 1LNUB 4XVUD 3VRLF 3F5WB 3ARGC 4ODTL 3BP6A 3IJYB 2B1AL 5IBUB 3VGFA 1VACA 1P6AB 1X5IA 4X6EA 5GGUB 4AG4H 3M8OL 4KMTL 1GGTA 4JFHE 4JFXB 1I7ZB 2FRGP 1KIUA 4V1DE 3ABZA 3O4LE 4D0BA 2ILLA 3QFJB 5J56B 1EX0A 2BDNL 3BQUB 1I8MA 1U3HD 3IKCB 2GW5A 4J3WA 2JB6A 4TRPL 3LQZB 4OQTL 5D1ZC 4PJGA 2J4WH 2ZCHL 1NMBL 4JM4H 3U0TB 1U36A 5LQBL 5EOQL 1A6PA 4PJ9A 1L9NA 2EXYD 2A77L 5KSAC 4PJBA 3SDAC 3D25A 1YEHL 3CFCH 4Y4FA 1W8NA 3JWDL 5T1KB 1XH3A 2ZUQB 4K8RC 4FQPA 4GG6F 3BOVA 1EBPA 5C0BA 3AC0A 3DGGB 1Y18A 3D5OF 4KRPD 2NY1C 5I8EA 3HB3D 4X83A 3WNMA 3ARDD 5AAMA 1A7PH 2X2YA 1XF4B 3KPLB 2B1AH 2ZJSL 1EMTL 1MQ8A 1CZ8H 2EDTA 3ARBD 4N1EA 3JZ7A 2YSSB 5E2UH 1FFOB 1OAZH 2BVPB 1YNLH 2CQVA 4PV8B 3VFGL 5C7XH 4HHAB 5ADOL 4HPOH 3MV9B 5ERWB 4F7MA 1A3LL 2WQ8A 3FQTA 3KYKL 4CAGA 4NCC1 1FG2A 4N8VB 3JXAA 5HGDB 4ODHL 4HX1B 5EUKA 4U1GB 2CRZA 3QIWB 4ZS6D 3PF2A 3AU1A 3V95A 2AS5M 4R0LC 2VABB 1MRDL 4NO2B 4ZUTA 3HPLA 2MCG1 2AJZA 4QGYA 3QIWC 1XGYH 1A21A 1UKQA 2QQKH 1TETH 4RFNB 1KN4L 1OF2A 1ZT4A 1NLDL 4JANA 5D71L 1ACYL 1KIQA 4JZOB 1LO4H 1E28B 3QPQD 5FGBC 4OIIL 5EC2A 3T1FA 3TP4A 3LQAL 5FIEA 1UT9A 4JQXC 1RY7B 1NMCB 1U3HA 4I0CC 3DXAD 4KKLC 4U1IB 3TZVC 2LABA 4Y2DD 1F2QA 4Y7MA 3KPOB 4G7YL 4HJJL 1K8IB 4EUPG 4HK3J 1LEIA 4OQTH 3V52L 1KCLA 3CDYA 3DX9B 3LZFL 1N6UA 2NY3B 5KSUA 5ADPH 3EUUA 4LGPB 3HAEA 4V1DD 2BRQA 3QHTC 3O2VH 5DF0A 3RKDC 1VHPA 1JP5A 1ETZB 4UTBH 3WMSA 5LWYL 1M7IA 1RHHA 4U1JA 5DMGC 4ZAKB 1FG9C 4HQQH 4IRSD 4DK3A 2R8SL 5JHLH 4QEGA 2M1KA 2XICA 4A6YB 2PXYA 4MNGB 3ULVE 1FFNB 2DKMA 2YK1L 5HBBA 3MREA 4HC1H 3EFFB 4OLVL 1MCCA 2P24B 3PABA 1R3IL 1BMGA 4MJIB 5C71A 3O2WL 1V7NL 4LNRB 2ATKA 4P3DB 4LEOA 2GJ6D 3FO9A 1N26A 2EC9T 2E27L 1NBYA 3HE6A 5CKAA 4N5EC 1RZFH 2PUQT 3DSFL 4MXQC 3MV7B 5C0NC 3LH2H 4FXGB 2DQFB 1MCKA 4L8CB 3QJFA 4OLZH 3ULVH 3P9MB 1M7IB 3C60C 1RZFL 3GHEH 4NDMB 5HJ3A 4XCEA 4MYWB 1BLNA 2UWEA 3WIHA 1NC2B 4TUJA 1U8NA 4WV1B 1QSZA 4XVJH 3WLWD 3WN5B 1NAKL 4Q97A 3S35X 4R3SA 4OD1H 1AGCA 5KS9A 2DYPB 1X9QA 3QUXA 4UV7L 3V8OA 4C56A 4F8QA 4R7NB 4MA8L 3DXAB 5C92A 3HLAB 5A2FA 1TCRB 4K3EH 1KJ2L 2AJUL 4HWBL 1OP9A 1FL5A 5FECB 5D7IB 2FD6L 5F1IB 5BRZB 4XZUB 3VFMB 4KKLD 2EEDA 1S7RA 3NAAH 5C6TH 1KSRA 3QCTH 3X11B 4KQ4H 1V3KA 4IIQB 5E70A 5F7DA 5ICYB 4JZNB 3MRJA 4ODWA 1FNGB 1WT5C 1KV3A 4L3CB 1TPXC 3AS2A 1JWMA 3MRHB 1CDUA 5FO8B 3BKMH 4KQ3H 3GBNH 5C07B 1QR4A 5ICZA 4HBCH 5DQJB 1WJ3A 1LK3H 4Z7OF 5I8CA 2EDRA 5CBAA 1IEHA 1JGLH 1KULA 5E9DE 1ZLVH 2ICEA 3CLEH 4WVRA 1QHPA 1OAUL 2DS4A 1H3UA 3BZ4B 5EO9A 1JBJA 1T04B 3JWOC 4WU7A 1KTRL 4NQDE 4LSSL 1MI5D 1RMFL 1WZ1L 2AJYH 2IGFL 4RNRB 1KCUH 1VDGA 3QXUA 3DUHA 2ESVE 4P99A 5F7EL 3X12A 4Y4FB 1CXIA 2OL3B 3CFBB 4U7SA 4GRWE 5I74C 3NA9H 3H9SD 1MHCB 4X7TA 5B22A 4LFHD 5GGSB 3SBWA 3T0EB 2CKBL 4PY8I 1BECA 3MRFB 4WGWB 2ZUYA 5T5NG 3SQOH 4H88H 1FORH 4F7EA 5FGCE 4JB9H 3P9WB 3EYOB 1SVCP 5BS0A 2A0LD 5GQBA 1AXSB 2V7NB 3QPXH 4FZEH 2Y07L 4G6JH 2G9HB 3NCFB 5KAQF 1BQLH 1A7PL 4MX7A 3LRSA 1MCIA 2DQEL 2Q3ZA 5EBWB 4P57A 3V7AE 4FFVD 3DO3A 4IMLB 3UBXB 3SKNB 5MP6H 3OAYH 4HUKB 3Q1SH 4AMKL 1IAIH 2FR4B 3NZHH 3FN0H 1PZ5A 5BRZD 3TNMB 4O00A 3UTOA 1JZ3A 3V7MA 5E4EB 1JF6A 4PJFB 5IEHB 5GRXG 2BY3A 4LOUC 3V2AR 4Y2DB 3X17A 3Q6FB 4NC1C 3Q6GH 3PV6A 5I74B 2P42B 3B5GA 4LCWE 2OX5A 5C0JA 1D5ZA 1LP9A 3P4OB 4RZCB 4DKFH 4LLAA 2F19H 2B7DT 4ZXBC 4UIMA 4I13B 4QGTA 3L3OA 5A40E 2CKBB 3D18A 5D7KE 3QO1B 2R2EA 4G8IB 4Y19B 5IVNA 2VSDA 2KKQA 1TJGH 1EJ6A 1Q9LB 3FQUB 3W11C 5EULV 5SWSA 5I73C 3CDGA 4WEBL 4WFFD 1KN2L 5FDWB 4MJ4A 1MI5E 3BD5A 4ZSOE 1IAII 4PG2C 1ITBB 1I3GH 2VH5L 4M7LH 3U4EA 4P2OD 2C4FT 3BEVA 4MGXA 5FCUH 1X5XA 2QSCL 4PRPD 2QTEA 4ZUVB 4ELKB 2EE9A 2VR4A 3L3HA 4YNYB 4BZ1L 3H9SE 3WYRA 4O5LL 1BM3L 4GRWF 4M3KB 2J8UF 1HZHH 4PRIE 5DA4A 1LEKB 1EUTA 5GJSH 1HSBA 3CFDA 2P8MA 5LBSL 4M1DH 5T3ZD 3P40A 4L8DB 5EORH 4X0KA 5HHXL 5GGRA 1MFNA 3X14A 5JW5A 2A6DA 1U8PB 4G6AC 5EA0L 2HRLA 5AZEH 1MHHA 2ED7A 3LKRA 5D2NB 1PDKA 3SQBA 2VZUA 3WSQH 4N8CH 4GQ9H 5CEYB 5TF1L 4KRPC 3IVKA 3C87A 5C0DB 4M1CD 3PP4H 1MEXH 5DGRA 2ZNXA 3UTTD 2YUZA 4FMFA 3BGFB 3SE8H 1JYXA 4KH2A 3VGBA 4P23A 3B2VL 4Z6AT 1T21A 5CZXC 1EK3A 2XG5A 5C1MB 2AK4A 2DQTH 5IFJB 3ZSSA 1IAOA 2Z4QB 3BP7A 2CUMA 4NIKB 3V6BR 4MA3A 3MYJB 1UJTA 3SDXF 2F53A 3VFPA 4GRWH 3G6AB 3MXWH 4UQ2B 4DAGH 4IOIB 1WICA 2ZOLB 4HUVB 1KC5H 5C0IA 1F3JB 2FX9H 3EFDL 4YK4B 3B6SB 2A9MH 4F9PA 3P0YL 5TQ2L 35C8H 4TN9A 4LSUH 4L8BA 3RVWC 2APTA 3Q5OA 5F9JA 1UENA 2RB8A 1GGIH 2BSRA 2ZOKA 2A74B 4ZFGL 4KTYA 3QCTL 5C0DA 1FLRH 4LP4A 3MRLB 2HFGL 4LVOB 3S88H 4ACPA 1J1OL 1HQ4B 3DX7B 3W82A 2DIAA 3OJ2C 1KJVB 2C1OB 2GFBB 3EAKA 4QRTB 5IV2A 1AFVL 1JZ7A 1P9MC 4BQ8A 5CILH 2NYYD 3O8XC 2JKXA 1MAKA 4J23A 3O3EA 2QKIB 4NT6A 1AGFB 3V6OA 1A1OB 3BRFA 2D03H 5DRXA 4UU9A 1BHGA 5IMLB 4PTTA 5J8OA 5DJDA 3I6GA 4XNQB 3PXJA 2Y4SA 4WW2F 1WBZB 4WFGD 1CD9B 2O5ZH 2DKUA 3VFVB 5K9KB 4LKXA 5E8NB 1CXEA 2Z92A 1CGTA 1MF2H 4PYGA 3QDGB 3HR5B 3R06A 2UVEA 1G0XA 4RAVB 3V0VB 3CSPA 3IFLH 1KIPB 1FVEB 4NKMA 4DEPB 2B5IB 2H32B 4PJHA 4RISH 2BHYA 4JY4A 2DM4A 1KGCE 1MHCA 2F5BH 3ZDZE 1WVZA 3CVHA 3D3VD 1OGTB 3STZA 5GHWL 4OLYL 4MAYB 3LN9A 1TNMA 3MLPA 1BD2D 2WUBL 5F8QC 2APVA 4E42B 3CAFA 4ZUWA 2H2PD 1CDCA 1DUYB 1OWWA 1ZGLB 4PJBE 1WIOA 3SCMA 1HILA 1BOYA 1U8QA 1U8PA 4PLKD 3SDCA 3IFNH 1X4XA 4Y5XA 4ETQA 4BSWB 5K9KA 2DD8L 5DMJB 2OSLA 3PWLB 1ONQA 4J12A 5DJ2B 1U0QA 4ZPTB 3IDMA 4N0RA 2Z8VC 1FH5L 3DSNA 4YUEL 4OGXL 4N1CA 5EBWA 4XT1C 5F7LB 1JRHH 3C8KB 5IBTH 3WFDH 4MNHA 5HPOA 1MIEL 1E6JH 5D2LE 5I8CB 5ADPL 5I19H 5GGVY 4RWYH 4IRZH 5C0GB 1X5AA 2W0FA 3FB6A 1ZLWK 3H3PH 1MFBH 4JE4B 4GW5A 1NGYA 1CYGA 4JM2B 1X5GA 3QA3A 3O6FC 5ID1B 3TC9A 1WC7A 4B50A 3PQYB 1OCWH 3QI9A 1P7HL 1ORSB 4UQ3A 3TPUA 5HHME 4LCWB 1J0KA 4CUCA 3HN3A 4Z95L 4NQSB 2QQKL 1H3PH 4Z5RB 3S37H 5J57B 5EBMB 1G9ML 1JPTH 1C7SA 4PV8A 4HS3B 4F9LC 3U79A 2WZPD 5HI4D 1MVUB 4OZFA 3N9GH 4DOHB 4JB9L 3HRPA 5IM7A 5HVWA 1FCCA 4JKLA 4ZFZA 2ZCKH 3OJMB 2ADFL 3LKOA 1UZ6E 4W4OC 4PP2B 3FQRB 2A6JB 4GG6E 1I7TA 4PB9H 1VADA 3UBXI 1G9EA 2ED9A 4HUXB 1DVFC 2VDMH 2W60B 4EN3B 1CXFA 2IALA 2Q7YB 3TA3B 3PWPE 1BWMA 3R4DA 4KKCC 3T0AA 4J3TA 4HKZB 2PN5A 2ZSWB 3QDJE 2NMSA 4UV4L 3VXNB 2YC1A 1GIGH 4IDJL 3QEQB 5D6CB 5HYIA 1DLHA 4UBDD 3MCLH 4NSKB 3VXMD 4P2QA 1KJMA 5KOVC 1KIRB 4W6YB 5D7LE 1KB5H 4YDJA 5FDYA 4X6BA 4O2EB 1CFSA 3ZKNC 2FL5B 5JZ7D 1NQBA 3HMXL 1ZV5A 5IB4A 5IB5B 3WO4B 1AQDB 4DVRL 1U8OB 1UM4H 4OCMC 5DSCA 5ITFB 1LP9E 5D70L 3AREB 3F62A 4L8SB 3RGVB 1FO0H 5DJYA 4K3HA 5SWSB 3ALXA 1SEBA 5D1ZB 5T3XD 2PKDA 1GZQA 3VFRB 3M1BB 4J8RA 3B5TA 3S8WA 3M8OH 4Y1AD 4AG4L 3BRGC 5C0FB 5I1LB 2ZUQC 5JPNB 5GGVL 4YE4L 2ID5A 4MCYB 4KJYB 1XGPA 5DJ6B 5FYJE 4NO0A 2XFXA 2ATKB 4Q6IA 4Y4HB 4ZUTB 5FYLL 3NZ8B 4LOUD 2NX5D 5FGSA 4KZEL 3JWDC 4WW2C 3PL6D 1VKXB 4JKWA 2VZOA 3HHRB 3RTQB 1IEBB 4BELD 2QR0A 4LCWA 1E27A 4RRPA 2OI9B 4PJXB 1E28A 3I02B 2ESVD 3QUML 3UCRA 1A9EB 3K80A 4JO3H 1EV2E 1T0PB 4A2LA 2EYRA 3F7VB 3L6FB 3MV8D 3RTQC 5EU4B 1HKFA 3RQ3A 3DSFH 3NCEB 2PO6B 5DJCB 2PTTB 5TPWL 2W07A 2J8HA 2XWTA 1WBZA 1N0XL 2VDQL 4DW2H 4BUHA 3BN9D 4OCSH 5JPNA 1INQA 4F7TA 2EZ0C 43C9A 3U4BH 4LSPL 1D9KC 5C0EB 1OSPL 5D2NC 4C55A 2EH8L 1A8JH 3DX9A 1INEL 2HKHL 2CSPA 1HH6A 2BY0A 1CG9B 4JZJC 4ZNEA 5TDPA 1JHKL 5DUML 2BK8A 3IDYC 5JOPE 1B6DA 1CE1H 5ETUA 3BWAA 4M8QA 4IMKC 2H9GA 3HZYA 4NQDA 1IGMH 4V1DA 1MWAL 2LTQB 1NFDF 1MJJB 3DETD 4IOIA 3I9GL 3QDGE 5GSRB 1JF1A 2AABL 2FD6H 5MHSD 3C2SA 4W4NA 1L9MA 4FMKA 4DGIL 3VFUA 3H7BB 3O0RL 4P2QB 3ZT7A 4XH2A 4KK8C 3MLSH 3LMJL 4N0YL 1DQMH 3P30L 2FL5A 4PJDB 3QQ3A 1IL1B 2Z91B 3RY6A 1T2XA 3P3YA 2NLJB 5F89A 4XXDA 1YQVL 4E41B 5ALBL 5D1QA 1ZS8A 5J6GA 5KVEL 5KVEH 4LHUB 4KROC 3H3PL 2GTWB 4MDIB 1BAFH 2J1KA 5I17A 5MEOA 2QKIA 3G6JB 5HVHB 1T66D 2C7UB 1KB9K 1CXLA 3QG6A 1GC1L 3DX6B 3CSBA 4JM2A 4GRMB 1MIEH 2CMRL 3MGOA 2YD9A 3CC5B 3HZMA 5C3TA 5HY9B 5I1LA 3LMJH 3RUGF 5BV7H 1XGQB 3BSZL 3MFFA 3EHBD 5FYKL 3EIFA 1CLOH 2EEAA 3PL6C 2EDQA 2DWDB 1A6AB 1MJUH 1GOHA 1Q0XH 2PYEE 3QUXD 4GAYB 3EYSL 3EDEA 5K9QG 5HHMB 4O2FB 1I1FA 4BZ2H 1U93A 2HVJB 4ODXA 5T1LD 5I1GL 5ITBL 1G7JB 2B1HL 4JVWA 1HILB 2YPVL 1XCTA 1HHHA 4FNLH 3ULUF 3KPSB 3VXPA 3D39A 5F7HA 1ERNA 3G6DH 2KQNA 1IC5H 4PRNB 4P9HH 3U4BL 4IHOB 5FUZH 5LWYH 3L7FB 4OQTA 5HYSG 3BYYA 1A02N 2FJGA 1ZHBB 5IESL 3IDMB 1U8IB 3UYRH 1FV1B 2M8XA 1C12A 3FTGB 4W70A 3WHE0 4F58H 5ISZB 3MBEB 2WP3T 1HHGA 4HDIA 1UFUA 4RDQF 3PGCA 4O58L 4K23L 5E56A 2D03L 2XTJB 3H9HA 4JFDB 5DD3H 5GGTH 5BMFL 1QFPA 5ILTL 1OL0A 4JG1H 4O2FA 1G1CA 1MJJA 2HFEA 3E3QE 3RIAK 1JGEB 3RZCD 5KZCD 3RWIA 4S1RH 1XT5A 2AK1H 1FIGL 1D5BB 4U0RC 4BFGA 5HYSB 3OZ9L 5LCVH 4U4BA 1OB1B 4KK6C 1OGAE 1DSFH 1RIVL 1OAQH 2YPKA 2A6IA 3DUUA 2MCPL 3IRPX 1LK2A 2V2WA 1MLCB 1JTTA 3ZKXC 2VXTL 3QDJA 4WTWA 4FXGA 1T1XA 1P4LA 3DTXB 4LASL 3G5YB 1I1CA 4G80A 4OKDA 4NQSA 3BEVB 4R4ND 4LSUL 1U58A 5CD3B 4IJ3B 5D1XB 1DR9A 3FTGA 3HE6C 2XKSA 1TVHA 3QIBB 5EO0A 3F58L 3HI1B 4ZOBA 1L0XA 4LHUA 4MDIA 2O26U 2N56A 4UDTB 5DRZA 4PJBB 2M2DA 1BJ8A 4NRZA 3L7EA 4G6FD 4OIBA 4XCNB 5EIIB 3UO1H 4Z18A 3OB0K 3TT1H 5JDJA 1YPZB 5C09A 3B2UD 1IGYB 3QCVL 1OGAD 1DANU 2JLLA 3MCLL 2V2WB 2AJVH 4R96B 2HFFA 2GSIA 4G43B 4OV6F 4PRHD 2G5RA 3PV6B 1JV5B 5IOPA 2DTML 1NEUA 5BRZA 4KUCF 5IEKA 4ELME 1P6FA 1TJIH 3IS1X 3QXAA 1YEHH 3CFCL 3FO1A 4RGOL 4DFHA 4MJ6B 4IOSD 4NWUH 4GLRH 1PLGL 4KVNL 4OFVA 3DMMC 1FSKB 4X6BB 4HG4J 4MB5A 3RL1B 1SY6L 2BNUA 2VITB 3WFBL 3FO9B 2FHCA 3VGGA 4FRWA 5TE7H 1U8OA 4NO2A 4HBQA 1T04A 2BRRL 3FFCD 3VXRD 5IBTL 3WFDL 1EFXA 4GFTB 2C3VB 4NCDA 2VXSH 3V6FA 4WWKA 1CDHA 1JHLH 2GSIB 3LV3B 4XCEB 4XI5C 2EDJA 4MB3A 3QIUB 3OKKA 5GS1A 5IB2B 4GKNB 4HCRL 4XPTH 4QRPD 1YUHA 3RWHB 2VYRE 4HUWB 3C6SA 2Z31B 1F00I 5DJ0A 4Y5YA 3CK0L 3HNTH 1MFEL 3D69A 1ROWA 1AGCB 5EC1B 1DBAH 3BH8A 1XGPB 3H7BA 3QHZL 3N85L 4CU7A 1NAMA 1IBGL 3DRQA 4QF1B 1GZPB 2CLVA 2C1PB 3O3EB 4X0KB 2BRRH 1A0QL 1OQXA 1CQYA 1N5YH 5GS0L 4PJHE 3ZYZA 4FS0A 4WUUD 3Q6GL 3NACH 1FSKC 3MBXL 3OPZL 4JPIB 2APFA 3P0VL 4UT6L 4O2CA 2PETA 4XBPB 1OD7A 1JRHL 5I18H 2J8UE 1QLEH 4H5SA 3KYNB 2NNAA 5ACZA 3UBXA 5E08H 3Q1SL 4H26A 5DRZB 1Z3GL 4YX2H 5INCB 1RUKH 3CC5A 1UKTA 5DS8A 5L2KA 1DLFL 4YHPA 1YDPB 5ESAB 5DI8A 2HFTA 4UQ2A 3HI6H 4FTVE 5FHBL 5D4QA 1INDH 5TDOB 1PY9A 1PQZA 1RFDL 1BQHB 3DGCR 1WTLA 1BVZA 1D5ZB 1XCQB 1F3RB 1WGOA 3DX8A 3REWB 1J1XL 2CLZB 3T65A 3VRIA 1OLZA 4M7LT 1GGBH 3KPRA 1WCBB 4A6YH 2X4SA 2JB5L 2XN9E 3BMVA 5INCA 4TTDD 5C0CA 1ADQA 5DK2B 4M43L 3FQWA 5J9PB 1FNEA 3BGAA 5CJ5A 2ORBL 4QXGH 1CK0L 5DJDB 4NQEB 3L9RB 5T1MA 1EHLH 2DN7A 1N64H 2P5WA 3BN9C 3V4UL 1A7BA 2EZ0D 1I85C 5CJXA 4Z78A 5LKNA 3GNMH 1JHTA 4UT9H 2AJSH 4RRPG 3GNML 4YDIH 3VG0H 2NW2B 3IFOA 3JBG7 3WUWB 4W6WB 1H15A 1Q9OB 2RQ8A 4GJTB 4Y5VB 5CGMA 4HBCL 1WBYB 1EHNA 2C26A 2P24A 3D85D 1JI2A 3SCMC 5MEPA 4JHAL 1NL0L 1SYSB 4DQOH 4TOYH 5DQJA 5EIQA 1Q1JL 2IEPA 2E6PA 3GRWL 3H0TA 4WUUE 1S7QA 5KSAB 5KTEH 3WLBB 5AD0B 1YEDB 1T1XB 5BO1H 1IGJB 3X13B 3T77A 1BD2A 2OTPA 4HWBH 4YO0B 4P9HL 1Q0YL 1IC5L 3GIZH 4XRCA 5CINH 5EWIH 4HULB 4UIMB 2FGZA 3LQAC 1AGEB 3WIFA 4C56E 4PJIE 1VADB 1X5LA 1ONQB 5L8JB 4HX1A 3BD4A 2NY4D 3ZT5A 2JIXA 4Z7WB 1CICC 3FT2B 5CWSA 1NEZB 4LPWA 1KN2H 2WIMA 4FQXA 4JRYE 2HVKB 1RULH 1T66C 1S7SB 3OSKA 4FQJL 1QBBA 3LD8B 5D7LD 3T4YB 1T0NB 2BSRB 1UJ3A 2PR4H 4GKZB 3S96A 1N7MH 5JW4R 5IK3A 1QRNA 5IMMA 3KGRA 4Y8DC 2F54A 3EHBC 1A9BA 1BBDL 1FYTD 3MLWL 4RMSA 3OKYA 1HSAB 4HG4K 3REWA 1FZMB 1WIUA 2E9IA 2KPNA 1NSNL 1JWMB 2DMCA 1SBSL 3VWKD 4LU5L 4NQVB 1EUUA 4RMWA 1TZIA 3QNXA 5DR5L 4X6DB 3SE9L 2LE9A 4KUZL 4IRSA 2IG2L 1F6AB 4PJ8C 1FDLH 3KWWA 4Z0XA 4KMLB 4MA1B 5JIPA 1MRCH 4L1HA 5E8NA 4XC1L 1JHLL 3GHBL 4YGAB 1P69B 5D1XA 1OPGH 4UIKL 4OZHB 3GKWL 3MODL 2P5WB 1U2CA 1KF9B 5HSFA 3MLUH 5KN5B 3K3QA 1T3FB 2Y36L 1YEGH 4F33A 2P45B 2BCKB 3IFOB 5L8LB 3GGWA 4UILL 5CEXA 1I8IB 3VW3H 2Y6SC 1V3MA 5HGHA 3MLTA 5IHBA 4NWUL 2CDGA 3O3AA 3ZE0F 1F3JA 1OARH 3VXOB 3LQAH 5FM8A 2R0KH 1CDJA 2NXZC 4CKVX 4PV9A 2EH8H 5K9OA 2NZIA 1A2YB 1UYWH 3MJ9L 4MHHI 3NPZB 1ED3B 1IGFL 2IF7A 3BQUD 1AQDA 3PWNA 4G8GD 4LSTL 4L4VA 1PYWA 5IG7B 3QUMB 4QOKD 3V7AG 4LSRL 1JMXA 4DN4L 3G5VB 3RWFA 4P46C 4GXVL 3V0WL 1OAUH 4ORGA 5EO1B 4LRNL 2BNUB 2DQHL 5FO7B 2P5EE 3A6BH 2WUCH 5F97E 1MCFA 2QQQA 3TVMA 5J11B 4J3XA 4JQXA 4WRLA 3HMWL 3UO1L 1BQSA 3P11L 3QEHB 5FA3B 4I9WD 1X6LA 1F11A 1R5WB 1NBQA 3MR9B 3QDMA 4N8VG 5D2NA 1NL0H 5DD6B 5HYJB 2IAMC 3K46A 3I3DA 4WFFE 1L6ZA 3QNZA 4X6CE 3MRDB 5K9QI 3AXLA 5FB8B 3FB7A 2OTWA 3OGOE 3VXMB 3LY6A 4Z7VA 5C0RL 1CD1A 3ARGD 5JIKA 4QXTA 4HIHB 1JNHB 3R0MA 2I9LB 1DVFA 4MAYA 4U7MA 2AGJH 1LEGA 4CMMA 1UM6H 5I1AB 4FQCL 2I24N 3BN3B 5LGHL 5IT2H 2MCPH 1CVRA 1T7WA 1Z9OA 5B39A 4S1RL 3TT3L 1OW0A 4PJ8B 4NZTH 3R0NA 2HTLC 3B6SA 4HH9B 2IC2A 1WAAF 1U8LA 2A6JA 4JRYD 3EYFB 5IB1A 4E41E 3NABL 1DTUA 1OM3H 3MMEA 3RWEA 3BDYL 2W59A 1EVTC 5F7FA 2NY0C 1VEMA 3HAEG 4K8RD 1OP5K 4DUWA 1A6AA 3IDNB 3VGHA 1A14H 3LH2L 4WW2B 4N5UA 3EOTH 4P59H 4MWFA 2UV3A 4LLUA 3UJIH 2I9TA 3BKYH 2DJ4A 4JFFB 5BS0D 2J12B 4JM2F 3BUYB 3QUYC 2AJUH 3C08H 1DZBA 2VLRE 3SKJH 4GXUN 3MOBH 5JXAL 4MD4A 4M7ZB 4K7PL 1S7TA 1MHHB 1ORSA 1H3GA 2BY2A 4Z7UB 1C08B 2CR3A 3FOMA 3L3KA 5D96B 3AS0A 4HF5L 4BQ6A 1FNGA 5IW6B 3B43A 3MLZL 1QLEL 3KLAA 2NLJA 43CAA 4QRRA 5D9SB 1P84K 4N0UA 2WLZA 2CJUL 2Q86A 3UJJH 2W0KA 4OZIF 1P1ZA 2YD7A 3CZJA 4K9EH 2NY2C 4APQA 3I85A 4PJ7E 1JNNL 5HGBB 2H8PB 1MFDL 4KRPB 1DQDL 5EO1A 5KANG 5E4IA 4B0MM 3IETA 5F1NA 1MOEA 4WHTB 1MCPL 3BP4A 3QRFM 5DO2C 2XY2A 3QHFH 2D0FA 3L1OL 3LEYL 3MACH 4HZLA 1R5IA 3VA6A 1VESA 3CSGA 3E3QC 5AEAA 2A6IB 4KHTL 3SDYL 3ARPA 3H9SB 2C9AA 3HNTL 3CUPA 3TZVD 3GMRA 2Q8BL 3VWJC 5IW6A 1VGEH 5GPRA 4X7TB 4WGVB 4Q2ZB 3GKZA 2N7AA 4U1LA 3OJDB 3WFCH 3MV9A 5ERWA 3ZE1E 1R3LB 2FO4B 2JTDA 1CFBA 3IRZA 4DGIH 1N6VA 1KTDA 4UT7L 1BD2B 1T89C 5AZ2L 4ZO8A 1QA9A 5F6IC 5T1KD 2OZ4L 4NC0B 4G9DA 2DB8A 1A5FL 4Z8FL 1FIEA 3GMPA 4U6XB 5BXFB 5ITFA 4N9GA 2DICA 5F3BB 2Q87A 1CE1L 3OXSB 3MJ8B 1OAYH 2X40A 2HKFL 3LQZA 2AV1A 4HV8A 2W38A 1KPRA 3LEVH 1AKJB 2A73A 4QRUB 5ID0B 4OSUH 4G7VL 3Q3GA 1R3LA 1OT1A 1I8KB 4PV9B 3I75B 3IF1A 2P7TB 4P23D 3UJJL 1F4YL 4PJ9D 2XFXB 3BMWA 2VN7A 4TTGA 4JGUA 3T2NL 3KLHC 5IF0B 3K1DA 4NNPL 5F9AC 4EN3D 5CJOH 4Y5XB 3TA3D 3TN0B 4ETQB 2FLBT 3TT3H 6FABH 4ONGL 5C0BD 4YQXL 3TYFB 3KLSA 1I7TB 4QNPE 5CILL 2R69L 5AYUL 2BNQD 1Q94B 2Q7YA 3T0XA 4H20L 4F37F 2ADJB 1OAZL 3W9DB 1N2RB 1F6AA 4BKLA 4NQEE 2ZUXA 1SJXA 2H2SC 5L6YL 2DMKA 2XTJC 2B4CH 1JYWA 1CZ8L 5E6IB 4MQXC 2R1WA 1KG0A 4GW4B 1PSKL 1DANT 1XF2B 3NPSC 2DWEB 3NH7L 3MV9D 4KV5F 4U1SA 4DVBA 3O6MH 4JQVC 2UYLA 3CD4A 1WBXA 1QFWI 2QHLA 2A9ML 4P3CH 5FYJD 3P11H 4U7KA 4I1NB 3UAJC 3HMWH 4MCZA 4RFEA 1C16B 2LQRA 5ESVA 4O02L 1FBIH 4X8JB 4F7PA 1G6RB 2D7TH 2DLEA 3CJJA 4CMMB 3VGAB 1ND0A 2B5IC 5JQ6H 1GXEA 3PGDA 4M62H 1QBLL 2XT1B 1EHXA 1X4YA 3VWJB 3FMGL 1I9RH 2BSSA 5FYLD 1KB5L 3LS5L 4MAYC 1KPUA 3HC0A 4IOFC 1RVFH 1SY6A 1PG7L 1U8JA 1ZOXA 4PLOB 3T08A 4F7CA 5IHZB 2NTFB 4LKXB 1FE8H 4R3SB 4Z7VE 2NTSP 4MCYA 1BGXL 4LCIH 3LKOB 1VFAB 1UWGH 5T33H 1NANH 1MCWM 4XMKH 2XPGA 4LDEB 1MWAA 5C8JA 4Y0GA 4OAWB 2G2RA 2Z8RA 4U1MB 4PRIB 4PGZA 2VL5B 3FRUB 3BGMB 4NWTL 4ZUSB 1OQOA 1RUAL 4OCRL 2BNRA 8FABA 4PB9L 5I17B 4LIQE 2YMXH 5MEOB 1BFVL 5TGBB 2DQCH 4KFZC 1J5OL 4LCCC 1IVLA 5CGTA 2D0GA 2YWZA 1MJ8L 4GRMA 2NY6B 1MJUL 4ODWB 4WTXA 2OL3L 2NY1B 2P5EA 5EU4A 1IZKA 3L5XH 4KJWC 4M03A 5D5ME 4L8BB 1U8KA 1UQSA 2V17H 2VTFA 4IMKA 4N90E 3TA3C 5BV7L 5AWNH 3HB3C 3IJSA 1G9MH 1JPTL 5GS2H 1P84J 1C5DB 1LDPH 4KXZI 5JOEA 3NTCL 5FOJA 3N1PC 1VGEL 5CEZL 2Q86B 4WEBH 4PD4J 1X5KA 2YXFA 3VFSA 4CVXA 3QP3A 2AEQL 2CK0H 4XNUL 2J8OA 4J6RH 4X6DE 4UTAL 2GJZA 2XXCB 2PTVA 2EYSA 3RA7H 4WDIB 1U8NB 1A7RH 1JPFB 5D7JD 3UTSD 1WUNT 1CBVL 5CLWA 2NNAB 1EEUA 4JZJB 4P2QE 2XOTA 2H6PB 3REVB 5L2KB 3IAQA 4KJQC 1D7FA 4K94L 3I6KA 1DQDH 4PJAA 2C3GA 1T89A 1U92A 3CFEA 5DQDL 3O45B 3TWCL 4QXWA 4EI6A 1BVLB 2D4FA 3T77B 2PTUA 2G5BA 4F2MA 3A67L 1JZ5A 3F7YA 1BZQK 2EIDA 2VLMD 2Z8WC 4W6XB 3VWJA 1IGCH 3MROA 2WUBH 2CLRA 3L3JA 5I75B 1T1WA 3WD5H 1OTUC 1I4FA 2IAMB 3QFJD 4X6CF 5JOPD 4Y2DC 5FO8A 2OR9H 3QDHA 2X4PA 2IQAB 1GVIA 2AJXH 3FQRA 2ERJC 3OX8B 4XMPH 3RNQA 4N9GB 5FAAA 3I2CH 5DMIH 3GSXB 2C3VA 2IPUG 3BPNC 4GBXB 4G80B 1OHQA 1MF2L 4XPBL 5CIPA 3LHPL 1ZKAA 1NFIA 1T0NA 3CXHJ 2A2QT 4HJ0C 4X98A 1BVLA 3CDCA 5ELIA 2FZ3A 1OM3L 1K4DA 4LLMB 3FJTA 3QNYB 2NY0D 4I0PC 5F9OH 1MI5A 4QLRA 4GMSL 5F7EH 1GHFH 4LCCB 5D5MB 1IAMA 5LXGH 5DHVA 1DDHB 2R39A 3THML 1ORQB 3UPRB 3T8XB 3V4UH 5H2BA 1YYLL 3WXWL 1T7XA 3KVQA 4LVHB 4JQIH 4MAUL 3H9SA 3O4LD 3BDBA 5IBUG 5I9QB 4L29A 4MD5B 1MHPL 4JFDE 1U8IA 3J8F7 5F72S 4WUKH 1NFIB 2BJMH 3GEWB 3QDGD 4FOMA 2NR6D 5BO1L 4CRPA 2HT3D 3BKML 4QYOA 5JLZB 4RGNC 2AKRA 5E8EA 4LARH 4ISVA 4XNZC 1JZ6A 4PJ5D 5F7KC 5IKCA 4PRAA 4RIRB 4WENB 4ZPVB 2W9DL 3HMXH 3K4AA 2L7UA 4L3EE 4PGEB 5JOFB 5SX5K 4U6XA 1G1YA 2APWA 5KS9E 3MFFB 1INDL 3TO4B 1FZOB 1J9CT 1EFXB 5EU3A 4X4XB 2A1WH 3QDJB 3NCJL 3WXWH 4R0LB 1DLFH 2RBLA 3GSVB 2Q6WB 3PNWB 3B2VH 5J12B 1IGTB 2ARJQ 1L7IH 1SM3L 5CD3A 5BW7A 4AM0A 1A4KB 1KACB 2BVUA 3RPKA 4MQ7A 1PX3A 2XA8H 4LAJH 4L1DA 2CRMA 4BK5A 5EC1A 1UADC 4XPFH 3KPRE 5B3NA 2ZG1A 5E0QA 2ZUTA 3EJJX 4PRHE 5CBAB 1B2WH 1H8OA 4TVPD 1FYTA 1RUMH 5AWNL 2CLVB 2JE8A 4P2RD 4OCYL 1UB5B 4PUBH 5GS0H 4IRSB 5C09B 4NQDD 1F6LL 3O9WC 2IJ0C 5DC0A 1QVOB 5LBSH 4LVOC 4Y19D 5SWSD 3TN0C 5F6HJ 4E9LA 5D1ZD 4X6CB 5EU5B 3CH8A 2E9WA 5CIPB 3QWRD 2LFGA 5DJAA 1J5OH 4TNVF 3KJ6L 5CHNA 1BFVH 3KNBB 2Y36H 4O5LH 5KSAD 4AEHH 3HI6L 2W1NA 4U49A 4LEXH 5IB3B 3B4NA 4F3FB 2QSQA 1J87A 3S5LG 3MRDA 4HKXB 3MLXH 1BREA 3WN5A 5HGAB 1DQLH 3MRKA 2UZIL 1MRCL 4KMQA 2EKJA 4LPYA 4GW1B 5F8RC 3T0EA 1A6ZB 1Z9LA 3RWIB 3ARDC 3VFOB 1D5XB 1D6VL 3ZDXE 3RL1A 4DZBA 4GRLB 3TWCH 4YHKH 1DBBL 1I3UA 5DRXB 4ERSL 1S5HB 4MD0B 3P77B 1U6AL 3HAEH 1KXVC 4PJ9C 3MLWH 4P5KA 3W9EB 3EJZD 3LIZL 4MVBC 2R1YA 4WO4D 5CHNB 4EVNB 1CBVH 1LO0L 1YY8A 1A7RL 4XVSL 4KKBD 3MREB 1VENA 3LSOA 5HGDA 3BPLC 4WW2A 4X7CC 5ICZB 4YDKH 3WS6C 1RQ5A 1IFHL 3MLXL 3D0VB 4XP9H 1IZJA 1NAMB 4RX4D 3F6IA 4MXWH 4G5ZL 4HUVA 5DMYA 1I1RA 2F53D 1OF2B 4HZAA 2V17L 4Q0XL 1A9BB 1IILE 5D7KD 1I1FB 5E6ID 1F4XH 1J0IA 3WFHA 1XR8B 5DLMH 2CKBA 1KEGL 1OGAB 1NGPL 3QXAB 4YDVA 3LKSB 1JF1B 2DLHA 5EZLA 1P4IL 1ZTXH 4U1IA 1VACB 5GGUA 2F74B 4H88L 4HK0B 4QRPB 1JE6A 3JTSA 1K8IA 3GO1H 3W5NA 2CKBH 4RMVA 3TO2A 5MEND 5DHYA 1HHJB 2NY0B 2LU4A 3BIKA 4ZO7A 1DVFD 2VXVL 4MAYD 4WCYL 5DQ9A 3TCLA 3OKLB 1RHFA 2ENYA 5DMGD 3ZTNL 4IRSC 2AXHA 1DSFL 1RIVH 4KI5E 2P44B 4M5ZH 1P4BL 4X98B 4CVXB 3IDIA 1S3KH 3C6LC 3U9PL 3RPIB 1RIHH 2FLRT 2GTWA 1DQJA 5DJAB 1YEKL 1WQVT 2VDKL 3WDIA 1OAYL 3K81A 4GKNA 1N64L 2HN7B 2IH1B 2IADA 3E6FB 3S6CA 3DI3B 4JZNA 4LAQH 1YEIH 4HMCA 4APQC 1NMBH 3C2AH 1MUJB 5DTFA 4GS7B 4N1HB 4XXCA 1VERA 4MJIA 4ZFGH 5C0AE 3LRHA 2EYTA 4OZIB 3GM8A 3A0OA 2BOBA 2R1XB 4P3DA 5C6WH 4ZFOB 1SJHA 5GIRB 3AUVA 1DJSA 3LN5B 4MNGE 1OTTD 4G6AD 3OV6A 2R4RH 5A16A 2G5BB 4F2MB 1CXKA 1HH9A 2JJTA 5BOPA 3VXQA 5IROA 4M1GL 3GMPB 5DZLA 5BXFA 1FG2B 5EZIL 1Z5LB 3QRGL 4PREB 5H94B 5E24E 3OXRB 3JUYA 1CR9H 4WI5A 1ZVSA 4BQ9A 1U91A 4H20H 5DJZA 3ES6A 4KHTH 3MJGX 3MSPA 4OZFG 1FO0A 1CXHA 2YPLE 4FTVA 4QHKI 1KCRL 4GUPA 5IFAH 3DMMA 2FIKA 4K23H 1JN6A 4GBXA 5F21B 1G9NC 3H0TB 3GSQA 3MR9A 3QDMB 1P2CA 2EDNA 4G43A 4NNPH 4V2CB 4CGTA 5DD0H 2HRPL 4XVJL 4NOFA 4M7ZC 1CVSC 5A16B 3RVWD 1JNNH 3VU2A 1HHGB 4HDIB 4FHBD 5J7CC 3V4VH 3TN0A 2F8XC 4X7SL 1CTNA 1T03H 2GY7B 3EKCA 1CLYH 3NACL 1CL7I 1J1PL 3JV6B 4AL8H 3EYUH 1KCVH 1YPZF 1HZHL 4N0CD 4GMTL 1V7NH 2P1YA 3NCCB 5F7WC 3BZFA 2CDGB 3O3AB 1LO5A 1WITA 1NUNB 2B1HH 1XR9B 5DD1H 4R90L 4Z7NE 3HNSH 2BVYA 3UBXG 1FNEB 2QBWA 3D85B 2HJKB 2VAAA 1DQML 1VB9A 3QEUB 2ADIA 4KVCL 3C6LD 3IU4H 2BVPA 3EO1B 3HKFA 3DWTA 3EOAB 3AAZB 3E1F1 4HFUH 3MRIA 3DVGB 4G9DB 1CICB 4YXLL 4RGMB 4CL7A 3DXAE 3B3IB 4Q6YA 3SJVB 4U1KA 2QSVA 2XWBB 3F7PC 5HHMD 2WBJB 2AV7A 4K8RH 1QPXA 5IMKB 3NABH 4XP1H 5D7SH 5D72H 1F4AA 2VABA 2EECA 4POZC 3TBTB 4AJ0A 1ES0B 3BT2H 2GIYA 2Z31C 3HFMH 3SDAD 5CJQL 1NBYB 3WCYA 2CK0L 4R96A 2XWTB 1MCNA 4CDGC 2DOCA 3SO3B 4F7CB 5IHZA 1C5BH 1NEZG 3L1OH 3LEYH 3MACL 1DUZB 4O2EA 3RX5A 4HMEA 3HG1D 4OIIH 1K8DA 1RU9H 3QG7H 1TVBB 1KBGL 4Y8AA 5HHNA 2VWEC 3ARBC 3QT2A 5DS8B 1YMMB 4U1HB 3BGFC 4P49A 5I30L 8FABB 1C8PA 1FC2D 4Z7WA 1FVCB 4P4RB 4MNQD 2HAZA 1U3YA 3JWNC 3ZKMD 5E99H 3TNNA 1RUPL 3C5ZC 2R0WL 3MJ9A 5FYLH 2BNQA 3UC0L 3QQ4B 2KZ1B 5GSRA 3RGVD 3UC0H 3DV4B 4HMDA 1RUAH 2X9WA 4OCRH 1AH1A 3CFKB 5FA4A 4EDXB 4MMZC 1IC7L 2BC4B 5KVDL 3TH2T 4K7PH 1SMOA 1A3LH 5DLML 4KK5C 4PGBB 4Y1AA 4OM1L 1ZHNA 3G5ZB 5IJKC 5D5MF 3OWEA 3QQ3B 4OF0A 3GSNB 4PTUB 3ULUE 4N0CC 4X5WA 3PABB 4F9PC 1QFWM 1F02I 4M7JH 4XNMA 1E27B 3VFOA 1IEAA 2NX5A 1LO5B 3RX7A 1S9VA 3SCMB 1KYOK 1TQCC 3OZ9H 3Q0HA 5J6HB 4YFLF 4DVRH 4KY1H 2XWJA 4GRLC 1AO7B 1KLGB 1QBMH 2IANA 5B3JF 3O8XB 4D8PA 3BX7C 5DDHB 2VKWA 1ITCA 3KPNA 1IC4L 2I26N 5D72L 1QKZL 5DJ2A 3T4AB 4G9FB 4CNIA 4MA7H 2VLME 4U1MA 3C8KA 3C5ZB 2DLFH 2FO1A 3SOBH 5GGVH 5ANMB 4EUPH 5KS9B 2DQIL 5HYQB 4JFZL 1F90L 4NRYB 3ZYIA 2O5XL 1JI1A 3RWDA 3IF1B 3GBML 3SE3C 3CNKA 2YD8A 2DQJH 2B2XH 4LK4A 3CLFH 4N0FA 3QB7C 4OD1L 4LU5H 4YQXH 2P5ED 5JZ7C 1NSNH 2R0WH 3GMLA 1AGDB 1HYRC 4N5ED 1ZWIA 4FQXD 2EH7H 3PWNB 5EUOF 2X10A 1TVDA 1C12B 2CRIA 2Y1VA 3UXFA 1QSVA 3OKDA 3C9NB 3STZB 3VXSE 1NAML 1RUQL 3EO9H 4JKPL 4LSTH 5DVOA 2CXKA 4YHIA 4KKBC 3GSRA 4BJLA 1GC1H 5C0BE 5HYSA 1FL3B 3O2DL 5IVZB 4WV1C 3RPIA 1QSED 1BAFL 3PWPA 4QRSB 1MNUH 2YXMA 4OB5L 1ZAGA 1CGXA 4R97C 2E7CA 1W72L 1SM3H 3K4DA 3MRCA 4L29B 3QNZB 1MREL 4HC1L 2I60L 1CT8B 3GSNA 4L4TB 4XNXL 3PQYD 5GZOD 2YWYA 1UB6A 4XP1L 3PIQA 1MLBA 3RU8L 3C5JB 4UT7H 3PUCA 3L5JA 1WF5A 4TUKH 2GFBA 1CL7L 3CVIH 3V4PL 2NW3A 3O0RH 3A6CL 4Z0XB 2YD3A 4HUMB 3ALPA 3GKWH 5B8CB 5BS0B 4KRMB 1W2KT 3B9KC 3TPKA 3IU4L 3RZCB 3B9AA 3L3HB 4KHXH 1D5IH 1H8SA 5IVZA 1D9KD 3WIFB 3QDAA 3QWOA 3D1MC 3QZWG 1C5CL 2DMBA 4WHYG 4U1NB 1S78C 1J0HA 3IGAA 3MMEB 3RWEB 5CSZB 1Y0LB 1Z0MA 3W0WE 3TPUB 3OKNA 5CCKH 3NCYS 3UPCA 1TITA 1JGVL 5C2BH 5T1DH 4EI5D 4C4KT 4MAUH 2DI7A 1R5VA 5I8OL 5D7LB 2DQGH 1FAIL 2P5EB 4GW4A 4OCWH 1X3DA 1J1PH 3DETC 1S7SA 1BBDH 1MVUA 3UTPD 2W65A 3IFLL 4KJYA 5I75C 4LLYB 5K9OB 1D5BA 4X4ZA 3TVMC 3U6RA 1U8QB 5H2BB 2HRPH 5JR1H 3MNVA 4MJ5A 1F8TL 1S5IH 1UA6H 3RZCA 4N0FB 4KK8D 4ODUB 4FQXC 4HKJA 1ZTXL 4CBPA 1KCSL 3MRMA 5INDA 3MUGA 2VR9A 2VIRA 5E2JA 4QRQB 1NGQL 5IJKA 1QNZH 4R6UA 2GJZB 5ADOH 3O81A 3H42L 5AG9A 3IKKA 4CN4A 4OZIE 4ZYKA 1HYSC 4JG0H 3ZE2E 4KROD 4YAQB 4ZUUA 4JREC 5IR1B 3MRKB 2HJKA 2VSCA 2ZJSH 2RAMA 3O6FD 1A14L 1AJ7L 2P7TA 2CDFA 4ELKA 4HZLB 4TVPH 4FFYH 5D1QD 3N06B 4AT6B 4M61B 1CFSB 3MV9E 1G7IB 3EFDH 3DPBA 3FQXB 3OAUH 4FABL 3VFNA 5DFVC 4S2SB 1TIUA 2JCCA 3BP5B 3WDJA 1I9JL 4HIEA 3STBA 1FYHB 4X6DF 4J3OC 4I3SL 4JO4H 5LQBH 4QRQA 1D9KA 3BHBB 5F7MC 2UZYB 1IMHC 2J4WL 4CU6A 2F58H 3LPWA 4R4FL 3JV5A 1BLNB 4U1LB 3CFJB 1EO7A 2H26A 2VXUL 3I6GB 3T0EC 5IT2L 4NJ9L 2NY5L 2D4DA 1A0QH 3SKUD 4HLJA 1NC4D 2R56H 3W11D 2D7NA 5A1AA 2FBOJ 2E3VA 5F88A 4YHMH 1J8KA 2QADB 2X6MA 4C54A 4OI8A 1C5CH 2OQJA 3HZKB 4XAWL 1ZHLA 4DWHA 1P5UA 5HHXH 3G5VA 3RWFB 3TIDA 4G6KL 1IAOB 1DL7H 3HMXA 4XWOD 4BSVB 4MWFB 5IMOA 1NJ9A 3OKNB 5DZOA 4PRDA 4POYA 1FVCA 1GGBL 1QACA 4ZUWB 3STLB 4PYHA 4PJ7B 4DAGL 1BIIA 1R5VB 3C6SB 4LPXA 1PFCA 5HGAA 4LRNH 3N0PB 5TFSH 1YNKL 2B0SL 5SWZE 3H3KA 4FFZH 4JAMB 3V0WH 1T1YB 4Q0XH 4M6OL 4QHLB 1ZT1A 1AD9A 5LAXA 1MAJA 2EDHA 2SEBB 32C2B 1EEYA 1MH5B 1U8HB 1X4ZA 4JHWL 3ESVF 4F57H 4LFHG 2XKNA 4PJBF 2IPUK 5BZWA 4NJAL 4QKXB 5JLZA 2OCFD 2W92A 4LCUB 3ME0A 2D7MA 3U7YH 5I1AA 5ETUB 3CXDL 4HC1A 1L7IL 1FJ1B 2FB4L 2Z9TA 4PRDB 5C0AA 4XVSH 4DGVL 5T3XL 1G6RH 3L5WA 4WUUA 4PTTB 4BKLB 1R24A 1SHMA 5ENWA 4ZUUB 3FCTB 4YAQA 3O4OB 4HJGA 3CCHA 2IFFH 4AIXA 4P2OB 5D1QC 3RBSA 3RNQB 2O5YL 3MLYH 1XGRA 2VLKE 5DFVD 3MQIA 3RVTC 3RI5F 3KYMA 3L3IB 4FFZL 3S3SA 3O6KH 1YNKH 2B0SH 1BPVA 5TDOA 4PJDA 1JK8A 3BZEA 5TE6H 1J10A 4TNWK 3U83A 1CFTA 4YO0A 3ZE0E 4AMKH 5F7NC 4E41A 1IEBA 3D9AL 1YYML 3OAUL 2GT9A 2AQ3A 3VFMA 3QR2A 4QNPF 3WJLA 1AGEA 3U46A 5T1KA 3GMQB 5E2VH 4DEPC 1MHPH 4D9RE 2D7PA 4HCRH 2A6KA 2H1PH 4NN6B 2VITA 2WAHA 3CSYB 4I18A 4HJGB 4Z7UA 1NCDL 4R8WH 1T7ZA 4GUPB 2F19L 2KH2B 3TO2B 3TIEB 1FORL 5IBLC 5F3BA 4NN6C 2GKIA 4OGAD 4FQ1L 3V6FB 2AEWA 4XWOC 2I5YH 4HLZH 1JK8B 3WV0A 2DRUA 4E5XA 3EGSA 4P5MB 3RUGB 3SDXE 5HHOA 2OYPA 4NQCD 3NCMA 4UOJA 1TENA 3U2SA 3VFWB 2WQRA 3P9LB 2P8LA 4POUB 2VKXA 5J06A 4P4KD 2HWZH 2EDXA 5DURD 1JWSB 2FHBA 4YDJB 1MJ7L 3TBVB 1KCUL 3JVGA 1T1YA 2J8UB 1YY9D 1J88A 3MV7A 3CUPB 3VRJA 4EXKA 5DD5H 3D85A 2ADGA 1JV5A 5IOPB 5JW3H 4LLDA 4HWUA 2Z0BA 1J0JA 3PHQB 2XKNB 5BZWB 2CO7B 2VDOH 1MELA 3G6JF 4U0QB 2X41A 1Q72H 2JJSA 1W72B 5BQ7B 4ONHA 3UTQB 5HHVL 3WJJA 3W9DA 5KTEL 3ZHKA 1LEIB 4JFDD 2XYCA 4B41A 3D0VA 3VXTA 5B3JE 3ROLA 2FJHB 1BJ1J 1TZGL 3WS6A 2EC9U 4YDIL 1AE6L 2J8UA 1RZKH 1JTPA 2KQMA 1G7LB 1X5JA 3AVEA 5IHUH 4G8EA 4L4VE 4YC2B 4TVPE 1RZ8A 2I60H 4P46B 4QT5B 5FYJH 3H9ZA 4XMLH 3T3PE 4WI4A 4KGLA 3MV8E 1E4WL 4X6FB 1A4JA 2YA1A 2CUIA 2X4OA 5F9OL 3M17A 2VLJB 5CS7A 5DD3L 4I18C 5JORA 1I8KA 3GBNL 4LLYA 1EO8H 4U2ZA 1I9IL 3MLSL 4J1UB 5EORL 1A7NH 3QEQD 3OF6D 5IB4B 1I7ZA 5C6TL 2ARJB 1CCZA 2E27H 1PKQB 3VWKA 3MV01 2HJFA 2ZWLT 1M6OA 3RDTD 1MPAL 4M9PA 4BSVA 5IMOB 1QLFB 1OAXL 3GJFH 3MV7D 2BFVL 4L8SC 1IKNA 4JJHA 5ACZB 2IBZX 2PF6A 3LSOB 2W9EL 2P47B 5FYJU 1KEML 5JXEC 5TDNA 5C09E 3SJVA 1RUKL 3MOBL 2VERN 3I6LD 5SWZB 3F12A 5C0BB 5E08L 1UWGL 2NCMA 4C56B 3B8SA 1IEAB 4XB8A 4BUGA 3UPRA 4M6AA 1SJHB 4H0IA 1Z6JT 2WIIB 3VJ6B 1GJIA 3U0WL 4FP8H 2QQLH 5DC4B 4YZFF 5E5MA 3TYGL 3NIGF 4R26L 1UM5L 1A7NL 1BIHA 5FOBB 5E7BA 1QRNE 4Z9KB 3QUMH 3SDAA 1KJ3H 3WFHB 4MNQE 3TH4T 4RBPK 1GGUA 4RA0C 1FVEA 2EKSB 2IMMA 2PXYB 5T5FL 4CJ1A 2EH7L 3U30C 4P57B 5HYJD 1QBML 1HKLL 1MCOH 4NO5A 3CVHB 3P4LA 3ARFA 4Y4KD 3T04D 1R3IH 4ORGB 5EIIA 3B9EA 4L4VD 3AREC 2AQ2A 1CR9L 3FB8B 3RVUD 4YGVB 1OP3H 3BI9X 4ZAKC 3MUY1 1XZ0A 1V7MH 4OZGE 4YPJA 4W68A 4JDZB 2DWDA 1M7DB 5KOMC 3RL2A 3QO0B 4EI6B 1NDMA 4JCMA 2B4CL 3VWJD 1JPGB 5KAQG 5MENE 1F90H 3DIFB 3HZYB 4NQDB 2AQ1A 3TH3T 4KROB 4ONOA 5FOBA 4Z7OE 3LKNA 1YPZE 1Q9OA 1ZHNB 3PWLA 2XN9B 4KAQL 1KELL 2WP3O 2DQCL 1B0RB 2APXA 1RK1A 1J8HE 3BIAX 5I1HL 5FO9B 1KT2A 4P0DA 1JGDA 5CAYB 3X3GH 3TBSA 3SKMB 1PX4A 3DYPA 2AEIT 4QCIB 3X13A 3SJVD 1A1NB 1YZZA 3NA9L 3RKPA 3U30B 5E00A 1NGZB 5ID1A 2VB5A 1RU9L 4M4PA 4LP5A 1PEWA 4HXBH 3LV3A 4WW1B 2RGSA 4XZUA 4TPRL 3MZTA 4Y16B 3M07A 4HKXA 4L3CA 1JWUA 1TTFA 4JRYB 4H8WH 2R0KL 5CJQH 3IT8D 3WXVH 3HG1B 5D1XD 4Y16C 5AZ2H 4KZEH 1XF4A 2BDNH 3T4YA 3NMEA 4DZBB 2AXFB 3SKMA 4GAFB 2EDEA 2EIZA 1QRNB 1RJCA 1TPXB 4MD0A 3QFJE 4D94A 4XCFL 5E8DH 4P5TC 1WCQA 5I1JL 3ZZ1A 4HHAA 1YEEL 2XIDA 2OJEA 2GUOA 3EDFA 1UXSA 2HVJA 3GMOB 1S8DB 1OAQL 4MQXD 3T0BA 1KJ2B 4KVCH 3MV8B 5LCVL 3IAGC 3WJJC 3U48A 4FZ8H 3VXTB 3CSYA 4Z7WE 3QUZB 4KI5F 5L2KE 5E2TH 1WSST 2VLJE 4IHOA 4PPTA 5JOFA 5HXMA 4KUZH 1JNJA 3IS0X 2CGRL 1YMHA 1MCPH 4S0TD 3WFEL 2NY3C 5HI3D 4F58L 1QLRB 4L4JA 3SDXA 3EYUL 4BFEA 3BEWA 5EZOL 1SJVA 3G04B 3TBYB 3LS4L 3GMMB 3GFUA 2IAMD 4OFYA 2NPLX 5GRJH 5L0QC 5EOCL 4LLVB 1KOAA 1D6VH 4OSUL 2C5DC 3MGTA 2I9LA 2P8LB 5L2JA 3IDXH 3KPMB 4ODTH 2F74A 3QDMD 2VDLH 2ADJA 4UU9B 5CSBA 4HCRA 5JIHA 3VI4F 5EG6C 5IVXA 2Y9RT 4BZ2L 2NW3B 1KB5B 2NY7H 3TNMA 3K2UH 5H37H 2DBLH 1KG0B 2X44D 3JUZA 1LQSR 2DBJA 5B8CA 3QQNA 2A83A 4GKZA 4H8WC 3S96B 1HDMA 2BFVH 5GHWH 3L3GB 3O9WB 3IDIB 4OZHE 1Q9WA 1N3NA 4MA1C 5CINL 3T3ME 5IBLD 4HQQL 4F9LA 3MGAA 1YMMA 4U1HA 4GW1A 4Y16A 4ZPVA 3HI5L 3MYJA 1FP5A 2CMRH 3OKEA 3OBAA 4IJ3C 5D1XC 4YJZL 3ETBF 1LVEA 1A47A 1TZIB 3WUZA 1WZMA 3DYOA 3MBEC 4EI5A 1I3VA 2MMXA 2GTZB 1A6TA 4HIIA 4NM8L 5GIRA 4PGBA 2A1WL 3B9KB 4KK6D 3RUGE 4CW1A 1RJYB 4ZD3H 3RJDA 2IBGA 3K8LA 1E4WH 1YY8B 4NJ9H 4S1DC 3HZVA 3B9DA 5L9DH 4WV1A 1S3KL 3NN8B 4LKCA 4N0UB 3KYNA 5D71H 2GEEA 3SBWC 2VL5A 3FRUA 3RHWF 4WCYH 1RZKL 1IKFL 2O61A 3SDCD 4IMLA 1A1OA 4YDLC 2GAZA 1N0LA 5CMAB 4J8RB 1XMWA 2JB5H 5KBNC 5E6IA 1N59B 2BSTA 4MDJB 3OB0H 4I2XB 5C9JB 3CX5J 5I15L 4K9EC 5DO2D 4ELMA 2J88H 3GBLA 3WXVL 3U4AA 3W39B 3MOAH 5SV3A 5E95B 3ILPB 3U7WH 2R23B 3B9KA 2WBJC 3C2AL 4KI1A 1JIBA 4CU8A 3T65B 3VRIB 4F7PB 1HSAA 2OXGA 4OLYH 3L5HA 4D2NA 3DVFA 5IFJA 4P59L 1CGYA 1D5XA 4NPYA 1C7TA 4PG2A 4W81A 4NQVA 1F4WL 1P7QB 2MOVA 3WSQL 3VFPB 3QI9D 3HTLX 3MRPA 2BMKB 4A2MA 5T1LB 3LKPB 2H3NA 2FWOB 3OR7B 1IQDB 1DBJH 2R4SH 4WIQA 5CGYC 3SDAB 2G60H 1JHTB 3ARTA 1S9XB 5HDBE 1DBMH 4XC3L 3ARXA 4TUJB 5D9SA 5HD8D 4TVSa 2I5YL 1PZUB 2X4NA 3MA7A 3RDTC 1PG7W 2VDPL 1EJOL 4YK4C 4BZ1H 2UVFA 3KR3L 1EO5A 3BFOA 4GG8B 2W65B 1PBYA 1TDQA 1KJMB 1F4HA 2ZKHL 3CVHL 4CVZA 3MRNB 3GI8H 8CGTA 1YYMH 1BQHA 4Z76B 3LDBC 2BMKA 1GGIL 1U8KB 3SDDA 4LCYB 4PJGE 5DJ8B 4NC2B 5DZNA 1CU4H 3KLHD 2YKLH 1TJGL 1BJMA 2FX9L 3NIDF 1I1AC 3W81A 4JHBA 1IL1A 1PGRB 2Z91A 1KIPA 3SE3A 4LPUA 2OP4H 1LO0H 1BWWA 5DEGA 3GK8H 4AH2A 1FO0B 4WJ5A 3HR6A 2V5SA 2V5YA 4JRXB 1U6AH 4YHYC 3ULUC 3PJSA 5LJYH 4YBLC 2DWEA 1CIDA 1KB9J 4NQEA 3QXDB 2NY2B 3MRNA 1E4XH 4NYLB 4PP2A 2Q3AA 3GMNB 3QPQC 5IK3B 4GAJL 3QAZB 4NP4H 5JO5B 4Z78B 1M05A 5D7JA 2D2OA 4LHUG 1DQJB 3F7QA 3UTSA 4G42B 1IT9L 2UWEF 3QULA 3KYMB 2E7LA 1KEMH 3S36X 5BV7C 3UAJD 3HCVA 3AXLB 4PJAF 2MKWA 4BM7A 5FB8A 5HI5C 3OGCB 4DZ8A 1LHZA 3VW3L 4UILH 4LDLB 2X1OA 4RDQG 2H26B 2BOBB 2R1XA 3OTTA 4M6MH 5FKPB 2AXFA 3RKDD 4RFNC 1V5JA 3MLUL 1A7OL 3TO4C 4WWKC 1K4CB 4PRPE 2Y25A 1NH6A 3VXSA 2H45A 5D8JH 3DOSA 3FAWA 1UCTA 5F96H 4ZTOH 3IDGA 1UZ6F 3EYFA 4Y5YC 4ZS7H 3QFJA 4HWZB 4Q9RL 4FQ2H 2ZKHH 1FDLL 3CVHH 4OKVB 4DUVA 3F65A 2O5XH 1NDGA 4H1LG 4I5BB 5DK0A 4K7FA 1H3TA 1BP3B 1EJOH 4X5XB 3CZFB 4DCQB 3KHOA 2X4QB 3BIBX 4G8GE 5IR1A 3CX5K 4Z0BL 2A6DB 3W5MA 5IEHA 1FIGH 12E8L 4OD2B 3AB0B 4UINL 4XWGH 2VXUH 2G75A 2E8ZA 3V5HA 3V5KA 3I3EA 3GJFK 4OM0L 1QA9B 4O58H 4KPHH 5E6ZA 5HVFB 5I2IA 1E6OH 5C70A 1BZ9A 3ARRA 5MI0B 1K2DA 5IW1B 3UTPE 5FGRA 4F8TA 1YNTB 3ARDA 1JNLL 2NY2D 5IQ9A 3SGDH 3DO7B 1H0DA 3SGEI 1J12A 1A9EA 3PQYE 5IFHL 4BH7A 3KLDA 5FO7A 5IB2A 2Z35A 5MI0C 2ZOLA 2PTTA 1QOKA 2NXZB 4MSWA 3G6DL 4Y5YB 1AR1C 5DD5L 3LEXB 3VDCA 3H42H 2ESVB 5D7JC 1RURH 2Y07H 1NANI 2R2HB 1UCBL 3T0VA 4NBXB 1CICD 3KXFB 4JG0L 1YC8A 2J88L 5A2IH 2F54E 2BXZA 1T22B 1NCBH 4PRIA 2HWZL 3H9YA 1NAKH 4PJDE 5BVPH 3D87B 3EYSH 5DWUH 3VXSD 3U7AA 4X4YB 4HIHA 1RZ8B 1JNHA 4M5YH 4JM2D 2WBJA 2IQ9L 3GHEL 1IKNC 2XTLA 3SKOA 3DRTB 4L9LA 5A3IC 2DQGL 4EVNA 4QY8B 4M6NH 1NC2A 3OAYK 3FT4B 4CVUA 4UNVA 2VISA 1YN6A 5KG9B 5T1DL 4XVUC 2UWEE 1G7QB 4IDLA 4GAGH 1S9YA 4ZFZB 1EEYB 4HK3N 2IBBA 2OR9L 5FFLA 3S88L 4IRJC 2AEQH