1KTMA

Solution structure of fat domain of focal adhesion kinase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
139
structure length
139
Chain Sequence
MANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDESLPVLPASTHREIEMAQKLLNSDLAELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMISQSRPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insight into the Mechanisms of Targeting and Signaling of Focal Adhesion Kinase
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
molecule keywords FOCAL ADHESION KINASE 1
total genus 53
structure length 139
sequence length 139
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2002-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ktmA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1ktmA02
3RQFA 3AE6C 3C8GB 1YQ3C 3AEAC 3RQEA 3AEBC 2H89C 3L8IA 3S9OA 2JPUA 3JYYA 2WQYC 3JZ0A 3C8GD 3B71A 1YQ4C 3ABVC 2PBEA 1KNYA 3C18A 3AE9C 3AE5C 3K7DA 3AEEC 3AE2C 4YXDC 2Q00A 2L6FA 2KK1A 3AECC 1ZZPA 1WTYA 1K04A 4XEFA 4XEKA 4EBKA 5F28E 1O3UA 3C8GA 2FBWC 3RQGA 3AE1C 1WWPA 1ZOYC 3L8JA 3AEDC 3GM2A 1QVXA 2JX0A 3AE8C 3SFEC 2YWAA 3GM3A 4XEVA 2HSBA 3O10A 3BRJA 3AEFC 1OW8A 3SFDC 3GM1A 3AE7C 4R32A 1V4AA 3U0CA 1K05A 4NQFA 2G3AA 2LK4A 1OW6A 4YTPC 2H88C 2L6GA 3AE3C 1OW7A 3MFNA 3U3FA 1ZP0C 3AJMA 1WOLA 1JOGA 1PV3A 1UFBA 3AEGC 3TULA 1K40A 3AE4C 4EBJA 2L6HA 1KTMA
chains in the Genus database with same CATH superfamily
1GMJA 3WUUA 1NG1A 2GA1A 1TWCA 1O87A 5L3VA 1FNTc 3JSVC 1QVGO 3W67A 3L73J 2E87A 3L72J 3HD7C 1Y8AA 1PP9J 3MYIA 2V3CC 4JTCB 1E2XA 2QNLA 4O79A 4ULVA 3WU2E 3G4XA 1PCXA 3JRMO 2KOGA 1MFZA 1RE4A 3DJNB 4G0HA 1V74B 1JB0J 2KYVA 3AEEC 4NPFX 1SZIA 5T3WA 4D6TE 4GYTA 2HKVA 1G1JA 1T2KC 1QZXA 1J2JB 5CCGD 5AVXB 2Y69C 1ZR4A 5JLIA 2R5BA 1QGKB 1IK7A 2P10A 3CCUP 3BATA 2WITA 1YYJA 2VB6A 3PTZA 5JP7A 3B5NA 1FE6A 2UWJE 1G2CA 4O6NA 1CGME 1ZOYC 3L71G 3MUDC 1H89A 1LS4A 3AEDC 1JY2P 2WVOA 5M1BA 1Y4CA 4O9BA 1DH3A 3IPMO 3PP5A 5AW3B 1FZFA 3VMYA 3HLZA 1NKNA 4TLFA 3O55A 1EI7A 3L74D 1BR1A 2XM0A 1QX8A 2N1TC 2FXMA 4EUKB 1KYOI 4XPYA 2KUBA 3K1IC 3CWBG 3PDMP 2HR3A 3RFYA 5KAFE 3H1HD 4JKVA 3HNIA 4W8KA 3L75E 4CBEA 3V2QA 3ZVRA 4G7HF 2H88C 2YL0A 3KYJA 3R4YA 3NMKA 3K5BA 3CCJP 3VMXA 2YO2A 3RGUA 3HJCA 5CBOA 1YDIA 1PP9E 3VOPA 1RQUA 5E3AA 5TJHA 5A69A 1FU1A 4NPDA 3NFQA 2KI7B 4XFJA 3WMM0 2OGUA 4YL3A 5KAFH 4Y99B 1Q0MA 2R25A 3E1RA 3KH2A 3M9BA 2M64A 1J1EC 5AW9B 2BEQD 1J1DC 3POVA 1JNMA 1SFCA 5DS5A 4N6JA 4I1OB 2IDBA 2WVRA 3RH3A 2BASA 1RKEB 3LS0A 1FTSA 2OYIA 4W7YA 2QUPA 1TQGA 1OVVA 3P8CE 3PHF2 1ZLLA 2K9YA 5AW1B 1NJIQ 1JPJA 4I1MA 3I5CA 2WZGA 2LSEA 1X8YA 5JRAA 1YAUO 1L0LE 1D0YA 1OKKD 2HMQA 5AW5B 1B68A 3DJUB 1MUUA 3CAXA 3ZTZA 4PV1B 4AYCA 1L4AD 2HFIA 3H65A 2FXPA 1YZAA 3N24A 1BE3D 2OJQA 2L5GB 2JDIH 3EZIA 3T6GB 3R2PA 4PD4I 1H0TB 2O1JA 3V5YA 5DS4A 3HUSB 3L73G 4PJJA 2QLAA 4WWIA 1KFNA 1I4YA 1H7IA 2E75C 5A6BD 5DQZA 2JP3A 1SQVD 3L75J 4XQ1A 1WN0A 2FYZA 3GF7A 2EIKC 1GM5A 1WWPA 2B0JA 3DE9A 1EKYA 2PP6A 2FAPB 4KNVA 4B6IA 3ABMC 5CMZA 4XLPF 2LFDA 2AXTH 2IFMA 5AW6B 2V4HA 1SS1A 3A5TA 2HSBA 3NKDA 1URQD 3ATPA 2OQMA 2NZ2A 1ZRTD 3AE7C 1KORA 4ZMDA 1YA7O 5KJ7D 3SP1A 3CX5H 5KAIE 3VF0A 3QWOC 1FAVA 4C7NB 2KXPB 2YVKA 1E84A 2Y39A 1CPQA 4LLCA 1NTME 2BC5A 1NKZB 3U9MA 2Y0CA 1L0NK 1LTJB 3U3BA 2ZXEB 4DJGA 2P2UA 1LIHA 1ZYRF 1U7MA 3HD7B 1WOLA 3AJMA 3FAPB 1JOGA 2EIJC 3KHUA 5A6JA 2CGEA 1EXJA 1GL2C 5A6AA 5AVSB 1SQBE 4Y99C 1OWAA 2OQQA 3S29A 2XLVA 4DVZA 3V6IA 4CPGA 1H88A 3AE4C 4LGDE 1IZNB 2N1TB 2XLOA 1ZV8A 1FMWA 1YBKA 3EHMA 1ORYA 2ITAA 5B3SC 1Z63A 4R4MA 2AXCA 1LTIC 1ZVZA 2R05A 2YHSA 3N4XA 1HW1A 1Q81Q 2XS1A 4NTAA 2R9RB 4YT5A 3EG9B 3PMRA 2M8RA 1KZUB 1SVFA 1RJ9B 3CEXA 2P61A 3T97A 1M1JC 2JR8A 3H6PA 2EILC 4JEAA 1HGVA 2ZXXA 1VK5A 1MV8A 3UMIA 1SQPJ 1RE3A 3HUSC 1AVOB 5B66E 4GQHA 4EBKA 4RDAA 1NAYA 1NVOA 2IBFA 3CCQP 3FAJA 1KD1Q 4CSAA 4PK4A 5AVVB 1R4TA 2B89A 4FESA 1NBBA 3BVHA 2J9UA 2CK3H 3II6A 1BSHA 4WVZA 1CZQA 2Q1KA 5KTBA 3HRNA 1FOSE 1OCCC 2QIWA 1ZHZA 4F4BA 2E74B 1MMNA 3TOLA 5GTHE 1WMKA 3C1LA 4OGQD 3QW0A 5KYYB 1SQXK 2IXMA 1HMDA 5L3QA 1FC2C 4IGGA 3S27A 4JJGA 4K35A 1CI6A 2HUJA 2NSFA 3GWLA 3MX3A 1U0BB 2V26A 3JSEO 3H25A 256BA 3TK0A 3S0XA 1HJ0A 3AG3C 5AVUB 2IYOA 1GD2E 1URQC 2YKOA 3E70C 2LR2A 2WZFA 3EGXB 3HE4A 3M1CB 3NRHA 1X0TA 2YIUB 1V55C 1NU1K 2FYUD 4PV1D 3JT1A 2WSEH 1GTWA 3L4FA 4DRHB 3DZAA 1GDTA 1L0NE 5CI9A 1RHZB 1KILE 1T6QA 3H1LG 1DD4A 2W27A 3O8ZA 1FZBA 2N9YB 2J0XA 1M57C 1FJKA 1QPUA 3FX0A 3ZIBA 3GEEA 1L0LJ 1SYQA 1LTJC 2KLVA 4BWNA 4UB8H 2OJED 1PGPA 2KK7A 1IFNA 1LGHB 1VQPP 1P84H 3FXHA 4D4XA 3AE2C 3C8VA 1AUEA 1K8AQ 1L0LD 4K0DA 1NTZE 2A0BA 2NUPB 1YIJP 5CCHC 1Q0KA 2YL7A 4HKZH 1S7ZA 3KZIE 3VMZA 1O3UA 1TWHA 3ZDLA 1BE3E 5JS5A 1WT6A 3B5NB 3C8ZA 5AVYB 1N1CA 4Q7CA 4EBBA 1NTMK 3EG9A 4N4WA 3SXZA 1KB9E 3MGNA 2HS5A 4L74A 2ZD9A 3DKAA 2NUTA 5APXA 3W8HA 5AW0B 4BEJA 1N86A 1BCCE 4PV1C 2KYHA 5CI8A 4IB4A 4Q5SF 1EZVG 2A1DD 2W4BA 4Y28J 3EGDB 1NO4A 2XL6A 4C7OA 3L75G 2NPSA 4XPXA 1UIXA 2Q5UA 1M2VB 5CCGA 3Q6MA 1DD3A 3DXJF 2Q4FA 3T6BA 2ZJSE 1OW6A 1M2VA 3MBGA 1GL2D 3QMKA 4H54A 3HD7A 1AV1A 1LTTC 3GHGA 2RH0A 3KZIH 1GU4A 1YLMA 5HSWA 1OFCX 2PNOA 2G3VA 3CX5E 1ZU5A 2YXQB 1LTAC 4IAOA 1S5LH 1SQBG 1FZCC 2H7HA 1LE4A 1ZW3A 2BE5F 3NDBB 1S4XA 3VN0A 1LM3B 1PGOA 2HODA 4BXLA 5B1AC 2KNCA 1PD1A 4BJ1A 1TWGA 2HFED 1TKNA 3B8EB 2E74C 3C8GB 1SMYF 5AW8B 1Q82Q 1OIPA 4NCQA 3W2VA 2J45A 3MYFA 3S9OA 1VLTA 2I15A 2Y3HA 4WY4D 2FYNB 3OW2O 2WTYA 4C7RA 3P8MC 1SQXD 1QVFO 3M0DA 2Q9IA 4HFKB 2DW3A 2OARA 2PGDA 5BUOA 5T3TA 2Y9YA 3V4WA 1FDOA 1M56D 2OCCC 4BJTA 1HH0A 5L0GA 2IYPA 2XZRA 1FBMA 3H1LD 1VQNP 2RSEB 1NTZG 4MVRA 2KSEA 2KP8A 3HKKA 2O3JA 4M3LA 1OVRA 3H1LJ 1RXQA 2H7BA 2ZVNB 3U1CA 2QE9A 4EWCA 2XU6A 1ZU4A 3MP7B 1MKMA 1KV4A 5KLIC 3Q5SA 4N06A 1LT9A 4JE9A 1GQAA 3LNMB 2A0UA 4IFDK 4MS2A 5KJ7C 4MVQA 4WABA 4NPEA 2EPNA 2KGOA 2W8ZA 1VF5C 2WPVB 3UIAA 3GLMA 1URQB 2XNDH 3QTHA 3AEFC 2QEXP 3AG4C 3ITFA 2FKWB 5APSA 2WPQA 3RK2C 5COGA 5GTIH 1S05A 4EHPA 2P58A 1RY3A 1G1IA 2G3AA 2GUVA 3VP9A 3JSZA 1BGYJ 2Y0EA 1MMAA 4WY4C 1YYCA 1JMWA 4PACA 1LI7A 1Q2NA 2QJYC 4U7JA 4WB4A 5AW7B 1LNQA 2WSSH 4JIOA 1BGYD 5L0CA 4IFFA 1QLEC 3CXHD 3HE5B 1RF1A 5F5FA 2BCCD 2WWWA 3ZSUA 1T6IA 2P7JA 2R7TA 2ZXPA 2YL3A 2DGJA 1ZHTA 5C39A 3M91A 1NTKD 4PD4H 1L0NG 2GM4A 2CNWD 4CIPA 4G7ZF 3CMEP 3ITKA 4N6HA 5KYXB 4FX5A 5E79E 1LPEA 2L6HA 3RYLA 3GHGC 1TFOB 3AG2C 1N7SB 1IFIA 2O01J 4R4LA 1KC8Q 2K9JB 3V2NA 3AGTA 2O01H 4RESB 1H9TA 3H32A 4EDFA 1HWTC 4U3FJ 3TSIA 3FWNA 5APTA 4I7ZB 1HVVA 1M1JB 3O6QB 1GS9A 2ZT9D 3G3ZA 2N1TD 3T4RA 4U3FD 1HY5A 3VP8A 2VCBA 5DVWA 1S9KE 1Q0DA 2VASA 3IQ5A 1TR2A 3EWKA 2RKLA 1TFKB 2L91A 2QY9A 4CS8C 2XSEA 2KNCB 4XEKA 3JYHA 3EFOA 1S3JA 3ZQVA 2R03A 3PLNA 4G7OF 1IC2A 2E75D 1WASA 1A7VA 2XKMA 4DRJB 3RK3D 1M1KQ 3L72E 1BGYG 5KYUA 4H0LD 3ZTMA 1BZ4A 5KKZC 4AL0A 3F46A 1BCCG 2J9BA 4J7YA 4NY3A 5EGYA 1BR4A 2W9YA 3DAGA 1VPCA 2ZYGA 3NYLA 2HMZA 1KYOD 2VCAA 1LTJA 3IF4A 4W80A 3SXMA 1MMDA 3P8CD 2KLUA 2J7PA 2Z15A 3L74J 2JD3A 4IFMA 4R32A 4A7PA 2XV5A 2VC9A 1ZW2A 2B0HA 4JTAB 1K9MQ 5L8RJ 5BQHA 3RF3A 2RD9A 3VYWA 2RN0A 3RVZA 2X51A 1KILB 2Y0DA 1JO5A 2LD6A 4PFOA 2R5DA 2WT7A 1KYOH 4KBLA 4JRZA 2FFDA 1JTHA 3GWNA 2C03A 4Z1MH 4CS7A 4J30B 4C3DA 2YO3A 4YL1A 2C0XA 5BU5A 2J59M 5CCHA 3L71J 3L0IA 1K40A 2JWDA 2HV6A 1S5LX 1VDFA 2F22A 2IXPA 2WSCH 3Q5RA 3SWKA 3L71D 3A7OA 3WAQA 3S1KA 1EQ7A 3L8IA 3ABLC 1D0ZA 3JYYA 3GMAA 1IK9A 1BCCD 3BCCE 2C04A 2QJYB 2Z4EA 2WQYC 4E0IA 2OYOA 3ABVC 2PBEA 3CQZA 3U8VA 1SQQK 2R7QA 1NFNA 2Q3TA 1RE4C 2ZYAA 4D6TD 1U89A 2R7XA 3FXEA 1T6UA 3L36A 4LDQA 4KI2A 1SQBK 3EH1A 3RKOF 3CX5I 1ZHYA 1K04A 5KYWB 1BE3G 3FXDA 2NUPA 2YXRB 1LWUA 2AEMA 4BJ6A 1RH5B 2XXAB 2XM4A 4P9FA 3TJ6A 2FYNC 4IARA 1IFPA 4XWJA 1J1DB 3SWFA 3UGPA 3ECSA 1SQVJ 1SFCB 3L75D 4JBZA 2OYHC 4WGYA 3C7JA 3ZWIA 3V5ZA 1TU3F 3L72G 3V2PA 3GM2A 4LC1A 5JVEA 2G62A 1PL5A 2GUSA 1EZVE 1KMIZ 1M1JA 3O10A 4PJ0H 4KC9A 3H1JE 3CWBE 2YKZA 1KYOE 2YRFA 3WODF 4C46A 4MTOA 1S5LE 5E2QA 3CI9A 3D70A 3IHUA 3GG2A 3TD7A 3RL0C 4ZLCA 3M4BA 3KYQA 1NLXA 3N2ZB 3EPVA 1DEBA 4YTPC 2B87A 1PPJE 5B1BC 2I8DA 5K0IA 4JCZA 1JAFA 2YMYA 1A7EA 3DAFA 2E76C 4OVNF 1NTKK 4JPZB 4HFFB 1U57A 3WUVA 2Y3DA 1K73Q 1VQ6P 1BR2A 3DWWA 1ZP0C 4H44B 2HPCA 2JWAA 3D71A 1HTLC 2L9JA 1ZHWA 2JO1A 4IL6X 3KL4A 2D2CD 2XS8A 1RF0A 2R7UA 4YWQA 4I6MC 1LT9B 2IM8A 4PJLA 1QLED 4JCHA 1T6AA 3AE6C 4LDRA 2R44A 2M0BA 2XLMA 4CIHA 1BDJB 1NOHA 3NMJA 4PR9A 1ZRTE 3BRTB 4KT0J 3UMHA 3LESA 2H8AA 3A0HH 2AP3A 2W83C 2HPCB 3K6BA 5IY5C 4CDAA 1SQXG 1LTBC 2YMKA 4YT4A 1EDLA 2YEVA 3SSUA 3X1OA 1G8XA 3K7DA 1SQBJ 4DOZA 4N78D 5H2FH 2NPSD 1YTZI 3ZG1A 3LJBA 3CC7P 1ZZPA 1JM0A 2WPRA 4CS8A 1LWUC 4BJ6C 2OEXA 3UR3C 1JCCA 1BGYE 1P84I 2PFXA 4BG0A 3LW5H 5KLVG 2M3EA 1UG7A 4LACB 1IO4A 5AVWB 4H13B 1ORSC 3L72D 1JY3N 4YJWA 1FFTC 2R3SA 3D6ZA 4H4KC 1QVXA 4OGQB 2XL8A 3SFEC 3O6XA 4L6RA 3X2QC 4E0HA 3T9OA 5KYNA 1IW7F 2XNXA 2R7SA 3LUTB 1KQFB 4RD9A 1PGQA 1I5NA 3G50A 4AK9A 1EZVI 3HTKB 4YPCA 3V4QA 1EZVD 1VOMA 2KW3C 1OXKA 3LLIA 4JZAA 2E43A 5L0DA 3C63A 5KAIH 3MLGA 1PIXA 2YL1A 1K05A 5F5HA 2J9WA 1OR3A 2LK4A 2VRSA 1NTMG 2Z5IA 1OXZA 1FFHA 3VRCA 1H9GA 2Q7CA 3P32A 3E7KA 1KU2A 4DXWA 2Q3IA 1YJWP 4H44D 2P7VA 1SP4A 1JY3O 3S4RA 4UB8E 1NWQA 1E5WA 1QEXA 4DRIB 1P84E 3W2WA 2L7AA 1ZMEC 1UFBA 3H1JD 1AVOA 1LS1A 3Q7LA 2C0WA 5BU8B 2QJPB 1Q0FA 1EDJA 3L1MA 4JURI 4EI2A 5B5EE 5AVQB 3GEHA 1HBWA 2ETSA 4MTFA 3PHLA 2OU6A 3QW1A 1YJGA 2CDQA 3L37A 3S28A 3H1HG 4XA4A 1JY2N 2QJKC 3QZCA 2FY8A 4WBAA 5KJ7A 1N73B 4JJFA 4I1LA 4U5CE 4AX2A 3A3YB 4XTKA 2POHA 4OD4A 2A45H 1JTHB 4GODA 3GF3A 4I7ZC 1SQVK 4N6CA 3H2UA 5AW2B 3U1AA 1YZCA 4YXDC 1JY3P 1KILA 2E42A 3HE4B 1HGZA 4I2LC 3AECC 3GW6A 4E17A 4JF7A 1YVIA 4LLEA 1XWJA 2OTKE 3C62A 3I5QA 3UMKA 4YL0A 3CCMP 4MVSA 3CL3D 1GK4A 5APVA 2IXOA 2Y3GA 4W7ZA 4LLHA 2EPKX 3DI5A 3AQCA 2QVAA 1L4AB 1DIPA 3H1KD 1M90Q 3MUDA 4YT2A 3CXHI 3HNLA 5L0IA 3AE8C 5APUA 3F89A 4A2NB 3GM3A 2NPUA 2DB4A 5DJTB 1OX3A 3H1KJ 2OYHB 1H8AA 1MQVA 3Q2YA 3L35A 4WGZA 4CJGA 1EDKA 3Q5PA 2BCCJ 5EHHA 1FZCA 1T3UA 3GORA 3M15A 2K3RA 2XLDA 1VYKA 3HNJA 3U0CA 1U6HA 2LCHA 3T6JA 1NTKJ 2IOQA 1BE3J 1I4ZA 1RKCA 2HJMA 2YLDA 1PPJG 1SF8A 5TISH 4DCKA 4IL6E 3KKBA 3L73D 1FJPA 3H32B 2IBZI 1A02F 1G5ZA 1QKRA 2FYUK 2K1AA 2J5UA 3F5HA 4MQ9F 4BRYA 5GPGB 3HTKA 3V2RA 5AC4A 1AVYA 2E76B 1RE3C 3TULA 1HE1A 3G9RA 1S72P 4GEHA 1LTGC 3RK3E 1KTMA 2K9JA 4PJMA 5AGFA 1CI6B 2PRRA 1HW2A 3FGAD 4EIJA 3KYIA 5APQA 3M9HA 2YIUC 2AWCA 1LWUB 3BCCG 2A69F 5HV9A 1SFCC 2A6HF 5FCLA 2IFNA 4D4NA 3ZC4A 3IAOA 1T9KA 5GTHH 1EXIA 1LJ2A 5CCHD 3FWLA 1Z5ZA 1YQ4C 1OR2A 2FFDC 4A4AA 4IWBA 1KQGB 2XDJA 4ZNCA 5AC5A 1IZMA 2Q9BA 2LXBA 1YARO 1LT9C 4RJTA 3B0PA 5BQIA 2Q00A 2KZJA 1NU1E 1WGWA 3W4YA 3TNUA 4C7OB 4IRUA 5B3IA 2BCCE 3LAYA 2A45I 3CMAP 1C02A 3CD6P 5KLVE 1Q7YQ 1USDA 2Q7RA 1NYHA 3JCUH 2FBWC 3L70G 2IYLD 1AFOA 5L0HA 1N2DC 2QRXA 1LE2A 2PX0A 1G4US 2ASRA 2Q3EA 2GAQA 2ZYDA 2OKUA 3U9JA 3L8JA 4GIFA 4UDVA 1O5HA 1N73A 1D1BA 3JCUQ 3TQOA 5K5GB 3H1JG 3TK1A 2Y9ZA 2CW0F 4KJMA 5E3CA 3U2LA 2AEFA 4M63A 2P67A 3T97B 1TWAA 2HJ3A 4MW8A 1NSGB 1JOCA 1SQPD 3CCRP 4EOTA 1AQTA 1R5SA 2G3KA 2HSQA 2P0NA 1MZ9A 4NQFA 5DJUB 2I1KA 3Q7GA 2AEJA 1DEEG 3BRVB 3H1IJ 3QVZA 5BQGA 2CCYA 4H13C 3K1HA 4I44A 2KB7P 1AJYA 3U59A 2EIMC 2LKMA 1A02J 1HUCA 2Z5HA 3SNHA 3SXKA 4BJ5C 1M6TA 2YLGA 2CPSA 2WSFJ 2P6VA 3OEOA 3MHVA 1VQLP 3A0HE 1YI2P 1FMVA 1NH4A 2YKPA 1NTZK 2LFFA 2NPSB 4FAPB 1GW4A 1VQ9P 2HLOA 1S2EA 1L0ND 2ZFCA 4OH8B 2HODB 3G4ZA 3IFMA 2QJKB 2GDCA 1AEPA 3B5NC 1J1EB 3BEHA 3LS1A 1PGJA 1YQ3C 2D5RB 2J58A 5E33A 3RVYA 5KLVJ 3GEIA 2H89C 1YTZT 4RO0A 1HF9A 1BSNA 4J32B 1LP1A 3OWTA 1SQXE 2KS1A 1G4WR 3TGUD 2Q6QA 2LQGA 4YXWH 3LIEA 5A6BA 4QMAA 5AVZB 2FXOA 4IOIH 4DT0A 2P1AA 1OCOC 4MVUA 3IQTA 4HB1A 2L6FA 3RBXA 4W8PA 3TYYA 1VQOP 4PD4E 2FYUJ 1NU1G 1R5ID 2D2CC 3C9IA 3NG1A 1V54C 2IBZG 2I8BA 2VH3A 3HNKA 2R7RA 4TT3H 4LERA 5GTIE 4E18A 4HEAJ 3SXYA 3JCUE 4MN4C 1H6GA 3L70E 5TJ5E 1CW5A 5CCGC 2FGYA 3ASOC 2ICWG 3EFOB 4IAQA 3H1KE 3TOMA 1N7SA 3A2AA 1J8YF 1NU7D 4U9DA 3E9VA 2XL4A 2M3BA 4CX9A 3SYNA 5CJ0A 2LXCB 3BRJA 5DQTA 2M5AB 3O6QA 4NTFA 1IJDB 4NC3A 2XLWA 4DVYP 2JKVA 2OYIB 1U7JA 1FS0E 1OKKA 4H0LC 4K3AA 1VL2A 1KB9H 3RL0D 3TDKA 2FFHA 2M4EA 1L4AA 1VB5A 3USSA 1G2CB 1D1CA 2FYUG 2OG2A 1N7SC 2GFHA 1BDDA 4ZLDA 2I1JA 2L6GA 3RL0g 1HJBA 2R7WA 1JMMA 3M0DC 3GODA 4BPMA 1VLSA 3QVYA 3RK2D 2NG1A 2MWQA 3U8PA 1AQ5A 1URQA 3GANA 1DX7A 2W6JH 3I55P 4MVMA 3FOPA 1ZHXA 1VYIA 3KXDA 1D7MA 3RK2B 1R5LA 3EZHA 1EQ1A 1S1CX 3G4SP 1X22A 3ZDMA 2V7QJ 2ZAEB 3LIDA 2EINC 3FDQA 2XLHA 3E1IA 2PF4E 4AE4A 2ZT9B 3H1HE 1MFTA 2WSFH 4GKGA 1SQVG 4GOEA 3K1IA 1CPRA 2W4MA 1IFMA 2A06D 1FZEA 2DYRC 2WSCJ 4YN0B 3G71P 5DLJA 4DZOA 4QI2A 1PP9D 1NTMD 3L34A 1PD0A 1T01A 2YNYA 2IX7C 2WZ7A 2KIKA 2UUHA 1JY2O 3CLQA 2DYSC 1EC5A 4AQRD 1YHQP 3MIWA 4MW3A 2OYHA 4P9TA 4FWVA 1NTMJ 3M4CA 4DJ9A 4U5BE 1T3JA 4Z9JA 2NPSC 3MD0A 5APWA 4WJ0A 4IJJA 2IZ0A 1M2OA 5KYYA 3M0AA 5JSLA 1E85A 1MNDA 4PD4D 5F28E 3WUTA 4C3EA 1J8MF 3C8GA 4O6MA 3DE8A 2PP4A 3RQGA 2LP4A 3V7OA 1RJ9A 3EHNA 4YT8A 4ER9A 2WVNA 4ZKPA 1YA9A 2ZPAA 2KSJA 1RQVA 5KYXA 1KILC 4GT1A 1OCZC 1GU5A 2PAJA 3B9QA 4ULWA 2CNWA 4KNWA 1E83A 2C9NY 4I3MA 2ZXWC 2KJGA 5JUAA 2XRHA 2D4UA 4BJ5A 1X9VA 3EJNA 1PZQA 1ZN5A 2GA0A 3A9CA 3NYMA 3CCEP 3Q6NA 4JTDB 2WMMA 1VQMP 3CCLP 1T2KD 3PH0A 4CS9C 1ST6A 1FOSF 2A6EF 3NXSA 1M57D 2KSFA 2LIGA 3NKEA 3KPEA 2KQ9A 4MVOA 2FYUE 4JW1A 5BVZA 5CIVA 4XE5B 3KMIA 4DOJA 1OMIA 3ABKC 1LTSC 5CHXA 1KB9I 2FFDB 4O7GA 3BCCD 1ZXGA 5KLVK 2HZ8A 4UB6E 5B66H 2NUTB 1SR2A 2GWWA 4PJ0E 1KN7A 3CWBJ 1HE9A 3AEGC 3FMSA 1QL2A 1ORJA 3W8IA 1GZLA 2A45G 4OIOF 2A68F 1NTZJ 1KQLA 3H2VA 5FZTA 4OIRF 5E79H 2N1TA 2KC3A 3CWBD 1VQ7P 3RL0B 1HMOA 3RQEA 2TMVP 3NMIA 1SQQG 4CS9A 1YITP 1AA0A 3IQCA 4BRYB 3OA1A 3OAKA 2PFDA 3UGOA 4UB6H 4YK5A 3SZRA 1D0XA 1DOWA 3AE9C 1M56C 4AUWA 3AE5C 1NGMB 1S9KD 2H7OA 2D2CB 1SQBD 4HH2A 2EPMX 1KB9D 2BCCG 2H7VC 2A06G 2KNHA 2ZVOB 1Q86Q 3B4SA 2OTLP 4HYTB 1XZPA 2B87B 1ZR2A 3MZWB 3IR9A 2WPSA 5EK0A 3AE1C 1GW3A 4U3FE 3H1KG 1Z56A 3EQLF 2JJLA 5CBNA 4L73A 2JX0A 3SWYA 1CGOA 1VF5D 2XLEA 2BL2A 3V5BA 2OYIC 2IZ1A 2EPOA 2YKQA 3I4UA 1GGQA 1SQQJ 1F1MA 5COFA 1L3PA 5H2FE 4ANJA 3O39A 1RMVA 4IL6H 4QI0A 1M7LA 3RBZA 1SQPG 3CXHH 3DD7A 5B5EH 1SQQD 2QM8A 2MKVA 1MMGA 1Z6AA 4NTBA 1OCRC 1JPNA 2JEEA 1E86A 1SQXJ 3MFNA 3B5ND 3H1IG 5KYWA 3LNRA 2ZXOA 5COMA 3IN6A 5KYUB 2QG4A 4OGQC 2J0WA 1IFJA 4PJNA 2QTVA 3AQBA 4N78E 2H8PD 3CCVP 2O01N 2YZSA 3FOOA 3CC4P 3H1HJ 4E7SA 1BDCA 3CPWO 1VQ5P 1SQVE 1W5CE 1OVUA 2MYSA 3L70D 1VQ8P 4O6YA 3ASNC 4OD5A 3RQFA 3U5SA 4CJOA 4EIYA 4E7ZA 1FAPB 1QSPA 3KDPB 1RF1B 3H1LE 3HE5A 5AVTB 3L70J 3A0BE 2E5TA 1QL1A 3V5XA 3C18A 1QQ3A 3AOUA 1SQPK 4X0RA 1NU9C 2KK1A 4ZKUA 4H0LB 2AU5A 4XEFA 4BEMJ 3HD7D 3J06A 2IBZE 2A06E 4U5GA 2K88A 2W6AA 3VYIA 3A0BH 3P7KA 5TISE 2J8WA 5AVRB 2O1KA 3H1ID 3S90A 2QE7H 3MTUE 2K37A 1BCCJ 2X0CA 2R3CA 3M9QA 3HTKC 4U3FG 3M06A 3TJ5A 1T8ZA 4JVSA 2H43A 4CDVA 2Q9AA 3RIPA 4GOFA 4XEVA 4DBRA 4CDYA 4D6TJ 1USEA 2QSIA 3TF5A 2WSEJ 2G8YA 1PFIA 1N7LA 2AXTE 2YLIA 3DM5A 3WHNA 3CXHE 1V4AA 2WT7B 4G78A 1FZGA 1L0NJ 1PPJD 1LP1B 4H13D 1N8RQ 1SLQA 3VTPC 3Q3DA 2WVQA 4B86A 3LEVA 1NAFA 1Q0GA 3EFGA 5JT4A 5KLVD 3R7CA 1LI5A 5T1DB 5L0JA 1YJNP 3TGUJ 3D6YA 2OOCA 4OINF 2SPZA 2QJPC 1MNEA 4JYBA 1W2BO 1Y47A 2ZXRA 1PV3A 1FDMA 3SEOA 1KQSO 2DI3A 4JQ0D 4L75A 3IEEA 3FHDA 3I56P 3RW0A 4EBJA 2O9XA 1NTKE 2WZLA 1C03A 1LT1A 1SQQE 1RCPA 5AW4B 1A41A 5DS6A 5L0FA 1JEKA 2OEVA 3OJAB 3AEBC 1RF1C 4C7NA 1Z3IX 3CX5D 1GK6A 3C8GD 1FR0A 2MJZA 1NZEA 1YJ9P 4J7TA 1JMBA 1IFDA 4KHXA 5KLIB 3AGUA 2MHRA 3I5PA 4ASWA 2J46A 3RK3B 3CSKA 3CCSP 2YQYA 1SFCD 3EQ2A 3N7NA 2N9BA 3L74E 4WY4A 5EFWB 4XPWA 2RMZA 3EGDA 4MVZA 2L81A 1VQ4P 1RKEA 4HE8D 2NSGA 5D92A 1WATA 2WL8A 4OIPF 3LW5J 1JR8A 2QA4P 2P1JA 3EFFK 3JRTA 2YWAA 4LDKA 1LVKA 2R32A 2E5YA 3TNUB 2R02A 1W2EA 2IPPA 1E79H 2QM7A 1Q90D 2HG5D 1OW8A 3SFDC 2UUIA 3EH2A 2XXAA 3VMAA 3KQGA 4WY4B 3FVYA 4AE4B 2W45A 3AG1C 4DBQA 2AVKA 3B29A 4Q4ZF 1M8OB 2HV7A 1DOVA 1A0BA 4K7BA 1N7SD 4Z9IA 2CYDA 1WRGA 3TGUG 3LLKA 2B9BA 3AE3C 1OW7A 2E76D 4U5EE 3U3FA 2W6BA 1P84D 4JEBA 3K66A 4OWFA 2EPLX 1Y9BA 1PP9G 1FZCB 1D1AA 3G6EP 3NTNA 1CGNA 1W2WA 4L76A 3CZ6A 1BBHA 4N3YB 1VTMP 3W68A 1UIIA 3Q1MA 3JC22 1JCDA 2Y3BA 4JYCA 3ZQYA 4EKWA 4JC7A 2M5AA 4P6IC 1LKXA 3VAYA 3AEAC 4CSAC 2VCCA 2IXNA 3VM6A 2JPUA 1XZQA 3HUSA 3EGXA 1N73C 3DM9B 3JZ0A 2BEZF 3BASA 3US6A 3B71A 1VF5B 3PJSK 1VQKP 2V7QH 1KNYA 1R8EA 1T5OA 4D6TG 2J7PD 4U5DE 3S84A 4GDOA 3CC2P 1OXBA 3RK3C 2W90A 3PRJA 3KPHA 3LEOA 1NHLA 1L0LG 3H1JJ 2E75B 2WB7A 2PX3A 3PCVA 1WTYA 3NMDA 2C9LY 3WG7C 1X79B 1RF0C 3UNGC 3L74G 2B88A 3L73E 3L71E 3OA7A 2R7OA 5CJ4A 1OQCA 3B0VC 1EDIA 1Z7Qc 1L4AC 1Z23A 1KILD 4RKUJ 4HJGH 1L2PA 1GL2A 2R7VA 2KS1B 1NFOA 2J9VA 4MNDA 4C3BA 4EYYQ 3BCCJ 3U2MA 1SQPE 1L0LK 2HYNA 5KKZB 3IQ6A 4U9EA 1Y6DA 3B0UX 4OIQF 2IBZD 3K33A 2AWYA 3DMDA 3GM1A 2KZIA 4U5FE 4MTGA 1XTCC 4QDLA 4XLNF 4Z9HA 1KFMA 4U5HA 4K1OA 1NTZD 1APCA 2NRGA 3WU2H 1FZAA 1EA8A 4RBNA 2OTJP 1XTGB 3H1IE 2CPBA 1ZW0A 3TGUE 3NYJA 4ASVA 3N0TA 1A7DA 1NU1J 1C17M 1JUNA 4ONSA 3F47A 5APYA 1L7CA 4H44C 3A11A 1FDIA 3QH9A 2Q9CA 1YYXA 3JTLO 5A6KA 3M79A 1JRAA 4AL1A 5D91A 1NU1D 1CSBA 1NTKG 4PFPA 1VMAA 1OZHA 1H0TA 2ZT9C 1GL2B 3GHGB 2E74D
chains in the Genus database with same CATH topology
1S5LX 2ZT9B 3FGAD 3RQFA 2E74C 1GMJA 3AE6C 3C8GB 1KILE 1YQ3C 2YIUC 3Q5RA 2BEQD 3AEAC 1ZRTE 3RQEA 1DD4A 3AEBC 2H89C 2WSCJ 4KT0J 1HF9A 3L8IA 4R4MA 3S9OA 2QJKC 2IDBA 2JPUA 3IAOA 3JYYA 3GMAA 1EXIA 2WQYC 3JZ0A 2BEZF 3C8GD 3B71A 1YQ4C 3ABVC 2PBEA 1VF5B 2YMKA 2K9YA 1KNYA 3C18A 1R8EA 4I7ZB 3AE9C 3GF3A 4I7ZC 1KQGB 1FDOA 2ZT9D 3AE5C 3K7DA 4GDOA 1NGMB 1JB0J 3AEEC 2D2CB 3AE2C 3C8VA 4YXDC 2Q00A 2L6FA 2KK1A 4PV1B 4H0LB 2E75B 3EWKA 3AECC 1ZZPA 2FXPA 1WTYA 1K04A 4XEFA 1IK7A 4XEKA 2P10A 2D2CC 4EBKA 5F28E 1O3UA 3C8GA 1NYHA 2FBWC 2E75D 2FYNC 4TT3H 2E75C 3RQGA 2JP3A 3GF7A 3AE1C 4H0LD 3LW5J 1DIPA 1MKMA 1ZOYC 1WWPA 4H13B 5KLIC 3Q5SA 1TU3F 4RKUJ 1RQVA 3L8JA 3AEDC 5KKZC 3D6ZA 3GM2A 1QVXA 4OGQB 2JX0A 3AE8C 3SFEC 1VF5D 5M1BA 2YWAA 1VF5C 3GM3A 1PL5A 2WPVB 3GLMA 4PV1C 4XEVA 1Q90D 1KQFB 1KMIZ 2HSBA 3O10A 3BRJA 3AEFC 1OW8A 2QSIA 3SFDC 3T97B 3Q2YA 4Y28J 3O6QA 2WSEJ 3Q5PA 2G8YA 2NZ2A 3GM1A 3AE7C 1KORA 2QIWA 4H0LC 4R32A 1VL2A 1V4AA 3U0CA 2E74B 1PIXA 1K05A 3D70A 1WMKA 1UIXA 4OGQD 4NQFA 5L8RJ 1DD3A 2G3AA 2LK4A 1OW6A 4H13C 2MKVA 4H13D 4YTPC 2H88C 3Q3DA 2L6GA 3AE3C 1AJYA 3RL0g 2QJYC 3R4YA 4U7JA 3H25A 1OW7A 1HJ0A 2E76D 1OMIA 3MFNA 2E76C 2WSFJ 3U3FA 4H44D 1U57A 3IN6A 2J5UA 4H44C 1RQUA 1ZP0C 4Z1MH 4H44B 4OGQC 3D6YA 1JOGA 1WOLA 3AJMA 1FDIA 2QJPC 1Y9BA 1EXJA 3D71A 1ZMEC 4XFJA 2JO1A 1PV3A 4IL6X 1UFBA 2E76B 1S1CX 2OQQA 3AEGC 2V7QJ 2D2CD 4PV1D 3TULA 3G9RA 1K40A 3AE4C 3RK3E 4EBJA 3Q1MA 2L6HA 1KTMA 2ZT9C 2O01J 4R4LA 2E74D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RQF A;  3AE6 C;  3C8G B;  1YQ3 C;  3AEA C;  3RQE A;  3AEB C;  2H89 C;  3L8I A;  3S9O A;  2JPU A;  3JYY A;  2WQY C;  3JZ0 A;  3C8G D;  3B71 A;  1YQ4 C;  3ABV C;  2PBE A;  1KNY A;  3C18 A;  3AE9 C;  3AE5 C;  3K7D A;  3AEE C;  3AE2 C;  4YXD C;  2Q00 A;  2L6F A;  2KK1 A;  3AEC C;  1ZZP A;  1WTY A;  1K04 A;  4XEF A;  4XEK A;  4EBK A;  5F28 E;  1O3U A;  3C8G A;  2FBW C;  3RQG A;  3AE1 C;  1WWP A;  1ZOY C;  3L8J A;  3AED C;  3GM2 A;  1QVX A;  2JX0 A;  3AE8 C;  3SFE C;  2YWA A;  3GM3 A;  4XEV A;  2HSB A;  3O10 A;  3BRJ A;  3AEF C;  1OW8 A;  3SFD C;  3GM1 A;  3AE7 C;  4R32 A;  1V4A A;  3U0C A;  1K05 A;  4NQF A;  2G3A A;  2LK4 A;  1OW6 A;  4YTP C;  2H88 C;  2L6G A;  3AE3 C;  1OW7 A;  3MFN A;  3U3F A;  1ZP0 C;  3AJM A;  1WOL A;  1JOG A;  1PV3 A;  1UFB A;  3AEG C;  3TUL A;  1K40 A;  3AE4 C;  4EBJ A;  2L6H A;  1KTM A; 
#chains in the Genus database with same CATH topology
 1GMJ A;  3WUU A;  1NG1 A;  2GA1 A;  1TWC A;  1O87 A;  5L3V A;  1FNT c;  3JSV C;  1QVG O;  3W67 A;  3L73 J;  2E87 A;  3L72 J;  3HD7 C;  1Y8A A;  1PP9 J;  3MYI A;  2V3C C;  4JTC B;  1E2X A;  2QNL A;  4O79 A;  4ULV A;  3WU2 E;  3G4X A;  1PCX A;  3JRM O;  2KOG A;  1MFZ A;  1RE4 A;  3DJN B;  4G0H A;  1V74 B;  1JB0 J;  2KYV A;  3AEE C;  4NPF X;  1SZI A;  5T3W A;  4D6T E;  4GYT A;  2HKV A;  1G1J A;  1T2K C;  1QZX A;  1J2J B;  5CCG D;  5AVX B;  2Y69 C;  1ZR4 A;  5JLI A;  2R5B A;  1QGK B;  1IK7 A;  2P10 A;  3CCU P;  3BAT A;  2WIT A;  1YYJ A;  2VB6 A;  3PTZ A;  5JP7 A;  3B5N A;  1FE6 A;  2UWJ E;  1G2C A;  4O6N A;  1CGM E;  1ZOY C;  3L71 G;  3MUD C;  1H89 A;  1LS4 A;  3AED C;  1JY2 P;  2WVO A;  5M1B A;  1Y4C A;  4O9B A;  1DH3 A;  3IPM O;  3PP5 A;  5AW3 B;  1FZF A;  3VMY A;  3HLZ A;  1NKN A;  4TLF A;  3O55 A;  1EI7 A;  3L74 D;  1BR1 A;  2XM0 A;  1QX8 A;  2N1T C;  2FXM A;  4EUK B;  1KYO I;  4XPY A;  2KUB A;  3K1I C;  3CWB G;  3PDM P;  2HR3 A;  3RFY A;  5KAF E;  3H1H D;  4JKV A;  3HNI A;  4W8K A;  3L75 E;  4CBE A;  3V2Q A;  3ZVR A;  4G7H F;  2H88 C;  2YL0 A;  3KYJ A;  3R4Y A;  3NMK A;  3K5B A;  3CCJ P;  3VMX A;  2YO2 A;  3RGU A;  3HJC A;  5CBO A;  1YDI A;  1PP9 E;  3VOP A;  1RQU A;  5E3A A;  5TJH A;  5A69 A;  1FU1 A;  4NPD A;  3NFQ A;  2KI7 B;  4XFJ A;  3WMM 0;  2OGU A;  4YL3 A;  5KAF H;  4Y99 B;  1Q0M A;  2R25 A;  3E1R A;  3KH2 A;  3M9B A;  2M64 A;  1J1E C;  5AW9 B;  2BEQ D;  1J1D C;  3POV A;  1JNM A;  1SFC A;  5DS5 A;  4N6J A;  4I1O B;  2IDB A;  2WVR A;  3RH3 A;  2BAS A;  1RKE B;  3LS0 A;  1FTS A;  2OYI A;  4W7Y A;  2QUP A;  1TQG A;  1OVV A;  3P8C E;  3PHF 2;  1ZLL A;  2K9Y A;  5AW1 B;  1NJI Q;  1JPJ A;  4I1M A;  3I5C A;  2WZG A;  2LSE A;  1X8Y A;  5JRA A;  1YAU O;  1L0L E;  1D0Y A;  1OKK D;  2HMQ A;  5AW5 B;  1B68 A;  3DJU B;  1MUU A;  3CAX A;  3ZTZ A;  4PV1 B;  4AYC A;  1L4A D;  2HFI A;  3H65 A;  2FXP A;  1YZA A;  3N24 A;  1BE3 D;  2OJQ A;  2L5G B;  2JDI H;  3EZI A;  3T6G B;  3R2P A;  4PD4 I;  1H0T B;  2O1J A;  3V5Y A;  5DS4 A;  3HUS B;  3L73 G;  4PJJ A;  2QLA A;  4WWI A;  1KFN A;  1I4Y A;  1H7I A;  2E75 C;  5A6B D;  5DQZ A;  2JP3 A;  1SQV D;  3L75 J;  4XQ1 A;  1WN0 A;  2FYZ A;  3GF7 A;  2EIK C;  1GM5 A;  1WWP A;  2B0J A;  3DE9 A;  1EKY A;  2PP6 A;  2FAP B;  4KNV A;  4B6I A;  3ABM C;  5CMZ A;  4XLP F;  2LFD A;  2AXT H;  2IFM A;  5AW6 B;  2V4H A;  1SS1 A;  3A5T A;  2HSB A;  3NKD A;  1URQ D;  3ATP A;  2OQM A;  2NZ2 A;  1ZRT D;  3AE7 C;  1KOR A;  4ZMD A;  1YA7 O;  5KJ7 D;  3SP1 A;  3CX5 H;  5KAI E;  3VF0 A;  3QWO C;  1FAV A;  4C7N B;  2KXP B;  2YVK A;  1E84 A;  2Y39 A;  1CPQ A;  4LLC A;  1NTM E;  2BC5 A;  1NKZ B;  3U9M A;  2Y0C A;  1L0N K;  1LTJ B;  3U3B A;  2ZXE B;  4DJG A;  2P2U A;  1LIH A;  1ZYR F;  1U7M A;  3HD7 B;  1WOL A;  3AJM A;  3FAP B;  1JOG A;  2EIJ C;  3KHU A;  5A6J A;  2CGE A;  1EXJ A;  1GL2 C;  5A6A A;  5AVS B;  1SQB E;  4Y99 C;  1OWA A;  2OQQ A;  3S29 A;  2XLV A;  4DVZ A;  3V6I A;  4CPG A;  1H88 A;  3AE4 C;  4LGD E;  1IZN B;  2N1T B;  2XLO A;  1ZV8 A;  1FMW A;  1YBK A;  3EHM A;  1ORY A;  2ITA A;  5B3S C;  1Z63 A;  4R4M A;  2AXC A;  1LTI C;  1ZVZ A;  2R05 A;  2YHS A;  3N4X A;  1HW1 A;  1Q81 Q;  2XS1 A;  4NTA A;  2R9R B;  4YT5 A;  3EG9 B;  3PMR A;  2M8R A;  1KZU B;  1SVF A;  1RJ9 B;  3CEX A;  2P61 A;  3T97 A;  1M1J C;  2JR8 A;  3H6P A;  2EIL C;  4JEA A;  1HGV A;  2ZXX A;  1VK5 A;  1MV8 A;  3UMI A;  1SQP J;  1RE3 A;  3HUS C;  1AVO B;  5B66 E;  4GQH A;  4EBK A;  4RDA A;  1NAY A;  1NVO A;  2IBF A;  3CCQ P;  3FAJ A;  1KD1 Q;  4CSA A;  4PK4 A;  5AVV B;  1R4T A;  2B89 A;  4FES A;  1NBB A;  3BVH A;  2J9U A;  2CK3 H;  3II6 A;  1BSH A;  4WVZ A;  1CZQ A;  2Q1K A;  5KTB A;  3HRN A;  1FOS E;  1OCC C;  2QIW A;  1ZHZ A;  4F4B A;  2E74 B;  1MMN A;  3TOL A;  5GTH E;  1WMK A;  3C1L A;  4OGQ D;  3QW0 A;  5KYY B;  1SQX K;  2IXM A;  1HMD A;  5L3Q A;  1FC2 C;  4IGG A;  3S27 A;  4JJG A;  4K35 A;  1CI6 A;  2HUJ A;  2NSF A;  3GWL A;  3MX3 A;  1U0B B;  2V26 A;  3JSE O;  3H25 A;  256B A;  3TK0 A;  3S0X A;  1HJ0 A;  3AG3 C;  5AVU B;  2IYO A;  1GD2 E;  1URQ C;  2YKO A;  3E70 C;  2LR2 A;  2WZF A;  3EGX B;  3HE4 A;  3M1C B;  3NRH A;  1X0T A;  2YIU B;  1V55 C;  1NU1 K;  2FYU D;  4PV1 D;  3JT1 A;  2WSE H;  1GTW A;  3L4F A;  4DRH B;  3DZA A;  1GDT A;  1L0N E;  5CI9 A;  1RHZ B;  1KIL E;  1T6Q A;  3H1L G;  1DD4 A;  2W27 A;  3O8Z A;  1FZB A;  2N9Y B;  2J0X A;  1M57 C;  1FJK A;  1QPU A;  3FX0 A;  3ZIB A;  3GEE A;  1L0L J;  1SYQ A;  1LTJ C;  2KLV A;  4BWN A;  4UB8 H;  2OJE D;  1PGP A;  2KK7 A;  1IFN A;  1LGH B;  1VQP P;  1P84 H;  3FXH A;  4D4X A;  3AE2 C;  3C8V A;  1AUE A;  1K8A Q;  1L0L D;  4K0D A;  1NTZ E;  2A0B A;  2NUP B;  1YIJ P;  5CCH C;  1Q0K A;  2YL7 A;  4HKZ H;  1S7Z A;  3KZI E;  3VMZ A;  1O3U A;  1TWH A;  3ZDL A;  1BE3 E;  5JS5 A;  1WT6 A;  3B5N B;  3C8Z A;  5AVY B;  1N1C A;  4Q7C A;  4EBB A;  1NTM K;  3EG9 A;  4N4W A;  3SXZ A;  1KB9 E;  3MGN A;  2HS5 A;  4L74 A;  2ZD9 A;  3DKA A;  2NUT A;  5APX A;  3W8H A;  5AW0 B;  4BEJ A;  1N86 A;  1BCC E;  4PV1 C;  2KYH A;  5CI8 A;  4IB4 A;  4Q5S F;  1EZV G;  2A1D D;  2W4B A;  4Y28 J;  3EGD B;  1NO4 A;  2XL6 A;  4C7O A;  3L75 G;  2NPS A;  4XPX A;  1UIX A;  2Q5U A;  1M2V B;  5CCG A;  3Q6M A;  1DD3 A;  3DXJ F;  2Q4F A;  3T6B A;  2ZJS E;  1OW6 A;  1M2V A;  3MBG A;  1GL2 D;  3QMK A;  4H54 A;  3HD7 A;  1AV1 A;  1LTT C;  3GHG A;  2RH0 A;  3KZI H;  1GU4 A;  1YLM A;  5HSW A;  1OFC X;  2PNO A;  2G3V A;  3CX5 E;  1ZU5 A;  2YXQ B;  1LTA C;  4IAO A;  1S5L H;  1SQB G;  1FZC C;  2H7H A;  1LE4 A;  1ZW3 A;  2BE5 F;  3NDB B;  1S4X A;  3VN0 A;  1LM3 B;  1PGO A;  2HOD A;  4BXL A;  5B1A C;  2KNC A;  1PD1 A;  4BJ1 A;  1TWG A;  2HFE D;  1TKN A;  3B8E B;  2E74 C;  3C8G B;  1SMY F;  5AW8 B;  1Q82 Q;  1OIP A;  4NCQ A;  3W2V A;  2J45 A;  3MYF A;  3S9O A;  1VLT A;  2I15 A;  2Y3H A;  4WY4 D;  2FYN B;  3OW2 O;  2WTY A;  4C7R A;  3P8M C;  1SQX D;  1QVF O;  3M0D A;  2Q9I A;  4HFK B;  2DW3 A;  2OAR A;  2PGD A;  5BUO A;  5T3T A;  2Y9Y A;  3V4W A;  1FDO A;  1M56 D;  2OCC C;  4BJT A;  1HH0 A;  5L0G A;  2IYP A;  2XZR A;  1FBM A;  3H1L D;  1VQN P;  2RSE B;  1NTZ G;  4MVR A;  2KSE A;  2KP8 A;  3HKK A;  2O3J A;  4M3L A;  1OVR A;  3H1L J;  1RXQ A;  2H7B A;  2ZVN B;  3U1C A;  2QE9 A;  4EWC A;  2XU6 A;  1ZU4 A;  3MP7 B;  1MKM A;  1KV4 A;  5KLI C;  3Q5S A;  4N06 A;  1LT9 A;  4JE9 A;  1GQA A;  3LNM B;  2A0U A;  4IFD K;  4MS2 A;  5KJ7 C;  4MVQ A;  4WAB A;  4NPE A;  2EPN A;  2KGO A;  2W8Z A;  1VF5 C;  2WPV B;  3UIA A;  3GLM A;  1URQ B;  2XND H;  3QTH A;  3AEF C;  2QEX P;  3AG4 C;  3ITF A;  2FKW B;  5APS A;  2WPQ A;  3RK2 C;  5COG A;  5GTI H;  1S05 A;  4EHP A;  2P58 A;  1RY3 A;  1G1I A;  2G3A A;  2GUV A;  3VP9 A;  3JSZ A;  1BGY J;  2Y0E A;  1MMA A;  4WY4 C;  1YYC A;  1JMW A;  4PAC A;  1LI7 A;  1Q2N A;  2QJY C;  4U7J A;  4WB4 A;  5AW7 B;  1LNQ A;  2WSS H;  4JIO A;  1BGY D;  5L0C A;  4IFF A;  1QLE C;  3CXH D;  3HE5 B;  1RF1 A;  5F5F A;  2BCC D;  2WWW A;  3ZSU A;  1T6I A;  2P7J A;  2R7T A;  2ZXP A;  2YL3 A;  2DGJ A;  1ZHT A;  5C39 A;  3M91 A;  1NTK D;  4PD4 H;  1L0N G;  2GM4 A;  2CNW D;  4CIP A;  4G7Z F;  3CME P;  3ITK A;  4N6H A;  5KYX B;  4FX5 A;  5E79 E;  1LPE A;  2L6H A;  3RYL A;  3GHG C;  1TFO B;  3AG2 C;  1N7S B;  1IFI A;  2O01 J;  4R4L A;  1KC8 Q;  2K9J B;  3V2N A;  3AGT A;  2O01 H;  4RES B;  1H9T A;  3H32 A;  4EDF A;  1HWT C;  4U3F J;  3TSI A;  3FWN A;  5APT A;  4I7Z B;  1HVV A;  1M1J B;  3O6Q B;  1GS9 A;  2ZT9 D;  3G3Z A;  2N1T D;  3T4R A;  4U3F D;  1HY5 A;  3VP8 A;  2VCB A;  5DVW A;  1S9K E;  1Q0D A;  2VAS A;  3IQ5 A;  1TR2 A;  3EWK A;  2RKL A;  1TFK B;  2L91 A;  2QY9 A;  4CS8 C;  2XSE A;  2KNC B;  4XEK A;  3JYH A;  3EFO A;  1S3J A;  3ZQV A;  2R03 A;  3PLN A;  4G7O F;  1IC2 A;  2E75 D;  1WAS A;  1A7V A;  2XKM A;  4DRJ B;  3RK3 D;  1M1K Q;  3L72 E;  1BGY G;  5KYU A;  4H0L D;  3ZTM A;  1BZ4 A;  5KKZ C;  4AL0 A;  3F46 A;  1BCC G;  2J9B A;  4J7Y A;  4NY3 A;  5EGY A;  1BR4 A;  2W9Y A;  3DAG A;  1VPC A;  2ZYG A;  3NYL A;  2HMZ A;  1KYO D;  2VCA A;  1LTJ A;  3IF4 A;  4W80 A;  3SXM A;  1MMD A;  3P8C D;  2KLU A;  2J7P A;  2Z15 A;  3L74 J;  2JD3 A;  4IFM A;  4R32 A;  4A7P A;  2XV5 A;  2VC9 A;  1ZW2 A;  2B0H A;  4JTA B;  1K9M Q;  5L8R J;  5BQH A;  3RF3 A;  2RD9 A;  3VYW A;  2RN0 A;  3RVZ A;  2X51 A;  1KIL B;  2Y0D A;  1JO5 A;  2LD6 A;  4PFO A;  2R5D A;  2WT7 A;  1KYO H;  4KBL A;  4JRZ A;  2FFD A;  1JTH A;  3GWN A;  2C03 A;  4Z1M H;  4CS7 A;  4J30 B;  4C3D A;  2YO3 A;  4YL1 A;  2C0X A;  5BU5 A;  2J59 M;  5CCH A;  3L71 J;  3L0I A;  1K40 A;  2JWD A;  2HV6 A;  1S5L X;  1VDF A;  2F22 A;  2IXP A;  2WSC H;  3Q5R A;  3SWK A;  3L71 D;  3A7O A;  3WAQ A;  3S1K A;  1EQ7 A;  3L8I A;  3ABL C;  1D0Z A;  3JYY A;  3GMA A;  1IK9 A;  1BCC D;  3BCC E;  2C04 A;  2QJY B;  2Z4E A;  2WQY C;  4E0I A;  2OYO A;  3ABV C;  2PBE A;  3CQZ A;  3U8V A;  1SQQ K;  2R7Q A;  1NFN A;  2Q3T A;  1RE4 C;  2ZYA A;  4D6T D;  1U89 A;  2R7X A;  3FXE A;  1T6U A;  3L36 A;  4LDQ A;  4KI2 A;  1SQB K;  3EH1 A;  3RKO F;  3CX5 I;  1ZHY A;  1K04 A;  5KYW B;  1BE3 G;  3FXD A;  2NUP A;  2YXR B;  1LWU A;  2AEM A;  4BJ6 A;  1RH5 B;  2XXA B;  2XM4 A;  4P9F A;  3TJ6 A;  2FYN C;  4IAR A;  1IFP A;  4XWJ A;  1J1D B;  3SWF A;  3UGP A;  3ECS A;  1SQV J;  1SFC B;  3L75 D;  4JBZ A;  2OYH C;  4WGY A;  3C7J A;  3ZWI A;  3V5Z A;  1TU3 F;  3L72 G;  3V2P A;  3GM2 A;  4LC1 A;  5JVE A;  2G62 A;  1PL5 A;  2GUS A;  1EZV E;  1KMI Z;  1M1J A;  3O10 A;  4PJ0 H;  4KC9 A;  3H1J E;  3CWB E;  2YKZ A;  1KYO E;  2YRF A;  3WOD F;  4C46 A;  4MTO A;  1S5L E;  5E2Q A;  3CI9 A;  3D70 A;  3IHU A;  3GG2 A;  3TD7 A;  3RL0 C;  4ZLC A;  3M4B A;  3KYQ A;  1NLX A;  3N2Z B;  3EPV A;  1DEB A;  4YTP C;  2B87 A;  1PPJ E;  5B1B C;  2I8D A;  5K0I A;  4JCZ A;  1JAF A;  2YMY A;  1A7E A;  3DAF A;  2E76 C;  4OVN F;  1NTK K;  4JPZ B;  4HFF B;  1U57 A;  3WUV A;  2Y3D A;  1K73 Q;  1VQ6 P;  1BR2 A;  3DWW A;  1ZP0 C;  4H44 B;  2HPC A;  2JWA A;  3D71 A;  1HTL C;  2L9J A;  1ZHW A;  2JO1 A;  4IL6 X;  3KL4 A;  2D2C D;  2XS8 A;  1RF0 A;  2R7U A;  4YWQ A;  4I6M C;  1LT9 B;  2IM8 A;  4PJL A;  1QLE D;  4JCH A;  1T6A A;  3AE6 C;  4LDR A;  2R44 A;  2M0B A;  2XLM A;  4CIH A;  1BDJ B;  1NOH A;  3NMJ A;  4PR9 A;  1ZRT E;  3BRT B;  4KT0 J;  3UMH A;  3LES A;  2H8A A;  3A0H H;  2AP3 A;  2W83 C;  2HPC B;  3K6B A;  5IY5 C;  4CDA A;  1SQX G;  1LTB C;  2YMK A;  4YT4 A;  1EDL A;  2YEV A;  3SSU A;  3X1O A;  1G8X A;  3K7D A;  1SQB J;  4DOZ A;  4N78 D;  5H2F H;  2NPS D;  1YTZ I;  3ZG1 A;  3LJB A;  3CC7 P;  1ZZP A;  1JM0 A;  2WPR A;  4CS8 A;  1LWU C;  4BJ6 C;  2OEX A;  3UR3 C;  1JCC A;  1BGY E;  1P84 I;  2PFX A;  4BG0 A;  3LW5 H;  5KLV G;  2M3E A;  1UG7 A;  4LAC B;  1IO4 A;  5AVW B;  4H13 B;  1ORS C;  3L72 D;  1JY3 N;  4YJW A;  1FFT C;  2R3S A;  3D6Z A;  4H4K C;  1QVX A;  4OGQ B;  2XL8 A;  3SFE C;  3O6X A;  4L6R A;  3X2Q C;  4E0H A;  3T9O A;  5KYN A;  1IW7 F;  2XNX A;  2R7S A;  3LUT B;  1KQF B;  4RD9 A;  1PGQ A;  1I5N A;  3G50 A;  4AK9 A;  1EZV I;  3HTK B;  4YPC A;  3V4Q A;  1EZV D;  1VOM A;  2KW3 C;  1OXK A;  3LLI A;  4JZA A;  2E43 A;  5L0D A;  3C63 A;  5KAI H;  3MLG A;  1PIX A;  2YL1 A;  1K05 A;  5F5H A;  2J9W A;  1OR3 A;  2LK4 A;  2VRS A;  1NTM G;  2Z5I A;  1OXZ A;  1FFH A;  3VRC A;  1H9G A;  2Q7C A;  3P32 A;  3E7K A;  1KU2 A;  4DXW A;  2Q3I A;  1YJW P;  4H44 D;  2P7V A;  1SP4 A;  1JY3 O;  3S4R A;  4UB8 E;  1NWQ A;  1E5W A;  1QEX A;  4DRI B;  1P84 E;  3W2W A;  2L7A A;  1ZME C;  1UFB A;  3H1J D;  1AVO A;  1LS1 A;  3Q7L A;  2C0W A;  5BU8 B;  2QJP B;  1Q0F A;  1EDJ A;  3L1M A;  4JUR I;  4EI2 A;  5B5E E;  5AVQ B;  3GEH A;  1HBW A;  2ETS A;  4MTF A;  3PHL A;  2OU6 A;  3QW1 A;  1YJG A;  2CDQ A;  3L37 A;  3S28 A;  3H1H G;  4XA4 A;  1JY2 N;  2QJK C;  3QZC A;  2FY8 A;  4WBA A;  5KJ7 A;  1N73 B;  4JJF A;  4I1L A;  4U5C E;  4AX2 A;  3A3Y B;  4XTK A;  2POH A;  4OD4 A;  2A45 H;  1JTH B;  4GOD A;  3GF3 A;  4I7Z C;  1SQV K;  4N6C A;  3H2U A;  5AW2 B;  3U1A A;  1YZC A;  4YXD C;  1JY3 P;  1KIL A;  2E42 A;  3HE4 B;  1HGZ A;  4I2L C;  3AEC C;  3GW6 A;  4E17 A;  4JF7 A;  1YVI A;  4LLE A;  1XWJ A;  2OTK E;  3C62 A;  3I5Q A;  3UMK A;  4YL0 A;  3CCM P;  4MVS A;  3CL3 D;  1GK4 A;  5APV A;  2IXO A;  2Y3G A;  4W7Z A;  4LLH A;  2EPK X;  3DI5 A;  3AQC A;  2QVA A;  1L4A B;  1DIP A;  3H1K D;  1M90 Q;  3MUD A;  4YT2 A;  3CXH I;  3HNL A;  5L0I A;  3AE8 C;  5APU A;  3F89 A;  4A2N B;  3GM3 A;  2NPU A;  2DB4 A;  5DJT B;  1OX3 A;  3H1K J;  2OYH B;  1H8A A;  1MQV A;  3Q2Y A;  3L35 A;  4WGZ A;  4CJG A;  1EDK A;  3Q5P A;  2BCC J;  5EHH A;  1FZC A;  1T3U A;  3GOR A;  3M15 A;  2K3R A;  2XLD A;  1VYK A;  3HNJ A;  3U0C A;  1U6H A;  2LCH A;  3T6J A;  1NTK J;  2IOQ A;  1BE3 J;  1I4Z A;  1RKC A;  2HJM A;  2YLD A;  1PPJ G;  1SF8 A;  5TIS H;  4DCK A;  4IL6 E;  3KKB A;  3L73 D;  1FJP A;  3H32 B;  2IBZ I;  1A02 F;  1G5Z A;  1QKR A;  2FYU K;  2K1A A;  2J5U A;  3F5H A;  4MQ9 F;  4BRY A;  5GPG B;  3HTK A;  3V2R A;  5AC4 A;  1AVY A;  2E76 B;  1RE3 C;  3TUL A;  1HE1 A;  3G9R A;  1S72 P;  4GEH A;  1LTG C;  3RK3 E;  1KTM A;  2K9J A;  4PJM A;  5AGF A;  1CI6 B;  2PRR A;  1HW2 A;  3FGA D;  4EIJ A;  3KYI A;  5APQ A;  3M9H A;  2YIU C;  2AWC A;  1LWU B;  3BCC G;  2A69 F;  5HV9 A;  1SFC C;  2A6H F;  5FCL A;  2IFN A;  4D4N A;  3ZC4 A;  3IAO A;  1T9K A;  5GTH H;  1EXI A;  1LJ2 A;  5CCH D;  3FWL A;  1Z5Z A;  1YQ4 C;  1OR2 A;  2FFD C;  4A4A A;  4IWB A;  1KQG B;  2XDJ A;  4ZNC A;  5AC5 A;  1IZM A;  2Q9B A;  2LXB A;  1YAR O;  1LT9 C;  4RJT A;  3B0P A;  5BQI A;  2Q00 A;  2KZJ A;  1NU1 E;  1WGW A;  3W4Y A;  3TNU A;  4C7O B;  4IRU A;  5B3I A;  2BCC E;  3LAY A;  2A45 I;  3CMA P;  1C02 A;  3CD6 P;  5KLV E;  1Q7Y Q;  1USD A;  2Q7R A;  1NYH A;  3JCU H;  2FBW C;  3L70 G;  2IYL D;  1AFO A;  5L0H A;  1N2D C;  2QRX A;  1LE2 A;  2PX0 A;  1G4U S;  2ASR A;  2Q3E A;  2GAQ A;  2ZYD A;  2OKU A;  3U9J A;  3L8J A;  4GIF A;  4UDV A;  1O5H A;  1N73 A;  1D1B A;  3JCU Q;  3TQO A;  5K5G B;  3H1J G;  3TK1 A;  2Y9Z A;  2CW0 F;  4KJM A;  5E3C A;  3U2L A;  2AEF A;  4M63 A;  2P67 A;  3T97 B;  1TWA A;  2HJ3 A;  4MW8 A;  1NSG B;  1JOC A;  1SQP D;  3CCR P;  4EOT A;  1AQT A;  1R5S A;  2G3K A;  2HSQ A;  2P0N A;  1MZ9 A;  4NQF A;  5DJU B;  2I1K A;  3Q7G A;  2AEJ A;  1DEE G;  3BRV B;  3H1I J;  3QVZ A;  5BQG A;  2CCY A;  4H13 C;  3K1H A;  4I44 A;  2KB7 P;  1AJY A;  3U59 A;  2EIM C;  2LKM A;  1A02 J;  1HUC A;  2Z5H A;  3SNH A;  3SXK A;  4BJ5 C;  1M6T A;  2YLG A;  2CPS A;  2WSF J;  2P6V A;  3OEO A;  3MHV A;  1VQL P;  3A0H E;  1YI2 P;  1FMV A;  1NH4 A;  2YKP A;  1NTZ K;  2LFF A;  2NPS B;  4FAP B;  1GW4 A;  1VQ9 P;  2HLO A;  1S2E A;  1L0N D;  2ZFC A;  4OH8 B;  2HOD B;  3G4Z A;  3IFM A;  2QJK B;  2GDC A;  1AEP A;  3B5N C;  1J1E B;  3BEH A;  3LS1 A;  1PGJ A;  1YQ3 C;  2D5R B;  2J58 A;  5E33 A;  3RVY A;  5KLV J;  3GEI A;  2H89 C;  1YTZ T;  4RO0 A;  1HF9 A;  1BSN A;  4J32 B;  1LP1 A;  3OWT A;  1SQX E;  2KS1 A;  1G4W R;  3TGU D;  2Q6Q A;  2LQG A;  4YXW H;  3LIE A;  5A6B A;  4QMA A;  5AVZ B;  2FXO A;  4IOI H;  4DT0 A;  2P1A A;  1OCO C;  4MVU A;  3IQT A;  4HB1 A;  2L6F A;  3RBX A;  4W8P A;  3TYY A;  1VQO P;  4PD4 E;  2FYU J;  1NU1 G;  1R5I D;  2D2C C;  3C9I A;  3NG1 A;  1V54 C;  2IBZ G;  2I8B A;  2VH3 A;  3HNK A;  2R7R A;  4TT3 H;  4LER A;  5GTI E;  4E18 A;  4HEA J;  3SXY A;  3JCU E;  4MN4 C;  1H6G A;  3L70 E;  5TJ5 E;  1CW5 A;  5CCG C;  2FGY A;  3ASO C;  2ICW G;  3EFO B;  4IAQ A;  3H1K E;  3TOM A;  1N7S A;  3A2A A;  1J8Y F;  1NU7 D;  4U9D A;  3E9V A;  2XL4 A;  2M3B A;  4CX9 A;  3SYN A;  5CJ0 A;  2LXC B;  3BRJ A;  5DQT A;  2M5A B;  3O6Q A;  4NTF A;  1IJD B;  4NC3 A;  2XLW A;  4DVY P;  2JKV A;  2OYI B;  1U7J A;  1FS0 E;  1OKK A;  4H0L C;  4K3A A;  1VL2 A;  1KB9 H;  3RL0 D;  3TDK A;  2FFH A;  2M4E A;  1L4A A;  1VB5 A;  3USS A;  1G2C B;  1D1C A;  2FYU G;  2OG2 A;  1N7S C;  2GFH A;  1BDD A;  4ZLD A;  2I1J A;  2L6G A;  3RL0 g;  1HJB A;  2R7W A;  1JMM A;  3M0D C;  3GOD A;  4BPM A;  1VLS A;  3QVY A;  3RK2 D;  2NG1 A;  2MWQ A;  3U8P A;  1AQ5 A;  1URQ A;  3GAN A;  1DX7 A;  2W6J H;  3I55 P;  4MVM A;  3FOP A;  1ZHX A;  1VYI A;  3KXD A;  1D7M A;  3RK2 B;  1R5L A;  3EZH A;  1EQ1 A;  1S1C X;  3G4S P;  1X22 A;  3ZDM A;  2V7Q J;  2ZAE B;  3LID A;  2EIN C;  3FDQ A;  2XLH A;  3E1I A;  2PF4 E;  4AE4 A;  2ZT9 B;  3H1H E;  1MFT A;  2WSF H;  4GKG A;  1SQV G;  4GOE A;  3K1I A;  1CPR A;  2W4M A;  1IFM A;  2A06 D;  1FZE A;  2DYR C;  2WSC J;  4YN0 B;  3G71 P;  5DLJ A;  4DZO A;  4QI2 A;  1PP9 D;  1NTM D;  3L34 A;  1PD0 A;  1T01 A;  2YNY A;  2IX7 C;  2WZ7 A;  2KIK A;  2UUH A;  1JY2 O;  3CLQ A;  2DYS C;  1EC5 A;  4AQR D;  1YHQ P;  3MIW A;  4MW3 A;  2OYH A;  4P9T A;  4FWV A;  1NTM J;  3M4C A;  4DJ9 A;  4U5B E;  1T3J A;  4Z9J A;  2NPS C;  3MD0 A;  5APW A;  4WJ0 A;  4IJJ A;  2IZ0 A;  1M2O A;  5KYY A;  3M0A A;  5JSL A;  1E85 A;  1MND A;  4PD4 D;  5F28 E;  3WUT A;  4C3E A;  1J8M F;  3C8G A;  4O6M A;  3DE8 A;  2PP4 A;  3RQG A;  2LP4 A;  3V7O A;  1RJ9 A;  3EHN A;  4YT8 A;  4ER9 A;  2WVN A;  4ZKP A;  1YA9 A;  2ZPA A;  2KSJ A;  1RQV A;  5KYX A;  1KIL C;  4GT1 A;  1OCZ C;  1GU5 A;  2PAJ A;  3B9Q A;  4ULW A;  2CNW A;  4KNW A;  1E83 A;  2C9N Y;  4I3M A;  2ZXW C;  2KJG A;  5JUA A;  2XRH A;  2D4U A;  4BJ5 A;  1X9V A;  3EJN A;  1PZQ A;  1ZN5 A;  2GA0 A;  3A9C A;  3NYM A;  3CCE P;  3Q6N A;  4JTD B;  2WMM A;  1VQM P;  3CCL P;  1T2K D;  3PH0 A;  4CS9 C;  1ST6 A;  1FOS F;  2A6E F;  3NXS A;  1M57 D;  2KSF A;  2LIG A;  3NKE A;  3KPE A;  2KQ9 A;  4MVO A;  2FYU E;  4JW1 A;  5BVZ A;  5CIV A;  4XE5 B;  3KMI A;  4DOJ A;  1OMI A;  3ABK C;  1LTS C;  5CHX A;  1KB9 I;  2FFD B;  4O7G A;  3BCC D;  1ZXG A;  5KLV K;  2HZ8 A;  4UB6 E;  5B66 H;  2NUT B;  1SR2 A;  2GWW A;  4PJ0 E;  1KN7 A;  3CWB J;  1HE9 A;  3AEG C;  3FMS A;  1QL2 A;  1ORJ A;  3W8I A;  1GZL A;  2A45 G;  4OIO F;  2A68 F;  1NTZ J;  1KQL A;  3H2V A;  5FZT A;  4OIR F;  5E79 H;  2N1T A;  2KC3 A;  3CWB D;  1VQ7 P;  3RL0 B;  1HMO A;  3RQE A;  2TMV P;  3NMI A;  1SQQ G;  4CS9 A;  1YIT P;  1AA0 A;  3IQC A;  4BRY B;  3OA1 A;  3OAK A;  2PFD A;  3UGO A;  4UB6 H;  4YK5 A;  3SZR A;  1D0X A;  1DOW A;  3AE9 C;  1M56 C;  4AUW A;  3AE5 C;  1NGM B;  1S9K D;  2H7O A;  2D2C B;  1SQB D;  4HH2 A;  2EPM X;  1KB9 D;  2BCC G;  2H7V C;  2A06 G;  2KNH A;  2ZVO B;  1Q86 Q;  3B4S A;  2OTL P;  4HYT B;  1XZP A;  2B87 B;  1ZR2 A;  3MZW B;  3IR9 A;  2WPS A;  5EK0 A;  3AE1 C;  1GW3 A;  4U3F E;  3H1K G;  1Z56 A;  3EQL F;  2JJL A;  5CBN A;  4L73 A;  2JX0 A;  3SWY A;  1CGO A;  1VF5 D;  2XLE A;  2BL2 A;  3V5B A;  2OYI C;  2IZ1 A;  2EPO A;  2YKQ A;  3I4U A;  1GGQ A;  1SQQ J;  1F1M A;  5COF A;  1L3P A;  5H2F E;  4ANJ A;  3O39 A;  1RMV A;  4IL6 H;  4QI0 A;  1M7L A;  3RBZ A;  1SQP G;  3CXH H;  3DD7 A;  5B5E H;  1SQQ D;  2QM8 A;  2MKV A;  1MMG A;  1Z6A A;  4NTB A;  1OCR C;  1JPN A;  2JEE A;  1E86 A;  1SQX J;  3MFN A;  3B5N D;  3H1I G;  5KYW A;  3LNR A;  2ZXO A;  5COM A;  3IN6 A;  5KYU B;  2QG4 A;  4OGQ C;  2J0W A;  1IFJ A;  4PJN A;  2QTV A;  3AQB A;  4N78 E;  2H8P D;  3CCV P;  2O01 N;  2YZS A;  3FOO A;  3CC4 P;  3H1H J;  4E7S A;  1BDC A;  3CPW O;  1VQ5 P;  1SQV E;  1W5C E;  1OVU A;  2MYS A;  3L70 D;  1VQ8 P;  4O6Y A;  3ASN C;  4OD5 A;  3RQF A;  3U5S A;  4CJO A;  4EIY A;  4E7Z A;  1FAP B;  1QSP A;  3KDP B;  1RF1 B;  3H1L E;  3HE5 A;  5AVT B;  3L70 J;  3A0B E;  2E5T A;  1QL1 A;  3V5X A;  3C18 A;  1QQ3 A;  3AOU A;  1SQP K;  4X0R A;  1NU9 C;  2KK1 A;  4ZKU A;  4H0L B;  2AU5 A;  4XEF A;  4BEM J;  3HD7 D;  3J06 A;  2IBZ E;  2A06 E;  4U5G A;  2K88 A;  2W6A A;  3VYI A;  3A0B H;  3P7K A;  5TIS E;  2J8W A;  5AVR B;  2O1K A;  3H1I D;  3S90 A;  2QE7 H;  3MTU E;  2K37 A;  1BCC J;  2X0C A;  2R3C A;  3M9Q A;  3HTK C;  4U3F G;  3M06 A;  3TJ5 A;  1T8Z A;  4JVS A;  2H43 A;  4CDV A;  2Q9A A;  3RIP A;  4GOF A;  4XEV A;  4DBR A;  4CDY A;  4D6T J;  1USE A;  2QSI A;  3TF5 A;  2WSE J;  2G8Y A;  1PFI A;  1N7L A;  2AXT E;  2YLI A;  3DM5 A;  3WHN A;  3CXH E;  1V4A A;  2WT7 B;  4G78 A;  1FZG A;  1L0N J;  1PPJ D;  1LP1 B;  4H13 D;  1N8R Q;  1SLQ A;  3VTP C;  3Q3D A;  2WVQ A;  4B86 A;  3LEV A;  1NAF A;  1Q0G A;  3EFG A;  5JT4 A;  5KLV D;  3R7C A;  1LI5 A;  5T1D B;  5L0J A;  1YJN P;  3TGU J;  3D6Y A;  2OOC A;  4OIN F;  2SPZ A;  2QJP C;  1MNE A;  4JYB A;  1W2B O;  1Y47 A;  2ZXR A;  1PV3 A;  1FDM A;  3SEO A;  1KQS O;  2DI3 A;  4JQ0 D;  4L75 A;  3IEE A;  3FHD A;  3I56 P;  3RW0 A;  4EBJ A;  2O9X A;  1NTK E;  2WZL A;  1C03 A;  1LT1 A;  1SQQ E;  1RCP A;  5AW4 B;  1A41 A;  5DS6 A;  5L0F A;  1JEK A;  2OEV A;  3OJA B;  3AEB C;  1RF1 C;  4C7N A;  1Z3I X;  3CX5 D;  1GK6 A;  3C8G D;  1FR0 A;  2MJZ A;  1NZE A;  1YJ9 P;  4J7T A;  1JMB A;  1IFD A;  4KHX A;  5KLI B;  3AGU A;  2MHR A;  3I5P A;  4ASW A;  2J46 A;  3RK3 B;  3CSK A;  3CCS P;  2YQY A;  1SFC D;  3EQ2 A;  3N7N A;  2N9B A;  3L74 E;  4WY4 A;  5EFW B;  4XPW A;  2RMZ A;  3EGD A;  4MVZ A;  2L81 A;  1VQ4 P;  1RKE A;  4HE8 D;  2NSG A;  5D92 A;  1WAT A;  2WL8 A;  4OIP F;  3LW5 J;  1JR8 A;  2QA4 P;  2P1J A;  3EFF K;  3JRT A;  2YWA A;  4LDK A;  1LVK A;  2R32 A;  2E5Y A;  3TNU B;  2R02 A;  1W2E A;  2IPP A;  1E79 H;  2QM7 A;  1Q90 D;  2HG5 D;  1OW8 A;  3SFD C;  2UUI A;  3EH2 A;  2XXA A;  3VMA A;  3KQG A;  4WY4 B;  3FVY A;  4AE4 B;  2W45 A;  3AG1 C;  4DBQ A;  2AVK A;  3B29 A;  4Q4Z F;  1M8O B;  2HV7 A;  1DOV A;  1A0B A;  4K7B A;  1N7S D;  4Z9I A;  2CYD A;  1WRG A;  3TGU G;  3LLK A;  2B9B A;  3AE3 C;  1OW7 A;  2E76 D;  4U5E E;  3U3F A;  2W6B A;  1P84 D;  4JEB A;  3K66 A;  4OWF A;  2EPL X;  1Y9B A;  1PP9 G;  1FZC B;  1D1A A;  3G6E P;  3NTN A;  1CGN A;  1W2W A;  4L76 A;  3CZ6 A;  1BBH A;  4N3Y B;  1VTM P;  3W68 A;  1UII A;  3Q1M A;  3JC2 2;  1JCD A;  2Y3B A;  4JYC A;  3ZQY A;  4EKW A;  4JC7 A;  2M5A A;  4P6I C;  1LKX A;  3VAY A;  3AEA C;  4CSA C;  2VCC A;  2IXN A;  3VM6 A;  2JPU A;  1XZQ A;  3HUS A;  3EGX A;  1N73 C;  3DM9 B;  3JZ0 A;  2BEZ F;  3BAS A;  3US6 A;  3B71 A;  1VF5 B;  3PJS K;  1VQK P;  2V7Q H;  1KNY A;  1R8E A;  1T5O A;  4D6T G;  2J7P D;  4U5D E;  3S84 A;  4GDO A;  3CC2 P;  1OXB A;  3RK3 C;  2W90 A;  3PRJ A;  3KPH A;  3LEO A;  1NHL A;  1L0L G;  3H1J J;  2E75 B;  2WB7 A;  2PX3 A;  3PCV A;  1WTY A;  3NMD A;  2C9L Y;  3WG7 C;  1X79 B;  1RF0 C;  3UNG C;  3L74 G;  2B88 A;  3L73 E;  3L71 E;  3OA7 A;  2R7O A;  5CJ4 A;  1OQC A;  3B0V C;  1EDI A;  1Z7Q c;  1L4A C;  1Z23 A;  1KIL D;  4RKU J;  4HJG H;  1L2P A;  1GL2 A;  2R7V A;  2KS1 B;  1NFO A;  2J9V A;  4MND A;  4C3B A;  4EYY Q;  3BCC J;  3U2M A;  1SQP E;  1L0L K;  2HYN A;  5KKZ B;  3IQ6 A;  4U9E A;  1Y6D A;  3B0U X;  4OIQ F;  2IBZ D;  3K33 A;  2AWY A;  3DMD A;  3GM1 A;  2KZI A;  4U5F E;  4MTG A;  1XTC C;  4QDL A;  4XLN F;  4Z9H A;  1KFM A;  4U5H A;  4K1O A;  1NTZ D;  1APC A;  2NRG A;  3WU2 H;  1FZA A;  1EA8 A;  4RBN A;  2OTJ P;  1XTG B;  3H1I E;  2CPB A;  1ZW0 A;  3TGU E;  3NYJ A;  4ASV A;  3N0T A;  1A7D A;  1NU1 J;  1C17 M;  1JUN A;  4ONS A;  3F47 A;  5APY A;  1L7C A;  4H44 C;  3A11 A;  1FDI A;  3QH9 A;  2Q9C A;  1YYX A;  3JTL O;  5A6K A;  3M79 A;  1JRA A;  4AL1 A;  5D91 A;  1NU1 D;  1CSB A;  1NTK G;  4PFP A;  1VMA A;  1OZH A;  1H0T A;  2ZT9 C;  1GL2 B;  3GHG B;  2E74 D; 
#chains in the Genus database with same CATH homology
 1S5L X;  2ZT9 B;  3FGA D;  3RQF A;  2E74 C;  1GMJ A;  3AE6 C;  3C8G B;  1KIL E;  1YQ3 C;  2YIU C;  3Q5R A;  2BEQ D;  3AEA C;  1ZRT E;  3RQE A;  1DD4 A;  3AEB C;  2H89 C;  2WSC J;  4KT0 J;  1HF9 A;  3L8I A;  4R4M A;  3S9O A;  2QJK C;  2IDB A;  2JPU A;  3IAO A;  3JYY A;  3GMA A;  1EXI A;  2WQY C;  3JZ0 A;  2BEZ F;  3C8G D;  3B71 A;  1YQ4 C;  3ABV C;  2PBE A;  1VF5 B;  2YMK A;  2K9Y A;  1KNY A;  3C18 A;  1R8E A;  4I7Z B;  3AE9 C;  3GF3 A;  4I7Z C;  1KQG B;  1FDO A;  2ZT9 D;  3AE5 C;  3K7D A;  4GDO A;  1NGM B;  1JB0 J;  3AEE C;  2D2C B;  3AE2 C;  3C8V A;  4YXD C;  2Q00 A;  2L6F A;  2KK1 A;  4PV1 B;  4H0L B;  2E75 B;  3EWK A;  3AEC C;  1ZZP A;  2FXP A;  1WTY A;  1K04 A;  4XEF A;  1IK7 A;  4XEK A;  2P10 A;  2D2C C;  4EBK A;  5F28 E;  1O3U A;  3C8G A;  1NYH A;  2FBW C;  2E75 D;  2FYN C;  4TT3 H;  2E75 C;  3RQG A;  2JP3 A;  3GF7 A;  3AE1 C;  4H0L D;  3LW5 J;  1DIP A;  1MKM A;  1ZOY C;  1WWP A;  4H13 B;  5KLI C;  3Q5S A;  1TU3 F;  4RKU J;  1RQV A;  3L8J A;  3AED C;  5KKZ C;  3D6Z A;  3GM2 A;  1QVX A;  4OGQ B;  2JX0 A;  3AE8 C;  3SFE C;  1VF5 D;  5M1B A;  2YWA A;  1VF5 C;  3GM3 A;  1PL5 A;  2WPV B;  3GLM A;  4PV1 C;  4XEV A;  1Q90 D;  1KQF B;  1KMI Z;  2HSB A;  3O10 A;  3BRJ A;  3AEF C;  1OW8 A;  2QSI A;  3SFD C;  3T97 B;  3Q2Y A;  4Y28 J;  3O6Q A;  2WSE J;  3Q5P A;  2G8Y A;  2NZ2 A;  3GM1 A;  3AE7 C;  1KOR A;  2QIW A;  4H0L C;  4R32 A;  1VL2 A;  1V4A A;  3U0C A;  2E74 B;  1PIX A;  1K05 A;  3D70 A;  1WMK A;  1UIX A;  4OGQ D;  4NQF A;  5L8R J;  1DD3 A;  2G3A A;  2LK4 A;  1OW6 A;  4H13 C;  2MKV A;  4H13 D;  4YTP C;  2H88 C;  3Q3D A;  2L6G A;  3AE3 C;  1AJY A;  3RL0 g;  2QJY C;  3R4Y A;  4U7J A;  3H25 A;  1OW7 A;  1HJ0 A;  2E76 D;  1OMI A;  3MFN A;  2E76 C;  2WSF J;  3U3F A;  4H44 D;  1U57 A;  3IN6 A;  2J5U A;  4H44 C;  1RQU A;  1ZP0 C;  4Z1M H;  4H44 B;  4OGQ C;  3D6Y A;  1JOG A;  1WOL A;  3AJM A;  1FDI A;  2QJP C;  1Y9B A;  1EXJ A;  3D71 A;  1ZME C;  4XFJ A;  2JO1 A;  1PV3 A;  4IL6 X;  1UFB A;  2E76 B;  1S1C X;  2OQQ A;  3AEG C;  2V7Q J;  2D2C D;  4PV1 D;  3TUL A;  3G9R A;  1K40 A;  3AE4 C;  3RK3 E;  4EBJ A;  3Q1M A;  2L6H A;  1KTM A;  2ZT9 C;  2O01 J;  4R4L A;  2E74 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...