1KTMA

Solution structure of fat domain of focal adhesion kinase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
139
structure length
139
Chain Sequence
MANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDESLPVLPASTHREIEMAQKLLNSDLAELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMISQSRPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FOCAL ADHESION KINASE 1
publication title Structural Insight into the Mechanisms of Targeting and Signaling of Focal Adhesion Kinase
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 53
structure length 139
sequence length 139
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2002-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ktmA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1ktmA02
2L6HA 5F28E 4NQFA 1OW8A 3AE2C 3RQFA 4YTPC 3AEBC 2H89C 4XEVA 1ZOYC 3AE7C 1WTYA 1WOLA 3AEFC 3AE6C 1K05A 3AEAC 3L8JA 3K7DA 3C8GD 4R32A 2HSBA 2JX0A 3AE5C 1KNYA 2JPUA 1PV3A 1OW6A 1JOGA 3AJMA 2L6FA 1ZZPA 3AE9C 3S9OA 1OW7A 3C8GA 3C8GB 1K40A 3L8IA 3AECC 3SFDC 4XEFA 1KTMA 2FBWC 1WWPA 3MFNA 3AEDC 1ZP0C 2Q00A 1QVXA 3GM2A 2G3AA 1O3UA 3B71A 3C18A 3SFEC 4YXDC 3JZ0A 3U3FA 3RQEA 3GM1A 3JYYA 3ABVC 4EBKA 3AEGC 4EBJA 3GM3A 1YQ4C 2WQYC 1K04A 3U0CA 3AE8C 3AE4C 1UFBA 3TULA 2H88C 2L6GA 4XEKA 2YWAA 3AE1C 2LK4A 3AE3C 3RQGA 1YQ3C 1V4AA 3O10A 3BRJA 3AEEC 2KK1A 2PBEA
chains in the Genus database with same CATH superfamily
1VQKP 2PGDA 3GG2A 1KZUB 1Z3IX 1HGVA 4WVZA 3ZDLA 3W8IA 1YTZT 1TWCA 1I4YA 4R4LA 1OVVA 1OFCX 2OTKE 1SQXD 1DEBA 3W2VA 1Q81Q 5EHHA 4U9EA 4H44C 1JR8A 2R7TA 3AEAC 3HTKC 2W9YA 4MW3A 2E87A 2V3CC 2P61A 2Q7CA 3N7NA 2R5DA 1QQ3A 2M3EA 5CMZA 2JX0A 4Z9JA 1R5LA 1IZNB 3LLKA 3N2ZB 4ASWA 2YEVA 3JCUQ 3L74G 1QEXA 1OXBA 2IDBA 2C03A 1HMOA 3MLGA 4JKVA 2Q9CA 1Z56A 1VF5B 4YT2A 3D6ZA 2OGUA 1RE4C 1VQ6P 1KYOD 2QJKC 2Y9YA 2N9YB 1VMAA 1V74B 1LTJC 3HE5A 2KB7P 1H9TA 2H8AA 1S5LE 1M2VA 4IAOA 2QJYC 1D0XA 4Q5SF 1FZBA 2IOQA 5CJ4A 3EQLF 1SVFA 4I7ZC 3VP9A 2HZ8A 3RKOF 2AU5A 2A06D 4MVOA 1FE6A 2J5UA 3BCCJ 4DVYP 3H1IE 3ZIBA 5APVA 2Q00A 3ZWIA 1NLXA 1NKZB 3SXYA 1T6UA 2YHSA 1LWUB 1D7MA 4ZNCA 2HYNA 4AK9A 2WPQA 4GKGA 5B66H 2CPSA 3EZHA 1BCCJ 3SFEC 5KYUA 1M56C 4ASVA 1AQ5A 2FGYA 2VB6A 3ZQVA 2FY8A 5JUAA 4Z9IA 1L4AD 4EBJA 1LNQA 4RD9A 2QJPB 3MD0A 4J7YA 1SQBE 3BCCE 1HW1A 2BCCE 1ZHXA 5AVQB 1XTCC 1D1CA 2WB7A 1E5WA 4O6NA 1URQC 1D1BA 2V7QJ 1NO4A 3RBXA 3D6YA 1GL2A 1KFMA 2ZT9C 3C63A 1OX3A 5TJ5E 4C7RA 5DQTA 2A45I 2N1TC 3FHDA 1HBWA 4DXWA 1KORA 2H7VC 1W2EA 1FAPB 5E2QA 3OEOA 1BDDA 1RF1A 3CX5H 1VQ4P 1XWJA 1OCRC 2WVNA 3QW1A 1IC2A 2KNCB 3HUSC 2WSFH 1GS9A 1FR0A 3NFQA 1OMIA 2MKVA 2KSEA 3AE6C 3HE5B 4C7NB 1NTMJ 3GF3A 2Q3IA 4PFPA 1QVFO 3RK2B 2CGEA 5JSLA 2JO1A 4GOEA 4IGGA 5KJ7A 3MUDC 1YJWP 2L6FA 4GQHA 3RVYA 5BQHA 3DKAA 2ITAA 1IFIA 2KW3C 1OW7A 4CDYA 3V5ZA 5DLJA 1OXKA 3W67A 4O6YA 2W83C 2EPKX 4PD4H 4RJTA 3D70A 2R25A 4LLHA 2A0UA 4B6IA 1JMBA 2NPSD 4H4KC 2YIUC 1VB5A 3USSA 1V55C 4RKUJ 4A4AA 1WASA 3L1MA 2FKWB 2J0WA 1FTSA 1MUUA 1NVOA 3CQZA 2HJMA 3L70J 5GTIH 5AVWB 1NJIQ 1HF9A 3AG3C 3MX3A 5AW3B 5KAFH 2MWQA 3H6PA 4MW8A 2QE7H 4OGQC 1KILE 3ABKC 4C46A 5KLVG 1P84E 2I1KA 2FXPA 1NFNA 4H44D 5DQZA 2ZXXA 1MMAA 2H7OA 4JPZB 1K04A 1YITP 2H8PD 1BE3D 3SXMA 1KQSO 3L70E 4EIYA 3ZQYA 3H1HD 5GTHH 4MVRA 2LK4A 4BJ6A 3CXHE 2XNDH 4IARA 2R44A 1V4AA 1NTZG 2ZJSE 3L74J 4JBZA 2FYUD 1N7LA 1E2XA 3I55P 4KBLA 3NKEA 2KK1A 1IK9A 4E17A 2KP8A 1MMDA 3NYJA 4DRJB 4QI2A 4XLNF 4NTAA 3H1KJ 1G1JA 3L75D 2TMVP 3HD7C 1DD4A 3SEOA 3CEXA 3CCJP 3TOMA 2YL0A 2QM8A 2J59M 2Y0EA 5KAIE 3FOPA 1L4AA 2A6HF 4R4MA 4NCQA 2KLUA 3GEIA 2R3SA 4MTOA 1Q0KA 2ZYAA 3VMZA 3Q7GA 1JB0J 4N4WA 1KNYA 3L74E 2JPUA 2B87B 4U3FD 4BG0A 3A11A 4LDQA 1OW6A 4DCKA 3NMJA 4WGZA 4YT4A 4DJ9A 1E83A 1OKKD 1RXQA 2R5BA 1APCA 3GWLA 1SQVD 3NG1A 5B5EE 3DMDA 3HNJA 3RH3A 4KC9A 2X0CA 3VP8A 2J58A 5AW4B 1OR3A 1JUNA 1H6GA 4L6RA 2WZ7A 2CW0F 5GPGB 2R05A 4U5DE 1SQQK 1FZAA 3PHLA 3Q1MA 3MGNA 2DYSC 2J0XA 2KYHA 3MBGA 4JE9A 2NUTA 1ZN5A 3BVHA 2OYHB 2PFXA 1ZHTA 4N06A 2FBWC 3VTPC 1OWAA 1URQD 4U5FE 2O01H 3U5SA 2KGOA 1RF0A 1YA9A 4ULWA 5JRAA 3S0XA 4YN0B 3CCVP 3L73J 3U3BA 3IEEA 4D6TJ 4WGYA 2N1TD 5AW1B 2IYPA 1X9VA 1QVGO 1L0LK 1MFTA 1O3UA 2PP6A 4L76A 1O87A 1YTZI 3A0BH 3O6XA 3FOOA 1YI2P 3L71D 3AOUA 2Q3EA 1NTKD 3U1CA 3WU2E 3JYYA 2WSSH 4EBKA 1SQPD 5TISE 4HB1A 1U89A 3SXKA 3CWBD 5AGFA 1FMVA 2G8YA 1E79H 1JMMA 1PPJG 4XTKA 4IL6H 3LW5J 3MIWA 3TNUA 3IQTA 1T2KC 1DOWA 1Q0MA 2A6EF 3EHMA 4ER9A 1FAVA 3UIAA 2OJQA 1X0TA 2OEVA 3LJBA 2OCCC 3WAQA 3NXSA 2DI3A 4OIRF 3VYIA 1FBMA 3PRJA 3U8VA 2H43A 3F46A 1R4TA 2OEXA 1KYOI 4IWBA 2AWYA 1GU5A 1EKYA 1Y47A 4AE4A 2J46A 1DH3A 1PGOA 1T9KA 1S4XA 1GK6A 3QMKA 2XM4A 1ZU4A 4BXLA 2V26A 1G5ZA 1K05A 3L8JA 1ZHZA 3HTKA 3JRTA 2KC3A 1ZMEC 4PK4A 3C8GD 4W80A 1Y9BA 4OH8B 2Z5HA 1NU1K 1XTGB 5CBOA 4JTCB 3KQGA 2Y3DA 3T97A 3C62A 3F89A 3BRTB 1FS0E 4LLEA 1T5OA 4CIPA 4G7HF 1ZW3A 4OGQD 1LI7A 1RE4A 3IQ5A 1LTJA 3S90A 3U1AA 1HTLC 3KYQA 2M5AA 2IYLD 4RDAA 3UMHA 1MZ9A 2Z15A 3FXEA 2E76C 4HFFB 5KJ7C 1MNEA 1T01A 2IBZG 4EOTA 4K0DA 1RH5B 4OD5A 1USEA 3G4XA 3GEEA 3EFFK 2NPSB 2KSFA 1H8AA 1FZCA 3LEVA 1K9MQ 4JW1A 1SQQJ 5B3SC 2XXAB 1SP4A 2PF4E 2QE9A 2WSEJ 1EQ1A 3HD7D 5KLVE 3V5YA 2JEEA 5KYXA 4UB6H 4EIJA 4Y99B 1QPUA 5M1BA 1JCDA 5E3AA 1JPNA 1HUCA 1IFDA 2BEQD 3U9MA 1S5LH 1N73A 1RKCA 4N6CA 1HH0A 2WQYC 4TLFA 3UMIA 4AE4B 1L0LJ 2AXTE 1URQA 1NTZE 1ZLLA 1FC2C 1VQNP 2WWWA 1N8RQ 4MQ9F 2K88A 3WUVA 2VC9A 3JYHA 1VOMA 2N1TA 2VRSA 1PP9J 3CCLP 2HODA 1VQ8P 2HKVA 1L0ND 2GDCA 2XL4A 5F28E 2HPCA 3T97B 3LIEA 3VMYA 2WTYA 3NDBB 1AJYA 3EGXB 2ZFCA 1JTHA 2E74B 1AVOB 3L0IA 5E79H 2H89C 4CX9A 1UG7A 3TYYA 2QJKB 3HUSA 2HR3A 2KSJA 1LTJB 2A69F 4BJ6C 3M1CB 1S72P 3OA7A 4WY4C 4E7SA 2M0BA 1PV3A 1KILC 2QJYB 4BJ1A 4I3MA 3MUDA 3HNKA 5DS6A 3Q3DA 1BCCG 1FZEA 2CK3H 1VTMP 2HFED 2WVOA 4ZMDA 3F47A 1FDIA 4K1OA 1X22A 2O01J 4HJGH 4NPEA 3S4RA 4I44A 1OZHA 2KJGA 3TF5A 5JT4A 4LACB 3PHF2 3RL0C 3Q6MA 2WSCJ 1TWHA 2WPSA 5KYXB 4CBEA 3VOPA 1T2KD 4ONSA 4PFOA 4YK5A 1IFMA 3H1JJ 1GGQA 4NC3A 3Q5SA 2P0NA 2QY9A 2XL6A 3D71A 2Q9IA 1NG1A 4IRUA 1G4US 4QMAA 2E5YA 2IFMA 3H32A 3K33A 2ZT9B 3H1ID 2XLOA 3QWOC 2AWCA 4YL3A 1H7IA 1ZXGA 3A2AA 4BEJA 1RF0C 3E1IA 4E7ZA 3GM3A 1PPJE 1JCCA 1YQ4C 4ZLCA 3CCRP 1KYOH 4MS2A 3E1RA 2W6AA 4LGDE 2K1AA 1Q0GA 2EIMC 3FXDA 4ZKPA 2L7AA 4PACA 2AEJA 1DD3A 5CIVA 3V4WA 3HUSB 3T9OA 3CCMP 3RIPA 1SQBD 3BCCD 2M64A 2BCCD 5CCHC 2M3BA 5AW9B 4JIOA 3U2LA 1YJGA 1Q90D 3K1HA 2V4HA 3I56P 2VCAA 3NMIA 2QIWA 2ZVNB 1ZW0A 3CCSP 3CCEP 3JC22 4PJJA 4LLCA 2POHA 3QVZA 1GTWA 4YTPC 1P84H 2CPBA 1JM0A 2E76D 2C0XA 2JR8A 2EIKC 4IJJA 1MNDA 4U9DA 2L81A 1R5ID 2XDJA 3VMXA 5AC5A 5KYWA 1SQXK 3A3YB 1VYKA 1BGYJ 2NUPB 2OJED 1QGKB 4CS9A 5B1AC 5DJTB 1YHQP 1LT9C 2XU6A 2DB4A 3CXHH 3QVYA 3VM6A 2Y3GA 3S9OA 3NKDA 1UIIA 3JCUE 1H9GA 1ZHYA 3G3ZA 3U8PA 3SXZA 1PD1A 3MYFA 3C8GB 4PR9A 3QTHA 1BR2A 1EZVG 1OXZA 2WPVB 2OYIC 3M0DC 1A7VA 5KTBA 3H32B 2OKUA 1CGME 2IBZE 3N4XA 1YYJA 3TGUJ 1OCCC 3GORA 1ZR4A 1LKXA 1PL5A 3M9QA 1NTMD 2LSEA 3AG1C 3CLQA 3ZG1A 1R5SA 3B5NA 3DI5A 3H1KG 2E43A 2HFIA 1Q0FA 3I5CA 4HKZH 2E75B 4L75A 3HKKA 2KI7B 1JPJA 2J45A 2YMYA 5DS5A 4YPCA 4C7OB 2XKMA 2P6VA 3W68A 1FDMA 3U3FA 2XS1A 2Y39A 1CSBA 2XRHA 3O55A 2YL7A 1N7SB 2K9JB 3T4RA 4W8PA 2ZPAA 3HE4B 1Z7Qc 5BUOA 4WABA 3I4UA 4WY4D 1FDOA 2W6BA 3HD7B 2XLVA 1KILD 1VQ9P 1LS4A 5KKZC 1FZCC 1P84D 3KZIE 3OJAB 1YA7O 3KYIA 4X0RA 3I5QA 4L74A 4YXWH 1HGZA 3RF3A 1CW5A 3L70D 3WHNA 2HMQA 2IX7C 3U9JA 1N73C 2YLGA 3CXHD 3RL0D 3WU2H 5JS5A 1DIPA 1JOCA 3L72J 2EPNA 2UUHA 5A6BA 1LP1A 1A7DA 4XWJA 3S27A 2CNWD 2P67A 4UDVA 5CI8A 2G3KA 3L73G 2WPRA 4D6TG 2VCBA 5BQGA 4JYBA 4H13C 2D2CC 5BU5A 3X2QC 4EWCA 2AP3A 2HSBA 1BCCE 3B0UX 1JOGA 4EHPA 4JC7A 3H1LJ 5APQA 5BVZA 5T3WA 2GAQA 2XS8A 1NH4A 3FGAD 5APSA 4DZOA 1TU3F 2SPZA 4PJMA 3H25A 3L74D 3M91A 1KN7A 3GHGC 5KLIB 1YAUO 5DVWA 4DRIB 1PGPA 3WG7C 4WWIA 4O79A 2QG4A 2R7WA 1SQXJ 1HJBA 256BA 4ZLDA 2PFDA 2R7VA 3TJ5A 1M2VB 1K8AQ 2O1KA 5C39A 4LDKA 1VYIA 2VCCA 3BATA 1SYQA 1AQTA 3S84A 1DEEG 1OIPA 1ZRTE 2JD3A 1A41A 2YKOA 2Y0DA 5CCHD 1VQPP 4JEBA 1M1JC 2R7SA 4NTFA 1RJ9A 2GA0A 3B71A 1YARO 1Q2NA 1QX8A 1NGMB 3KPEA 5JP7A 4HEAJ 1Q7YQ 2I8DA 1RE3C 1NTME 3M15A 5KYUB 2ZVOB 3GF7A 4PJ0E 1EXIA 2HMZA 3MZWB 1VL2A 3K1IC 1NAYA 3RBZA 3QH9A 3L35A 1PD0A 3O39A 3LS1A 5JLIA 3U0CA 2HG5D 1LVKA 3H65A 1AV1A 2B89A 3DZAA 1YZAA 4MVMA 2E42A 1LP1B 4OIOF 1GL2B 3IQCA 1KB9E 4YL0A 2VH3A 1IFJA 3CPWO 4MTGA 1ST6A 1VDFA 5EGYA 2QNLA 2PP4A 2A1DD 4DBRA 2OYOA 2IXOA 1RF1B 3MYIA 1FFTC 2MJZA 2XLMA 3UNGC 4P9TA 3L37A 2OOCA 2Q9BA 3VRCA 1H89A 2FFHA 2AXTH 4WY4A 1SQQG 3PJSK 1J1DB 2R02A 1KILA 2DYRC 4MVSA 3LESA 1IZMA 5CCGC 3SWKA 5BQIA 5COGA 3G6EP 1AA0A 1EZVE 2CDQA 1K40A 5COFA 2NSFA 3HLZA 3R4YA 1SQVK 3DE8A 1JAFA 1GMJA 1L0LG 4GYTA 5EK0A 3PH0A 4CS9C 3NTNA 3E7KA 3DE9A 4KNWA 2R03A 1Y6DA 1L3PA 2CNWA 5HSWA 3J06A 1E85A 2KUBA 4YL1A 2G62A 5JVEA 1PP9G 3H1KE 1TFKB 2WITA 4U5HA 1M8OB 1E84A 3RK3E 2G3AA 3NMDA 3U2MA 3WMM0 4XFJA 4JCHA 2WL8A 3L34A 4BJ5A 2QEXP 1AFOA 2M4EA 3Q7LA 1NSGB 1FZFA 2PX0A 3NRHA 3JT1A 3B4SA 3WODF 3M0AA 1T3JA 1SMYF 3SWFA 3OWTA 3RQEA 1GK4A 1LTBC 4XLPF 1VQ5P 3AEGC 3P8CE 3KPHA 1VQMP 3IQ6A 2B0HA 1M7LA 4H13D 2D2CD 2R7UA 3H2UA 1MV8A 5KLVD 1SZIA 1NTKK 4Y28J 3W4YA 1LTGC 3TULA 1SQPK 4BRYA 1YIJP 5A69A 4EI2A 3B5NC 3B8EB 1YLMA 4J30B 3Q5PA 2YZSA 1S7ZA 1JRAA 1YQ3C 3BRJA 4K7BA 1WT6A 5CCHA 4GT1A 3WUUA 1GZLA 3GW6A 4PV1D 3JTLO 2QRXA 1AEPA 1M90Q 3EFOA 1NTZD 3A7OA 3T6BA 4KHXA 4GIFA 2LQGA 1NU1G 1VQOP 3GODA 2HUJA 3ASNC 3L73E 4D6TE 3H1JG 3AEBC 1KC8Q 3PMRA 4YWQA 2R7OA 3ABLC 3CZ6A 1L4AB 3K7DA 3QZCA 3EG9A 2A45G 1OVUA 3U59A 1FU1A 2WZFA 3SZRA 2ZXWC 2WSFJ 1LT9A 2P1JA 3BASA 4U5CE 2R9RB 1HVVA 1ZHWA 3SYNA 3T6JA 3AGTA 3G50A 5AW8B 2RD9A 3I5PA 3M9BA 3AECC 4F4BA 5L0IA 2OYIA 3M0DA 3CX5E 5IY5C 1LE2A 2NUTB 3KHUA 2PX3A 5BU8B 1YYXA 4U7JA 1S2EA 1P84I 2ZAEB 5AW7B 2KOGA 3IPMO 4H54A 4QDLA 4IB4A 4AX2A 4NPFX 3IHUA 1WGWA 3GM2A 4PJLA 1S9KE 3K66A 1RKEA 4GODA 1EDKA 4OVNF 3JSEO 3KL4A 3CXHI 2IXMA 2UUIA 2LKMA 1HE1A 5DJUB 2N9BA 4TT3H 3T6GB 5AVYB 1T6AA 2LFFA 3ZTMA 4PD4E 1BGYG 4ZKUA 1N86A 1WATA 2MYSA 3E9VA 5L3QA 2A0BA 4EYYQ 4C3EA 4JF7A 5B3IA 1EZVI 4XEKA 1G2CA 1YJNP 1J8MF 3AE3C 5L8RJ 3TNUB 5CCGD 3CC2P 2PAJA 1CGOA 5AW2B 1PPJD 3O10A 2C9NY 3O8ZA 1J8YF 5A6KA 1VLTA 1TKNA 5GTIE 3ZDMA 3TOLA 2L6HA 1RY3A 5F5HA 3IAOA 4XA4A 4JCZA 1ORJA 3L71J 1NTKJ 1OW8A 3RQFA 1SQPJ 3TGUG 5AVUB 1L0NK 1W2WA 1C03A 1BDJB 2K37A 1ZVZA 1WTYA 3AEFC 1FNTc 1SQQE 4KJMA 2OTLP 3AG4C 4H44B 1T6QA 5AVRB 2ZXPA 3HTKB 4AQRD 2Q4FA 3KZIH 2FYZA 4EBBA 4FESA 1DOVA 1WN0A 5GTHE 3AE9C 3VMAA 4DJGA 4LC1A 3GLMA 3C8ZA 2B88A 2XV5A 3CCQP 2LFDA 3KXDA 1L0LE 3GHGA 1HMDA 1RKEB 5CI9A 3AGUA 2OYHC 3Q6NA 2Q9AA 2GWWA 4J32B 1BSNA 1LIHA 1IJDB 2G3VA 1TWAA 2M5AB 4B86A 5AVZB 1OVRA 3B5ND 1PP9E 4I7ZB 2HSQA 2QVAA 2XZRA 2WT7A 4XQ1A 3S1KA 2IBZD 1M1JA 1S3JA 5KKZB 3FXHA 1LTTC 4G7ZF 1VPCA 1FZCB 3LLIA 2YL3A 2Y3HA 3L72G 1RE3A 3G71P 1NU1J 1IO4A 2V7QH 3A0HE 4KNVA 3K1IA 4EDFA 2RMZA 4JZAA 2YMKA 2PRRA 3RGUA 1N73B 3AE8C 4HFKB 2WZGA 3H1LG 3F5HA 1SLQA 1LI5A 3DAFA 1ZU5A 3LNMB 5T1DB 4BJ5C 1URQB 2D5RB 3RQGA 4HH2A 1JNMA 2XNXA 3IFMA 5AVSB 4H13B 2D2CB 2HLOA 3Q5RA 3EZIA 4WBAA 3JRMO 3KYJA 1NU1E 2N1TB 1OQCA 1SQXG 5A6BD 4G78A 2HODB 4PJNA 2KQ9A 3V5BA 1SQBK 1F1MA 3H1JE 1QLEC 2HPCB 2UWJE 4Q7CA 2YKPA 1Z63A 4EUKB 3RK3C 2W4BA 4DT0A 1JTHB 5CBNA 2IXNA 2M8RA 4NY3A 4C3DA 2JWDA 3QW0A 2OQQA 1M57C 2QTVA 2HS5A 2P10A 1Z6AA 4R32A 3NYMA 1YYCA 4JEAA 2QLAA 3WUTA 4IL6E 3Q2YA 4UB8E 4BWNA 5FZTA 1EI7A 5CCGA 2AXCA 2QSIA 1KB9H 3US6A 3K6BA 1L0NJ 1JMWA 1BCCD 1PZQA 5APTA 1YVIA 1HJ0A 1J2JB 1N1CA 1M1JB 4E18A 3IN6A 5CHXA 3LNRA 1MKMA 2A06G 4IL6X 1QL2A 2YIUB 3L36A 5AVXB 3NMKA 5A6JA 4JTAB 2F22A 2R7RA 1J1EC 1LE4A 2IZ0A 3FAPB 4H0LC 3OW2O 1PGJA 2YL1A 4RO0A 1BR4A 3CC4P 3UR3C 2GUSA 2O1JA 4CPGA 4YXDC 1NWQA 1ZRTD 2H7BA 2ASRA 4JURI 2J8WA 4OWFA 4LERA 2E5TA 1U6HA 4I1OB 5KAIH 1BGYE 3POVA 1T6IA 2NSGA 4OGQB 4N6JA 2Y69C 1MMGA 1NU7D 5EFWB 3KDPB 1LTSC 1YDIA 2P7JA 1Z5ZA 1BBHA 1W2BO 2J9UA 4IFFA 1ZV8A 1U0BB 2H88C 3AE1C 2RSEB 3TJ6A 1RQVA 1FFHA 5B5EH 1UIXA 1I5NA 5L0DA 5L3VA 1D1AA 4O7GA 2WVQA 3HRNA 3KMIA 3TK0A 5H2FE 3AEEC 2C9LY 2IPPA 4G7OF 2Y9ZA 1BSHA 2NRGA 2GFHA 2WVRA 3H1IJ 3TGUE 1E86A 2E74C 1M6TA 3FWNA 3AE2C 3M9HA 1KB9D 4JJGA 2KNCA 3SNHA 4N78E 2WZLA 4OD4A 4UB6E 2CCYA 1SF8A 4I6MC 4C7NA 5E3CA 2FYNC 1BR1A 4AL0A 5DS4A 2Q6QA 2OG2A 2LR2A 5KYWB 4FWVA 3SWYA 4FAPB 1SQBJ 1ORYA 2BCCJ 1NZEA 1Z23A 1RHZB 3AQBA 4JQ0D 2Y3BA 4MVUA 3A5TA 2FFDC 2ZXRA 4E0HA 4KI2A 5TISH 2GM4A 1A02F 1S5LX 1MQVA 2W90A 3SFDC 4ULVA 4W7ZA 2XLDA 4JTDB 1FJPA 2AVKA 4XEFA 2BE5F 1EZVD 5E79E 2H7HA 1M2OA 2C0WA 2I8BA 5CJ0A 1KD1Q 3CMEP 3CL3D 1QVXA 1JY3N 2Q3TA 3DXJF 4PV1C 3B9QA 3L72E 3MTUE 4IOIH 3B5NB 1BDCA 3O6QA 4CSAC 4BPMA 3E70C 1QLED 3VN0A 2EILC 2R7QA 4DOJA 1SFCC 1U7JA 1S1CX 3H1KD 2EPMX 2YLDA 4IAQA 4U5BE 1CGNA 3V6IA 2LD6A 3L4FA 3RK3D 3LW5H 1BE3G 3B0PA 2W8ZA 2ZYDA 3ITFA 1M57D 3H1HG 3H1LE 3TSIA 2C04A 5F5FA 3ITKA 1JY3O 1CPQA 2VASA 4M3LA 2BEZF 2HV6A 2HV7A 2FYUG 4JYCA 3PLNA 3P8CD 3G4SP 2HJ3A 3GEHA 1A0BA 2DGJA 1SQXE 1FOSF 2KZIA 1OCOC 3L75G 3CMAP 2JP3A 1U7MA 2JDIH 3TK1A 2JJLA 2PBEA 4LDRA 2JKVA 3EFGA 2KZJA 3M06A 2IFNA 1EDIA 1EDJA 4L73A 1OR2A 3HNIA 4I2LC 2R7XA 2Q7RA 1JY3P 4U3FG 1A02J 1TWGA 4DOZA 5AW0B 4H0LD 4RESB 2B87A 3EJNA 1NU9C 1GW3A 1SQVG 3VAYA 1KYOE 4CS7A 1ZR2A 1LT1A 3L73D 3FVYA 4D6TD 3AQCA 4NTBA 2IBZI 1EQ7A 3DWWA 2FYUK 4FX5A 1JEKA 3B29A 2A06E 2OYHA 2B9BA 1LPEA 3O6QB 3V2PA 3C1LA 2DW3A 2R3CA 1ORSC 4K3AA 2P58A 3B0VC 5AC4A 2E76B 2WSEH 4D4NA 1VF5C 1JO5A 1HE9A 1N2DC 1X8YA 3CX5D 4MTFA 2OQMA 2J7PD 2P2UA 4G0HA 2E75C 2FAPB 3L71G 2LIGA 1NTKG 1QSPA 1PIXA 2YNYA 1RJ9B 1U57A 3DJUB 2E74D 1SQPG 2RN0A 5L0FA 3BEHA 3CWBG 3JZ0A 1N7SC 1S9KD 4WB4A 1CZQA 2KIKA 4AYCA 1LM3B 2W6JH 3FX0A 4CDAA 1A7EA 3W2WA 1LWUC 1G1IA 3FAJA 2YQYA 2MHRA 3C8VA 2QM7A 2IZ1A 2FXOA 4CS8C 3R2PA 3HJCA 4PD4D 1LTIC 5KLVK 1MFZA 5B1BC 1TR2A 1FOSE 2BASA 3H2VA 3V4QA 2QJPC 1VQLP 3CD6P 4DBQA 1WMKA 2OTJP 2KYVA 4NQFA 3TDKA 5FCLA 1NHLA 2KS1A 3C9IA 5L0CA 2KLVA 1M56D 1SS1A 3X1OA 1USDA 3S29A 3A0HH 1NTZK 2YXQB 2FXMA 1WOLA 2OARA 1NKNA 3N0TA 4JVSA 4CDVA 4XE5B 3ZTZA 1BZ4A 3LEOA 1O5HA 1Y4CA 2XL8A 4WJ0A 1Y8AA 2YO3A 3AE5C 3MHVA 1B68A 2LXBA 3V5XA 4N3YB 4I1MA 4WY4B 1CI6A 2ZT9D 4M63A 1KILB 1KFNA 1H0TA 1SQQD 5APUA 2ZD9A 5B66E 1XZQA 2CYDA 3K5BA 1SFCD 5KLIC 2IXPA 3DJNB 2ZXEB 1IFPA 3II6A 2WSCH 2LXCB 3LIDA 3MP7B 1DX7A 3L8IA 1M1KQ 3RK2C 1BE3J 2L91A 2A68F 5E33A 1GQAA 5KYNA 5APYA 2KXPB 2YLIA 3GMAA 1WWPA 1QL1A 3H1HJ 4GDOA 3ABMC 2Q5UA 3RL0B 2A45H 1L0LD 1L2PA 3RL0g 3MFNA 3AEDC 3CSKA 2FYUJ 2NPSA 2NPUA 4JJFA 4AUWA 1AUEA 1SR2A 2XXAA 3V2RA 4XPWA 3TQOA 1KV4A 1XZPA 4UB8H 3L75J 4MVQA 1GD2E 1PP9D 3V2NA 4W7YA 2GUVA 3PTZA 3EGDA 1BE3E 3LS0A 3SSUA 1S05A 2IBFA 5COMA 3UMKA 1KB9I 1LGHB 2D4UA 4CIHA 3RYLA 3H1HE 4OINF 2LCHA 3RW0A 1AVYA 3P32A 2J9WA 4Q4ZF 3FDQA 1KQFB 4U3FJ 2FYUE 2R32A 3V7OA 3W8HA 2KS1B 3TD7A 3CI9A 1UFBA 3ZC4A 1GU4A 5AVTB 1SQVJ 1GL2C 2YWAA 3RK3B 4GEHA 4BRYB 3L75E 1HY5A 2P1AA 3EH2A 1L0NG 3A9CA 1GDTA 2RKLA 2EPOA 3JCUH 1RMVA 4IFMA 4W8KA 4K35A 2J7PA 3M79A 1YJ9P 3N24A 2L9JA 5T3TA 2RH0A 5AVVB 1RF1C 1QKRA 1CI6B 3M4CA 3EGXA 2PNOA 3EFOB 1AVOA 1NYHA 2WMMA 1H0TB 1MMNA 2W4MA 1WRGA 3GWNA 4Z1MH 2O3JA 4U3FE 1HWTC 4XEVA 1IFNA 3EHNA 2ZYGA 1NU1D 5KLVJ 1VK5A 4U5GA 5K5GB 4Z9HA 1SQVE 1ZYRF 4JRZA 3JSZA 1VF5D 1J1DC 3H1JD 5K0IA 2IM8A 4D4XA 3UGPA 1X79B 1CPRA 3VF0A 1KQGB 1Q0DA 4AL1A 3EG9B 2E75D 2XLWA 1IW7F 1NOHA 2W45A 1LT9B 2K9YA 5H2FH 5KAFE 1PCXA 1J1EB 4H0LB 3VYWA 1EC5A 1N7SD 1NTZJ 2FFDA 3EWKA 1G4WR 1RQUA 2NG1A 2K3RA 3CWBJ 1OKKA 2NZ2A 1GM5A 4XPYA 2LP4A 1TFOB 1KMIZ 1KU2A 2OYIB 3EGDB 4MN4C 1KTMA 2X51A 1GW4A 1PGQA 1YZCA 2QA4P 1NFOA 4N6HA 2XSEA 2L5GB 1IK7A 3L71E 1PFIA 1LS1A 1NTKE 4P9FA 3H1IG 1SQPE 4DRHB 4YJWA 3CWBE 4CSAA 4U5EE 4I1LA 4RBNA 3AG2C 1SFCA 2EINC 2BL2A 2ZXOA 4YT8A 2Q1KA 1KQLA 3GM1A 3CAXA 2I15A 3LUTB 2XLHA 3PP5A 5D91A 5APWA 3ZVRA 3G4ZA 3ASOC 3PDMP 1YBKA 3AE4C 1JY2N 2GA1A 2IYOA 2Y0CA 1SQBG 3GANA 3BCCG 3EPVA 1BGYD 2BCCG 2L6GA 5L0JA 5AW5B 2P7VA 3ECSA 3IR9A 3EH1A 1D0ZA 2YO2A 1G2CB 3P7KA 4KT0J 2FYNB 1HW2A 1V54C 2ICWG 4E0IA 1NAFA 3OA1A 3KKBA 4XPXA 5A6AA 2XM0A 1VLSA 1T3UA 3RK2D 2YRFA 4C3BA 5KYYA 4CJOA 1G8XA 3DAGA 3M4BA 3ZSUA 1JY2O 2OU6A 1EXJA 4QI0A 1H88A 4J7TA 1VQ7P 1L4AC 1ZOYC 2FFDB 3AE7C 4OIPF 3DM9B 2NUPA 1NBBA 3TGUD 3FMSA 3EQ2A 2QUPA 2YKZA 4MVZA 4BJTA 2XLEA 5TJHA 3R7CA 3CX5I 4N78D 3P8MC 2AEMA 2J9BA 2YXRB 3AJMA 4CJGA 5AW6B 2O01N 1ZZPA 2JWAA 3HNLA 1Q86Q 3BRVB 1OCZC 2KNHA 2KK7A 2W27A 3C8GA 2BC5A 1ZW2A 1FZGA 3A0BE 4PJ0H 4HYTB 1EDLA 3V2QA 1QZXA 3PCVA 4PV1B 1JY2P 1Q82Q 4O6MA 3FWLA 3GHGB 3DD7A 3LAYA 4YT5A 4BEMJ 2AEFA 1SFCB 3CCUP 1K73Q 4MNDA 2Z4EA 4EKWA 1NTMG 4DVZA 1GL2D 2B0JA 4GOFA 5D92A 1EA8A 1C17M 1ZP0C 2I1JA 4PD4I 1I4ZA 2EIJC 3RFYA 3UGOA 2YKQA 3IF4A 1L7CA 2WT7B 1RCPA 5L0GA 4P6IC 1TQGA 4OIQF 3C18A 3G9RA 4C7OA 4A7PA 2Z5IA 2YVKA 1R8EA 3JSVC 1N7SA 2K9JA 4NPDA 5L0HA 5APXA 3OAKA 3DM5A 3ABVC 3HE4A 4IFDK 2ETSA 3KH2A 3L72D 3C7JA 3HD7A 1FMWA 2NPSC 5KYYB 1LWUA 5KJ7D 1L0NE 4O9BA 3S28A 3NYLA 2J9VA 5HV9A 3RVZA 3CC7P 3SP1A 4CS8A 1T8ZA 1W5CE 3L70G 4A2NB 1FJKA 4Y99C 3H1LD 1LTAC 1NTMK 4HE8D 2O9XA 2EPLX 1LJ2A 1D0YA 3ATPA 1C02A 4ANJA
chains in the Genus database with same CATH topology
2L6HA 2QIWA 2QJPC 5F28E 3IAOA 1WMKA 4NQFA 3T97B 2E74C 1NYHA 1OW8A 3AE2C 3RQFA 4R4LA 1DD4A 1AJYA 4YTPC 4Z1MH 2E74B 1DIPA 1EXJA 2E76D 2H89C 3AEBC 4XEVA 1ZOYC 3AE7C 4H44C 1WOLA 3AEFC 1OMIA 2MKVA 4R4MA 3AE6C 1WTYA 1K05A 2FYNC 3AEAC 3L8JA 2OQQA 1VF5D 2D2CC 3GF3A 4H0LD 4H13C 4H44B 1ZMEC 3K7DA 2P10A 1JB0J 3C8GD 4R32A 2HSBA 2JX0A 1Y9BA 2JO1A 3AE5C 1KNYA 2JPUA 1PV3A 1KQGB 2E75D 2WSFJ 1OW6A 1JOGA 3Q2YA 2ZT9D 3Q3DA 1ZZPA 2L6FA 3AJMA 2IDBA 2QSIA 2K9YA 3AE9C 3FGAD 3S9OA 1OW7A 3C8GA 3GLMA 1VF5B 4H0LB 5KLIC 1TU3F 1FDIA 3D6ZA 4OGQD 3H25A 3C8GB 2O01J 2QJKC 1K40A 3EWKA 1RQUA 1HJ0A 3L8IA 3R4YA 1S5LX 3AECC 4PV1B 3D70A 2NZ2A 3SFDC 3IN6A 3Q1MA 2WPVB 1GMJA 1KMIZ 1MKMA 2QJYC 2YIUC 4XEFA 1KTMA 2WSCJ 2FBWC 4IL6X 3GMAA 1WWPA 4GDOA 2E76C 4I7ZC 4RKUJ 4U7JA 2E76B 2J5UA 4I7ZB 3RL0g 3Q5SA 3MFNA 3AEDC 1VF5C 4H0LC 1ZRTE 1ZP0C 1PL5A 1QVXA 2Q00A 1IK7A 3GM2A 3D71A 3RK3E 2E75C 2G3AA 4PV1C 1HF9A 1O3UA 3B71A 4XFJA 1PIXA 2WSEJ 1NGMB 2E75B 3G9RA 1U57A 3O6QA 3C18A 2E74D 3SFEC 2ZT9B 1R8EA 4YXDC 1S1CX 4OGQC 1KILE 3JZ0A 3U3FA 5M1BA 3GF7A 1EXIA 3GM1A 3RQEA 3JYYA 3ABVC 4OGQB 2FXPA 4TT3H 4H44D 2BEQD 4EBKA 1VL2A 3AEGC 4EBJA 3GM3A 4H13D 2D2CD 2YMKA 1YQ4C 1KQFB 2WQYC 1K04A 3U0CA 2G8YA 3AE8C 1FDOA 3AE4C 4Y28J 1UFBA 2BEZF 3C8VA 5KKZC 3LW5J 2V7QJ 3TULA 2H88C 2L6GA 4XEKA 3D6YA 3AE1C 2YWAA 2LK4A 1DD3A 2ZT9C 1RQVA 3AE3C 5L8RJ 3Q5PA 3RQGA 1UIXA 1YQ3C 4KT0J 1V4AA 3O10A 3BRJA 4H13B 2D2CB 3AEEC 1KORA 1Q90D 2JP3A 3Q5RA 4PV1D 2KK1A 2PBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6H A;  5F28 E;  4NQF A;  1OW8 A;  3AE2 C;  3RQF A;  4YTP C;  3AEB C;  2H89 C;  4XEV A;  1ZOY C;  3AE7 C;  1WTY A;  1WOL A;  3AEF C;  3AE6 C;  1K05 A;  3AEA C;  3L8J A;  3K7D A;  3C8G D;  4R32 A;  2HSB A;  2JX0 A;  3AE5 C;  1KNY A;  2JPU A;  1PV3 A;  1OW6 A;  1JOG A;  3AJM A;  2L6F A;  1ZZP A;  3AE9 C;  3S9O A;  1OW7 A;  3C8G A;  3C8G B;  1K40 A;  3L8I A;  3AEC C;  3SFD C;  4XEF A;  1KTM A;  2FBW C;  1WWP A;  3MFN A;  3AED C;  1ZP0 C;  2Q00 A;  1QVX A;  3GM2 A;  2G3A A;  1O3U A;  3B71 A;  3C18 A;  3SFE C;  4YXD C;  3JZ0 A;  3U3F A;  3RQE A;  3GM1 A;  3JYY A;  3ABV C;  4EBK A;  3AEG C;  4EBJ A;  3GM3 A;  1YQ4 C;  2WQY C;  1K04 A;  3U0C A;  3AE8 C;  3AE4 C;  1UFB A;  3TUL A;  2H88 C;  2L6G A;  4XEK A;  2YWA A;  3AE1 C;  2LK4 A;  3AE3 C;  3RQG A;  1YQ3 C;  1V4A A;  3O10 A;  3BRJ A;  3AEE C;  2KK1 A;  2PBE A; 
#chains in the Genus database with same CATH topology
 1VQK P;  2PGD A;  3GG2 A;  1KZU B;  1Z3I X;  1HGV A;  4WVZ A;  3ZDL A;  3W8I A;  1YTZ T;  1TWC A;  1I4Y A;  4R4L A;  1OVV A;  1OFC X;  2OTK E;  1SQX D;  1DEB A;  3W2V A;  1Q81 Q;  5EHH A;  4U9E A;  4H44 C;  1JR8 A;  2R7T A;  3AEA C;  3HTK C;  2W9Y A;  4MW3 A;  2E87 A;  2V3C C;  2P61 A;  2Q7C A;  3N7N A;  2R5D A;  1QQ3 A;  2M3E A;  5CMZ A;  2JX0 A;  4Z9J A;  1R5L A;  1IZN B;  3LLK A;  3N2Z B;  4ASW A;  2YEV A;  3JCU Q;  3L74 G;  1QEX A;  1OXB A;  2IDB A;  2C03 A;  1HMO A;  3MLG A;  4JKV A;  2Q9C A;  1Z56 A;  1VF5 B;  4YT2 A;  3D6Z A;  2OGU A;  1RE4 C;  1VQ6 P;  1KYO D;  2QJK C;  2Y9Y A;  2N9Y B;  1VMA A;  1V74 B;  1LTJ C;  3HE5 A;  2KB7 P;  1H9T A;  2H8A A;  1S5L E;  1M2V A;  4IAO A;  2QJY C;  1D0X A;  4Q5S F;  1FZB A;  2IOQ A;  5CJ4 A;  3EQL F;  1SVF A;  4I7Z C;  3VP9 A;  2HZ8 A;  3RKO F;  2AU5 A;  2A06 D;  4MVO A;  1FE6 A;  2J5U A;  3BCC J;  4DVY P;  3H1I E;  3ZIB A;  5APV A;  2Q00 A;  3ZWI A;  1NLX A;  1NKZ B;  3SXY A;  1T6U A;  2YHS A;  1LWU B;  1D7M A;  4ZNC A;  2HYN A;  4AK9 A;  2WPQ A;  4GKG A;  5B66 H;  2CPS A;  3EZH A;  1BCC J;  3SFE C;  5KYU A;  1M56 C;  4ASV A;  1AQ5 A;  2FGY A;  2VB6 A;  3ZQV A;  2FY8 A;  5JUA A;  4Z9I A;  1L4A D;  4EBJ A;  1LNQ A;  4RD9 A;  2QJP B;  3MD0 A;  4J7Y A;  1SQB E;  3BCC E;  1HW1 A;  2BCC E;  1ZHX A;  5AVQ B;  1XTC C;  1D1C A;  2WB7 A;  1E5W A;  4O6N A;  1URQ C;  1D1B A;  2V7Q J;  1NO4 A;  3RBX A;  3D6Y A;  1GL2 A;  1KFM A;  2ZT9 C;  3C63 A;  1OX3 A;  5TJ5 E;  4C7R A;  5DQT A;  2A45 I;  2N1T C;  3FHD A;  1HBW A;  4DXW A;  1KOR A;  2H7V C;  1W2E A;  1FAP B;  5E2Q A;  3OEO A;  1BDD A;  1RF1 A;  3CX5 H;  1VQ4 P;  1XWJ A;  1OCR C;  2WVN A;  3QW1 A;  1IC2 A;  2KNC B;  3HUS C;  2WSF H;  1GS9 A;  1FR0 A;  3NFQ A;  1OMI A;  2MKV A;  2KSE A;  3AE6 C;  3HE5 B;  4C7N B;  1NTM J;  3GF3 A;  2Q3I A;  4PFP A;  1QVF O;  3RK2 B;  2CGE A;  5JSL A;  2JO1 A;  4GOE A;  4IGG A;  5KJ7 A;  3MUD C;  1YJW P;  2L6F A;  4GQH A;  3RVY A;  5BQH A;  3DKA A;  2ITA A;  1IFI A;  2KW3 C;  1OW7 A;  4CDY A;  3V5Z A;  5DLJ A;  1OXK A;  3W67 A;  4O6Y A;  2W83 C;  2EPK X;  4PD4 H;  4RJT A;  3D70 A;  2R25 A;  4LLH A;  2A0U A;  4B6I A;  1JMB A;  2NPS D;  4H4K C;  2YIU C;  1VB5 A;  3USS A;  1V55 C;  4RKU J;  4A4A A;  1WAS A;  3L1M A;  2FKW B;  2J0W A;  1FTS A;  1MUU A;  1NVO A;  3CQZ A;  2HJM A;  3L70 J;  5GTI H;  5AVW B;  1NJI Q;  1HF9 A;  3AG3 C;  3MX3 A;  5AW3 B;  5KAF H;  2MWQ A;  3H6P A;  4MW8 A;  2QE7 H;  4OGQ C;  1KIL E;  3ABK C;  4C46 A;  5KLV G;  1P84 E;  2I1K A;  2FXP A;  1NFN A;  4H44 D;  5DQZ A;  2ZXX A;  1MMA A;  2H7O A;  4JPZ B;  1K04 A;  1YIT P;  2H8P D;  1BE3 D;  3SXM A;  1KQS O;  3L70 E;  4EIY A;  3ZQY A;  3H1H D;  5GTH H;  4MVR A;  2LK4 A;  4BJ6 A;  3CXH E;  2XND H;  4IAR A;  2R44 A;  1V4A A;  1NTZ G;  2ZJS E;  3L74 J;  4JBZ A;  2FYU D;  1N7L A;  1E2X A;  3I55 P;  4KBL A;  3NKE A;  2KK1 A;  1IK9 A;  4E17 A;  2KP8 A;  1MMD A;  3NYJ A;  4DRJ B;  4QI2 A;  4XLN F;  4NTA A;  3H1K J;  1G1J A;  3L75 D;  2TMV P;  3HD7 C;  1DD4 A;  3SEO A;  3CEX A;  3CCJ P;  3TOM A;  2YL0 A;  2QM8 A;  2J59 M;  2Y0E A;  5KAI E;  3FOP A;  1L4A A;  2A6H F;  4R4M A;  4NCQ A;  2KLU A;  3GEI A;  2R3S A;  4MTO A;  1Q0K A;  2ZYA A;  3VMZ A;  3Q7G A;  1JB0 J;  4N4W A;  1KNY A;  3L74 E;  2JPU A;  2B87 B;  4U3F D;  4BG0 A;  3A11 A;  4LDQ A;  1OW6 A;  4DCK A;  3NMJ A;  4WGZ A;  4YT4 A;  4DJ9 A;  1E83 A;  1OKK D;  1RXQ A;  2R5B A;  1APC A;  3GWL A;  1SQV D;  3NG1 A;  5B5E E;  3DMD A;  3HNJ A;  3RH3 A;  4KC9 A;  2X0C A;  3VP8 A;  2J58 A;  5AW4 B;  1OR3 A;  1JUN A;  1H6G A;  4L6R A;  2WZ7 A;  2CW0 F;  5GPG B;  2R05 A;  4U5D E;  1SQQ K;  1FZA A;  3PHL A;  3Q1M A;  3MGN A;  2DYS C;  2J0X A;  2KYH A;  3MBG A;  4JE9 A;  2NUT A;  1ZN5 A;  3BVH A;  2OYH B;  2PFX A;  1ZHT A;  4N06 A;  2FBW C;  3VTP C;  1OWA A;  1URQ D;  4U5F E;  2O01 H;  3U5S A;  2KGO A;  1RF0 A;  1YA9 A;  4ULW A;  5JRA A;  3S0X A;  4YN0 B;  3CCV P;  3L73 J;  3U3B A;  3IEE A;  4D6T J;  4WGY A;  2N1T D;  5AW1 B;  2IYP A;  1X9V A;  1QVG O;  1L0L K;  1MFT A;  1O3U A;  2PP6 A;  4L76 A;  1O87 A;  1YTZ I;  3A0B H;  3O6X A;  3FOO A;  1YI2 P;  3L71 D;  3AOU A;  2Q3E A;  1NTK D;  3U1C A;  3WU2 E;  3JYY A;  2WSS H;  4EBK A;  1SQP D;  5TIS E;  4HB1 A;  1U89 A;  3SXK A;  3CWB D;  5AGF A;  1FMV A;  2G8Y A;  1E79 H;  1JMM A;  1PPJ G;  4XTK A;  4IL6 H;  3LW5 J;  3MIW A;  3TNU A;  3IQT A;  1T2K C;  1DOW A;  1Q0M A;  2A6E F;  3EHM A;  4ER9 A;  1FAV A;  3UIA A;  2OJQ A;  1X0T A;  2OEV A;  3LJB A;  2OCC C;  3WAQ A;  3NXS A;  2DI3 A;  4OIR F;  3VYI A;  1FBM A;  3PRJ A;  3U8V A;  2H43 A;  3F46 A;  1R4T A;  2OEX A;  1KYO I;  4IWB A;  2AWY A;  1GU5 A;  1EKY A;  1Y47 A;  4AE4 A;  2J46 A;  1DH3 A;  1PGO A;  1T9K A;  1S4X A;  1GK6 A;  3QMK A;  2XM4 A;  1ZU4 A;  4BXL A;  2V26 A;  1G5Z A;  1K05 A;  3L8J A;  1ZHZ A;  3HTK A;  3JRT A;  2KC3 A;  1ZME C;  4PK4 A;  3C8G D;  4W80 A;  1Y9B A;  4OH8 B;  2Z5H A;  1NU1 K;  1XTG B;  5CBO A;  4JTC B;  3KQG A;  2Y3D A;  3T97 A;  3C62 A;  3F89 A;  3BRT B;  1FS0 E;  4LLE A;  1T5O A;  4CIP A;  4G7H F;  1ZW3 A;  4OGQ D;  1LI7 A;  1RE4 A;  3IQ5 A;  1LTJ A;  3S90 A;  3U1A A;  1HTL C;  3KYQ A;  2M5A A;  2IYL D;  4RDA A;  3UMH A;  1MZ9 A;  2Z15 A;  3FXE A;  2E76 C;  4HFF B;  5KJ7 C;  1MNE A;  1T01 A;  2IBZ G;  4EOT A;  4K0D A;  1RH5 B;  4OD5 A;  1USE A;  3G4X A;  3GEE A;  3EFF K;  2NPS B;  2KSF A;  1H8A A;  1FZC A;  3LEV A;  1K9M Q;  4JW1 A;  1SQQ J;  5B3S C;  2XXA B;  1SP4 A;  2PF4 E;  2QE9 A;  2WSE J;  1EQ1 A;  3HD7 D;  5KLV E;  3V5Y A;  2JEE A;  5KYX A;  4UB6 H;  4EIJ A;  4Y99 B;  1QPU A;  5M1B A;  1JCD A;  5E3A A;  1JPN A;  1HUC A;  1IFD A;  2BEQ D;  3U9M A;  1S5L H;  1N73 A;  1RKC A;  4N6C A;  1HH0 A;  2WQY C;  4TLF A;  3UMI A;  4AE4 B;  1L0L J;  2AXT E;  1URQ A;  1NTZ E;  1ZLL A;  1FC2 C;  1VQN P;  2WWW A;  1N8R Q;  4MQ9 F;  2K88 A;  3WUV A;  2VC9 A;  3JYH A;  1VOM A;  2N1T A;  2VRS A;  1PP9 J;  3CCL P;  2HOD A;  1VQ8 P;  2HKV A;  1L0N D;  2GDC A;  2XL4 A;  5F28 E;  2HPC A;  3T97 B;  3LIE A;  3VMY A;  2WTY A;  3NDB B;  1AJY A;  3EGX B;  2ZFC A;  1JTH A;  2E74 B;  1AVO B;  3L0I A;  5E79 H;  2H89 C;  4CX9 A;  1UG7 A;  3TYY A;  2QJK B;  3HUS A;  2HR3 A;  2KSJ A;  1LTJ B;  2A69 F;  4BJ6 C;  3M1C B;  1S72 P;  3OA7 A;  4WY4 C;  4E7S A;  2M0B A;  1PV3 A;  1KIL C;  2QJY B;  4BJ1 A;  4I3M A;  3MUD A;  3HNK A;  5DS6 A;  3Q3D A;  1BCC G;  1FZE A;  2CK3 H;  1VTM P;  2HFE D;  2WVO A;  4ZMD A;  3F47 A;  1FDI A;  4K1O A;  1X22 A;  2O01 J;  4HJG H;  4NPE A;  3S4R A;  4I44 A;  1OZH A;  2KJG A;  3TF5 A;  5JT4 A;  4LAC B;  3PHF 2;  3RL0 C;  3Q6M A;  2WSC J;  1TWH A;  2WPS A;  5KYX B;  4CBE A;  3VOP A;  1T2K D;  4ONS A;  4PFO A;  4YK5 A;  1IFM A;  3H1J J;  1GGQ A;  4NC3 A;  3Q5S A;  2P0N A;  2QY9 A;  2XL6 A;  3D71 A;  2Q9I A;  1NG1 A;  4IRU A;  1G4U S;  4QMA A;  2E5Y A;  2IFM A;  3H32 A;  3K33 A;  2ZT9 B;  3H1I D;  2XLO A;  3QWO C;  2AWC A;  4YL3 A;  1H7I A;  1ZXG A;  3A2A A;  4BEJ A;  1RF0 C;  3E1I A;  4E7Z A;  3GM3 A;  1PPJ E;  1JCC A;  1YQ4 C;  4ZLC A;  3CCR P;  1KYO H;  4MS2 A;  3E1R A;  2W6A A;  4LGD E;  2K1A A;  1Q0G A;  2EIM C;  3FXD A;  4ZKP A;  2L7A A;  4PAC A;  2AEJ A;  1DD3 A;  5CIV A;  3V4W A;  3HUS B;  3T9O A;  3CCM P;  3RIP A;  1SQB D;  3BCC D;  2M64 A;  2BCC D;  5CCH C;  2M3B A;  5AW9 B;  4JIO A;  3U2L A;  1YJG A;  1Q90 D;  3K1H A;  2V4H A;  3I56 P;  2VCA A;  3NMI A;  2QIW A;  2ZVN B;  1ZW0 A;  3CCS P;  3CCE P;  3JC2 2;  4PJJ A;  4LLC A;  2POH A;  3QVZ A;  1GTW A;  4YTP C;  1P84 H;  2CPB A;  1JM0 A;  2E76 D;  2C0X A;  2JR8 A;  2EIK C;  4IJJ A;  1MND A;  4U9D A;  2L81 A;  1R5I D;  2XDJ A;  3VMX A;  5AC5 A;  5KYW A;  1SQX K;  3A3Y B;  1VYK A;  1BGY J;  2NUP B;  2OJE D;  1QGK B;  4CS9 A;  5B1A C;  5DJT B;  1YHQ P;  1LT9 C;  2XU6 A;  2DB4 A;  3CXH H;  3QVY A;  3VM6 A;  2Y3G A;  3S9O A;  3NKD A;  1UII A;  3JCU E;  1H9G A;  1ZHY A;  3G3Z A;  3U8P A;  3SXZ A;  1PD1 A;  3MYF A;  3C8G B;  4PR9 A;  3QTH A;  1BR2 A;  1EZV G;  1OXZ A;  2WPV B;  2OYI C;  3M0D C;  1A7V A;  5KTB A;  3H32 B;  2OKU A;  1CGM E;  2IBZ E;  3N4X A;  1YYJ A;  3TGU J;  1OCC C;  3GOR A;  1ZR4 A;  1LKX A;  1PL5 A;  3M9Q A;  1NTM D;  2LSE A;  3AG1 C;  3CLQ A;  3ZG1 A;  1R5S A;  3B5N A;  3DI5 A;  3H1K G;  2E43 A;  2HFI A;  1Q0F A;  3I5C A;  4HKZ H;  2E75 B;  4L75 A;  3HKK A;  2KI7 B;  1JPJ A;  2J45 A;  2YMY A;  5DS5 A;  4YPC A;  4C7O B;  2XKM A;  2P6V A;  3W68 A;  1FDM A;  3U3F A;  2XS1 A;  2Y39 A;  1CSB A;  2XRH A;  3O55 A;  2YL7 A;  1N7S B;  2K9J B;  3T4R A;  4W8P A;  2ZPA A;  3HE4 B;  1Z7Q c;  5BUO A;  4WAB A;  3I4U A;  4WY4 D;  1FDO A;  2W6B A;  3HD7 B;  2XLV A;  1KIL D;  1VQ9 P;  1LS4 A;  5KKZ C;  1FZC C;  1P84 D;  3KZI E;  3OJA B;  1YA7 O;  3KYI A;  4X0R A;  3I5Q A;  4L74 A;  4YXW H;  1HGZ A;  3RF3 A;  1CW5 A;  3L70 D;  3WHN A;  2HMQ A;  2IX7 C;  3U9J A;  1N73 C;  2YLG A;  3CXH D;  3RL0 D;  3WU2 H;  5JS5 A;  1DIP A;  1JOC A;  3L72 J;  2EPN A;  2UUH A;  5A6B A;  1LP1 A;  1A7D A;  4XWJ A;  3S27 A;  2CNW D;  2P67 A;  4UDV A;  5CI8 A;  2G3K A;  3L73 G;  2WPR A;  4D6T G;  2VCB A;  5BQG A;  4JYB A;  4H13 C;  2D2C C;  5BU5 A;  3X2Q C;  4EWC A;  2AP3 A;  2HSB A;  1BCC E;  3B0U X;  1JOG A;  4EHP A;  4JC7 A;  3H1L J;  5APQ A;  5BVZ A;  5T3W A;  2GAQ A;  2XS8 A;  1NH4 A;  3FGA D;  5APS A;  4DZO A;  1TU3 F;  2SPZ A;  4PJM A;  3H25 A;  3L74 D;  3M91 A;  1KN7 A;  3GHG C;  5KLI B;  1YAU O;  5DVW A;  4DRI B;  1PGP A;  3WG7 C;  4WWI A;  4O79 A;  2QG4 A;  2R7W A;  1SQX J;  1HJB A;  256B A;  4ZLD A;  2PFD A;  2R7V A;  3TJ5 A;  1M2V B;  1K8A Q;  2O1K A;  5C39 A;  4LDK A;  1VYI A;  2VCC A;  3BAT A;  1SYQ A;  1AQT A;  3S84 A;  1DEE G;  1OIP A;  1ZRT E;  2JD3 A;  1A41 A;  2YKO A;  2Y0D A;  5CCH D;  1VQP P;  4JEB A;  1M1J C;  2R7S A;  4NTF A;  1RJ9 A;  2GA0 A;  3B71 A;  1YAR O;  1Q2N A;  1QX8 A;  1NGM B;  3KPE A;  5JP7 A;  4HEA J;  1Q7Y Q;  2I8D A;  1RE3 C;  1NTM E;  3M15 A;  5KYU B;  2ZVO B;  3GF7 A;  4PJ0 E;  1EXI A;  2HMZ A;  3MZW B;  1VL2 A;  3K1I C;  1NAY A;  3RBZ A;  3QH9 A;  3L35 A;  1PD0 A;  3O39 A;  3LS1 A;  5JLI A;  3U0C A;  2HG5 D;  1LVK A;  3H65 A;  1AV1 A;  2B89 A;  3DZA A;  1YZA A;  4MVM A;  2E42 A;  1LP1 B;  4OIO F;  1GL2 B;  3IQC A;  1KB9 E;  4YL0 A;  2VH3 A;  1IFJ A;  3CPW O;  4MTG A;  1ST6 A;  1VDF A;  5EGY A;  2QNL A;  2PP4 A;  2A1D D;  4DBR A;  2OYO A;  2IXO A;  1RF1 B;  3MYI A;  1FFT C;  2MJZ A;  2XLM A;  3UNG C;  4P9T A;  3L37 A;  2OOC A;  2Q9B A;  3VRC A;  1H89 A;  2FFH A;  2AXT H;  4WY4 A;  1SQQ G;  3PJS K;  1J1D B;  2R02 A;  1KIL A;  2DYR C;  4MVS A;  3LES A;  1IZM A;  5CCG C;  3SWK A;  5BQI A;  5COG A;  3G6E P;  1AA0 A;  1EZV E;  2CDQ A;  1K40 A;  5COF A;  2NSF A;  3HLZ A;  3R4Y A;  1SQV K;  3DE8 A;  1JAF A;  1GMJ A;  1L0L G;  4GYT A;  5EK0 A;  3PH0 A;  4CS9 C;  3NTN A;  3E7K A;  3DE9 A;  4KNW A;  2R03 A;  1Y6D A;  1L3P A;  2CNW A;  5HSW A;  3J06 A;  1E85 A;  2KUB A;  4YL1 A;  2G62 A;  5JVE A;  1PP9 G;  3H1K E;  1TFK B;  2WIT A;  4U5H A;  1M8O B;  1E84 A;  3RK3 E;  2G3A A;  3NMD A;  3U2M A;  3WMM 0;  4XFJ A;  4JCH A;  2WL8 A;  3L34 A;  4BJ5 A;  2QEX P;  1AFO A;  2M4E A;  3Q7L A;  1NSG B;  1FZF A;  2PX0 A;  3NRH A;  3JT1 A;  3B4S A;  3WOD F;  3M0A A;  1T3J A;  1SMY F;  3SWF A;  3OWT A;  3RQE A;  1GK4 A;  1LTB C;  4XLP F;  1VQ5 P;  3AEG C;  3P8C E;  3KPH A;  1VQM P;  3IQ6 A;  2B0H A;  1M7L A;  4H13 D;  2D2C D;  2R7U A;  3H2U A;  1MV8 A;  5KLV D;  1SZI A;  1NTK K;  4Y28 J;  3W4Y A;  1LTG C;  3TUL A;  1SQP K;  4BRY A;  1YIJ P;  5A69 A;  4EI2 A;  3B5N C;  3B8E B;  1YLM A;  4J30 B;  3Q5P A;  2YZS A;  1S7Z A;  1JRA A;  1YQ3 C;  3BRJ A;  4K7B A;  1WT6 A;  5CCH A;  4GT1 A;  3WUU A;  1GZL A;  3GW6 A;  4PV1 D;  3JTL O;  2QRX A;  1AEP A;  1M90 Q;  3EFO A;  1NTZ D;  3A7O A;  3T6B A;  4KHX A;  4GIF A;  2LQG A;  1NU1 G;  1VQO P;  3GOD A;  2HUJ A;  3ASN C;  3L73 E;  4D6T E;  3H1J G;  3AEB C;  1KC8 Q;  3PMR A;  4YWQ A;  2R7O A;  3ABL C;  3CZ6 A;  1L4A B;  3K7D A;  3QZC A;  3EG9 A;  2A45 G;  1OVU A;  3U59 A;  1FU1 A;  2WZF A;  3SZR A;  2ZXW C;  2WSF J;  1LT9 A;  2P1J A;  3BAS A;  4U5C E;  2R9R B;  1HVV A;  1ZHW A;  3SYN A;  3T6J A;  3AGT A;  3G50 A;  5AW8 B;  2RD9 A;  3I5P A;  3M9B A;  3AEC C;  4F4B A;  5L0I A;  2OYI A;  3M0D A;  3CX5 E;  5IY5 C;  1LE2 A;  2NUT B;  3KHU A;  2PX3 A;  5BU8 B;  1YYX A;  4U7J A;  1S2E A;  1P84 I;  2ZAE B;  5AW7 B;  2KOG A;  3IPM O;  4H54 A;  4QDL A;  4IB4 A;  4AX2 A;  4NPF X;  3IHU A;  1WGW A;  3GM2 A;  4PJL A;  1S9K E;  3K66 A;  1RKE A;  4GOD A;  1EDK A;  4OVN F;  3JSE O;  3KL4 A;  3CXH I;  2IXM A;  2UUI A;  2LKM A;  1HE1 A;  5DJU B;  2N9B A;  4TT3 H;  3T6G B;  5AVY B;  1T6A A;  2LFF A;  3ZTM A;  4PD4 E;  1BGY G;  4ZKU A;  1N86 A;  1WAT A;  2MYS A;  3E9V A;  5L3Q A;  2A0B A;  4EYY Q;  4C3E A;  4JF7 A;  5B3I A;  1EZV I;  4XEK A;  1G2C A;  1YJN P;  1J8M F;  3AE3 C;  5L8R J;  3TNU B;  5CCG D;  3CC2 P;  2PAJ A;  1CGO A;  5AW2 B;  1PPJ D;  3O10 A;  2C9N Y;  3O8Z A;  1J8Y F;  5A6K A;  1VLT A;  1TKN A;  5GTI E;  3ZDM A;  3TOL A;  2L6H A;  1RY3 A;  5F5H A;  3IAO A;  4XA4 A;  4JCZ A;  1ORJ A;  3L71 J;  1NTK J;  1OW8 A;  3RQF A;  1SQP J;  3TGU G;  5AVU B;  1L0N K;  1W2W A;  1C03 A;  1BDJ B;  2K37 A;  1ZVZ A;  1WTY A;  3AEF C;  1FNT c;  1SQQ E;  4KJM A;  2OTL P;  3AG4 C;  4H44 B;  1T6Q A;  5AVR B;  2ZXP A;  3HTK B;  4AQR D;  2Q4F A;  3KZI H;  2FYZ A;  4EBB A;  4FES A;  1DOV A;  1WN0 A;  5GTH E;  3AE9 C;  3VMA A;  4DJG A;  4LC1 A;  3GLM A;  3C8Z A;  2B88 A;  2XV5 A;  3CCQ P;  2LFD A;  3KXD A;  1L0L E;  3GHG A;  1HMD A;  1RKE B;  5CI9 A;  3AGU A;  2OYH C;  3Q6N A;  2Q9A A;  2GWW A;  4J32 B;  1BSN A;  1LIH A;  1IJD B;  2G3V A;  1TWA A;  2M5A B;  4B86 A;  5AVZ B;  1OVR A;  3B5N D;  1PP9 E;  4I7Z B;  2HSQ A;  2QVA A;  2XZR A;  2WT7 A;  4XQ1 A;  3S1K A;  2IBZ D;  1M1J A;  1S3J A;  5KKZ B;  3FXH A;  1LTT C;  4G7Z F;  1VPC A;  1FZC B;  3LLI A;  2YL3 A;  2Y3H A;  3L72 G;  1RE3 A;  3G71 P;  1NU1 J;  1IO4 A;  2V7Q H;  3A0H E;  4KNV A;  3K1I A;  4EDF A;  2RMZ A;  4JZA A;  2YMK A;  2PRR A;  3RGU A;  1N73 B;  3AE8 C;  4HFK B;  2WZG A;  3H1L G;  3F5H A;  1SLQ A;  1LI5 A;  3DAF A;  1ZU5 A;  3LNM B;  5T1D B;  4BJ5 C;  1URQ B;  2D5R B;  3RQG A;  4HH2 A;  1JNM A;  2XNX A;  3IFM A;  5AVS B;  4H13 B;  2D2C B;  2HLO A;  3Q5R A;  3EZI A;  4WBA A;  3JRM O;  3KYJ A;  1NU1 E;  2N1T B;  1OQC A;  1SQX G;  5A6B D;  4G78 A;  2HOD B;  4PJN A;  2KQ9 A;  3V5B A;  1SQB K;  1F1M A;  3H1J E;  1QLE C;  2HPC B;  2UWJ E;  4Q7C A;  2YKP A;  1Z63 A;  4EUK B;  3RK3 C;  2W4B A;  4DT0 A;  1JTH B;  5CBN A;  2IXN A;  2M8R A;  4NY3 A;  4C3D A;  2JWD A;  3QW0 A;  2OQQ A;  1M57 C;  2QTV A;  2HS5 A;  2P10 A;  1Z6A A;  4R32 A;  3NYM A;  1YYC A;  4JEA A;  2QLA A;  3WUT A;  4IL6 E;  3Q2Y A;  4UB8 E;  4BWN A;  5FZT A;  1EI7 A;  5CCG A;  2AXC A;  2QSI A;  1KB9 H;  3US6 A;  3K6B A;  1L0N J;  1JMW A;  1BCC D;  1PZQ A;  5APT A;  1YVI A;  1HJ0 A;  1J2J B;  1N1C A;  1M1J B;  4E18 A;  3IN6 A;  5CHX A;  3LNR A;  1MKM A;  2A06 G;  4IL6 X;  1QL2 A;  2YIU B;  3L36 A;  5AVX B;  3NMK A;  5A6J A;  4JTA B;  2F22 A;  2R7R A;  1J1E C;  1LE4 A;  2IZ0 A;  3FAP B;  4H0L C;  3OW2 O;  1PGJ A;  2YL1 A;  4RO0 A;  1BR4 A;  3CC4 P;  3UR3 C;  2GUS A;  2O1J A;  4CPG A;  4YXD C;  1NWQ A;  1ZRT D;  2H7B A;  2ASR A;  4JUR I;  2J8W A;  4OWF A;  4LER A;  2E5T A;  1U6H A;  4I1O B;  5KAI H;  1BGY E;  3POV A;  1T6I A;  2NSG A;  4OGQ B;  4N6J A;  2Y69 C;  1MMG A;  1NU7 D;  5EFW B;  3KDP B;  1LTS C;  1YDI A;  2P7J A;  1Z5Z A;  1BBH A;  1W2B O;  2J9U A;  4IFF A;  1ZV8 A;  1U0B B;  2H88 C;  3AE1 C;  2RSE B;  3TJ6 A;  1RQV A;  1FFH A;  5B5E H;  1UIX A;  1I5N A;  5L0D A;  5L3V A;  1D1A A;  4O7G A;  2WVQ A;  3HRN A;  3KMI A;  3TK0 A;  5H2F E;  3AEE C;  2C9L Y;  2IPP A;  4G7O F;  2Y9Z A;  1BSH A;  2NRG A;  2GFH A;  2WVR A;  3H1I J;  3TGU E;  1E86 A;  2E74 C;  1M6T A;  3FWN A;  3AE2 C;  3M9H A;  1KB9 D;  4JJG A;  2KNC A;  3SNH A;  4N78 E;  2WZL A;  4OD4 A;  4UB6 E;  2CCY A;  1SF8 A;  4I6M C;  4C7N A;  5E3C A;  2FYN C;  1BR1 A;  4AL0 A;  5DS4 A;  2Q6Q A;  2OG2 A;  2LR2 A;  5KYW B;  4FWV A;  3SWY A;  4FAP B;  1SQB J;  1ORY A;  2BCC J;  1NZE A;  1Z23 A;  1RHZ B;  3AQB A;  4JQ0 D;  2Y3B A;  4MVU A;  3A5T A;  2FFD C;  2ZXR A;  4E0H A;  4KI2 A;  5TIS H;  2GM4 A;  1A02 F;  1S5L X;  1MQV A;  2W90 A;  3SFD C;  4ULV A;  4W7Z A;  2XLD A;  4JTD B;  1FJP A;  2AVK A;  4XEF A;  2BE5 F;  1EZV D;  5E79 E;  2H7H A;  1M2O A;  2C0W A;  2I8B A;  5CJ0 A;  1KD1 Q;  3CME P;  3CL3 D;  1QVX A;  1JY3 N;  2Q3T A;  3DXJ F;  4PV1 C;  3B9Q A;  3L72 E;  3MTU E;  4IOI H;  3B5N B;  1BDC A;  3O6Q A;  4CSA C;  4BPM A;  3E70 C;  1QLE D;  3VN0 A;  2EIL C;  2R7Q A;  4DOJ A;  1SFC C;  1U7J A;  1S1C X;  3H1K D;  2EPM X;  2YLD A;  4IAQ A;  4U5B E;  1CGN A;  3V6I A;  2LD6 A;  3L4F A;  3RK3 D;  3LW5 H;  1BE3 G;  3B0P A;  2W8Z A;  2ZYD A;  3ITF A;  1M57 D;  3H1H G;  3H1L E;  3TSI A;  2C04 A;  5F5F A;  3ITK A;  1JY3 O;  1CPQ A;  2VAS A;  4M3L A;  2BEZ F;  2HV6 A;  2HV7 A;  2FYU G;  4JYC A;  3PLN A;  3P8C D;  3G4S P;  2HJ3 A;  3GEH A;  1A0B A;  2DGJ A;  1SQX E;  1FOS F;  2KZI A;  1OCO C;  3L75 G;  3CMA P;  2JP3 A;  1U7M A;  2JDI H;  3TK1 A;  2JJL A;  2PBE A;  4LDR A;  2JKV A;  3EFG A;  2KZJ A;  3M06 A;  2IFN A;  1EDI A;  1EDJ A;  4L73 A;  1OR2 A;  3HNI A;  4I2L C;  2R7X A;  2Q7R A;  1JY3 P;  4U3F G;  1A02 J;  1TWG A;  4DOZ A;  5AW0 B;  4H0L D;  4RES B;  2B87 A;  3EJN A;  1NU9 C;  1GW3 A;  1SQV G;  3VAY A;  1KYO E;  4CS7 A;  1ZR2 A;  1LT1 A;  3L73 D;  3FVY A;  4D6T D;  3AQC A;  4NTB A;  2IBZ I;  1EQ7 A;  3DWW A;  2FYU K;  4FX5 A;  1JEK A;  3B29 A;  2A06 E;  2OYH A;  2B9B A;  1LPE A;  3O6Q B;  3V2P A;  3C1L A;  2DW3 A;  2R3C A;  1ORS C;  4K3A A;  2P58 A;  3B0V C;  5AC4 A;  2E76 B;  2WSE H;  4D4N A;  1VF5 C;  1JO5 A;  1HE9 A;  1N2D C;  1X8Y A;  3CX5 D;  4MTF A;  2OQM A;  2J7P D;  2P2U A;  4G0H A;  2E75 C;  2FAP B;  3L71 G;  2LIG A;  1NTK G;  1QSP A;  1PIX A;  2YNY A;  1RJ9 B;  1U57 A;  3DJU B;  2E74 D;  1SQP G;  2RN0 A;  5L0F A;  3BEH A;  3CWB G;  3JZ0 A;  1N7S C;  1S9K D;  4WB4 A;  1CZQ A;  2KIK A;  4AYC A;  1LM3 B;  2W6J H;  3FX0 A;  4CDA A;  1A7E A;  3W2W A;  1LWU C;  1G1I A;  3FAJ A;  2YQY A;  2MHR A;  3C8V A;  2QM7 A;  2IZ1 A;  2FXO A;  4CS8 C;  3R2P A;  3HJC A;  4PD4 D;  1LTI C;  5KLV K;  1MFZ A;  5B1B C;  1TR2 A;  1FOS E;  2BAS A;  3H2V A;  3V4Q A;  2QJP C;  1VQL P;  3CD6 P;  4DBQ A;  1WMK A;  2OTJ P;  2KYV A;  4NQF A;  3TDK A;  5FCL A;  1NHL A;  2KS1 A;  3C9I A;  5L0C A;  2KLV A;  1M56 D;  1SS1 A;  3X1O A;  1USD A;  3S29 A;  3A0H H;  1NTZ K;  2YXQ B;  2FXM A;  1WOL A;  2OAR A;  1NKN A;  3N0T A;  4JVS A;  4CDV A;  4XE5 B;  3ZTZ A;  1BZ4 A;  3LEO A;  1O5H A;  1Y4C A;  2XL8 A;  4WJ0 A;  1Y8A A;  2YO3 A;  3AE5 C;  3MHV A;  1B68 A;  2LXB A;  3V5X A;  4N3Y B;  4I1M A;  4WY4 B;  1CI6 A;  2ZT9 D;  4M63 A;  1KIL B;  1KFN A;  1H0T A;  1SQQ D;  5APU A;  2ZD9 A;  5B66 E;  1XZQ A;  2CYD A;  3K5B A;  1SFC D;  5KLI C;  2IXP A;  3DJN B;  2ZXE B;  1IFP A;  3II6 A;  2WSC H;  2LXC B;  3LID A;  3MP7 B;  1DX7 A;  3L8I A;  1M1K Q;  3RK2 C;  1BE3 J;  2L91 A;  2A68 F;  5E33 A;  1GQA A;  5KYN A;  5APY A;  2KXP B;  2YLI A;  3GMA A;  1WWP A;  1QL1 A;  3H1H J;  4GDO A;  3ABM C;  2Q5U A;  3RL0 B;  2A45 H;  1L0L D;  1L2P A;  3RL0 g;  3MFN A;  3AED C;  3CSK A;  2FYU J;  2NPS A;  2NPU A;  4JJF A;  4AUW A;  1AUE A;  1SR2 A;  2XXA A;  3V2R A;  4XPW A;  3TQO A;  1KV4 A;  1XZP A;  4UB8 H;  3L75 J;  4MVQ A;  1GD2 E;  1PP9 D;  3V2N A;  4W7Y A;  2GUV A;  3PTZ A;  3EGD A;  1BE3 E;  3LS0 A;  3SSU A;  1S05 A;  2IBF A;  5COM A;  3UMK A;  1KB9 I;  1LGH B;  2D4U A;  4CIH A;  3RYL A;  3H1H E;  4OIN F;  2LCH A;  3RW0 A;  1AVY A;  3P32 A;  2J9W A;  4Q4Z F;  3FDQ A;  1KQF B;  4U3F J;  2FYU E;  2R32 A;  3V7O A;  3W8H A;  2KS1 B;  3TD7 A;  3CI9 A;  1UFB A;  3ZC4 A;  1GU4 A;  5AVT B;  1SQV J;  1GL2 C;  2YWA A;  3RK3 B;  4GEH A;  4BRY B;  3L75 E;  1HY5 A;  2P1A A;  3EH2 A;  1L0N G;  3A9C A;  1GDT A;  2RKL A;  2EPO A;  3JCU H;  1RMV A;  4IFM A;  4W8K A;  4K35 A;  2J7P A;  3M79 A;  1YJ9 P;  3N24 A;  2L9J A;  5T3T A;  2RH0 A;  5AVV B;  1RF1 C;  1QKR A;  1CI6 B;  3M4C A;  3EGX A;  2PNO A;  3EFO B;  1AVO A;  1NYH A;  2WMM A;  1H0T B;  1MMN A;  2W4M A;  1WRG A;  3GWN A;  4Z1M H;  2O3J A;  4U3F E;  1HWT C;  4XEV A;  1IFN A;  3EHN A;  2ZYG A;  1NU1 D;  5KLV J;  1VK5 A;  4U5G A;  5K5G B;  4Z9H A;  1SQV E;  1ZYR F;  4JRZ A;  3JSZ A;  1VF5 D;  1J1D C;  3H1J D;  5K0I A;  2IM8 A;  4D4X A;  3UGP A;  1X79 B;  1CPR A;  3VF0 A;  1KQG B;  1Q0D A;  4AL1 A;  3EG9 B;  2E75 D;  2XLW A;  1IW7 F;  1NOH A;  2W45 A;  1LT9 B;  2K9Y A;  5H2F H;  5KAF E;  1PCX A;  1J1E B;  4H0L B;  3VYW A;  1EC5 A;  1N7S D;  1NTZ J;  2FFD A;  3EWK A;  1G4W R;  1RQU A;  2NG1 A;  2K3R A;  3CWB J;  1OKK A;  2NZ2 A;  1GM5 A;  4XPY A;  2LP4 A;  1TFO B;  1KMI Z;  1KU2 A;  2OYI B;  3EGD B;  4MN4 C;  1KTM A;  2X51 A;  1GW4 A;  1PGQ A;  1YZC A;  2QA4 P;  1NFO A;  4N6H A;  2XSE A;  2L5G B;  1IK7 A;  3L71 E;  1PFI A;  1LS1 A;  1NTK E;  4P9F A;  3H1I G;  1SQP E;  4DRH B;  4YJW A;  3CWB E;  4CSA A;  4U5E E;  4I1L A;  4RBN A;  3AG2 C;  1SFC A;  2EIN C;  2BL2 A;  2ZXO A;  4YT8 A;  2Q1K A;  1KQL A;  3GM1 A;  3CAX A;  2I15 A;  3LUT B;  2XLH A;  3PP5 A;  5D91 A;  5APW A;  3ZVR A;  3G4Z A;  3ASO C;  3PDM P;  1YBK A;  3AE4 C;  1JY2 N;  2GA1 A;  2IYO A;  2Y0C A;  1SQB G;  3GAN A;  3BCC G;  3EPV A;  1BGY D;  2BCC G;  2L6G A;  5L0J A;  5AW5 B;  2P7V A;  3ECS A;  3IR9 A;  3EH1 A;  1D0Z A;  2YO2 A;  1G2C B;  3P7K A;  4KT0 J;  2FYN B;  1HW2 A;  1V54 C;  2ICW G;  4E0I A;  1NAF A;  3OA1 A;  3KKB A;  4XPX A;  5A6A A;  2XM0 A;  1VLS A;  1T3U A;  3RK2 D;  2YRF A;  4C3B A;  5KYY A;  4CJO A;  1G8X A;  3DAG A;  3M4B A;  3ZSU A;  1JY2 O;  2OU6 A;  1EXJ A;  4QI0 A;  1H88 A;  4J7T A;  1VQ7 P;  1L4A C;  1ZOY C;  2FFD B;  3AE7 C;  4OIP F;  3DM9 B;  2NUP A;  1NBB A;  3TGU D;  3FMS A;  3EQ2 A;  2QUP A;  2YKZ A;  4MVZ A;  4BJT A;  2XLE A;  5TJH A;  3R7C A;  3CX5 I;  4N78 D;  3P8M C;  2AEM A;  2J9B A;  2YXR B;  3AJM A;  4CJG A;  5AW6 B;  2O01 N;  1ZZP A;  2JWA A;  3HNL A;  1Q86 Q;  3BRV B;  1OCZ C;  2KNH A;  2KK7 A;  2W27 A;  3C8G A;  2BC5 A;  1ZW2 A;  1FZG A;  3A0B E;  4PJ0 H;  4HYT B;  1EDL A;  3V2Q A;  1QZX A;  3PCV A;  4PV1 B;  1JY2 P;  1Q82 Q;  4O6M A;  3FWL A;  3GHG B;  3DD7 A;  3LAY A;  4YT5 A;  4BEM J;  2AEF A;  1SFC B;  3CCU P;  1K73 Q;  4MND A;  2Z4E A;  4EKW A;  1NTM G;  4DVZ A;  1GL2 D;  2B0J A;  4GOF A;  5D92 A;  1EA8 A;  1C17 M;  1ZP0 C;  2I1J A;  4PD4 I;  1I4Z A;  2EIJ C;  3RFY A;  3UGO A;  2YKQ A;  3IF4 A;  1L7C A;  2WT7 B;  1RCP A;  5L0G A;  4P6I C;  1TQG A;  4OIQ F;  3C18 A;  3G9R A;  4C7O A;  4A7P A;  2Z5I A;  2YVK A;  1R8E A;  3JSV C;  1N7S A;  2K9J A;  4NPD A;  5L0H A;  5APX A;  3OAK A;  3DM5 A;  3ABV C;  3HE4 A;  4IFD K;  2ETS A;  3KH2 A;  3L72 D;  3C7J A;  3HD7 A;  1FMW A;  2NPS C;  5KYY B;  1LWU A;  5KJ7 D;  1L0N E;  4O9B A;  3S28 A;  3NYL A;  2J9V A;  5HV9 A;  3RVZ A;  3CC7 P;  3SP1 A;  4CS8 A;  1T8Z A;  1W5C E;  3L70 G;  4A2N B;  1FJK A;  4Y99 C;  3H1L D;  1LTA C;  1NTM K;  4HE8 D;  2O9X A;  2EPL X;  1LJ2 A;  1D0Y A;  3ATP A;  1C02 A;  4ANJ A; 
#chains in the Genus database with same CATH homology
 2L6H A;  2QIW A;  2QJP C;  5F28 E;  3IAO A;  1WMK A;  4NQF A;  3T97 B;  2E74 C;  1NYH A;  1OW8 A;  3AE2 C;  3RQF A;  4R4L A;  1DD4 A;  1AJY A;  4YTP C;  4Z1M H;  2E74 B;  1DIP A;  1EXJ A;  2E76 D;  2H89 C;  3AEB C;  4XEV A;  1ZOY C;  3AE7 C;  4H44 C;  1WOL A;  3AEF C;  1OMI A;  2MKV A;  4R4M A;  3AE6 C;  1WTY A;  1K05 A;  2FYN C;  3AEA C;  3L8J A;  2OQQ A;  1VF5 D;  2D2C C;  3GF3 A;  4H0L D;  4H13 C;  4H44 B;  1ZME C;  3K7D A;  2P10 A;  1JB0 J;  3C8G D;  4R32 A;  2HSB A;  2JX0 A;  1Y9B A;  2JO1 A;  3AE5 C;  1KNY A;  2JPU A;  1PV3 A;  1KQG B;  2E75 D;  2WSF J;  1OW6 A;  1JOG A;  3Q2Y A;  2ZT9 D;  3Q3D A;  1ZZP A;  2L6F A;  3AJM A;  2IDB A;  2QSI A;  2K9Y A;  3AE9 C;  3FGA D;  3S9O A;  1OW7 A;  3C8G A;  3GLM A;  1VF5 B;  4H0L B;  5KLI C;  1TU3 F;  1FDI A;  3D6Z A;  4OGQ D;  3H25 A;  3C8G B;  2O01 J;  2QJK C;  1K40 A;  3EWK A;  1RQU A;  1HJ0 A;  3L8I A;  3R4Y A;  1S5L X;  3AEC C;  4PV1 B;  3D70 A;  2NZ2 A;  3SFD C;  3IN6 A;  3Q1M A;  2WPV B;  1GMJ A;  1KMI Z;  1MKM A;  2QJY C;  2YIU C;  4XEF A;  1KTM A;  2WSC J;  2FBW C;  4IL6 X;  3GMA A;  1WWP A;  4GDO A;  2E76 C;  4I7Z C;  4RKU J;  4U7J A;  2E76 B;  2J5U A;  4I7Z B;  3RL0 g;  3Q5S A;  3MFN A;  3AED C;  1VF5 C;  4H0L C;  1ZRT E;  1ZP0 C;  1PL5 A;  1QVX A;  2Q00 A;  1IK7 A;  3GM2 A;  3D71 A;  3RK3 E;  2E75 C;  2G3A A;  4PV1 C;  1HF9 A;  1O3U A;  3B71 A;  4XFJ A;  1PIX A;  2WSE J;  1NGM B;  2E75 B;  3G9R A;  1U57 A;  3O6Q A;  3C18 A;  2E74 D;  3SFE C;  2ZT9 B;  1R8E A;  4YXD C;  1S1C X;  4OGQ C;  1KIL E;  3JZ0 A;  3U3F A;  5M1B A;  3GF7 A;  1EXI A;  3GM1 A;  3RQE A;  3JYY A;  3ABV C;  4OGQ B;  2FXP A;  4TT3 H;  4H44 D;  2BEQ D;  4EBK A;  1VL2 A;  3AEG C;  4EBJ A;  3GM3 A;  4H13 D;  2D2C D;  2YMK A;  1YQ4 C;  1KQF B;  2WQY C;  1K04 A;  3U0C A;  2G8Y A;  3AE8 C;  1FDO A;  3AE4 C;  4Y28 J;  1UFB A;  2BEZ F;  3C8V A;  5KKZ C;  3LW5 J;  2V7Q J;  3TUL A;  2H88 C;  2L6G A;  4XEK A;  3D6Y A;  3AE1 C;  2YWA A;  2LK4 A;  1DD3 A;  2ZT9 C;  1RQV A;  3AE3 C;  5L8R J;  3Q5P A;  3RQG A;  1UIX A;  1YQ3 C;  4KT0 J;  1V4A A;  3O10 A;  3BRJ A;  4H13 B;  2D2C B;  3AEE C;  1KOR A;  1Q90 D;  2JP3 A;  3Q5R A;  4PV1 D;  2KK1 A;  2PBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...