1KTMA

Solution structure of fat domain of focal adhesion kinase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
139
structure length
139
Chain Sequence
b'MANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDESLPVLPASTHREIEMAQKLLNSDLAELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMISQSRPH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FOCAL ADHESION KINASE 1
molecule tags Transferase
source organism Gallus gallus
publication title Structural Insight into the Mechanisms of Targeting and Signaling of Focal Adhesion Kinase
pubmed doi rcsb
total genus 53
structure length 139
sequence length 139
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2002-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ktmA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1ktmA02
1UFBA 1K05A 2Q00A 3K7DA 1V4AA 4YXDC 4R32A 2L6HA 3AE1C 3AE4C 1KNYA 3AE9C 1WOLA 3SFEC 1OW7A 3AEGC 3ABVC 1ZZPA 3AECC 2JX0A 3TULA 3U0CA 3AE8C 3JZ0A 3S9OA 3C18A 3JYYA 4XEVA 3AE7C 4YTPC 1ZOYC 3AEFC 1KTMA 2KK1A 1WWPA 2H89C 3SFDC 3C8GA 3RQFA 3RQEA 3AE6C 3C8GD 3AEDC 4XEKA 1JOGA 4EBKA 2L6GA 3MFNA 2G3AA 1K40A 2HSBA 1O3UA 3GM3A 3L8IA 1YQ3C 3RQGA 1WTYA 2FBWC 3U3FA 3B71A 3AE2C 3AEEC 5F28E 3GM2A 3AEAC 2WQYC 3GM1A 3AE5C 3BRJA 4XEFA 1QVXA 3C8GB 2L6FA 2LK4A 1K04A 3AJMA 1ZP0C 2YWAA 3L8JA 2PBEA 1YQ4C 3AEBC 3AE3C 2H88C 4EBJA 2JPUA 1OW6A 1PV3A 4NQFA 1OW8A 3O10A
chains in the Genus database with same CATH superfamily
2ZT9B 1EC5A 1PPJE 1VYKA 1FJKA 2AU5A 1K05A 4GIFA 2R9RB 1L0LK 4B6IA 1NTMG 2C0WA 1V4AA 2R7QA 5COMA 2AXTH 4BJ5C 2EPOA 4U5DE 2PFXA 1RE4A 2YO2A 5KYYA 1SFCB 2W45A 3NFQA 2KSJA 3V2NA 2HFIA 1SQBK 4C46A 3T97B 3V2QA 2ICWG 3Q5SA 3LJBA 1LS4A 1ZHZA 1HGZA 1URQA 1S72P 2XXAB 1KV4A 2B89A 3UNGC 3L72D 3S4RA 1IO4A 2J9WA 4Z9JA 3HNLA 1SQBJ 1URQD 3SP1A 2ZXOA 2QRXA 3F89A 2OEXA 4U5FE 1LGHB 2WVOA 3MUDC 1L0LJ 1IZNB 3EJNA 1GL2B 5BUOA 3PH0A 3CWBG 1NH4A 1LIHA 4PJ0H 2CCYA 2JWDA 4HYTB 5JP7A 4JIOA 1JY2P 5TJHA 1S5LX 4CS9C 4IL6X 1Z23A 2FFHA 1ZYRF 4E18A 1KU2A 2HFED 3CLQA 1WATA 2FXPA 3KH2A 4ULWA 1YQ3C 2KLUA 3KZIH 3H25A 5AW6B 2V7QJ 1JCCA 4HJGH 3O6XA 3PMRA 5B3IA 1XTCC 3B0PA 2K9JB 5E79H 3TOLA 4HB1A 3W2VA 3C9IA 5CJ0A 2WVQA 2XS8A 1GW3A 4XEFA 1RF0A 1AEPA 1M7LA 2XDJA 5KLIC 1HE9A 4N78D 1HMOA 2XLOA 3H1LD 5BQGA 4HFKB 2E76C 2KW3C 3CXHI 3JTLO 3L75D 2C0XA 2NPSD 2FFDC 1VK5A 2LCHA 2V4HA 3RBXA 1SLQA 3SWKA 1JMMA 2EPNA 3RL0C 4EBJA 1RE3A 4IOIH 2N1TB 1Q2NA 5HV9A 1KZUB 4L75A 1N73A 3EFFK 4D6TG 1LTAC 2CYDA 3PTZA 4AYCA 2NRGA 1RMVA 1K8AQ 4ASVA 3US6A 1SQBE 1F1MA 3D6YA 3BVHA 4M63A 2E74B 3WU2E 1GW4A 5A6BD 1J2JB 1SS1A 1OCRC 1QVFO 3WHNA 3P8MC 4BPMA 3L70D 2WZ7A 4Y99B 3H1LJ 1AVOA 2XL4A 4JC7A 1ZHXA 5APSA 3EGDB 3PHLA 1BCCJ 3B5ND 2Q9AA 1RCPA 1P84I 2XNDH 4N6CA 1VOMA 3U0CA 1QX8A 3AE8C 3HJCA 1TWAA 1JMBA 2LIGA 1VQ4P 4WGZA 3M79A 4A4AA 3I5PA 5A6BA 2D2CD 1LS1A 1ORYA 2E42A 2E76B 1IZMA 4O79A 3WAQA 2Y0EA 3DKAA 3SSUA 1IFPA 5D92A 3JRMO 2QVAA 1JY2O 1FDIA 3B4SA 3TSIA 1SF8A 5L0IA 1OKKA 2R7XA 3R2PA 5FCLA 1JOGA 4XEKA 5A6JA 1EA8A 5HSWA 2G3VA 2RKLA 3GWNA 2HV6A 4MN4C 5APVA 2OYIC 1ZHYA 2FYUG 1EQ7A 1SQVD 5CBNA 2R5BA 3A0BE 3VP8A 3CZ6A 3CPWO 2PFDA 2YL3A 2R03A 2H8AA 1YIJP 3H1ID 1OCZC 4XLPF 3W68A 2P61A 3A7OA 3JRTA 2YIUB 3AEEC 1PFIA 4U5HA 1N7SA 1Q0DA 1J1DC 2R32A 1YARO 2YL7A 2WQYC 2YLGA 3P8CD 3AE5C 3Q7LA 5AVZB 3DWWA 4CIPA 1JCDA 5KAFH 4U3FJ 1YJWP 1LVKA 4E17A 4NTFA 2YZSA 3L70J 3C62A 2P58A 2A68F 2YWAA 5B3SC 1VYIA 4U5BE 1APCA 3GHGC 1XZPA 4PV1D 5AW2B 2YQYA 3RL0D 1FZFA 2YXRB 1FFHA 1N7LA 5KAIE 1MMGA 4WY4C 2JJLA 3QVZA 1HY5A 1NOHA 3UMHA 3RVZA 1X79B 5CCGA 4GOEA 4OGQB 2CK3H 1ST6A 5DS6A 4AL0A 2J0XA 3H1LG 1VF5D 4RJTA 2A6HF 2XLMA 3CX5D 2I15A 4DT0A 3VMXA 2M8RA 3UR3C 3IQ5A 5KAFE 1M1JA 2D4UA 4W7YA 3DAFA 5KYYB 3L72J 1JMWA 3U8VA 4Y99C 1N73B 3DD7A 2HKVA 2C04A 3Q1MA 2KNCB 4K35A 3FMSA 3KYIA 3ZG1A 3ZQVA 2O9XA 3C18A 3OEOA 2IYOA 1CGOA 2WSEH 3IQTA 2QJYC 4X0RA 1Z7Qc 1SQVK 2X0CA 1SQQG 1G2CA 4DXWA 1NYHA 3NXSA 5AW4B 2CW0F 2FXMA 2QJPC 2HMZA 2UUHA 1JTHA 3H1KD 3TNUA 1AA0A 3X1OA 2Q7RA 4GYTA 1Y8AA 1JY3O 1LP1B 1ZN5A 2KXPB 4DOJA 2XL6A 3ZQYA 5AVWB 1L0NG 1QLED 5KLVK 3FVYA 2FFDA 1T6QA 2E76D 5L0GA 1R5ID 4H13B 4JQ0D 4WY4B 2E75C 3CCRP 4O7GA 4AL1A 3MYIA 1A0BA 1Q0GA 1UG7A 2R05A 4YXWH 1NTZK 1VL2A 5AVQB 3G6EP 1L4AA 4CBEA 1Q7YQ 4QI0A 1VF5C 3RK3C 1PD0A 1SR2A 1MMDA 1A7DA 1KILC 2M3EA 3Q6NA 5CCGD 2IFNA 5A6AA 4DVZA 4HEAJ 3CX5H 1H0TB 1OW6A 5KYXA 3O10A 1ZU4A 3I5QA 2IXMA 4DJ9A 1ZVZA 2ITAA 1ZMEC 1UIXA 4YT2A 1O87A 4WABA 4G0HA 1JO5A 2P7JA 4U7JA 3N7NA 1A41A 5T1DB 5JUAA 3C7JA 5L3VA 5B1BC 2HODA 5JRAA 3EG9B 1T9KA 1YHQP 2AEFA 1BZ4A 4J7TA 2AEMA 2OYOA 2JWAA 4OIPF 1SMYF 5F5FA 3CCSP 2QM7A 3L71D 1H7IA 1LTJC 4BWNA 3GHGB 3M9HA 2A06E 2QM8A 4L74A 1JM0A 3CWBJ 2V7QH 5JLIA 2ZVNB 1SQVG 2M0BA 3V5XA 3PHF2 5EK0A 2YLIA 3HD7B 5EHHA 3Q2YA 5JSLA 1JY3P 2B0HA 4PR9A 1A02J 3B5NC 1OKKD 3EZIA 2LSEA 2KNHA 2LD6A 1PP9E 1N7SC 3A9CA 1GL2A 1FU1A 3RF3A 4GQHA 3ZIBA 2IZ1A 4LLHA 1NG1A 5KLVD 1UIIA 3E7KA 2E75D 4AE4B 1XWJA 3EFGA 3E9VA 2WPRA 3DJUB 1JY2N 3P7KA 4XPYA 2AP3A 4I3MA 256BA 3GHGA 1YJGA 2WSSH 1JPJA 2XNXA 5B1AC 3RQGA 2DW3A 1Q86Q 3ECSA 2ZXRA 2ZD9A 1LJ2A 4G7ZF 4WJ0A 4LLCA 4CS9A 4WY4A 4H4KC 4MVMA 4YL3A 5F28E 3VMAA 5CCGC 1ZW0A 3BRJA 1JY3N 2FYUK 4PACA 4LLEA 5AW5B 3VM6A 2KB7P 3G3ZA 3QTHA 3HE5B 1DD3A 1DEBA 3ABKC 4EUKB 4MVOA 1IFJA 2WSCJ 3IEEA 2HV7A 4DRHB 4KT0J 1FMWA 3H1HD 1ZU5A 3CCLP 2L91A 1LP1A 3L8JA 5GPGB 2IYLD 2EIMC 5CMZA 1MMAA 4BRYA 3H1JG 1KN7A 2OTKE 2XV5A 1I4ZA 2VRSA 2KNCA 5GTHH 2P67A 4ASWA 3TQOA 1CZQA 3KXDA 3SZRA 1VDFA 2IOQA 5AVUB 4N78E 4LACB 4NQFA 2CNWA 1Z63A 1USDA 1SQPD 4U3FE 3K7DA 2O01H 2CPSA 3MX3A 4OWFA 3W4YA 1QEXA 1WOLA 3L75J 2KQ9A 1KILB 3N0TA 3AEGC 4IFDK 1M56D 2KUBA 2Y39A 5BU8B 1XZQA 4YWQA 5TISH 1TWHA 2CGEA 2W27A 3JYYA 2LR2A 3AG4C 3U8PA 3VYWA 1A7VA 4O6YA 1LTJB 3V5BA 2J45A 3LW5H 4PV1B 1OFCX 2KGOA 1JRAA 4H44C 5BVZA 3SFDC 2XLVA 1PP9D 3SEOA 4HKZH 2G3KA 2A6EF 4WBAA 4E0IA 1IK9A 3L72E 2WPQA 1HJ0A 2W6JH 3A0HH 3B0VC 3RYLA 2P10A 1R8EA 1XTGB 4Z1MH 1FOSE 3NYJA 2ZT9C 5E33A 4XFJA 1BBHA 1BR4A 4JTCB 3D71A 3HRNA 2F22A 3B71A 5KLVE 1WASA 2OTLP 1YYJA 4AK9A 1ZXGA 3KPEA 3U3BA 1KILD 3FWNA 4JTAB 5E2QA 1RKEB 3O8ZA 1OXBA 1NTME 2B87A 2L6FA 3L73G 3CX5I 3H1JJ 4KC9A 4RKUJ 3JCUQ 2ZXEB 2P6VA 2YO3A 1BCCD 1PGOA 4U5EE 2WT7B 3SXMA 3DI5A 5APQA 3EGDA 5H2FE 4GOFA 1NAYA 3ZTMA 3TD7A 5F5HA 1T6UA 3FXHA 3JSZA 5B5EH 4YJWA 3CCMP 1PGJA 2YKQA 1ZHWA 3N2ZB 3KQGA 4AQRD 3O39A 2O3JA 1D0YA 1VQ5P 3B8EB 4MNDA 4OGQC 1SQQE 3L73J 1W2EA 1KFNA 4YXDC 3AE1C 3H1JD 4H0LC 2MWQA 3LEOA 1KNYA 1CW5A 5AVTB 4C3BA 3NDBB 3WUTA 2B87B 3V2PA 4NY3A 3EZHA 2Y9YA 3SWYA 5KYWB 4D6TE 3AECC 1BDJB 3CXHE 3L71G 4O6MA 5L0CA 2R25A 4YT5A 2VH3A 4E7SA 3BCCG 2R44A 5H2FH 1X8YA 3HE5A 2BC5A 3CAXA 3MLGA 4PJJA 1KB9H 1BGYE 4DJGA 1MFTA 2JEEA 2Y3GA 4XQ1A 4D6TJ 1J1DB 1X9VA 2Z5IA 4PJ0E 1V54C 3RVYA 3I4UA 2Y9ZA 2HODB 1YJNP 3M0AA 2BCCG 2DGJA 1VQOP 5CCHA 3EFOB 5KYWA 2L6GA 3G50A 1SVFA 1KFMA 1SQXG 4W80A 1GD2E 4K3AA 1KYOD 1K40A 3A3YB 1E86A 3JSEO 1KB9I 2GDCA 3L73E 3LAYA 2TMVP 1HW1A 1G5ZA 3P8CE 1NO4A 5AW1B 3D70A 1KILA 1KD1Q 4HE8D 2IPPA 2W90A 3H2UA 4DBRA 3CWBE 4XTKA 2MHRA 3MP7B 5EGYA 4CS8A 3U5SA 2JKVA 1FOSF 2OG2A 1NTZJ 3L75G 3L0IA 1K9MQ 1YZAA 3SXYA 3H1HG 5COFA 2GA0A 3S29A 1IFMA 2V26A 1AFOA 3U2MA 4DRJB 1DEEG 1YLMA 1Z5ZA 2H88C 1YDIA 4I1OB 3VP9A 2EIJC 2OKUA 4OD5A 3ZVRA 2O01N 4D6TD 2E74C 2KS1B 4ZKPA 2XRHA 1BGYJ 3E1RA 3ZWIA 2SPZA 2NZ2A 2WVNA 3N24A 3UGOA 2Y3HA 3G4SP 4MW8A 3ZTZA 3HD7C 3IPMO 1J1EC 3S27A 1Y47A 2Q7CA 3AE9C 1D7MA 3KYJA 3RKOF 2VCBA 1M1JB 4TT3H 1Y6DA 4MTFA 1PGQA 2Y3DA 2RH0A 4JW1A 4EKWA 3KYQA 1T01A 1HBWA 1FR0A 3H1IJ 2FGYA 3JCUE 3QW1A 2KYVA 4CX9A 1LT9A 4MTOA 1FBMA 2YXQB 3FGAD 1VLSA 4EI2A 1BE3G 1RXQA 4XWJA 5L0JA 5L3QA 3EH1A 5CBOA 3DM9B 2K37A 4J32B 4O9BA 1OMIA 2Q9BA 2A06G 1LTJA 1E85A 2N1TD 2OYHC 1OR2A 4CS7A 3HD7D 1YTZI 1VQKP 4NPFX 2AXTE 5KJ7A 3USSA 2OARA 1EZVG 3VOPA 2L7AA 1VQ6P 4ZMDA 1YYXA 3HNJA 3QWOC 1YYCA 4N06A 1KQFB 5K5GB 1GL2C 3H1LE 4DBQA 2W83C 2BCCD 1M6TA 4KNVA 1N86A 3H1IG 2QA4P 2NG1A 1PD1A 2MKVA 2YKZA 5AW0B 2KC3A 1QGKB 3MYFA 3BRTB 3CQZA 2P2UA 2Y0DA 2I8BA 4PJNA 3LLIA 3RBZA 1LWUC 1Q0FA 5KAIH 4C3EA 2GFHA 5A69A 3U1AA 1D1CA 3CCQP 3QH9A 1VQMP 3AGUA 1MQVA 1NU1E 2Q9IA 2BE5F 3CCUP 1NJIQ 4ULVA 1E83A 2AWCA 1S3JA 3IHUA 3KKBA 1TKNA 4RBNA 1N8RQ 1GL2D 1NTKE 1IW7F 1NBBA 1U6HA 3EHMA 2ZAEB 1BE3E 3WUVA 2YRFA 2HJ3A 1PV3A 1MNEA 1RHZB 4NC3A 2M3BA 2Y0CA 2LXCB 3LS0A 5KYUB 4R4MA 1S9KE 1IC2A 2N9BA 3CCVP 1S7ZA 1UFBA 2YL1A 3PCVA 5BQIA 1Z3IX 3DMDA 3HNKA 2QJPB 2G62A 1D1AA 3CL3D 4IAQA 4EIJA 2JR8A 2YMKA 4CJOA 3S0XA 4N6JA 1TWGA 1SQXJ 1AV1A 3AE4C 4WB4A 4ER9A 1FJPA 4KI2A 2HR3A 3TULA 3JZ0A 1EDLA 4AE4A 3U59A 4K1OA 1L0LG 3T9OA 4GT1A 1OZHA 3MD0A 1W2BO 3S90A 2DB4A 4JJGA 2EPMX 4WY4D 2RD9A 2R7UA 1KB9D 3B9QA 4H0LB 1T3JA 3C8GA 1KQSO 1OWAA 2R5DA 1WN0A 2Y69C 3DM5A 2KK7A 3AEDC 2AEJA 3AQBA 4CJGA 4I6MC 2Q3TA 1FDOA 4IB4A 1FE6A 2OJED 3JT1A 2HPCB 1EXJA 1KQGB 4YL1A 3CCEP 4IJJA 4ANJA 4QI2A 4D4XA 1PL5A 1GK6A 2KLVA 2HMQA 1Y4CA 3GODA 3L8IA 3H1KJ 2A1DD 2A06D 4N4WA 1KYOH 1V74B 1NTKJ 3BCCJ 3G4ZA 2B88A 1T2KD 1G8XA 1FAPB 1QKRA 3VN0A 2PF4E 3LUTB 3GM2A 1T6AA 3ZDMA 1OVUA 5APWA 3H1KE 2MJZA 2WTYA 4HH2A 2BCCJ 3F47A 1K04A 3K1IA 3WODF 4CDAA 3B0UX 1QL1A 4RD9A 5JT4A 4JTDB 3M9BA 1H9TA 1JB0J 4CSAC 1YQ4C 3JYHA 1W2WA 1L0LE 3L4FA 3ITKA 1RE4C 1H88A 1LTBC 4IRUA 2IBFA 3LIEA 3L71E 1V55C 2O1JA 2POHA 1OW8A 1Q90D 4MVSA 1NVOA 1N1CA 3ZSUA 3B29A 2WT7A 1YBKA 4QDLA 3FXEA 2WSFH 1GGQA 3CMAP 2IXNA 3UMKA 2Q6QA 3CMEP 4J7YA 1BE3D 4PV1C 3GMAA 4JJFA 3V4QA 3H32A 1NHLA 2OOCA 2ZVOB 3H1HJ 1OW7A 3M4CA 2ZYGA 1GTWA 3PLNA 4JZAA 4AX2A 2ZFCA 1LTSC 3S9OA 1FTSA 4EBBA 5KJ7C 2PX0A 2QG4A 3AG3C 5CCHC 2WSFJ 2Z5HA 3AEFC 3AG1C 2JP3A 4B86A 5KYNA 1SYQA 3LNRA 4BJ5A 1LT1A 1YJ9P 2ASRA 3CI9A 5E3CA 3GWLA 1ZR4A 1RKEA 3M4BA 3LNMB 3V7OA 4BJ1A 3NYLA 1RF0C 2O1KA 2ETSA 2FXOA 1NTKG 4O6NA 2ZT9D 3JSVC 1EDKA 4W8PA 4OINF 4EOTA 2BL2A 3E1IA 4ONSA 1H0TA 4KNWA 3PRJA 1E79H 3SXZA 1O3UA 2ZJSE 1RJ9B 1GS9A 1CI6A 2P7VA 1SQVE 1WRGA 4HFFB 1MV8A 2GWWA 2HS5A 1FAVA 3RFYA 3TK0A 2QJKB 3KPHA 4C7NB 1JOCA 3GEEA 1KYOE 1YI2P 2C9LY 4MTGA 5AW7B 4M3LA 1G1JA 3T97A 1VB5A 2CNWD 3K6BA 2HLOA 2NUTB 1H6GA 2CPBA 3PJSK 5DLJA 2H7OA 4G78A 3HTKB 3H1HE 1L3PA 3HUSC 5DS5A 1A7EA 3A5TA 4CS8C 2IBZD 5L0DA 1AQ5A 1LTIC 3FOPA 3PDMP 2Y3BA 5L0HA 3TGUE 1I4YA 2YNYA 1GU4A 2Q9CA 3TK1A 3ASNC 1S1CX 3L70E 1LM3B 2QJYB 2IYPA 4G7HF 5TISE 3IF4A 1S2EA 3EQ2A 3IAOA 2N1TC 2M64A 4E0HA 2HYNA 1OIPA 2HUJA 3NRHA 1QL2A 1YVIA 3KL4A 1LT9C 2E87A 2FYUJ 4A7PA 2H7BA 3TJ6A 3NMKA 1N73C 1PGPA 3H1JE 4PJLA 1P84D 2QUPA 2ZPAA 3HTKC 4RO0A 1M2VB 2OYIA 3BRVB 1HE1A 4LDKA 1HUCA 4YTPC 1EXIA 3F46A 2R7WA 1EKYA 4C7OB 2QIWA 3VTPC 1KTMA 2O01J 3RK3D 1NU7D 2H7VC 1QQ3A 2GUSA 4I2LC 2L9JA 4U3FG 1SQXK 1IFNA 3CC4P 5KKZB 3VMYA 1QVGO 3RQFA 1VPCA 1L0NJ 3AE6C 5BU5A 1JNMA 4YPCA 4BXLA 1SQBD 2NUPA 1LPEA 1U89A 4IAOA 2KSEA 3ZC4A 5AC5A 3BCCD 3GF3A 5GTIH 3LESA 3HLZA 1I5NA 4CPGA 2I1JA 3G9RA 4N3YB 4C7NA 3NMDA 3L74G 1NU1K 1H9GA 4Q5SF 2YMYA 1SQPK 2P1AA 1D1BA 2DI3A 1QZXA 4OIOF 1NLXA 1S9KD 1JAFA 2XXAA 5EFWB 3DAGA 5KYUA 3NYMA 2KSFA 1SQQK 5CHXA 1VF5B 2WB7A 4W7ZA 3MZWB 5AVSB 1WMKA 3D6ZA 4AUWA 2ZXWC 2V3CC 3Q6MA 1T5OA 1ZW3A 2XL8A 1OCOC 2GUVA 2QLAA 4H13C 1C02A 2JD3A 3EQLF 1RF1B 3CC2P 2EIKC 4JURI 2XKMA 1EZVI 1LWUA 3QW0A 4GEHA 3EFOA 4LDQA 3WU2H 3VYIA 4U5GA 4PJMA 3HKKA 2QNLA 1OR3A 4WWIA 3TGUD 3NMIA 4LGDE 3T4RA 2OEVA 4KBLA 2PP4A 4H44B 3C8VA 2HPCA 2OCCC 3K66A 2K3RA 3NKEA 4U9EA 1NTMK 1S4XA 5KJ7D 2J9BA 1FNTc 2K9YA 3CXHH 2YHSA 1HJBA 3V2RA 1PPJD 4P9FA 2RMZA 2NPSB 3NG1A 3V5ZA 3WG7C 3OW2O 1T8ZA 2WZFA 3U9JA 1LE2A 3Q5RA 4L76A 5M1BA 4KJMA 4FESA 2Q1KA 3AE7C 3OJAB 4MS2A 1BDCA 5KLVJ 2E74D 2KIKA 3OWTA 3EGXB 2R7VA 1CGME 2VCAA 3BASA 3MGNA 1N7SB 2H89C 1Y9BA 2OYIB 3L75E 1KQLA 2IXPA 2A45G 2J9UA 2IBZI 4NPDA 3RQEA 3S28A 3O6QA 4EBKA 3H1KG 1SQXD 2IX7C 4NPEA 1NTKD 2A0BA 3MFNA 4IARA 1FMVA 4EDFA 3K5BA 3S1KA 1ZRTD 4DZOA 3LLKA 2M5AA 4XPWA 1NZEA 1IJDB 2UWJE 4C3DA 4QMAA 1Q0MA 4YK5A 1QSPA 2WL8A 4PK4A 1FZAA 1LTTC 5AC4A 5AGFA 2AXCA 3JCUH 5APUA 3U2LA 1J1EB 1JTHB 2VCCA 1NTZE 4Z9IA 1LTGC 1ZLLA 2ZXXA 3A2AA 4MVRA 1EZVD 1PIXA 4PD4D 5AVXB 1A02F 2M5AB 4I1LA 2FAPB 4H13D 2BEQD 1GU5A 1SQXE 2WPVB 3NMJA 2W4BA 4P6IC 2R7OA 2XLWA 2KZJA 2XU6A 2QSIA 3A0HE 3BEHA 2W6BA 3O55A 2PBEA 3FAPB 4JF7A 1KORA 1BGYG 1SP4A 1C03A 2PNOA 1NWQA 1YTZT 3U1CA 4JE9A 3HE4B 1HWTC 1AVYA 3PP5A 1T2KC 2M4EA 2JPUA 4YT8A 1D0XA 4G7OF 3HTKA 1OXZA 2NPUA 5C39A 3Q7GA 4CDVA 4CSAA 1GMJA 4LC1A 1CI6B 2E5YA 4CIHA 1MKMA 2XS1A 2FFDB 1U0BB 2A69F 2AVKA 2J8WA 2VC9A 4D4NA 3S84A 5AVVB 1NTMD 5CCHD 3FXDA 1OQCA 4MVUA 5KLIB 2HSQA 4Y28J 1KC8Q 1YA7O 1VQLP 4OD4A 3M0DA 5KKZC 1ZR2A 2R7TA 3A0BH 3FHDA 4LERA 3ABVC 1ZZPA 1SQQJ 4IL6H 5KTBA 4BJTA 1S5LH 3JC22 2KJGA 3TF5A 3L72G 1BR2A 3G4XA 4EYYQ 4PD4E 4YN0B 1TR2A 4NTAA 1P84H 4JCZA 4H44D 4K0DA 3GEHA 4U5CE 2HZ8A 3RK2B 3EG9A 1TU3F 2R7RA 3RK3E 1LWUB 1VQ7P 3EWKA 1HGVA 1LT9B 1SQBG 2AWYA 1KILE 5KLVG 1L0NK 5AW3B 4TLFA 2D2CC 1TQGA 4PFOA 3W8HA 3L37A 3H32B 3C1LA 2G3AA 5IY5C 2KZIA 2J59M 2J5UA 3GORA 1FC2C 2JO1A 1OVVA 2NSGA 4IFMA 1SZIA 2W8ZA 2A45I 4JEAA 3RL0B 2HSBA 2LFDA 3AGTA 4Q4ZF 1R5SA 4I44A 4IL6E 1NU1D 3C63A 1LI7A 1NTZD 3B5NA 3SXKA 3U3FA 4PD4H 3CWBD 4R4LA 1BDDA 1JUNA 2OYHB 5DQTA 2FYNC 1MMNA 1R5LA 3E70C 3LW5J 2C03A 3TGUG 3KZIE 1NU9C 1NAFA 2R3SA 3DZAA 1BSHA 3LS1A 1ZV8A 1CPQA 3AJMA 2YVKA 1YAUO 5E79E 3LIDA 4OIQF 1VTMP 4ZLDA 1Q82Q 2FYNB 3TOMA 2OQQA 3AEBC 1G1IA 1TFKB 5CJ4A 2Q4FA 5CI8A 3II6A 4E7ZA 2WZLA 3H1IE 3QZCA 3TYYA 2N1TA 4K7BA 4J30B 2EILC 3ABLC 4BEMJ 2GA1A 1EI7A 3ASOC 3HUSA 3VRCA 1MZ9A 3AG2C 3SNHA 4OH8B 3ABMC 3BCCE 1L0LD 2I8DA 1MNDA 3TGUJ 1ORJA 4R32A 3K1HA 3IFMA 3L70G 3LEVA 2FKWB 3SFEC 3DE9A 4BJ6C 3CXHD 5APXA 5A6KA 3F5HA 1NGMB 1H89A 2PAJA 5DS4A 2R7SA 4PD4I 1NKNA 1M2OA 3TJ5A 4OIRF 1AQTA 2KS1A 1L4AB 2L81A 2HG5D 1DIPA 5K0IA 3MIWA 1HMDA 1SFCC 1GDTA 2J0WA 1WWPA 2QTVA 3J06A 1FZCA 1PP9G 2WITA 5AVRB 2NUTA 3W8IA 3GF7A 1OCCC 2I1KA 1TWCA 5FZTA 3L34A 1RF1A 2FYUD 2XLEA 1J8YF 1RY3A 2KYHA 3L35A 1Z6AA 5DQZA 3BATA 4FAPB 3GEIA 2GAQA 3CC7P 5TJ5E 2VASA 2QE9A 2H8PD 3T6BA 1ZW2A 2H7HA 3L74E 2OU6A 3H6PA 4FWVA 1M57D 1RH5B 2YLDA 2WZGA 3I56P 3AE2C 1DOWA 5CIVA 2ZXPA 4JRZA 4L73A 3GG2A 1EDIA 1PP9J 1OX3A 3IR9A 1M1KQ 1ZHTA 2B9BA 1WGWA 5T3TA 4KHXA 1M2VA 2OTJP 2W6AA 3L1MA 1FS0E 3I5CA 1BCCG 3DXJF 1BGYD 3FWLA 5APYA 2NPSC 3AOUA 3AE3C 5DJTB 4JVSA 2FYUE 4XLNF 1NFOA 2J7PD 3M91A 4IGGA 1FZCB 4ZKUA 4ZLCA 3RGUA 4P9TA 2OJQA 2OQMA 4OGQD 1L2PA 3ZDLA 2Q00A 1USEA 2K1AA 2Z4EA 2IBZE 3MTUE 2WWWA 3OA7A 2EINC 1QLEC 4DOZA 2A45H 3OA1A 1RQUA 1DX7A 4JEBA 3ATPA 1AUEA 2VB6A 5BQHA 1MFZA 3VAYA 5T3WA 2N9YB 1NTKK 3EHNA 2LQGA 1AJYA 3MUDA 2ZYDA 2W4MA 1Q81Q 2ZYAA 1LI5A 3C8ZA 4DVYP 3WMM0 1ZOYC 3TDKA 1VLTA 2Q5UA 2IM8A 1SQQD 4IFFA 3GANA 1URQB 1NTZG 1RKCA 4LDRA 2PGDA 3C8GD 3IQ6A 1X0TA 4OVNF 3CEXA 1O5HA 1GQAA 1YITP 1BR1A 1VMAA 5COGA 2J46A 3T6JA 3RK2C 4MQ9F 1NFNA 2E75B 3W2WA 1EQ1A 5E3AA 3POVA 3M9QA 3RIPA 1J8MF 1SFCD 5JS5A 4H0LD 1LNQA 2XM0A 3KDPB 2MYSA 3GM1A 4I1MA 2IBZG 2HJMA 2Q3IA 1N2DC 1RJ9A 1YZCA 2JDIH 1HH0A 1L0ND 1RE3C 2YEVA 1U57A 1VQPP 3RL0g 1L4AD 4YT4A 1U7JA 1KYOI 2PP6A 3O6QB 2QEXP 1QPUA 4L6RA 3EPVA 1GZLA 1KMIZ 1GK4A 3DE8A 4JBZA 2QE7H 1JPNA 2E43A 3L74J 2WVRA 5DJUB 3RW0A 4Z9HA 2QY9A 1M57C 3FX0A 5JVEA 3H2VA 2D2CB 2X51A 3RK3B 1CSBA 3M06A 3M0DC 1DH3A 1HTLC 3CX5E 3L71J 2J7PA 4XA4A 3EH2A 3HE4A 1M56C 4EWCA 1OVRA 1P84E 4XPXA 4RDAA 2EPLX 5DVWA 2OYHA 1SQVJ 3U9MA 3GLMA 3VMZA 4JYCA 2PRRA 1S05A 4WGYA 2BASA 4XEVA 1G2CB 1K73Q 4EIYA 4GKGA 1MUUA 2KI7B 4ZNCA 2LKMA 2QJKC 3CCJP 2YKOA 3IN6A 2R3CA 2FYZA 3HD7A 2C9NY 3DJNB 1SQPE 4U3FD 2WPSA 4GODA 1E84A 4FX5A 2WMMA 2G8YA 3M15A 1T3UA 1NTMJ 1URQC 3MHVA 1TFOB 2DYRC 3I55P 1U7MA 2L5GB 2WSCH 4DCKA 5L0FA 1JEKA 1WT6A 3N4XA 3V5YA 5D91A 4UB8E 3L74D 2XM4A 3A11A 5B5EE 1G4US 2K9JA 3M1CB 3ITFA 4Q7CA 2K88A 2BCCE 3CD6P 2LFFA 1EDJA 3SWFA 3HUSB 5CI9A 4I7ZB 3Q3DA 2PX3A 2XLDA 4H54A 1CPRA 3G71P 3C8GB 4UB6H 3MBGA 1FFTC 4NCQA 4NTBA 4IWBA 1H8AA 4JYBA 5KYXB 2R02A 2P0NA 2YL0A 1VQ9P 1IFIA 1D0ZA 4GDOA 2Q3EA 3R4YA 1VQNP 4XE5B 1LKXA 4PFPA 4MVQA 1IK7A 1N7SD 2J9VA 1T6IA 3FOOA 3KMIA 1ZRTE 2UUIA 1SQPJ 3SYNA 1PZQA 2E5TA 1KB9E 4F4BA 1NU1J 4UB8H 1M1JC 3CSKA 1Z56A 3EGXA 4BJ6A 3K33A 2NUPB 3VF0A 3UMIA 1DOVA 2A0UA 4JCHA 4BEJA 4DRIB 2IXOA 4I7ZC 2KP8A 2L6HA 1HW2A 1YA9A 2YIUC 1PPJG 3Q5PA 2WSEJ 3FDQA 4UDVA 2KOGA 3NKDA 1SFCA 1PCXA 4JKVA 1BSNA 1B68A 4BRYB 2NSFA 4CDYA 2JX0A 4WVZA 3H65A 3HNIA 4MVZA 3V4WA 2LXBA 1VQ8P 4RESB 5AVYB 1SQPG 1HVVA 3TNUB 5B66H 2DYSC 3T6GB 3AQCA 2FY8A 2IZ0A 1RQVA 3NTNA 2KK1A 3UGPA 2W9YA 5APTA 1FZEA 4JPZB 1CGNA 1JR8A 4W8KA 3RH3A 3L36A 4YL0A 1EZVE 1IFDA 2H43A 2RN0A 1FZGA 1FDMA 2P1JA 1BE3J 2LP4A 4BG0A 2XZRA 1L0NE 1FZCC 1NKZB 1NSGB 1L7CA 3V6IA 2IDBA 1AVOB 2CDQA 3FAJA 3K1IC 3X2QC 2YKPA 5GTHE 2RSEB 1M90Q 2XSEA 5AW9B 3GM3A 2B0JA 2Z15A 3R7CA 1S5LE 1M8OB 2FBWC 1L4AC 3UIAA 1WTYA 1G4WR 1OXKA 1E5WA 1RF1C 5B66E 1LE4A 3KHUA 2XLHA 1Q0KA 3WUUA 4A2NB 3AEAC 5L8RJ 1HF9A 1QVXA 2NPSA 4C7OA 4MW3A 2LK4A 4N6HA 2OGUA 1FZBA 4U9DA 3QVYA 1ZP0C 3OAKA 1NU1G 3GW6A 1R4TA 1E2XA 3QMKA 3RK2D 4UB6E 1X22A 3B5NB 5GTIE 1ORSC 1GM5A 1BCCE 2BEZF 1C17M 3P32A 5AW8B 3W67A 2GM4A 3IQCA 2D5RB 1W5CE 3L73D 2IFMA 1DD4A 4EHPA 4C7RA 2J58A 2EPKX
chains in the Genus database with same CATH topology
2D2CB 4R4MA 2ZT9B 3D6YA 1UFBA 1GMJA 2E74B 4OGQD 1MKMA 2NZ2A 1K05A 1S1CX 1ZMEC 1UIXA 2Q00A 3K7DA 2K9YA 4OGQC 3IAOA 4U7JA 1V4AA 4H0LC 4YXDC 4I7ZC 3AE1C 2L6HA 4R32A 2YMKA 2YIUC 3AE4C 4PV1C 1KNYA 3AE9C 1WOLA 3GMAA 3SFEC 3Q5PA 4Y28J 2WSEJ 4TT3H 5KKZC 3Q1MA 1RQUA 1OW7A 3AEGC 1NGMB 3ABVC 3GLMA 1ZZPA 3T97B 3AECC 3Q5SA 2JX0A 3TULA 3U0CA 3Q5RA 3AE8C 3JZ0A 3S9OA 5M1BA 3C18A 1AJYA 3JYYA 4XEVA 2QJYC 3AE7C 4YTPC 1EXIA 2WSFJ 2D2CD 4H44D 1DIPA 1ZOYC 2QJKC 2QIWA 3AEFC 2E74D 3FGAD 1KTMA 2E76B 2JP3A 1RQVA 2KK1A 2O01J 4PV1B 3IN6A 1WWPA 3Q2YA 2H89C 1TU3F 1NYHA 4H44C 3SFDC 1Y9BA 4H0LB 1FDIA 3RK3E 1OMIA 3C8GA 2QJPC 3RQFA 3RQEA 3EWKA 3GF7A 3AE6C 3C8GD 3AEDC 3O6QA 1KILE 2G8YA 1FDOA 1JOGA 4XEKA 4EBKA 1HJ0A 2L6GA 3MFNA 2D2CC 2E75D 3GF3A 2G3AA 2P10A 2ZT9D 1R8EA 1S5LX 2J5UA 4IL6X 1KQGB 1EXJA 2IDBA 2JO1A 4Z1MH 3G9RA 1PL5A 2ZT9C 1K40A 4XFJA 2FXPA 2E75B 2HSBA 1KQFB 1O3UA 3GM3A 3L8IA 3D71A 1YQ3C 3RQGA 3H25A 1WTYA 2FBWC 2E76D 2V7QJ 3U3FA 3B71A 2MKVA 4R4LA 4H13B 3AE2C 3AEEC 4H0LD 5F28E 2E75C 3GM2A 3AEAC 3D70A 5L8RJ 1VF5B 4I7ZB 2WQYC 2FYNC 3D6ZA 1WMKA 3AE5C 3Q3DA 1HF9A 3LW5J 1QVXA 1VL2A 3BRJA 3C8GB 1PIXA 2L6FA 4XEFA 5KLIC 2LK4A 4H13D 1DD3A 2BEQD 1K04A 1U57A 1ZP0C 1VF5C 3AJMA 2WSCJ 2E76C 3RL0g 2WPVB 2YWAA 4GDOA 3R4YA 4RKUJ 4H13C 4PV1D 4KT0J 2QSIA 3L8JA 1KMIZ 2PBEA 1JB0J 1IK7A 1KORA 1YQ4C 2OQQA 3AEBC 3AE3C 2BEZF 1ZRTE 2H88C 4EBJA 3GM1A 4OGQB 2JPUA 1DD4A 1OW6A 1PV3A 4H44B 1VF5D 1OW8A 3C8VA 4NQFA 1Q90D 2E74C 3O10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UFB A;  1K05 A;  2Q00 A;  3K7D A;  1V4A A;  4YXD C;  4R32 A;  2L6H A;  3AE1 C;  3AE4 C;  1KNY A;  3AE9 C;  1WOL A;  3SFE C;  1OW7 A;  3AEG C;  3ABV C;  1ZZP A;  3AEC C;  2JX0 A;  3TUL A;  3U0C A;  3AE8 C;  3JZ0 A;  3S9O A;  3C18 A;  3JYY A;  4XEV A;  3AE7 C;  4YTP C;  1ZOY C;  3AEF C;  1KTM A;  2KK1 A;  1WWP A;  2H89 C;  3SFD C;  3C8G A;  3RQF A;  3RQE A;  3AE6 C;  3C8G D;  3AED C;  4XEK A;  1JOG A;  4EBK A;  2L6G A;  3MFN A;  2G3A A;  1K40 A;  2HSB A;  1O3U A;  3GM3 A;  3L8I A;  1YQ3 C;  3RQG A;  1WTY A;  2FBW C;  3U3F A;  3B71 A;  3AE2 C;  3AEE C;  5F28 E;  3GM2 A;  3AEA C;  2WQY C;  3GM1 A;  3AE5 C;  3BRJ A;  4XEF A;  1QVX A;  3C8G B;  2L6F A;  2LK4 A;  1K04 A;  3AJM A;  1ZP0 C;  2YWA A;  3L8J A;  2PBE A;  1YQ4 C;  3AEB C;  3AE3 C;  2H88 C;  4EBJ A;  2JPU A;  1OW6 A;  1PV3 A;  4NQF A;  1OW8 A;  3O10 A; 
#chains in the Genus database with same CATH topology
 2ZT9 B;  1EC5 A;  1PPJ E;  1VYK A;  1FJK A;  2AU5 A;  1K05 A;  4GIF A;  2R9R B;  1L0L K;  4B6I A;  1NTM G;  2C0W A;  1V4A A;  2R7Q A;  5COM A;  2AXT H;  4BJ5 C;  2EPO A;  4U5D E;  2PFX A;  1RE4 A;  2YO2 A;  5KYY A;  1SFC B;  2W45 A;  3NFQ A;  2KSJ A;  3V2N A;  2HFI A;  1SQB K;  4C46 A;  3T97 B;  3V2Q A;  2ICW G;  3Q5S A;  3LJB A;  1LS4 A;  1ZHZ A;  1HGZ A;  1URQ A;  1S72 P;  2XXA B;  1KV4 A;  2B89 A;  3UNG C;  3L72 D;  3S4R A;  1IO4 A;  2J9W A;  4Z9J A;  3HNL A;  1SQB J;  1URQ D;  3SP1 A;  2ZXO A;  2QRX A;  3F89 A;  2OEX A;  4U5F E;  1LGH B;  2WVO A;  3MUD C;  1L0L J;  1IZN B;  3EJN A;  1GL2 B;  5BUO A;  3PH0 A;  3CWB G;  1NH4 A;  1LIH A;  4PJ0 H;  2CCY A;  2JWD A;  4HYT B;  5JP7 A;  4JIO A;  1JY2 P;  5TJH A;  1S5L X;  4CS9 C;  4IL6 X;  1Z23 A;  2FFH A;  1ZYR F;  4E18 A;  1KU2 A;  2HFE D;  3CLQ A;  1WAT A;  2FXP A;  3KH2 A;  4ULW A;  1YQ3 C;  2KLU A;  3KZI H;  3H25 A;  5AW6 B;  2V7Q J;  1JCC A;  4HJG H;  3O6X A;  3PMR A;  5B3I A;  1XTC C;  3B0P A;  2K9J B;  5E79 H;  3TOL A;  4HB1 A;  3W2V A;  3C9I A;  5CJ0 A;  2WVQ A;  2XS8 A;  1GW3 A;  4XEF A;  1RF0 A;  1AEP A;  1M7L A;  2XDJ A;  5KLI C;  1HE9 A;  4N78 D;  1HMO A;  2XLO A;  3H1L D;  5BQG A;  4HFK B;  2E76 C;  2KW3 C;  3CXH I;  3JTL O;  3L75 D;  2C0X A;  2NPS D;  2FFD C;  1VK5 A;  2LCH A;  2V4H A;  3RBX A;  1SLQ A;  3SWK A;  1JMM A;  2EPN A;  3RL0 C;  4EBJ A;  1RE3 A;  4IOI H;  2N1T B;  1Q2N A;  5HV9 A;  1KZU B;  4L75 A;  1N73 A;  3EFF K;  4D6T G;  1LTA C;  2CYD A;  3PTZ A;  4AYC A;  2NRG A;  1RMV A;  1K8A Q;  4ASV A;  3US6 A;  1SQB E;  1F1M A;  3D6Y A;  3BVH A;  4M63 A;  2E74 B;  3WU2 E;  1GW4 A;  5A6B D;  1J2J B;  1SS1 A;  1OCR C;  1QVF O;  3WHN A;  3P8M C;  4BPM A;  3L70 D;  2WZ7 A;  4Y99 B;  3H1L J;  1AVO A;  2XL4 A;  4JC7 A;  1ZHX A;  5APS A;  3EGD B;  3PHL A;  1BCC J;  3B5N D;  2Q9A A;  1RCP A;  1P84 I;  2XND H;  4N6C A;  1VOM A;  3U0C A;  1QX8 A;  3AE8 C;  3HJC A;  1TWA A;  1JMB A;  2LIG A;  1VQ4 P;  4WGZ A;  3M79 A;  4A4A A;  3I5P A;  5A6B A;  2D2C D;  1LS1 A;  1ORY A;  2E42 A;  2E76 B;  1IZM A;  4O79 A;  3WAQ A;  2Y0E A;  3DKA A;  3SSU A;  1IFP A;  5D92 A;  3JRM O;  2QVA A;  1JY2 O;  1FDI A;  3B4S A;  3TSI A;  1SF8 A;  5L0I A;  1OKK A;  2R7X A;  3R2P A;  5FCL A;  1JOG A;  4XEK A;  5A6J A;  1EA8 A;  5HSW A;  2G3V A;  2RKL A;  3GWN A;  2HV6 A;  4MN4 C;  5APV A;  2OYI C;  1ZHY A;  2FYU G;  1EQ7 A;  1SQV D;  5CBN A;  2R5B A;  3A0B E;  3VP8 A;  3CZ6 A;  3CPW O;  2PFD A;  2YL3 A;  2R03 A;  2H8A A;  1YIJ P;  3H1I D;  1OCZ C;  4XLP F;  3W68 A;  2P61 A;  3A7O A;  3JRT A;  2YIU B;  3AEE C;  1PFI A;  4U5H A;  1N7S A;  1Q0D A;  1J1D C;  2R32 A;  1YAR O;  2YL7 A;  2WQY C;  2YLG A;  3P8C D;  3AE5 C;  3Q7L A;  5AVZ B;  3DWW A;  4CIP A;  1JCD A;  5KAF H;  4U3F J;  1YJW P;  1LVK A;  4E17 A;  4NTF A;  2YZS A;  3L70 J;  3C62 A;  2P58 A;  2A68 F;  2YWA A;  5B3S C;  1VYI A;  4U5B E;  1APC A;  3GHG C;  1XZP A;  4PV1 D;  5AW2 B;  2YQY A;  3RL0 D;  1FZF A;  2YXR B;  1FFH A;  1N7L A;  5KAI E;  1MMG A;  4WY4 C;  2JJL A;  3QVZ A;  1HY5 A;  1NOH A;  3UMH A;  3RVZ A;  1X79 B;  5CCG A;  4GOE A;  4OGQ B;  2CK3 H;  1ST6 A;  5DS6 A;  4AL0 A;  2J0X A;  3H1L G;  1VF5 D;  4RJT A;  2A6H F;  2XLM A;  3CX5 D;  2I15 A;  4DT0 A;  3VMX A;  2M8R A;  3UR3 C;  3IQ5 A;  5KAF E;  1M1J A;  2D4U A;  4W7Y A;  3DAF A;  5KYY B;  3L72 J;  1JMW A;  3U8V A;  4Y99 C;  1N73 B;  3DD7 A;  2HKV A;  2C04 A;  3Q1M A;  2KNC B;  4K35 A;  3FMS A;  3KYI A;  3ZG1 A;  3ZQV A;  2O9X A;  3C18 A;  3OEO A;  2IYO A;  1CGO A;  2WSE H;  3IQT A;  2QJY C;  4X0R A;  1Z7Q c;  1SQV K;  2X0C A;  1SQQ G;  1G2C A;  4DXW A;  1NYH A;  3NXS A;  5AW4 B;  2CW0 F;  2FXM A;  2QJP C;  2HMZ A;  2UUH A;  1JTH A;  3H1K D;  3TNU A;  1AA0 A;  3X1O A;  2Q7R A;  4GYT A;  1Y8A A;  1JY3 O;  1LP1 B;  1ZN5 A;  2KXP B;  4DOJ A;  2XL6 A;  3ZQY A;  5AVW B;  1L0N G;  1QLE D;  5KLV K;  3FVY A;  2FFD A;  1T6Q A;  2E76 D;  5L0G A;  1R5I D;  4H13 B;  4JQ0 D;  4WY4 B;  2E75 C;  3CCR P;  4O7G A;  4AL1 A;  3MYI A;  1A0B A;  1Q0G A;  1UG7 A;  2R05 A;  4YXW H;  1NTZ K;  1VL2 A;  5AVQ B;  3G6E P;  1L4A A;  4CBE A;  1Q7Y Q;  4QI0 A;  1VF5 C;  3RK3 C;  1PD0 A;  1SR2 A;  1MMD A;  1A7D A;  1KIL C;  2M3E A;  3Q6N A;  5CCG D;  2IFN A;  5A6A A;  4DVZ A;  4HEA J;  3CX5 H;  1H0T B;  1OW6 A;  5KYX A;  3O10 A;  1ZU4 A;  3I5Q A;  2IXM A;  4DJ9 A;  1ZVZ A;  2ITA A;  1ZME C;  1UIX A;  4YT2 A;  1O87 A;  4WAB A;  4G0H A;  1JO5 A;  2P7J A;  4U7J A;  3N7N A;  1A41 A;  5T1D B;  5JUA A;  3C7J A;  5L3V A;  5B1B C;  2HOD A;  5JRA A;  3EG9 B;  1T9K A;  1YHQ P;  2AEF A;  1BZ4 A;  4J7T A;  2AEM A;  2OYO A;  2JWA A;  4OIP F;  1SMY F;  5F5F A;  3CCS P;  2QM7 A;  3L71 D;  1H7I A;  1LTJ C;  4BWN A;  3GHG B;  3M9H A;  2A06 E;  2QM8 A;  4L74 A;  1JM0 A;  3CWB J;  2V7Q H;  5JLI A;  2ZVN B;  1SQV G;  2M0B A;  3V5X A;  3PHF 2;  5EK0 A;  2YLI A;  3HD7 B;  5EHH A;  3Q2Y A;  5JSL A;  1JY3 P;  2B0H A;  4PR9 A;  1A02 J;  3B5N C;  1OKK D;  3EZI A;  2LSE A;  2KNH A;  2LD6 A;  1PP9 E;  1N7S C;  3A9C A;  1GL2 A;  1FU1 A;  3RF3 A;  4GQH A;  3ZIB A;  2IZ1 A;  4LLH A;  1NG1 A;  5KLV D;  1UII A;  3E7K A;  2E75 D;  4AE4 B;  1XWJ A;  3EFG A;  3E9V A;  2WPR A;  3DJU B;  1JY2 N;  3P7K A;  4XPY A;  2AP3 A;  4I3M A;  256B A;  3GHG A;  1YJG A;  2WSS H;  1JPJ A;  2XNX A;  5B1A C;  3RQG A;  2DW3 A;  1Q86 Q;  3ECS A;  2ZXR A;  2ZD9 A;  1LJ2 A;  4G7Z F;  4WJ0 A;  4LLC A;  4CS9 A;  4WY4 A;  4H4K C;  4MVM A;  4YL3 A;  5F28 E;  3VMA A;  5CCG C;  1ZW0 A;  3BRJ A;  1JY3 N;  2FYU K;  4PAC A;  4LLE A;  5AW5 B;  3VM6 A;  2KB7 P;  3G3Z A;  3QTH A;  3HE5 B;  1DD3 A;  1DEB A;  3ABK C;  4EUK B;  4MVO A;  1IFJ A;  2WSC J;  3IEE A;  2HV7 A;  4DRH B;  4KT0 J;  1FMW A;  3H1H D;  1ZU5 A;  3CCL P;  2L91 A;  1LP1 A;  3L8J A;  5GPG B;  2IYL D;  2EIM C;  5CMZ A;  1MMA A;  4BRY A;  3H1J G;  1KN7 A;  2OTK E;  2XV5 A;  1I4Z A;  2VRS A;  2KNC A;  5GTH H;  2P67 A;  4ASW A;  3TQO A;  1CZQ A;  3KXD A;  3SZR A;  1VDF A;  2IOQ A;  5AVU B;  4N78 E;  4LAC B;  4NQF A;  2CNW A;  1Z63 A;  1USD A;  1SQP D;  4U3F E;  3K7D A;  2O01 H;  2CPS A;  3MX3 A;  4OWF A;  3W4Y A;  1QEX A;  1WOL A;  3L75 J;  2KQ9 A;  1KIL B;  3N0T A;  3AEG C;  4IFD K;  1M56 D;  2KUB A;  2Y39 A;  5BU8 B;  1XZQ A;  4YWQ A;  5TIS H;  1TWH A;  2CGE A;  2W27 A;  3JYY A;  2LR2 A;  3AG4 C;  3U8P A;  3VYW A;  1A7V A;  4O6Y A;  1LTJ B;  3V5B A;  2J45 A;  3LW5 H;  4PV1 B;  1OFC X;  2KGO A;  1JRA A;  4H44 C;  5BVZ A;  3SFD C;  2XLV A;  1PP9 D;  3SEO A;  4HKZ H;  2G3K A;  2A6E F;  4WBA A;  4E0I A;  1IK9 A;  3L72 E;  2WPQ A;  1HJ0 A;  2W6J H;  3A0H H;  3B0V C;  3RYL A;  2P10 A;  1R8E A;  1XTG B;  4Z1M H;  1FOS E;  3NYJ A;  2ZT9 C;  5E33 A;  4XFJ A;  1BBH A;  1BR4 A;  4JTC B;  3D71 A;  3HRN A;  2F22 A;  3B71 A;  5KLV E;  1WAS A;  2OTL P;  1YYJ A;  4AK9 A;  1ZXG A;  3KPE A;  3U3B A;  1KIL D;  3FWN A;  4JTA B;  5E2Q A;  1RKE B;  3O8Z A;  1OXB A;  1NTM E;  2B87 A;  2L6F A;  3L73 G;  3CX5 I;  3H1J J;  4KC9 A;  4RKU J;  3JCU Q;  2ZXE B;  2P6V A;  2YO3 A;  1BCC D;  1PGO A;  4U5E E;  2WT7 B;  3SXM A;  3DI5 A;  5APQ A;  3EGD A;  5H2F E;  4GOF A;  1NAY A;  3ZTM A;  3TD7 A;  5F5H A;  1T6U A;  3FXH A;  3JSZ A;  5B5E H;  4YJW A;  3CCM P;  1PGJ A;  2YKQ A;  1ZHW A;  3N2Z B;  3KQG A;  4AQR D;  3O39 A;  2O3J A;  1D0Y A;  1VQ5 P;  3B8E B;  4MND A;  4OGQ C;  1SQQ E;  3L73 J;  1W2E A;  1KFN A;  4YXD C;  3AE1 C;  3H1J D;  4H0L C;  2MWQ A;  3LEO A;  1KNY A;  1CW5 A;  5AVT B;  4C3B A;  3NDB B;  3WUT A;  2B87 B;  3V2P A;  4NY3 A;  3EZH A;  2Y9Y A;  3SWY A;  5KYW B;  4D6T E;  3AEC C;  1BDJ B;  3CXH E;  3L71 G;  4O6M A;  5L0C A;  2R25 A;  4YT5 A;  2VH3 A;  4E7S A;  3BCC G;  2R44 A;  5H2F H;  1X8Y A;  3HE5 A;  2BC5 A;  3CAX A;  3MLG A;  4PJJ A;  1KB9 H;  1BGY E;  4DJG A;  1MFT A;  2JEE A;  2Y3G A;  4XQ1 A;  4D6T J;  1J1D B;  1X9V A;  2Z5I A;  4PJ0 E;  1V54 C;  3RVY A;  3I4U A;  2Y9Z A;  2HOD B;  1YJN P;  3M0A A;  2BCC G;  2DGJ A;  1VQO P;  5CCH A;  3EFO B;  5KYW A;  2L6G A;  3G50 A;  1SVF A;  1KFM A;  1SQX G;  4W80 A;  1GD2 E;  4K3A A;  1KYO D;  1K40 A;  3A3Y B;  1E86 A;  3JSE O;  1KB9 I;  2GDC A;  3L73 E;  3LAY A;  2TMV P;  1HW1 A;  1G5Z A;  3P8C E;  1NO4 A;  5AW1 B;  3D70 A;  1KIL A;  1KD1 Q;  4HE8 D;  2IPP A;  2W90 A;  3H2U A;  4DBR A;  3CWB E;  4XTK A;  2MHR A;  3MP7 B;  5EGY A;  4CS8 A;  3U5S A;  2JKV A;  1FOS F;  2OG2 A;  1NTZ J;  3L75 G;  3L0I A;  1K9M Q;  1YZA A;  3SXY A;  3H1H G;  5COF A;  2GA0 A;  3S29 A;  1IFM A;  2V26 A;  1AFO A;  3U2M A;  4DRJ B;  1DEE G;  1YLM A;  1Z5Z A;  2H88 C;  1YDI A;  4I1O B;  3VP9 A;  2EIJ C;  2OKU A;  4OD5 A;  3ZVR A;  2O01 N;  4D6T D;  2E74 C;  2KS1 B;  4ZKP A;  2XRH A;  1BGY J;  3E1R A;  3ZWI A;  2SPZ A;  2NZ2 A;  2WVN A;  3N24 A;  3UGO A;  2Y3H A;  3G4S P;  4MW8 A;  3ZTZ A;  3HD7 C;  3IPM O;  1J1E C;  3S27 A;  1Y47 A;  2Q7C A;  3AE9 C;  1D7M A;  3KYJ A;  3RKO F;  2VCB A;  1M1J B;  4TT3 H;  1Y6D A;  4MTF A;  1PGQ A;  2Y3D A;  2RH0 A;  4JW1 A;  4EKW A;  3KYQ A;  1T01 A;  1HBW A;  1FR0 A;  3H1I J;  2FGY A;  3JCU E;  3QW1 A;  2KYV A;  4CX9 A;  1LT9 A;  4MTO A;  1FBM A;  2YXQ B;  3FGA D;  1VLS A;  4EI2 A;  1BE3 G;  1RXQ A;  4XWJ A;  5L0J A;  5L3Q A;  3EH1 A;  5CBO A;  3DM9 B;  2K37 A;  4J32 B;  4O9B A;  1OMI A;  2Q9B A;  2A06 G;  1LTJ A;  1E85 A;  2N1T D;  2OYH C;  1OR2 A;  4CS7 A;  3HD7 D;  1YTZ I;  1VQK P;  4NPF X;  2AXT E;  5KJ7 A;  3USS A;  2OAR A;  1EZV G;  3VOP A;  2L7A A;  1VQ6 P;  4ZMD A;  1YYX A;  3HNJ A;  3QWO C;  1YYC A;  4N06 A;  1KQF B;  5K5G B;  1GL2 C;  3H1L E;  4DBQ A;  2W83 C;  2BCC D;  1M6T A;  4KNV A;  1N86 A;  3H1I G;  2QA4 P;  2NG1 A;  1PD1 A;  2MKV A;  2YKZ A;  5AW0 B;  2KC3 A;  1QGK B;  3MYF A;  3BRT B;  3CQZ A;  2P2U A;  2Y0D A;  2I8B A;  4PJN A;  3LLI A;  3RBZ A;  1LWU C;  1Q0F A;  5KAI H;  4C3E A;  2GFH A;  5A69 A;  3U1A A;  1D1C A;  3CCQ P;  3QH9 A;  1VQM P;  3AGU A;  1MQV A;  1NU1 E;  2Q9I A;  2BE5 F;  3CCU P;  1NJI Q;  4ULV A;  1E83 A;  2AWC A;  1S3J A;  3IHU A;  3KKB A;  1TKN A;  4RBN A;  1N8R Q;  1GL2 D;  1NTK E;  1IW7 F;  1NBB A;  1U6H A;  3EHM A;  2ZAE B;  1BE3 E;  3WUV A;  2YRF A;  2HJ3 A;  1PV3 A;  1MNE A;  1RHZ B;  4NC3 A;  2M3B A;  2Y0C A;  2LXC B;  3LS0 A;  5KYU B;  4R4M A;  1S9K E;  1IC2 A;  2N9B A;  3CCV P;  1S7Z A;  1UFB A;  2YL1 A;  3PCV A;  5BQI A;  1Z3I X;  3DMD A;  3HNK A;  2QJP B;  2G62 A;  1D1A A;  3CL3 D;  4IAQ A;  4EIJ A;  2JR8 A;  2YMK A;  4CJO A;  3S0X A;  4N6J A;  1TWG A;  1SQX J;  1AV1 A;  3AE4 C;  4WB4 A;  4ER9 A;  1FJP A;  4KI2 A;  2HR3 A;  3TUL A;  3JZ0 A;  1EDL A;  4AE4 A;  3U59 A;  4K1O A;  1L0L G;  3T9O A;  4GT1 A;  1OZH A;  3MD0 A;  1W2B O;  3S90 A;  2DB4 A;  4JJG A;  2EPM X;  4WY4 D;  2RD9 A;  2R7U A;  1KB9 D;  3B9Q A;  4H0L B;  1T3J A;  3C8G A;  1KQS O;  1OWA A;  2R5D A;  1WN0 A;  2Y69 C;  3DM5 A;  2KK7 A;  3AED C;  2AEJ A;  3AQB A;  4CJG A;  4I6M C;  2Q3T A;  1FDO A;  4IB4 A;  1FE6 A;  2OJE D;  3JT1 A;  2HPC B;  1EXJ A;  1KQG B;  4YL1 A;  3CCE P;  4IJJ A;  4ANJ A;  4QI2 A;  4D4X A;  1PL5 A;  1GK6 A;  2KLV A;  2HMQ A;  1Y4C A;  3GOD A;  3L8I A;  3H1K J;  2A1D D;  2A06 D;  4N4W A;  1KYO H;  1V74 B;  1NTK J;  3BCC J;  3G4Z A;  2B88 A;  1T2K D;  1G8X A;  1FAP B;  1QKR A;  3VN0 A;  2PF4 E;  3LUT B;  3GM2 A;  1T6A A;  3ZDM A;  1OVU A;  5APW A;  3H1K E;  2MJZ A;  2WTY A;  4HH2 A;  2BCC J;  3F47 A;  1K04 A;  3K1I A;  3WOD F;  4CDA A;  3B0U X;  1QL1 A;  4RD9 A;  5JT4 A;  4JTD B;  3M9B A;  1H9T A;  1JB0 J;  4CSA C;  1YQ4 C;  3JYH A;  1W2W A;  1L0L E;  3L4F A;  3ITK A;  1RE4 C;  1H88 A;  1LTB C;  4IRU A;  2IBF A;  3LIE A;  3L71 E;  1V55 C;  2O1J A;  2POH A;  1OW8 A;  1Q90 D;  4MVS A;  1NVO A;  1N1C A;  3ZSU A;  3B29 A;  2WT7 A;  1YBK A;  4QDL A;  3FXE A;  2WSF H;  1GGQ A;  3CMA P;  2IXN A;  3UMK A;  2Q6Q A;  3CME P;  4J7Y A;  1BE3 D;  4PV1 C;  3GMA A;  4JJF A;  3V4Q A;  3H32 A;  1NHL A;  2OOC A;  2ZVO B;  3H1H J;  1OW7 A;  3M4C A;  2ZYG A;  1GTW A;  3PLN A;  4JZA A;  4AX2 A;  2ZFC A;  1LTS C;  3S9O A;  1FTS A;  4EBB A;  5KJ7 C;  2PX0 A;  2QG4 A;  3AG3 C;  5CCH C;  2WSF J;  2Z5H A;  3AEF C;  3AG1 C;  2JP3 A;  4B86 A;  5KYN A;  1SYQ A;  3LNR A;  4BJ5 A;  1LT1 A;  1YJ9 P;  2ASR A;  3CI9 A;  5E3C A;  3GWL A;  1ZR4 A;  1RKE A;  3M4B A;  3LNM B;  3V7O A;  4BJ1 A;  3NYL A;  1RF0 C;  2O1K A;  2ETS A;  2FXO A;  1NTK G;  4O6N A;  2ZT9 D;  3JSV C;  1EDK A;  4W8P A;  4OIN F;  4EOT A;  2BL2 A;  3E1I A;  4ONS A;  1H0T A;  4KNW A;  3PRJ A;  1E79 H;  3SXZ A;  1O3U A;  2ZJS E;  1RJ9 B;  1GS9 A;  1CI6 A;  2P7V A;  1SQV E;  1WRG A;  4HFF B;  1MV8 A;  2GWW A;  2HS5 A;  1FAV A;  3RFY A;  3TK0 A;  2QJK B;  3KPH A;  4C7N B;  1JOC A;  3GEE A;  1KYO E;  1YI2 P;  2C9L Y;  4MTG A;  5AW7 B;  4M3L A;  1G1J A;  3T97 A;  1VB5 A;  2CNW D;  3K6B A;  2HLO A;  2NUT B;  1H6G A;  2CPB A;  3PJS K;  5DLJ A;  2H7O A;  4G78 A;  3HTK B;  3H1H E;  1L3P A;  3HUS C;  5DS5 A;  1A7E A;  3A5T A;  4CS8 C;  2IBZ D;  5L0D A;  1AQ5 A;  1LTI C;  3FOP A;  3PDM P;  2Y3B A;  5L0H A;  3TGU E;  1I4Y A;  2YNY A;  1GU4 A;  2Q9C A;  3TK1 A;  3ASN C;  1S1C X;  3L70 E;  1LM3 B;  2QJY B;  2IYP A;  4G7H F;  5TIS E;  3IF4 A;  1S2E A;  3EQ2 A;  3IAO A;  2N1T C;  2M64 A;  4E0H A;  2HYN A;  1OIP A;  2HUJ A;  3NRH A;  1QL2 A;  1YVI A;  3KL4 A;  1LT9 C;  2E87 A;  2FYU J;  4A7P A;  2H7B A;  3TJ6 A;  3NMK A;  1N73 C;  1PGP A;  3H1J E;  4PJL A;  1P84 D;  2QUP A;  2ZPA A;  3HTK C;  4RO0 A;  1M2V B;  2OYI A;  3BRV B;  1HE1 A;  4LDK A;  1HUC A;  4YTP C;  1EXI A;  3F46 A;  2R7W A;  1EKY A;  4C7O B;  2QIW A;  3VTP C;  1KTM A;  2O01 J;  3RK3 D;  1NU7 D;  2H7V C;  1QQ3 A;  2GUS A;  4I2L C;  2L9J A;  4U3F G;  1SQX K;  1IFN A;  3CC4 P;  5KKZ B;  3VMY A;  1QVG O;  3RQF A;  1VPC A;  1L0N J;  3AE6 C;  5BU5 A;  1JNM A;  4YPC A;  4BXL A;  1SQB D;  2NUP A;  1LPE A;  1U89 A;  4IAO A;  2KSE A;  3ZC4 A;  5AC5 A;  3BCC D;  3GF3 A;  5GTI H;  3LES A;  3HLZ A;  1I5N A;  4CPG A;  2I1J A;  3G9R A;  4N3Y B;  4C7N A;  3NMD A;  3L74 G;  1NU1 K;  1H9G A;  4Q5S F;  2YMY A;  1SQP K;  2P1A A;  1D1B A;  2DI3 A;  1QZX A;  4OIO F;  1NLX A;  1S9K D;  1JAF A;  2XXA A;  5EFW B;  3DAG A;  5KYU A;  3NYM A;  2KSF A;  1SQQ K;  5CHX A;  1VF5 B;  2WB7 A;  4W7Z A;  3MZW B;  5AVS B;  1WMK A;  3D6Z A;  4AUW A;  2ZXW C;  2V3C C;  3Q6M A;  1T5O A;  1ZW3 A;  2XL8 A;  1OCO C;  2GUV A;  2QLA A;  4H13 C;  1C02 A;  2JD3 A;  3EQL F;  1RF1 B;  3CC2 P;  2EIK C;  4JUR I;  2XKM A;  1EZV I;  1LWU A;  3QW0 A;  4GEH A;  3EFO A;  4LDQ A;  3WU2 H;  3VYI A;  4U5G A;  4PJM A;  3HKK A;  2QNL A;  1OR3 A;  4WWI A;  3TGU D;  3NMI A;  4LGD E;  3T4R A;  2OEV A;  4KBL A;  2PP4 A;  4H44 B;  3C8V A;  2HPC A;  2OCC C;  3K66 A;  2K3R A;  3NKE A;  4U9E A;  1NTM K;  1S4X A;  5KJ7 D;  2J9B A;  1FNT c;  2K9Y A;  3CXH H;  2YHS A;  1HJB A;  3V2R A;  1PPJ D;  4P9F A;  2RMZ A;  2NPS B;  3NG1 A;  3V5Z A;  3WG7 C;  3OW2 O;  1T8Z A;  2WZF A;  3U9J A;  1LE2 A;  3Q5R A;  4L76 A;  5M1B A;  4KJM A;  4FES A;  2Q1K A;  3AE7 C;  3OJA B;  4MS2 A;  1BDC A;  5KLV J;  2E74 D;  2KIK A;  3OWT A;  3EGX B;  2R7V A;  1CGM E;  2VCA A;  3BAS A;  3MGN A;  1N7S B;  2H89 C;  1Y9B A;  2OYI B;  3L75 E;  1KQL A;  2IXP A;  2A45 G;  2J9U A;  2IBZ I;  4NPD A;  3RQE A;  3S28 A;  3O6Q A;  4EBK A;  3H1K G;  1SQX D;  2IX7 C;  4NPE A;  1NTK D;  2A0B A;  3MFN A;  4IAR A;  1FMV A;  4EDF A;  3K5B A;  3S1K A;  1ZRT D;  4DZO A;  3LLK A;  2M5A A;  4XPW A;  1NZE A;  1IJD B;  2UWJ E;  4C3D A;  4QMA A;  1Q0M A;  4YK5 A;  1QSP A;  2WL8 A;  4PK4 A;  1FZA A;  1LTT C;  5AC4 A;  5AGF A;  2AXC A;  3JCU H;  5APU A;  3U2L A;  1J1E B;  1JTH B;  2VCC A;  1NTZ E;  4Z9I A;  1LTG C;  1ZLL A;  2ZXX A;  3A2A A;  4MVR A;  1EZV D;  1PIX A;  4PD4 D;  5AVX B;  1A02 F;  2M5A B;  4I1L A;  2FAP B;  4H13 D;  2BEQ D;  1GU5 A;  1SQX E;  2WPV B;  3NMJ A;  2W4B A;  4P6I C;  2R7O A;  2XLW A;  2KZJ A;  2XU6 A;  2QSI A;  3A0H E;  3BEH A;  2W6B A;  3O55 A;  2PBE A;  3FAP B;  4JF7 A;  1KOR A;  1BGY G;  1SP4 A;  1C03 A;  2PNO A;  1NWQ A;  1YTZ T;  3U1C A;  4JE9 A;  3HE4 B;  1HWT C;  1AVY A;  3PP5 A;  1T2K C;  2M4E A;  2JPU A;  4YT8 A;  1D0X A;  4G7O F;  3HTK A;  1OXZ A;  2NPU A;  5C39 A;  3Q7G A;  4CDV A;  4CSA A;  1GMJ A;  4LC1 A;  1CI6 B;  2E5Y A;  4CIH A;  1MKM A;  2XS1 A;  2FFD B;  1U0B B;  2A69 F;  2AVK A;  2J8W A;  2VC9 A;  4D4N A;  3S84 A;  5AVV B;  1NTM D;  5CCH D;  3FXD A;  1OQC A;  4MVU A;  5KLI B;  2HSQ A;  4Y28 J;  1KC8 Q;  1YA7 O;  1VQL P;  4OD4 A;  3M0D A;  5KKZ C;  1ZR2 A;  2R7T A;  3A0B H;  3FHD A;  4LER A;  3ABV C;  1ZZP A;  1SQQ J;  4IL6 H;  5KTB A;  4BJT A;  1S5L H;  3JC2 2;  2KJG A;  3TF5 A;  3L72 G;  1BR2 A;  3G4X A;  4EYY Q;  4PD4 E;  4YN0 B;  1TR2 A;  4NTA A;  1P84 H;  4JCZ A;  4H44 D;  4K0D A;  3GEH A;  4U5C E;  2HZ8 A;  3RK2 B;  3EG9 A;  1TU3 F;  2R7R A;  3RK3 E;  1LWU B;  1VQ7 P;  3EWK A;  1HGV A;  1LT9 B;  1SQB G;  2AWY A;  1KIL E;  5KLV G;  1L0N K;  5AW3 B;  4TLF A;  2D2C C;  1TQG A;  4PFO A;  3W8H A;  3L37 A;  3H32 B;  3C1L A;  2G3A A;  5IY5 C;  2KZI A;  2J59 M;  2J5U A;  3GOR A;  1FC2 C;  2JO1 A;  1OVV A;  2NSG A;  4IFM A;  1SZI A;  2W8Z A;  2A45 I;  4JEA A;  3RL0 B;  2HSB A;  2LFD A;  3AGT A;  4Q4Z F;  1R5S A;  4I44 A;  4IL6 E;  1NU1 D;  3C63 A;  1LI7 A;  1NTZ D;  3B5N A;  3SXK A;  3U3F A;  4PD4 H;  3CWB D;  4R4L A;  1BDD A;  1JUN A;  2OYH B;  5DQT A;  2FYN C;  1MMN A;  1R5L A;  3E70 C;  3LW5 J;  2C03 A;  3TGU G;  3KZI E;  1NU9 C;  1NAF A;  2R3S A;  3DZA A;  1BSH A;  3LS1 A;  1ZV8 A;  1CPQ A;  3AJM A;  2YVK A;  1YAU O;  5E79 E;  3LID A;  4OIQ F;  1VTM P;  4ZLD A;  1Q82 Q;  2FYN B;  3TOM A;  2OQQ A;  3AEB C;  1G1I A;  1TFK B;  5CJ4 A;  2Q4F A;  5CI8 A;  3II6 A;  4E7Z A;  2WZL A;  3H1I E;  3QZC A;  3TYY A;  2N1T A;  4K7B A;  4J30 B;  2EIL C;  3ABL C;  4BEM J;  2GA1 A;  1EI7 A;  3ASO C;  3HUS A;  3VRC A;  1MZ9 A;  3AG2 C;  3SNH A;  4OH8 B;  3ABM C;  3BCC E;  1L0L D;  2I8D A;  1MND A;  3TGU J;  1ORJ A;  4R32 A;  3K1H A;  3IFM A;  3L70 G;  3LEV A;  2FKW B;  3SFE C;  3DE9 A;  4BJ6 C;  3CXH D;  5APX A;  5A6K A;  3F5H A;  1NGM B;  1H89 A;  2PAJ A;  5DS4 A;  2R7S A;  4PD4 I;  1NKN A;  1M2O A;  3TJ5 A;  4OIR F;  1AQT A;  2KS1 A;  1L4A B;  2L81 A;  2HG5 D;  1DIP A;  5K0I A;  3MIW A;  1HMD A;  1SFC C;  1GDT A;  2J0W A;  1WWP A;  2QTV A;  3J06 A;  1FZC A;  1PP9 G;  2WIT A;  5AVR B;  2NUT A;  3W8I A;  3GF7 A;  1OCC C;  2I1K A;  1TWC A;  5FZT A;  3L34 A;  1RF1 A;  2FYU D;  2XLE A;  1J8Y F;  1RY3 A;  2KYH A;  3L35 A;  1Z6A A;  5DQZ A;  3BAT A;  4FAP B;  3GEI A;  2GAQ A;  3CC7 P;  5TJ5 E;  2VAS A;  2QE9 A;  2H8P D;  3T6B A;  1ZW2 A;  2H7H A;  3L74 E;  2OU6 A;  3H6P A;  4FWV A;  1M57 D;  1RH5 B;  2YLD A;  2WZG A;  3I56 P;  3AE2 C;  1DOW A;  5CIV A;  2ZXP A;  4JRZ A;  4L73 A;  3GG2 A;  1EDI A;  1PP9 J;  1OX3 A;  3IR9 A;  1M1K Q;  1ZHT A;  2B9B A;  1WGW A;  5T3T A;  4KHX A;  1M2V A;  2OTJ P;  2W6A A;  3L1M A;  1FS0 E;  3I5C A;  1BCC G;  3DXJ F;  1BGY D;  3FWL A;  5APY A;  2NPS C;  3AOU A;  3AE3 C;  5DJT B;  4JVS A;  2FYU E;  4XLN F;  1NFO A;  2J7P D;  3M91 A;  4IGG A;  1FZC B;  4ZKU A;  4ZLC A;  3RGU A;  4P9T A;  2OJQ A;  2OQM A;  4OGQ D;  1L2P A;  3ZDL A;  2Q00 A;  1USE A;  2K1A A;  2Z4E A;  2IBZ E;  3MTU E;  2WWW A;  3OA7 A;  2EIN C;  1QLE C;  4DOZ A;  2A45 H;  3OA1 A;  1RQU A;  1DX7 A;  4JEB A;  3ATP A;  1AUE A;  2VB6 A;  5BQH A;  1MFZ A;  3VAY A;  5T3W A;  2N9Y B;  1NTK K;  3EHN A;  2LQG A;  1AJY A;  3MUD A;  2ZYD A;  2W4M A;  1Q81 Q;  2ZYA A;  1LI5 A;  3C8Z A;  4DVY P;  3WMM 0;  1ZOY C;  3TDK A;  1VLT A;  2Q5U A;  2IM8 A;  1SQQ D;  4IFF A;  3GAN A;  1URQ B;  1NTZ G;  1RKC A;  4LDR A;  2PGD A;  3C8G D;  3IQ6 A;  1X0T A;  4OVN F;  3CEX A;  1O5H A;  1GQA A;  1YIT P;  1BR1 A;  1VMA A;  5COG A;  2J46 A;  3T6J A;  3RK2 C;  4MQ9 F;  1NFN A;  2E75 B;  3W2W A;  1EQ1 A;  5E3A A;  3POV A;  3M9Q A;  3RIP A;  1J8M F;  1SFC D;  5JS5 A;  4H0L D;  1LNQ A;  2XM0 A;  3KDP B;  2MYS A;  3GM1 A;  4I1M A;  2IBZ G;  2HJM A;  2Q3I A;  1N2D C;  1RJ9 A;  1YZC A;  2JDI H;  1HH0 A;  1L0N D;  1RE3 C;  2YEV A;  1U57 A;  1VQP P;  3RL0 g;  1L4A D;  4YT4 A;  1U7J A;  1KYO I;  2PP6 A;  3O6Q B;  2QEX P;  1QPU A;  4L6R A;  3EPV A;  1GZL A;  1KMI Z;  1GK4 A;  3DE8 A;  4JBZ A;  2QE7 H;  1JPN A;  2E43 A;  3L74 J;  2WVR A;  5DJU B;  3RW0 A;  4Z9H A;  2QY9 A;  1M57 C;  3FX0 A;  5JVE A;  3H2V A;  2D2C B;  2X51 A;  3RK3 B;  1CSB A;  3M06 A;  3M0D C;  1DH3 A;  1HTL C;  3CX5 E;  3L71 J;  2J7P A;  4XA4 A;  3EH2 A;  3HE4 A;  1M56 C;  4EWC A;  1OVR A;  1P84 E;  4XPX A;  4RDA A;  2EPL X;  5DVW A;  2OYH A;  1SQV J;  3U9M A;  3GLM A;  3VMZ A;  4JYC A;  2PRR A;  1S05 A;  4WGY A;  2BAS A;  4XEV A;  1G2C B;  1K73 Q;  4EIY A;  4GKG A;  1MUU A;  2KI7 B;  4ZNC A;  2LKM A;  2QJK C;  3CCJ P;  2YKO A;  3IN6 A;  2R3C A;  2FYZ A;  3HD7 A;  2C9N Y;  3DJN B;  1SQP E;  4U3F D;  2WPS A;  4GOD A;  1E84 A;  4FX5 A;  2WMM A;  2G8Y A;  3M15 A;  1T3U A;  1NTM J;  1URQ C;  3MHV A;  1TFO B;  2DYR C;  3I55 P;  1U7M A;  2L5G B;  2WSC H;  4DCK A;  5L0F A;  1JEK A;  1WT6 A;  3N4X A;  3V5Y A;  5D91 A;  4UB8 E;  3L74 D;  2XM4 A;  3A11 A;  5B5E E;  1G4U S;  2K9J A;  3M1C B;  3ITF A;  4Q7C A;  2K88 A;  2BCC E;  3CD6 P;  2LFF A;  1EDJ A;  3SWF A;  3HUS B;  5CI9 A;  4I7Z B;  3Q3D A;  2PX3 A;  2XLD A;  4H54 A;  1CPR A;  3G71 P;  3C8G B;  4UB6 H;  3MBG A;  1FFT C;  4NCQ A;  4NTB A;  4IWB A;  1H8A A;  4JYB A;  5KYX B;  2R02 A;  2P0N A;  2YL0 A;  1VQ9 P;  1IFI A;  1D0Z A;  4GDO A;  2Q3E A;  3R4Y A;  1VQN P;  4XE5 B;  1LKX A;  4PFP A;  4MVQ A;  1IK7 A;  1N7S D;  2J9V A;  1T6I A;  3FOO A;  3KMI A;  1ZRT E;  2UUI A;  1SQP J;  3SYN A;  1PZQ A;  2E5T A;  1KB9 E;  4F4B A;  1NU1 J;  4UB8 H;  1M1J C;  3CSK A;  1Z56 A;  3EGX A;  4BJ6 A;  3K33 A;  2NUP B;  3VF0 A;  3UMI A;  1DOV A;  2A0U A;  4JCH A;  4BEJ A;  4DRI B;  2IXO A;  4I7Z C;  2KP8 A;  2L6H A;  1HW2 A;  1YA9 A;  2YIU C;  1PPJ G;  3Q5P A;  2WSE J;  3FDQ A;  4UDV A;  2KOG A;  3NKD A;  1SFC A;  1PCX A;  4JKV A;  1BSN A;  1B68 A;  4BRY B;  2NSF A;  4CDY A;  2JX0 A;  4WVZ A;  3H65 A;  3HNI A;  4MVZ A;  3V4W A;  2LXB A;  1VQ8 P;  4RES B;  5AVY B;  1SQP G;  1HVV A;  3TNU B;  5B66 H;  2DYS C;  3T6G B;  3AQC A;  2FY8 A;  2IZ0 A;  1RQV A;  3NTN A;  2KK1 A;  3UGP A;  2W9Y A;  5APT A;  1FZE A;  4JPZ B;  1CGN A;  1JR8 A;  4W8K A;  3RH3 A;  3L36 A;  4YL0 A;  1EZV E;  1IFD A;  2H43 A;  2RN0 A;  1FZG A;  1FDM A;  2P1J A;  1BE3 J;  2LP4 A;  4BG0 A;  2XZR A;  1L0N E;  1FZC C;  1NKZ B;  1NSG B;  1L7C A;  3V6I A;  2IDB A;  1AVO B;  2CDQ A;  3FAJ A;  3K1I C;  3X2Q C;  2YKP A;  5GTH E;  2RSE B;  1M90 Q;  2XSE A;  5AW9 B;  3GM3 A;  2B0J A;  2Z15 A;  3R7C A;  1S5L E;  1M8O B;  2FBW C;  1L4A C;  3UIA A;  1WTY A;  1G4W R;  1OXK A;  1E5W A;  1RF1 C;  5B66 E;  1LE4 A;  3KHU A;  2XLH A;  1Q0K A;  3WUU A;  4A2N B;  3AEA C;  5L8R J;  1HF9 A;  1QVX A;  2NPS A;  4C7O A;  4MW3 A;  2LK4 A;  4N6H A;  2OGU A;  1FZB A;  4U9D A;  3QVY A;  1ZP0 C;  3OAK A;  1NU1 G;  3GW6 A;  1R4T A;  1E2X A;  3QMK A;  3RK2 D;  4UB6 E;  1X22 A;  3B5N B;  5GTI E;  1ORS C;  1GM5 A;  1BCC E;  2BEZ F;  1C17 M;  3P32 A;  5AW8 B;  3W67 A;  2GM4 A;  3IQC A;  2D5R B;  1W5C E;  3L73 D;  2IFM A;  1DD4 A;  4EHP A;  4C7R A;  2J58 A;  2EPK X; 
#chains in the Genus database with same CATH homology
 2D2C B;  4R4M A;  2ZT9 B;  3D6Y A;  1UFB A;  1GMJ A;  2E74 B;  4OGQ D;  1MKM A;  2NZ2 A;  1K05 A;  1S1C X;  1ZME C;  1UIX A;  2Q00 A;  3K7D A;  2K9Y A;  4OGQ C;  3IAO A;  4U7J A;  1V4A A;  4H0L C;  4YXD C;  4I7Z C;  3AE1 C;  2L6H A;  4R32 A;  2YMK A;  2YIU C;  3AE4 C;  4PV1 C;  1KNY A;  3AE9 C;  1WOL A;  3GMA A;  3SFE C;  3Q5P A;  4Y28 J;  2WSE J;  4TT3 H;  5KKZ C;  3Q1M A;  1RQU A;  1OW7 A;  3AEG C;  1NGM B;  3ABV C;  3GLM A;  1ZZP A;  3T97 B;  3AEC C;  3Q5S A;  2JX0 A;  3TUL A;  3U0C A;  3Q5R A;  3AE8 C;  3JZ0 A;  3S9O A;  5M1B A;  3C18 A;  1AJY A;  3JYY A;  4XEV A;  2QJY C;  3AE7 C;  4YTP C;  1EXI A;  2WSF J;  2D2C D;  4H44 D;  1DIP A;  1ZOY C;  2QJK C;  2QIW A;  3AEF C;  2E74 D;  3FGA D;  1KTM A;  2E76 B;  2JP3 A;  1RQV A;  2KK1 A;  2O01 J;  4PV1 B;  3IN6 A;  1WWP A;  3Q2Y A;  2H89 C;  1TU3 F;  1NYH A;  4H44 C;  3SFD C;  1Y9B A;  4H0L B;  1FDI A;  3RK3 E;  1OMI A;  3C8G A;  2QJP C;  3RQF A;  3RQE A;  3EWK A;  3GF7 A;  3AE6 C;  3C8G D;  3AED C;  3O6Q A;  1KIL E;  2G8Y A;  1FDO A;  1JOG A;  4XEK A;  4EBK A;  1HJ0 A;  2L6G A;  3MFN A;  2D2C C;  2E75 D;  3GF3 A;  2G3A A;  2P10 A;  2ZT9 D;  1R8E A;  1S5L X;  2J5U A;  4IL6 X;  1KQG B;  1EXJ A;  2IDB A;  2JO1 A;  4Z1M H;  3G9R A;  1PL5 A;  2ZT9 C;  1K40 A;  4XFJ A;  2FXP A;  2E75 B;  2HSB A;  1KQF B;  1O3U A;  3GM3 A;  3L8I A;  3D71 A;  1YQ3 C;  3RQG A;  3H25 A;  1WTY A;  2FBW C;  2E76 D;  2V7Q J;  3U3F A;  3B71 A;  2MKV A;  4R4L A;  4H13 B;  3AE2 C;  3AEE C;  4H0L D;  5F28 E;  2E75 C;  3GM2 A;  3AEA C;  3D70 A;  5L8R J;  1VF5 B;  4I7Z B;  2WQY C;  2FYN C;  3D6Z A;  1WMK A;  3AE5 C;  3Q3D A;  1HF9 A;  3LW5 J;  1QVX A;  1VL2 A;  3BRJ A;  3C8G B;  1PIX A;  2L6F A;  4XEF A;  5KLI C;  2LK4 A;  4H13 D;  1DD3 A;  2BEQ D;  1K04 A;  1U57 A;  1ZP0 C;  1VF5 C;  3AJM A;  2WSC J;  2E76 C;  3RL0 g;  2WPV B;  2YWA A;  4GDO A;  3R4Y A;  4RKU J;  4H13 C;  4PV1 D;  4KT0 J;  2QSI A;  3L8J A;  1KMI Z;  2PBE A;  1JB0 J;  1IK7 A;  1KOR A;  1YQ4 C;  2OQQ A;  3AEB C;  3AE3 C;  2BEZ F;  1ZRT E;  2H88 C;  4EBJ A;  3GM1 A;  4OGQ B;  2JPU A;  1DD4 A;  1OW6 A;  1PV3 A;  4H44 B;  1VF5 D;  1OW8 A;  3C8V A;  4NQF A;  1Q90 D;  2E74 C;  3O10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...