1KTMA

Solution structure of fat domain of focal adhesion kinase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
139
structure length
139
Chain Sequence
MANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDESLPVLPASTHREIEMAQKLLNSDLAELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMISQSRPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FOCAL ADHESION KINASE 1
publication title Structural Insight into the Mechanisms of Targeting and Signaling of Focal Adhesion Kinase
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 53
structure length 139
sequence length 139
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2002-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ktmA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1ktmA02
1YQ3C 3B71A 1UFBA 3K7DA 3L8IA 3AE7C 3AECC 3JYYA 3GM3A 1KNYA 1K05A 3AEAC 3O10A 3U0CA 3AEEC 2L6HA 2G3AA 3SFEC 4YXDC 3S9OA 1ZOYC 3U3FA 1WTYA 1YQ4C 3C18A 1ZP0C 3AE4C 2Q00A 3AE5C 3AE8C 3BRJA 3RQGA 3MFNA 2WQYC 3AE1C 1K40A 4R32A 2PBEA 4NQFA 3TULA 3L8JA 2KK1A 2YWAA 1OW6A 5F28E 3AE3C 2LK4A 4YTPC 3AE6C 3AEDC 3AE2C 2JPUA 2JX0A 1O3UA 1QVXA 1JOGA 3AEGC 2L6FA 4XEFA 2H89C 1OW7A 1PV3A 3C8GB 2H88C 1ZZPA 4EBKA 4XEVA 3GM1A 3RQEA 1K04A 4EBJA 3C8GD 1KTMA 4XEKA 2HSBA 1OW8A 3AEFC 1V4AA 3AE9C 3GM2A 3JZ0A 1WWPA 3ABVC 3C8GA 3SFDC 1WOLA 3AEBC 2L6GA 3AJMA 2FBWC 3RQFA
chains in the Genus database with same CATH superfamily
4PFPA 3V4WA 4BEMJ 1KMIZ 1FAPB 1QPUA 3RIPA 4YT5A 5TISE 3U59A 1NZEA 4HKZH 1L4AB 1SLQA 5APUA 4YL0A 1IJDB 1NYHA 4EI2A 1NTZG 4C3EA 2XZRA 2M8RA 2PFDA 4PJNA 5GPGB 3V5ZA 4BRYB 1SQVD 1LTSC 1GDTA 2M64A 1MFTA 3S0XA 2FAPB 1UG7A 4NPDA 5IY5C 2AEMA 3CXHD 4K0DA 4G78A 5L0HA 1FMVA 3GLMA 5KJ7A 2DB4A 2J5UA 1T6IA 2B89A 1WN0A 1JCCA 3C18A 1IZMA 4G0HA 4H0LC 3RK3D 4NY3A 2ITAA 3L72E 1KQFB 1NH4A 2WQYC 3NMIA 4DBQA 2E75B 4XPYA 3L71D 1V74B 2XLDA 4JQ0D 1SQQD 1NU1E 5DQTA 1TFKB 2POHA 3EJNA 4BPMA 2IM8A 3L72J 2WZFA 2KYHA 1QVFO 2ETSA 4GYTA 4OWFA 4CS9C 3B5NC 2XM4A 2XV5A 2K9YA 3HD7D 1PL5A 3EFFK 3L4FA 2XRHA 5KYNA 1VYIA 3B0VC 3C7JA 1GL2D 4W7YA 5KLIB 2H89C 2GA1A 1Q90D 2OEXA 1SVFA 2FYUD 3NDBB 2QJYC 1ZZPA 3L37A 4O6YA 2AEJA 1O87A 5CI9A 1PD1A 1YJWP 2ZFCA 5TISH 4BJTA 3CCUP 4HE8D 2IYPA 1KTMA 2QNLA 2BL2A 3KL4A 3L73E 4A4AA 1FZBA 4PR9A 1U0BB 4OGQB 1FDOA 3GWLA 4D4NA 3POVA 2V3CC 1ZR2A 3RK3C 5B1AC 1KYOD 1FZEA 3GMAA 4NPFX 4RO0A 3M0DC 1L0LD 5B5EE 2A06D 1MV8A 1L0NJ 5GTHE 3WHNA 2HFIA 3O39A 1M2VB 2ZYAA 1FDMA 1D7MA 4GT1A 3IEEA 4JURI 3CQZA 1SQBK 1AQTA 3EG9A 3HTKA 1RQUA 3C63A 2QA4P 3JCUQ 3Q6MA 1VQLP 1LJ2A 2FFDB 2Q3IA 3V7OA 1OVVA 1A02J 1LWUC 2YIUB 1CW5A 1S3JA 1HE9A 2GUVA 1GL2C 1NTZJ 3Q3DA 3QWOC 1L4AA 1SQBG 1HGZA 3FAJA 4ZLCA 3NYJA 2Q00A 3AGUA 2IDBA 4A7PA 1IFMA 1ZMEC 1VLSA 4BRYA 1FR0A 4JTCB 3IF4A 4ASWA 5KTBA 3B29A 5EK0A 1PPJE 4GIFA 1IFJA 2QTVA 3SP1A 3UMHA 2XLWA 4GOFA 3Q5PA 1M7LA 1SQXK 2QE7H 4H13B 2Y69C 2EILC 3G50A 2A68F 1IFDA 1R5SA 3AE3C 1FZCB 2BEQD 1OFCX 3M1CB 2A69F 3H1HG 4JF7A 2Q7CA 1X9VA 5TJHA 1EQ7A 1IW7F 1O3UA 1Q0MA 1EZVG 4IFFA 4I2LC 5HSWA 1QVXA 2E5TA 1OKKA 5A6AA 4YWQA 1NU7D 3FXEA 3C8GB 4J30B 1YA7O 4M3LA 4R4MA 5B5EH 4CJOA 3BRTB 3E9VA 1Y47A 3A5TA 5KKZC 5AVWB 2PNOA 1FDIA 2VCBA 5GTHH 1CSBA 2P0NA 3PCVA 3SEOA 3IPMO 3ZG1A 2KZIA 2QM7A 1USDA 2WZ7A 4CSAA 1A02F 1JR8A 1JO5A 3EFGA 3SFDC 1WOLA 2YLDA 4O6NA 3ZTZA 2FBWC 1JEKA 3VMAA 2QUPA 1FOSF 1L0ND 2EINC 3H25A 3K7DA 2IBZI 3EH1A 2R3SA 1H7IA 1KFMA 3VN0A 2Y3BA 5K0IA 1C03A 5F5HA 3JTLO 5EHHA 1ZU5A 3TSIA 2A1DD 2G62A 1LE2A 2W8ZA 2ICWG 1APCA 1RCPA 2NUTB 4OD5A 3I5PA 1AV1A 1GZLA 1VQNP 2Y9YA 1VLTA 4MVRA 1HJ0A 3E70C 4IARA 1GGQA 4IAOA 3MHVA 4JZAA 3HNJA 3V4QA 1SQBE 4MS2A 1YVIA 4MVSA 3QZCA 3SZRA 1BGYG 1AUEA 3DJUB 3AE8C 2FFDA 1G4WR 3L70E 1EXIA 3MFNA 4I1MA 1YZCA 3V5XA 1PGJA 1YYJA 2QVAA 5T1DB 1NU9C 4PD4D 2LP4A 2WSFH 1DEEG 4CDAA 1RMVA 3A2AA 2JKVA 3A0HE 3DAFA 1PP9E 2H7VC 2HUJA 1Q0GA 2LXBA 3H2UA 2L9JA 4XTKA 4Z9JA 3AEDC 4Z1MH 1JY2N 3FGAD 4U3FG 4YXWH 3FMSA 5BQIA 5CCGA 4MVOA 1EZVE 4I7ZC 1UIXA 1SQXE 3VMXA 1PV3A 3V5YA 3MUDC 3N7NA 1AJYA 1WASA 4PJJA 2JWAA 4NCQA 3JCUE 1JCDA 3LIEA 3V2RA 4LDRA 3RBZA 3H1HJ 4DBRA 1LTTC 1FZCA 2D2CD 3TF5A 2O01H 5AW8B 1NBBA 1V55C 3F5HA 2HMQA 3B8EB 1MMAA 2J0XA 1VYKA 1ZW0A 3AE9C 3H1KE 2XNDH 1JY3O 3MYFA 4NTFA 3C8GA 3H1IG 5BUOA 2E76D 2YLGA 2FYZA 5D91A 1T01A 1LVKA 1FBMA 1PZQA 5DS5A 2G8YA 3L34A 5L3QA 3V6IA 1SQVK 2DW3A 2IFMA 2K88A 3AECC 3JYYA 3K1IC 2M3BA 4DZOA 1D0YA 1IO4A 2P10A 2Z15A 4YL3A 2CK3H 2V4HA 4KBLA 5AW3B 5CMZA 4IAQA 3T6BA 2HFED 2XLOA 5BQGA 4BWNA 5K5GB 2OJQA 1JB0J 2JO1A 1SMYF 5COMA 2JWDA 1OVRA 3S84A 1LPEA 1VL2A 5AVVB 3EQ2A 5CHXA 2R32A 2J7PA 1KILE 4LDQA 1SQVG 1C02A 4YT2A 3A0HH 4JJFA 3I5CA 1M1JB 1M8OB 1RF1C 2GDCA 1MQVA 2R44A 4LERA 3HE5B 3BVHA 2QIWA 2MKVA 3C62A 1USEA 2MHRA 1SQQK 2NUTA 3W67A 1RKEB 2IBFA 1K40A 4O79A 2D2CC 3DM5A 3M4CA 3LEOA 1OVUA 3TQOA 2CCYA 3CC7P 1XZPA 3JCUH 3P32A 1NTKK 3O8ZA 1BGYJ 3K1HA 3W2VA 1SQQG 5B3SC 5AVZB 2HV7A 5A6KA 1GK4A 2E76C 4CS8C 4IFMA 4L75A 3K6BA 2Q9AA 2PP6A 2FYUK 4C7RA 2JPUA 1NFOA 1P84E 4U3FE 2H8AA 1DD4A 3SSUA 1JOGA 1HY5A 3ABKC 3P8CE 1KV4A 1NTKG 1J8MF 4UB6E 1WATA 3L1MA 1Z56A 2P7VA 1KB9E 3KYQA 2OU6A 3AQCA 2FYUG 4DT0A 2KSFA 1K04A 1VQPP 1NFNA 4KT0J 5AW2B 2W9YA 4MW3A 1L0LK 3LW5J 3QMKA 3LESA 4LLEA 1Z6AA 1G8XA 1JMMA 3JC22 1H88A 3AG3C 2WSEH 3AEBC 3E1RA 3H1IE 2AU5A 2LSEA 3UNGC 2QJYB 1Z3IX 1JRAA 3CI9A 2L91A 1L0LG 1L2PA 4ZNCA 3I56P 2A06G 3MLGA 2R25A 3S90A 2O9XA 3TDKA 2YKQA 3RH3A 1FFHA 2B0HA 4U5FE 5APYA 3PP5A 3TK0A 1VPCA 3AEEC 2B87B 3H1JG 3SFEC 2GWWA 3ASOC 4Z9HA 3DKAA 4N3YB 1YAUO 2V7QH 1SQVE 1SQPJ 3V5BA 2Y9ZA 2MYSA 1H0TB 1OZHA 1Q86Q 5AVQB 1ZW3A 1EDLA 1GW3A 3WUTA 3BATA 4JW1A 3M06A 1VQMP 1KQSO 1P84H 3ABMC 3WAQA 4DVZA 2RD9A 1RHZB 2PBEA 1N8RQ 3RGUA 2YXQB 1PCXA 2XLEA 3ZC4A 1T5OA 3FXDA 1M1JA 4UB6H 1YYXA 2M5AB 3L71E 2OYIC 1HMOA 3HE5A 1Y9BA 1KB9H 1D1CA 2R5DA 4Y99C 3H1LE 2A0BA 1TQGA 3W8IA 3CPWO 2IBZD 4YTPC 1RKEA 2N1TB 5A69A 1X22A 3V2PA 2ZT9D 4LLCA 4CIPA 2OYOA 3VAYA 1MFZA 1RE3C 5DJTB 1BSNA 3SWYA 5CJ0A 2A0UA 3Q7LA 1LTAC 2GUSA 2D5RB 4YK5A 4JCHA 2WL8A 3L36A 3L74D 1ORYA 5CCHD 4IFDK 4CDYA 2CNWA 1SQQJ 3D70A 1D0ZA 5KYWB 1HMDA 4WGYA 2Q7RA 1EDJA 2R02A 1F1MA 1FTSA 1C17M 2RMZA 5AW0B 3QVZA 4XFJA 1CPRA 4E17A 3ZQYA 3V2QA 1QVGO 2HKVA 3T4RA 2WT7B 4KI2A 1NKNA 1NTKJ 3OWTA 3CD6P 1QZXA 5APSA 1G4US 4XE5B 1OR3A 1WWPA 1PGQA 4IB4A 4JBZA 3IAOA 1W2BO 2EPNA 2FYUJ 2IXOA 3EZHA 4NTBA 3HUSC 2A45G 3ECSA 1LM3B 1KYOE 2EIJC 4BJ6C 1J1EB 4C7NB 1JMWA 5KKZB 1L0LE 3CCSP 4HFKB 3LS1A 3RL0g 2A06E 3HE4B 3CMAP 3NTNA 1VQKP 4O6MA 1NSGB 2GFHA 1LIHA 3CZ6A 2ZYGA 1QSPA 1WGWA 1YBKA 3BASA 2YMYA 2ZT9C 2B0JA 3MYIA 1HH0A 3ZWIA 2R7OA 3ZDMA 1H9TA 4MVUA 5EFWB 3TJ5A 4IWBA 4OD4A 2Q6QA 1SQPD 2HZ8A 2C03A 5CCHC 1A41A 1LT9C 3G3ZA 4H54A 5KYXB 2WSCJ 5JVEA 3DI5A 2WZLA 4KNWA 1ZRTD 1BR4A 1U7MA 3H1JJ 3AE1C 2J58A 1OCCC 1ZLLA 1PFIA 5E3CA 2B87A 3U2LA 3TNUB 1FNTc 2R7TA 3CX5I 1QEXA 3M0DA 2I1KA 4IL6E 3R7CA 4C3BA 3PRJA 2Q4FA 3H32B 4RBNA 3X2QC 1RY3A 1BSHA 1H0TA 3CSKA 4I6MC 1IK7A 2KUBA 3AG4C 1YHQP 1B68A 1J2JB 3OJAB 1YARO 4P9TA 2JP3A 2DYRC 3AE6C 4WY4B 3IQTA 1RF0C 3PTZA 4OVNF 3O6QB 2H7HA 2KSEA 1AVOB 2MJZA 3GHGC 2PF4E 4AUWA 5F5FA 2M5AA 1Q2NA 1XTCC 1R8EA 5L0IA 3CWBD 5AC5A 1ZHTA 4WJ0A 3RK2C 1KYOH 1XZQA 3U8VA 3PDMP 4EBJA 2XLHA 2N1TA 4AYCA 4DJGA 1IZNB 4XEKA 2R7RA 1NTKD 1OIPA 1OW8A 4DXWA 5KJ7D 4LLHA 1TWHA 3OEOA 4W8KA 2KLUA 4YL1A 4I7ZB 1KC8Q 4PJ0E 1S5LE 3F89A 2XNXA 4U5HA 5KYWA 2NRGA 4Q7CA 2PP4A 2E74D 1S05A 1N7LA 3FAPB 2OTKE 2KJGA 1JY2O 4GOEA 2QEXP 2WT7A 4DOZA 2CW0F 2Y3DA 5DS6A 3PLNA 1L0NE 4AQRD 3FHDA 2D4UA 2YKOA 1QLED 2R9RB 4RDAA 3E7KA 2FYNC 3RL0D 3HJCA 4UB8E 1NHLA 4IL6H 4I1LA 4C7NA 1YZAA 4PK4A 3VYWA 3HE4A 1CZQA 2QJKC 1SP4A 5DVWA 3A3YB 3MGNA 4E7SA 4P6IC 1NTZE 3BCCD 1J1DB 3ZDLA 3H1JD 1EDKA 2JR8A 1FOSE 3K66A 4PV1D 4DJ9A 1FFTC 4AL0A 1K8AQ 1YTZT 3HD7C 1E2XA 5BVZA 5KJ7C 3VP9A 2WSSH 2NPSB 4PD4E 2OARA 4LACB 1RF1B 2LXCB 5KYXA 2QE9A 2YXRB 1VQ9P 3TOLA 2E74C 4G7OF 1L3PA 2EPMX 2QM8A 3ITKA 3AE2C 3W8HA 4WABA 1W2EA 1ZU4A 2AWYA 3TNUA 4DOJA 2KNCB 1FMWA 1MNDA 4PJLA 1FZAA 1VMAA 3MBGA 2AVKA 2D2CB 2P67A 1BCCJ 4PJ0H 1S5LH 1T9KA 1RQVA 4DRJB 3H32A 2Q3TA 1FZGA 3F47A 3RQEA 2OTJP 4X0RA 1QLEC 3USSA 3RL0C 4WY4A 1URQB 1QX8A 2B9BA 2BE5F 1LP1B 2W83C 3O6QA 1OXBA 1AVOA 2J9VA 1S9KD 1L4AD 3MTUE 5T3TA 1RE4C 1VB5A 3GORA 3W2WA 4UB8H 5AVSB 3Q5RA 4PV1C 5KYUB 4EWCA 4MTFA 2UUHA 3EGDB 4XWJA 3P8MC 5L0GA 2H7BA 1OWAA 5DJUB 1D1BA 1OCRC 2KOGA 3RW0A 3FOPA 2YHSA 2YQYA 4EUKB 1E85A 1FE6A 2NUPB 3FX0A 3VMZA 1Q81Q 3WG7C 3LEVA 3U0CA 3GW6A 1X0TA 2L6HA 1S72P 1VK5A 1H6GA 1JTHB 2E75D 3J06A 3L75G 1AQ5A 2YMKA 2K9JB 4W8PA 4PD4H 2ZXEB 3T6GB 1OKKD 2PGDA 3AE4C 1GQAA 3N24A 4RESB 1N1CA 3HTKC 4OIRF 2C9LY 1Y4CA 1YJGA 4NPEA 3DWWA 4FWVA 2GA0A 1TWGA 1AVYA 2JJLA 3LLIA 3DMDA 4JEAA 2DYSC 2OYHB 4K3AA 2RSEB 1G5ZA 1VTMP 1CGME 2J9UA 3HRNA 4U7JA 4IOIH 1L4AC 5DLJA 5A6BA 1M2VA 1PGOA 2OQMA 3QTHA 2KZJA 1M2OA 1MMDA 3M79A 3FWNA 5B1BC 1VQOP 1DIPA 4CDVA 3ZSUA 2IBZG 1E83A 2XL4A 1LTJB 4TT3H 3B4SA 2HPCB 4XEFA 1EA8A 3H6PA 4IL6X 1BCCD 2NPSA 3L74G 5AC4A 5AVRB 5L0CA 1A7VA 2YL3A 3QW0A 2KYVA 4Y99B 2E5YA 4KC9A 2E75C 4MW8A 1S7ZA 4L76A 4DCKA 3H1HE 4HFFB 2YNYA 1KB9I 4WB4A 1G1JA 3ZIBA 1YLMA 1N7SB 2HJMA 3QH9A 2IZ0A 4AK9A 3UGOA 3S1KA 3CX5D 2K1AA 1SFCB 4BJ5A 3VM6A 4EIJA 1TWCA 1LGHB 5JS5A 4FAPB 1URQA 1PPJD 5AVYB 4CS8A 2IFNA 2G3KA 3H65A 4U5BE 1LP1A 1KU2A 1HF9A 1HE1A 1TFOB 1I4ZA 1O5HA 5KLIC 2P7JA 4J7YA 4CSAC 3SYNA 3O10A 1SQPK 2VC9A 2EPOA 1T6UA 4YXDC 3KMIA 1R5LA 3A9CA 5KYUA 4E7ZA 2WVOA 2JEEA 1MNEA 3EGDA 3HNIA 1KILB 5CCGD 4LGDE 4FESA 4H13D 4YT8A 4HH2A 2NG1A 2NUPA 3AE5C 2TMVP 5KLVJ 1SQPG 1JPJA 3MD0A 1ORJA 1IFPA 4XPWA 4HEAJ 3MIWA 3GWNA 3L75J 3ATPA 1VF5B 1LT1A 1JTHA 2NPUA 3NYMA 2ZT9B 2C0XA 2K9JA 3A11A 2RN0A 3EWKA 5AW6B 1BDDA 3RBXA 3L0IA 1YITP 2MWQA 5BU5A 2P61A 1N73C 3TOMA 5COGA 2FFDC 1MUUA 1BGYE 1OMIA 3SWKA 2H8PD 2OYHA 1U89A 2AP3A 4W7ZA 3AEGC 1KZUB 4WWIA 2P1AA 2P1JA 3GF3A 4OINF 4XEVA 3IFMA 3IHUA 2OGUA 4MTGA 1X79B 3EHNA 2PX3A 2WWWA 5AW7B 1QGKB 3CWBG 4RD9A 3CCEP 4EOTA 1NTMD 2J7PD 4H0LB 1JOCA 1U7JA 1LTJA 1HGVA 2HPCA 2GM4A 2AXTE 4MQ9F 4H13C 2Q3EA 1LKXA 1LTGC 2M4EA 4BJ1A 3L74J 3GHGB 2IXMA 4JIOA 4C7OB 4JCZA 3ABLC 3RQFA 2M0BA 2WB7A 4AE4B 2NZ2A 3U5SA 1ZW2A 2R7UA 3RK2B 2LCHA 2YKPA 1Z7Qc 3Q5SA 3M0AA 3R2PA 1GU4A 3B5NB 1N7SA 3GM3A 4U5DE 3GG2A 2HG5D 1KYOI 2VH3A 2R7WA 1PP9D 1NO4A 2X51A 3X1OA 1FZFA 2W6BA 1SFCA 4RKUJ 1A7EA 3TD7A 2G3AA 3VTPC 2HLOA 3S9OA 5APXA 3KXDA 2DI3A 3TGUJ 2EIMC 3EH2A 4MVQA 3U3FA 1ST6A 3EFOB 1BE3G 4CPGA 1PGPA 2OKUA 1WT6A 3GODA 3GEIA 3UMKA 2EPLX 3EZIA 3U8PA 2PX0A 5KLVD 4D6TG 1SQPE 5C39A 2ZXPA 3IQ5A 3L75D 4IGGA 3BCCG 3RK3B 1ZRTE 1KORA 5JUAA 4O7GA 2FYNB 1KILA 2WMMA 4JC7A 1LI7A 4D4XA 1YDIA 2OQQA 5AW9B 2F22A 2WPQA 3DAGA 3CXHE 1E86A 2WVRA 1RKCA 3SWFA 4B6IA 2L7AA 4ONSA 2AXTH 3RK3E 4GEHA 3CC4P 4UDVA 2JDIH 3MP7B 3B0PA 1GK6A 1LWUB 1AA0A 3LW5H 3HD7B 1T6QA 5APTA 1JY2P 1GL2B 1SQQE 1BBHA 1EXJA 4BG0A 3PHLA 1GD2E 2WPSA 2E74B 3KH2A 4U5CE 3AEFC 1ZVZA 1OXZA 4ASVA 1Q7YQ 2N9BA 4HB1A 2EIKC 2H7OA 1NTKE 2HMZA 2I8DA 2X0CA 1NU1K 3CWBJ 1RH5B 1MKMA 2R03A 4H44D 1TU3F 3G4SP 3AOUA 2I1JA 3II6A 5L3VA 2BCCD 1CGNA 3L8IA 3JRTA 1IK9A 2FYUE 1TR2A 5JT4A 1H8AA 256BA 3CCLP 2OTLP 3CLQA 2G3VA 3ZQVA 1KNYA 1K05A 3AEAC 2R7SA 3JT1A 3GHGA 1NU1G 1M6TA 2WVNA 4N78D 4YT4A 4A2NB 4C7OA 2XU6A 2DGJA 3VF0A 4AE4A 2H43A 2OEVA 2ZJSE 3TGUD 2OCCC 3Q7GA 4M63A 3NFQA 2AXCA 5CBOA 3P8CD 4CS9A 2WZGA 3B5NA 3CXHH 2CNWD 1EQ1A 1T8ZA 4ER9A 2VCAA 1KB9D 1W5CE 4ANJA 2UUIA 4E0IA 1N2DC 4OH8B 2Y3GA 4U9EA 1Y6DA 3NG1A 2I8BA 1BE3J 3TULA 3CCMP 2FXPA 3H1JE 3I5QA 4W80A 3CL3D 2P6VA 4D6TJ 1H9GA 2LK4A 2KGOA 1VQ5P 2E87A 3NKDA 3W68A 1Q0DA 3RF3A 2VASA 4H44C 5L8RJ 3BCCJ 3TK1A 2KLVA 4PD4I 2YL0A 2KS1B 3GEEA 3FDQA 4NC3A 2YZSA 5BU8B 1YTZI 3SXZA 2Q1KA 4LC1A 2XXAB 2ZAEB 1BCCG 2Q9CA 2WPVB 3UR3C 2LFFA 2W6AA 4MVMA 3M9QA 1FU1A 1T3UA 4L73A 4Y28J 5GTIE 1YI2P 1T2KD 4J7TA 1M56D 1V4AA 2A6EF 3OW2O 3U3BA 1I4YA 1JUNA 5APQA 1LWUA 1YYCA 5E79E 3HD7A 4Q4ZF 5APWA 1UIIA 4E0HA 1S9KE 2XLVA 1GU5A 4YPCA 2YRFA 3S29A 1GL2A 3B71A 1UFBA 2XL8A 3RYLA 1Z63A 3I55P 2LFDA 5H2FE 2KI7B 2W27A 2XKMA 1M57D 1PPJG 5JRAA 2E43A 2CPSA 2YL1A 4XA4A 2PFXA 3C1LA 3H1LD 3KPHA 1DEBA 3M9HA 3DE9A 2Z5IA 1CPQA 1SR2A 2WSCH 4N6JA 3M15A 1DOWA 3NMKA 3LLKA 1KQGB 3G4ZA 3EHMA 2ZXOA 1ZP0C 4F4BA 3FOOA 3W4YA 2J45A 2KK7A 3IQCA 3TYYA 3DD7A 1AFOA 1NU1J 2Z4EA 4IRUA 1R4TA 1Q82Q 1CGOA 2HODB 3CCQP 4R32A 5JSLA 3HNKA 2FGYA 2Y0DA 3ITFA 1RE4A 1WRGA 2N1TD 1VQ7P 4OIPF 1BE3D 4AX2A 3AGTA 1T2KC 1Z23A 3S4RA 1M56C 3ZTMA 2KK1A 1NG1A 2FXOA 1MMNA 1DOVA 2QY9A 4D6TD 1HWTC 2KP8A 2I15A 2Y0CA 1VQ6P 1YA9A 2L81A 5GTIH 4KJMA 1JAFA 2L5GB 2WVQA 3EPVA 3T6JA 2QJPC 2L6FA 2Y3HA 1QQ3A 2BC5A 3LJBA 2VB6A 3U9MA 2LKMA 5E33A 4N4WA 3MX3A 1W2WA 1M57C 1NTMK 1VDFA 5E79H 3KYJA 4EIYA 3L73J 1S1CX 4EBBA 4DRHB 3JRMO 3KHUA 1BCCE 1NWQA 3CEXA 1NGMB 4N6HA 2HJ3A 5E2QA 2LR2A 4ZMDA 5H2FH 1N73B 4K7BA 4JPZB 2E42A 3GM2A 1JY3P 1NTMG 2KS1A 3C8VA 3N0TA 5DQZA 2O1JA 4DRIB 3G71P 2N9YB 4YJWA 2L6GA 2HS5A 2XXAA 3L35A 2IXNA 1BZ4A 2UWJE 3A0BE 5L0FA 1YQ3C 1EZVI 4ZKUA 2A45H 2N1TC 3CX5E 2YKZA 3BEHA 2ASRA 4K1OA 5CI8A 3L70G 2KQ9A 2E76B 4I1OB 3KKBA 2R3CA 1SZIA 2J8WA 2J9WA 3N4XA 1G2CB 3T97B 3V2NA 2OG2A 1T3JA 1U6HA 4U5GA 1PP9G 4QDLA 5KLVK 5DS4A 1ZOYC 3L72D 1GW4A 2XSEA 5EGYA 3RVYA 1JNMA 3WUVA 1TKNA 2LD6A 1D1AA 1HW1A 1EDIA 2FY8A 1LE4A 3RKOF 1IFIA 3ASNC 4QI0A 3RQGA 4ZKPA 5FCLA 1NJIQ 1NU1D 3EQLF 2P58A 2OOCA 1JMBA 1SQXG 3VOPA 4IJJA 2YL7A 1FJKA 3Q2YA 3N2ZB 5KLVG 4I44A 4WY4D 2IYOA 3WODF 3H2VA 3B0UX 2C0WA 3MUDA 2W4MA 3L8JA 1J1EC 1FAVA 2R7QA 1M1KQ 4R4LA 4G7ZF 3GANA 5F28E 4Q5SF 1KD1Q 1A7DA 1J8YF 1L7CA 2WSFJ 4ULWA 1T6AA 3SXMA 2KNHA 3GF7A 3U1AA 4EYYQ 2R7XA 2JX0A 2HODA 1HTLC 3H1KG 3HNLA 4DVYP 1KN7A 5BQHA 1K9MQ 2W6JH 1V54C 1FS0E 2J46A 5JP7A 5AVXB 2H88C 4JKVA 4G7HF 4JE9A 2NSFA 3L73D 2A6HF 3A0BH 3S28A 3CX5H 2IZ1A 5TJ5E 2BEZF 3AG2C 2AEFA 3VMYA 3DXJF 3K1IA 3FWLA 1PIXA 2WITA 3OA7A 3FVYA 3ZVRA 2QRXA 3CAXA 4CS7A 1NTME 2O1KA 4KNVA 2O01J 2C04A 1OCZC 3G4XA 5M1BA 4OGQD 1SYQA 1OR2A 5HV9A 1NTZD 2YO2A 1P84I 1RF1A 2K37A 2K3RA 5AW1B 3PHF2 4WY4C 1HVVA 2OYIB 1NAFA 3US6A 2FKWB 3AE7C 1N73A 5AVUB 1NTMJ 1EKYA 5AVTB 1OXKA 2J9BA 4FX5A 3M4BA 2BCCG 1VQ4P 2KNCA 5A6BD 1LI5A 3SXYA 3U1CA 5APVA 2R05A 1R5ID 3LAYA 1GMJA 1Y8AA 1SQBJ 2HR3A 3PH0A 2Z5HA 3IN6A 2GAQA 4BXLA 3IQ6A 3L70J 1WTYA 1BDJB 3NKEA 3KDPB 1IFNA 3TGUG 1S4XA 2NPSD 3SXKA 3A7OA 1Q0KA 1LNQA 1CI6B 1G2CA 3G9RA 3T97A 5A6JA 1M90Q 1PP9J 2XLMA 3LUTB 3Q6NA 1EI7A 3UGPA 2C9NY 1S5LX 5KLVE 5KYYB 3M91A 4NQFA 4I3MA 1MMGA 4MN4C 2YWAA 1OW6A 2HYNA 4CJGA 4MNDA 3L75E 3HUSB 3JSZA 2YLIA 1SQXJ 1NVOA 1GS9A 5CBNA 4JYCA 1N86A 4OGQC 2ZXRA 3RFYA 3KZIE 1A0BA 2ZVNB 4PFOA 3NMJA 5AGFA 2HV6A 4GQHA 3VRCA 2XL6A 1GTWA 2XS1A 1AEPA 1URQD 2W4BA 3EGXB 3CXHI 3FXHA 2YEVA 1E5WA 4QMAA 4P9FA 5AW4B 3M9BA 2ZVOB 4EBKA 1OCOC 2VRSA 4JVSA 1RJ9B 4KHXA 1NKZB 1EC5A 3H1KJ 2Q5UA 1X8YA 3C8GD 2Q9IA 4EKWA 1J1DC 1LT9B 5D92A 3JYHA 1QL1A 2KB7P 2YVKA 3C9IA 3S27A 1E84A 4QI2A 3B9QA 4H44B 5CIVA 3ABVC 2YIUC 2IBZE 3JSVC 1S2EA 1K73Q 2CPBA 3O55A 4Z9IA 2NPSC 3WUUA 2HSBA 3AJMA 3NRHA 2O01N 3VYIA 3T9OA 2CYDA 3UIAA 2ZPAA 3L74E 2WSEJ 1ZHWA 4RJTA 1I5NA 3CCRP 5CCGC 1NAYA 2BCCE 1NOHA 3K5BA 2YO3A 4CIHA 5KAIE 3CMEP 2XS8A 4GDOA 4ULVA 4ZLDA 1E79H 1BR1A 1SQBD 3R4YA 3L71G 1LTBC 4BJ5C 4GKGA 4U9DA 3BRVB 3H1LG 2EPKX 2OYIA 1URQC 1FZCC 3L70D 3HLZA 3LNRA 3NMDA 4N78E 4L74A 2BCCJ 1DD3A 4YN0B 1ZXGA 2ZXXA 3TGUE 4H4KC 3VP8A 3BRJA 2QG4A 2V7QJ 3KZIH 1ZN5A 3AQBA 3OA1A 1FC2C 1ZV8A 1RE3A 2PRRA 3PJSK 2AWCA 2KIKA 4E18A 4O9BA 4JTDB 3KYIA 4CBEA 3KPEA 1LTIC 1LS1A 2NSGA 4XLPF 4GODA 1ZYRF 3H1HD 4B86A 2WPRA 2O3JA 4U3FJ 2FXMA 2OJED 4MTOA 1EZVD 5L0JA 2ZYDA 2IOQA 3C8ZA 3JSEO 1SQXD 1U57A 4CX9A 1QL2A 1ZHXA 1D0XA 1CI6A 4JRZA 4U5EE 1TWAA 3OAKA 3D6YA 2XM0A 4BEJA 2LQGA 5KYYA 1OW7A 3F46A 1H89A 3LIDA 1HJBA 4JTAB 1N7SD 3HUSA 1ZHYA 3GM1A 4JJGA 4AL1A 4XPXA 4BJ6A 5T3WA 3H1KD 5B3IA 3DZAA 1SFCD 1MZ9A 2QSIA 4JEBA 4EDFA 5B66E 3H1IJ 2KSJA 3O6XA 3CCVP 2B88A 5KAFE 5COFA 2QJKB 2OYHC 4HJGH 3WMM0 3K33A 1DH3A 2JD3A 3JZ0A 3EGXA 3I4UA 4C3DA 2CGEA 5KAIH 2P2UA 2QJPB 1ZR4A 1ORSC 1QKRA 1RJ9A 3WU2E 1Z5ZA 1SF8A 3TJ6A 1YJNP 2V26A 4OIQF 1KQLA 1JPNA 2IX7C 2PAJA 2IYLD 2Q9BA 5CCHA 3G6EP 1LT9A 3U9JA 5JLIA 3IR9A 2J0WA 3KQGA 2W90A 3CWBE 1LTJC 1BR2A 1KILD 1DX7A 2Y0EA 1SQVJ 4J32B 4N6CA 1XWJA 4MVZA 4NTAA 3LS0A 3CCJP 1RXQA 3P7KA 2IPPA 3RVZA 1YIJP 1OQCA 3HKKA 1XTGB 1BGYD 2R5BA 4EHPA 5L0DA 1VOMA 2LIGA 1YQ4C 2R7VA 1HUCA 1VF5D 3QVYA 4L6RA 1FJPA 5FZTA 3MZWB 1GM5A 3L72G 3Q1MA 1N7SC 4XLNF 3RL0B 3CC2P 1NLXA 1RF0A 2M3EA 3L71J 2A45I 1HBWA 1LS4A 4WVZA 3D6ZA 3GEHA 1WMKA 1SFCC 4PACA 3H1LJ 2ZXWC 1JY3N 5CJ4A 4WBAA 3SNHA 1YJ9P 1PD0A 3U2MA 1P84D 4U3FD 1SS1A 3DJNB 4PV1B 4WGZA 5E3AA 1BE3E 2QLAA 2HSQA 1HW2A 2KC3A 5B66H 1G1IA 4N06A 1Q0FA 5KAFH 2KXPB 4XQ1A 1L0NK 4D6TE 2Y39A 3QW1A 3D71A 2CDQA 4HYTB 2IXPA 3AG1C 4H0LD 3DM9B 1KILC 3BCCE 1ZHZA 2RH0A 3NXSA 4PJMA 3PMRA 1IC2A 3EFOA 3WU2H 3UMIA 2BASA 5AW5B 1KFNA 3L73G 1L0NG 1OX3A 3H1ID 2VCCA 2SPZA 1BDCA 2ZD9A 3DE8A 3LNMB 3EG9B 2XDJA 1NTZK 1JM0A 3HTKB 1VF5C 3NYLA 3RK2D 2FFHA 4OIOF 2W45A 4JYBA 4TLFA 4LDKA 1L0LJ 2J59M 3E1IA 2KW3C 3B5ND 2RKLA 1M1JC 1VQ8P 2WTYA 4K35A 4C46A
chains in the Genus database with same CATH topology
4OGQD 2NZ2A 3Q5RA 1KMIZ 4PV1C 1MKMA 2G8YA 4H44D 1TU3F 1YQ3C 3B71A 3H25A 1UFBA 3K7DA 3L8IA 3AE7C 2WSEJ 3AECC 3JYYA 1NYHA 3RL0g 1HF9A 3Q5SA 2E76B 2P10A 3GM3A 1RQUA 5KLIC 1KNYA 1K05A 3AEAC 3O10A 3U0CA 1JB0J 2JO1A 3AEEC 4GDOA 3T97B 4RKUJ 2L6HA 1GMJA 1VL2A 2G3AA 3SFEC 4YXDC 2FYNC 2ZT9C 3R4YA 1HJ0A 1KILE 3S9OA 3IN6A 2E75D 3GLMA 1ZOYC 1KQGB 3Q3DA 2J5UA 3U3FA 1WTYA 2YMKA 1YQ4C 2QIWA 2MKVA 1ZP0C 3C18A 1VF5D 4H0LC 1DD3A 4H13D 3AE4C 2QJKC 2Q00A 2WSCJ 2IDBA 3AE5C 3Q1MA 3AE8C 1ZMEC 3BRJA 3RQGA 1KQFB 2V7QJ 3MFNA 1EXIA 2WQYC 3AE1C 2E75B 3G9RA 1K40A 4R32A 2D2CC 4PV1D 3D6ZA 1WMKA 2PBEA 3Q2YA 1S5LX 3Q5PA 1VF5B 1ZRTE 4NQFA 3TULA 4H13B 1KORA 3L8JA 2FXPA 2ZT9B 2KK1A 2YWAA 4R4LA 4U7JA 1OW6A 1Y9BA 3EWKA 2OQQA 5F28E 1IK7A 2E76C 3AE3C 4PV1B 2LK4A 2WSFJ 4YTPC 1U57A 2BEQD 1DIPA 2JP3A 2E74C 3GF7A 4OGQC 3AE6C 3AEDC 2K9YA 4Z1MH 3FGAD 1PL5A 3AE2C 2ZT9D 2JPUA 2JX0A 4H44C 5L8RJ 3D6YA 1OMIA 1O3UA 1DD4A 1QVXA 4I7ZC 1UIXA 1JOGA 3AEGC 4TT3H 3D71A 2QJPC 3RK3E 2L6FA 4XEFA 2H89C 1OW7A 1PV3A 1Q90D 2D2CB 1AJYA 3GF3A 4IL6X 3C8GB 2H88C 4H0LD 2QJYC 3D70A 1RQVA 4R4MA 1ZZPA 4EBKA 4XEVA 1R8EA 1S1CX 3RQFA 5KKZC 3GM1A 1FDIA 3RQEA 1K04A 4EBJA 2WPVB 2D2CD 4XFJA 2BEZF 2QSIA 4KT0J 1NGMB 3C8GD 1KTMA 1EXJA 4XEKA 2E75C 1PIXA 4H0LB 3AJMA 2E74B 1OW8A 3LW5J 4OGQB 1FDOA 4Y28J 3AEFC 3O6QA 1V4AA 3AE9C 4H44B 3GM2A 1VF5C 1WWPA 3C8VA 3JZ0A 3ABVC 2YIUC 4H13C 3C8GA 3GMAA 4I7ZB 3SFDC 1WOLA 3AEBC 3IAOA 2E76D 2O01J 2L6GA 2HSBA 2FBWC 5M1BA 2E74D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQ3 C;  3B71 A;  1UFB A;  3K7D A;  3L8I A;  3AE7 C;  3AEC C;  3JYY A;  3GM3 A;  1KNY A;  1K05 A;  3AEA C;  3O10 A;  3U0C A;  3AEE C;  2L6H A;  2G3A A;  3SFE C;  4YXD C;  3S9O A;  1ZOY C;  3U3F A;  1WTY A;  1YQ4 C;  3C18 A;  1ZP0 C;  3AE4 C;  2Q00 A;  3AE5 C;  3AE8 C;  3BRJ A;  3RQG A;  3MFN A;  2WQY C;  3AE1 C;  1K40 A;  4R32 A;  2PBE A;  4NQF A;  3TUL A;  3L8J A;  2KK1 A;  2YWA A;  1OW6 A;  5F28 E;  3AE3 C;  2LK4 A;  4YTP C;  3AE6 C;  3AED C;  3AE2 C;  2JPU A;  2JX0 A;  1O3U A;  1QVX A;  1JOG A;  3AEG C;  2L6F A;  4XEF A;  2H89 C;  1OW7 A;  1PV3 A;  3C8G B;  2H88 C;  1ZZP A;  4EBK A;  4XEV A;  3GM1 A;  3RQE A;  1K04 A;  4EBJ A;  3C8G D;  1KTM A;  4XEK A;  2HSB A;  1OW8 A;  3AEF C;  1V4A A;  3AE9 C;  3GM2 A;  3JZ0 A;  1WWP A;  3ABV C;  3C8G A;  3SFD C;  1WOL A;  3AEB C;  2L6G A;  3AJM A;  2FBW C;  3RQF A; 
#chains in the Genus database with same CATH topology
 4PFP A;  3V4W A;  4BEM J;  1KMI Z;  1FAP B;  1QPU A;  3RIP A;  4YT5 A;  5TIS E;  3U59 A;  1NZE A;  4HKZ H;  1L4A B;  1SLQ A;  5APU A;  4YL0 A;  1IJD B;  1NYH A;  4EI2 A;  1NTZ G;  4C3E A;  2XZR A;  2M8R A;  2PFD A;  4PJN A;  5GPG B;  3V5Z A;  4BRY B;  1SQV D;  1LTS C;  1GDT A;  2M64 A;  1MFT A;  3S0X A;  2FAP B;  1UG7 A;  4NPD A;  5IY5 C;  2AEM A;  3CXH D;  4K0D A;  4G78 A;  5L0H A;  1FMV A;  3GLM A;  5KJ7 A;  2DB4 A;  2J5U A;  1T6I A;  2B89 A;  1WN0 A;  1JCC A;  3C18 A;  1IZM A;  4G0H A;  4H0L C;  3RK3 D;  4NY3 A;  2ITA A;  3L72 E;  1KQF B;  1NH4 A;  2WQY C;  3NMI A;  4DBQ A;  2E75 B;  4XPY A;  3L71 D;  1V74 B;  2XLD A;  4JQ0 D;  1SQQ D;  1NU1 E;  5DQT A;  1TFK B;  2POH A;  3EJN A;  4BPM A;  2IM8 A;  3L72 J;  2WZF A;  2KYH A;  1QVF O;  2ETS A;  4GYT A;  4OWF A;  4CS9 C;  3B5N C;  2XM4 A;  2XV5 A;  2K9Y A;  3HD7 D;  1PL5 A;  3EFF K;  3L4F A;  2XRH A;  5KYN A;  1VYI A;  3B0V C;  3C7J A;  1GL2 D;  4W7Y A;  5KLI B;  2H89 C;  2GA1 A;  1Q90 D;  2OEX A;  1SVF A;  2FYU D;  3NDB B;  2QJY C;  1ZZP A;  3L37 A;  4O6Y A;  2AEJ A;  1O87 A;  5CI9 A;  1PD1 A;  1YJW P;  2ZFC A;  5TIS H;  4BJT A;  3CCU P;  4HE8 D;  2IYP A;  1KTM A;  2QNL A;  2BL2 A;  3KL4 A;  3L73 E;  4A4A A;  1FZB A;  4PR9 A;  1U0B B;  4OGQ B;  1FDO A;  3GWL A;  4D4N A;  3POV A;  2V3C C;  1ZR2 A;  3RK3 C;  5B1A C;  1KYO D;  1FZE A;  3GMA A;  4NPF X;  4RO0 A;  3M0D C;  1L0L D;  5B5E E;  2A06 D;  1MV8 A;  1L0N J;  5GTH E;  3WHN A;  2HFI A;  3O39 A;  1M2V B;  2ZYA A;  1FDM A;  1D7M A;  4GT1 A;  3IEE A;  4JUR I;  3CQZ A;  1SQB K;  1AQT A;  3EG9 A;  3HTK A;  1RQU A;  3C63 A;  2QA4 P;  3JCU Q;  3Q6M A;  1VQL P;  1LJ2 A;  2FFD B;  2Q3I A;  3V7O A;  1OVV A;  1A02 J;  1LWU C;  2YIU B;  1CW5 A;  1S3J A;  1HE9 A;  2GUV A;  1GL2 C;  1NTZ J;  3Q3D A;  3QWO C;  1L4A A;  1SQB G;  1HGZ A;  3FAJ A;  4ZLC A;  3NYJ A;  2Q00 A;  3AGU A;  2IDB A;  4A7P A;  1IFM A;  1ZME C;  1VLS A;  4BRY A;  1FR0 A;  4JTC B;  3IF4 A;  4ASW A;  5KTB A;  3B29 A;  5EK0 A;  1PPJ E;  4GIF A;  1IFJ A;  2QTV A;  3SP1 A;  3UMH A;  2XLW A;  4GOF A;  3Q5P A;  1M7L A;  1SQX K;  2QE7 H;  4H13 B;  2Y69 C;  2EIL C;  3G50 A;  2A68 F;  1IFD A;  1R5S A;  3AE3 C;  1FZC B;  2BEQ D;  1OFC X;  3M1C B;  2A69 F;  3H1H G;  4JF7 A;  2Q7C A;  1X9V A;  5TJH A;  1EQ7 A;  1IW7 F;  1O3U A;  1Q0M A;  1EZV G;  4IFF A;  4I2L C;  5HSW A;  1QVX A;  2E5T A;  1OKK A;  5A6A A;  4YWQ A;  1NU7 D;  3FXE A;  3C8G B;  4J30 B;  1YA7 O;  4M3L A;  4R4M A;  5B5E H;  4CJO A;  3BRT B;  3E9V A;  1Y47 A;  3A5T A;  5KKZ C;  5AVW B;  2PNO A;  1FDI A;  2VCB A;  5GTH H;  1CSB A;  2P0N A;  3PCV A;  3SEO A;  3IPM O;  3ZG1 A;  2KZI A;  2QM7 A;  1USD A;  2WZ7 A;  4CSA A;  1A02 F;  1JR8 A;  1JO5 A;  3EFG A;  3SFD C;  1WOL A;  2YLD A;  4O6N A;  3ZTZ A;  2FBW C;  1JEK A;  3VMA A;  2QUP A;  1FOS F;  1L0N D;  2EIN C;  3H25 A;  3K7D A;  2IBZ I;  3EH1 A;  2R3S A;  1H7I A;  1KFM A;  3VN0 A;  2Y3B A;  5K0I A;  1C03 A;  5F5H A;  3JTL O;  5EHH A;  1ZU5 A;  3TSI A;  2A1D D;  2G62 A;  1LE2 A;  2W8Z A;  2ICW G;  1APC A;  1RCP A;  2NUT B;  4OD5 A;  3I5P A;  1AV1 A;  1GZL A;  1VQN P;  2Y9Y A;  1VLT A;  4MVR A;  1HJ0 A;  3E70 C;  4IAR A;  1GGQ A;  4IAO A;  3MHV A;  4JZA A;  3HNJ A;  3V4Q A;  1SQB E;  4MS2 A;  1YVI A;  4MVS A;  3QZC A;  3SZR A;  1BGY G;  1AUE A;  3DJU B;  3AE8 C;  2FFD A;  1G4W R;  3L70 E;  1EXI A;  3MFN A;  4I1M A;  1YZC A;  3V5X A;  1PGJ A;  1YYJ A;  2QVA A;  5T1D B;  1NU9 C;  4PD4 D;  2LP4 A;  2WSF H;  1DEE G;  4CDA A;  1RMV A;  3A2A A;  2JKV A;  3A0H E;  3DAF A;  1PP9 E;  2H7V C;  2HUJ A;  1Q0G A;  2LXB A;  3H2U A;  2L9J A;  4XTK A;  4Z9J A;  3AED C;  4Z1M H;  1JY2 N;  3FGA D;  4U3F G;  4YXW H;  3FMS A;  5BQI A;  5CCG A;  4MVO A;  1EZV E;  4I7Z C;  1UIX A;  1SQX E;  3VMX A;  1PV3 A;  3V5Y A;  3MUD C;  3N7N A;  1AJY A;  1WAS A;  4PJJ A;  2JWA A;  4NCQ A;  3JCU E;  1JCD A;  3LIE A;  3V2R A;  4LDR A;  3RBZ A;  3H1H J;  4DBR A;  1LTT C;  1FZC A;  2D2C D;  3TF5 A;  2O01 H;  5AW8 B;  1NBB A;  1V55 C;  3F5H A;  2HMQ A;  3B8E B;  1MMA A;  2J0X A;  1VYK A;  1ZW0 A;  3AE9 C;  3H1K E;  2XND H;  1JY3 O;  3MYF A;  4NTF A;  3C8G A;  3H1I G;  5BUO A;  2E76 D;  2YLG A;  2FYZ A;  5D91 A;  1T01 A;  1LVK A;  1FBM A;  1PZQ A;  5DS5 A;  2G8Y A;  3L34 A;  5L3Q A;  3V6I A;  1SQV K;  2DW3 A;  2IFM A;  2K88 A;  3AEC C;  3JYY A;  3K1I C;  2M3B A;  4DZO A;  1D0Y A;  1IO4 A;  2P10 A;  2Z15 A;  4YL3 A;  2CK3 H;  2V4H A;  4KBL A;  5AW3 B;  5CMZ A;  4IAQ A;  3T6B A;  2HFE D;  2XLO A;  5BQG A;  4BWN A;  5K5G B;  2OJQ A;  1JB0 J;  2JO1 A;  1SMY F;  5COM A;  2JWD A;  1OVR A;  3S84 A;  1LPE A;  1VL2 A;  5AVV B;  3EQ2 A;  5CHX A;  2R32 A;  2J7P A;  1KIL E;  4LDQ A;  1SQV G;  1C02 A;  4YT2 A;  3A0H H;  4JJF A;  3I5C A;  1M1J B;  1M8O B;  1RF1 C;  2GDC A;  1MQV A;  2R44 A;  4LER A;  3HE5 B;  3BVH A;  2QIW A;  2MKV A;  3C62 A;  1USE A;  2MHR A;  1SQQ K;  2NUT A;  3W67 A;  1RKE B;  2IBF A;  1K40 A;  4O79 A;  2D2C C;  3DM5 A;  3M4C A;  3LEO A;  1OVU A;  3TQO A;  2CCY A;  3CC7 P;  1XZP A;  3JCU H;  3P32 A;  1NTK K;  3O8Z A;  1BGY J;  3K1H A;  3W2V A;  1SQQ G;  5B3S C;  5AVZ B;  2HV7 A;  5A6K A;  1GK4 A;  2E76 C;  4CS8 C;  4IFM A;  4L75 A;  3K6B A;  2Q9A A;  2PP6 A;  2FYU K;  4C7R A;  2JPU A;  1NFO A;  1P84 E;  4U3F E;  2H8A A;  1DD4 A;  3SSU A;  1JOG A;  1HY5 A;  3ABK C;  3P8C E;  1KV4 A;  1NTK G;  1J8M F;  4UB6 E;  1WAT A;  3L1M A;  1Z56 A;  2P7V A;  1KB9 E;  3KYQ A;  2OU6 A;  3AQC A;  2FYU G;  4DT0 A;  2KSF A;  1K04 A;  1VQP P;  1NFN A;  4KT0 J;  5AW2 B;  2W9Y A;  4MW3 A;  1L0L K;  3LW5 J;  3QMK A;  3LES A;  4LLE A;  1Z6A A;  1G8X A;  1JMM A;  3JC2 2;  1H88 A;  3AG3 C;  2WSE H;  3AEB C;  3E1R A;  3H1I E;  2AU5 A;  2LSE A;  3UNG C;  2QJY B;  1Z3I X;  1JRA A;  3CI9 A;  2L91 A;  1L0L G;  1L2P A;  4ZNC A;  3I56 P;  2A06 G;  3MLG A;  2R25 A;  3S90 A;  2O9X A;  3TDK A;  2YKQ A;  3RH3 A;  1FFH A;  2B0H A;  4U5F E;  5APY A;  3PP5 A;  3TK0 A;  1VPC A;  3AEE C;  2B87 B;  3H1J G;  3SFE C;  2GWW A;  3ASO C;  4Z9H A;  3DKA A;  4N3Y B;  1YAU O;  2V7Q H;  1SQV E;  1SQP J;  3V5B A;  2Y9Z A;  2MYS A;  1H0T B;  1OZH A;  1Q86 Q;  5AVQ B;  1ZW3 A;  1EDL A;  1GW3 A;  3WUT A;  3BAT A;  4JW1 A;  3M06 A;  1VQM P;  1KQS O;  1P84 H;  3ABM C;  3WAQ A;  4DVZ A;  2RD9 A;  1RHZ B;  2PBE A;  1N8R Q;  3RGU A;  2YXQ B;  1PCX A;  2XLE A;  3ZC4 A;  1T5O A;  3FXD A;  1M1J A;  4UB6 H;  1YYX A;  2M5A B;  3L71 E;  2OYI C;  1HMO A;  3HE5 A;  1Y9B A;  1KB9 H;  1D1C A;  2R5D A;  4Y99 C;  3H1L E;  2A0B A;  1TQG A;  3W8I A;  3CPW O;  2IBZ D;  4YTP C;  1RKE A;  2N1T B;  5A69 A;  1X22 A;  3V2P A;  2ZT9 D;  4LLC A;  4CIP A;  2OYO A;  3VAY A;  1MFZ A;  1RE3 C;  5DJT B;  1BSN A;  3SWY A;  5CJ0 A;  2A0U A;  3Q7L A;  1LTA C;  2GUS A;  2D5R B;  4YK5 A;  4JCH A;  2WL8 A;  3L36 A;  3L74 D;  1ORY A;  5CCH D;  4IFD K;  4CDY A;  2CNW A;  1SQQ J;  3D70 A;  1D0Z A;  5KYW B;  1HMD A;  4WGY A;  2Q7R A;  1EDJ A;  2R02 A;  1F1M A;  1FTS A;  1C17 M;  2RMZ A;  5AW0 B;  3QVZ A;  4XFJ A;  1CPR A;  4E17 A;  3ZQY A;  3V2Q A;  1QVG O;  2HKV A;  3T4R A;  2WT7 B;  4KI2 A;  1NKN A;  1NTK J;  3OWT A;  3CD6 P;  1QZX A;  5APS A;  1G4U S;  4XE5 B;  1OR3 A;  1WWP A;  1PGQ A;  4IB4 A;  4JBZ A;  3IAO A;  1W2B O;  2EPN A;  2FYU J;  2IXO A;  3EZH A;  4NTB A;  3HUS C;  2A45 G;  3ECS A;  1LM3 B;  1KYO E;  2EIJ C;  4BJ6 C;  1J1E B;  4C7N B;  1JMW A;  5KKZ B;  1L0L E;  3CCS P;  4HFK B;  3LS1 A;  3RL0 g;  2A06 E;  3HE4 B;  3CMA P;  3NTN A;  1VQK P;  4O6M A;  1NSG B;  2GFH A;  1LIH A;  3CZ6 A;  2ZYG A;  1QSP A;  1WGW A;  1YBK A;  3BAS A;  2YMY A;  2ZT9 C;  2B0J A;  3MYI A;  1HH0 A;  3ZWI A;  2R7O A;  3ZDM A;  1H9T A;  4MVU A;  5EFW B;  3TJ5 A;  4IWB A;  4OD4 A;  2Q6Q A;  1SQP D;  2HZ8 A;  2C03 A;  5CCH C;  1A41 A;  1LT9 C;  3G3Z A;  4H54 A;  5KYX B;  2WSC J;  5JVE A;  3DI5 A;  2WZL A;  4KNW A;  1ZRT D;  1BR4 A;  1U7M A;  3H1J J;  3AE1 C;  2J58 A;  1OCC C;  1ZLL A;  1PFI A;  5E3C A;  2B87 A;  3U2L A;  3TNU B;  1FNT c;  2R7T A;  3CX5 I;  1QEX A;  3M0D A;  2I1K A;  4IL6 E;  3R7C A;  4C3B A;  3PRJ A;  2Q4F A;  3H32 B;  4RBN A;  3X2Q C;  1RY3 A;  1BSH A;  1H0T A;  3CSK A;  4I6M C;  1IK7 A;  2KUB A;  3AG4 C;  1YHQ P;  1B68 A;  1J2J B;  3OJA B;  1YAR O;  4P9T A;  2JP3 A;  2DYR C;  3AE6 C;  4WY4 B;  3IQT A;  1RF0 C;  3PTZ A;  4OVN F;  3O6Q B;  2H7H A;  2KSE A;  1AVO B;  2MJZ A;  3GHG C;  2PF4 E;  4AUW A;  5F5F A;  2M5A A;  1Q2N A;  1XTC C;  1R8E A;  5L0I A;  3CWB D;  5AC5 A;  1ZHT A;  4WJ0 A;  3RK2 C;  1KYO H;  1XZQ A;  3U8V A;  3PDM P;  4EBJ A;  2XLH A;  2N1T A;  4AYC A;  4DJG A;  1IZN B;  4XEK A;  2R7R A;  1NTK D;  1OIP A;  1OW8 A;  4DXW A;  5KJ7 D;  4LLH A;  1TWH A;  3OEO A;  4W8K A;  2KLU A;  4YL1 A;  4I7Z B;  1KC8 Q;  4PJ0 E;  1S5L E;  3F89 A;  2XNX A;  4U5H A;  5KYW A;  2NRG A;  4Q7C A;  2PP4 A;  2E74 D;  1S05 A;  1N7L A;  3FAP B;  2OTK E;  2KJG A;  1JY2 O;  4GOE A;  2QEX P;  2WT7 A;  4DOZ A;  2CW0 F;  2Y3D A;  5DS6 A;  3PLN A;  1L0N E;  4AQR D;  3FHD A;  2D4U A;  2YKO A;  1QLE D;  2R9R B;  4RDA A;  3E7K A;  2FYN C;  3RL0 D;  3HJC A;  4UB8 E;  1NHL A;  4IL6 H;  4I1L A;  4C7N A;  1YZA A;  4PK4 A;  3VYW A;  3HE4 A;  1CZQ A;  2QJK C;  1SP4 A;  5DVW A;  3A3Y B;  3MGN A;  4E7S A;  4P6I C;  1NTZ E;  3BCC D;  1J1D B;  3ZDL A;  3H1J D;  1EDK A;  2JR8 A;  1FOS E;  3K66 A;  4PV1 D;  4DJ9 A;  1FFT C;  4AL0 A;  1K8A Q;  1YTZ T;  3HD7 C;  1E2X A;  5BVZ A;  5KJ7 C;  3VP9 A;  2WSS H;  2NPS B;  4PD4 E;  2OAR A;  4LAC B;  1RF1 B;  2LXC B;  5KYX A;  2QE9 A;  2YXR B;  1VQ9 P;  3TOL A;  2E74 C;  4G7O F;  1L3P A;  2EPM X;  2QM8 A;  3ITK A;  3AE2 C;  3W8H A;  4WAB A;  1W2E A;  1ZU4 A;  2AWY A;  3TNU A;  4DOJ A;  2KNC B;  1FMW A;  1MND A;  4PJL A;  1FZA A;  1VMA A;  3MBG A;  2AVK A;  2D2C B;  2P67 A;  1BCC J;  4PJ0 H;  1S5L H;  1T9K A;  1RQV A;  4DRJ B;  3H32 A;  2Q3T A;  1FZG A;  3F47 A;  3RQE A;  2OTJ P;  4X0R A;  1QLE C;  3USS A;  3RL0 C;  4WY4 A;  1URQ B;  1QX8 A;  2B9B A;  2BE5 F;  1LP1 B;  2W83 C;  3O6Q A;  1OXB A;  1AVO A;  2J9V A;  1S9K D;  1L4A D;  3MTU E;  5T3T A;  1RE4 C;  1VB5 A;  3GOR A;  3W2W A;  4UB8 H;  5AVS B;  3Q5R A;  4PV1 C;  5KYU B;  4EWC A;  4MTF A;  2UUH A;  3EGD B;  4XWJ A;  3P8M C;  5L0G A;  2H7B A;  1OWA A;  5DJU B;  1D1B A;  1OCR C;  2KOG A;  3RW0 A;  3FOP A;  2YHS A;  2YQY A;  4EUK B;  1E85 A;  1FE6 A;  2NUP B;  3FX0 A;  3VMZ A;  1Q81 Q;  3WG7 C;  3LEV A;  3U0C A;  3GW6 A;  1X0T A;  2L6H A;  1S72 P;  1VK5 A;  1H6G A;  1JTH B;  2E75 D;  3J06 A;  3L75 G;  1AQ5 A;  2YMK A;  2K9J B;  4W8P A;  4PD4 H;  2ZXE B;  3T6G B;  1OKK D;  2PGD A;  3AE4 C;  1GQA A;  3N24 A;  4RES B;  1N1C A;  3HTK C;  4OIR F;  2C9L Y;  1Y4C A;  1YJG A;  4NPE A;  3DWW A;  4FWV A;  2GA0 A;  1TWG A;  1AVY A;  2JJL A;  3LLI A;  3DMD A;  4JEA A;  2DYS C;  2OYH B;  4K3A A;  2RSE B;  1G5Z A;  1VTM P;  1CGM E;  2J9U A;  3HRN A;  4U7J A;  4IOI H;  1L4A C;  5DLJ A;  5A6B A;  1M2V A;  1PGO A;  2OQM A;  3QTH A;  2KZJ A;  1M2O A;  1MMD A;  3M79 A;  3FWN A;  5B1B C;  1VQO P;  1DIP A;  4CDV A;  3ZSU A;  2IBZ G;  1E83 A;  2XL4 A;  1LTJ B;  4TT3 H;  3B4S A;  2HPC B;  4XEF A;  1EA8 A;  3H6P A;  4IL6 X;  1BCC D;  2NPS A;  3L74 G;  5AC4 A;  5AVR B;  5L0C A;  1A7V A;  2YL3 A;  3QW0 A;  2KYV A;  4Y99 B;  2E5Y A;  4KC9 A;  2E75 C;  4MW8 A;  1S7Z A;  4L76 A;  4DCK A;  3H1H E;  4HFF B;  2YNY A;  1KB9 I;  4WB4 A;  1G1J A;  3ZIB A;  1YLM A;  1N7S B;  2HJM A;  3QH9 A;  2IZ0 A;  4AK9 A;  3UGO A;  3S1K A;  3CX5 D;  2K1A A;  1SFC B;  4BJ5 A;  3VM6 A;  4EIJ A;  1TWC A;  1LGH B;  5JS5 A;  4FAP B;  1URQ A;  1PPJ D;  5AVY B;  4CS8 A;  2IFN A;  2G3K A;  3H65 A;  4U5B E;  1LP1 A;  1KU2 A;  1HF9 A;  1HE1 A;  1TFO B;  1I4Z A;  1O5H A;  5KLI C;  2P7J A;  4J7Y A;  4CSA C;  3SYN A;  3O10 A;  1SQP K;  2VC9 A;  2EPO A;  1T6U A;  4YXD C;  3KMI A;  1R5L A;  3A9C A;  5KYU A;  4E7Z A;  2WVO A;  2JEE A;  1MNE A;  3EGD A;  3HNI A;  1KIL B;  5CCG D;  4LGD E;  4FES A;  4H13 D;  4YT8 A;  4HH2 A;  2NG1 A;  2NUP A;  3AE5 C;  2TMV P;  5KLV J;  1SQP G;  1JPJ A;  3MD0 A;  1ORJ A;  1IFP A;  4XPW A;  4HEA J;  3MIW A;  3GWN A;  3L75 J;  3ATP A;  1VF5 B;  1LT1 A;  1JTH A;  2NPU A;  3NYM A;  2ZT9 B;  2C0X A;  2K9J A;  3A11 A;  2RN0 A;  3EWK A;  5AW6 B;  1BDD A;  3RBX A;  3L0I A;  1YIT P;  2MWQ A;  5BU5 A;  2P61 A;  1N73 C;  3TOM A;  5COG A;  2FFD C;  1MUU A;  1BGY E;  1OMI A;  3SWK A;  2H8P D;  2OYH A;  1U89 A;  2AP3 A;  4W7Z A;  3AEG C;  1KZU B;  4WWI A;  2P1A A;  2P1J A;  3GF3 A;  4OIN F;  4XEV A;  3IFM A;  3IHU A;  2OGU A;  4MTG A;  1X79 B;  3EHN A;  2PX3 A;  2WWW A;  5AW7 B;  1QGK B;  3CWB G;  4RD9 A;  3CCE P;  4EOT A;  1NTM D;  2J7P D;  4H0L B;  1JOC A;  1U7J A;  1LTJ A;  1HGV A;  2HPC A;  2GM4 A;  2AXT E;  4MQ9 F;  4H13 C;  2Q3E A;  1LKX A;  1LTG C;  2M4E A;  4BJ1 A;  3L74 J;  3GHG B;  2IXM A;  4JIO A;  4C7O B;  4JCZ A;  3ABL C;  3RQF A;  2M0B A;  2WB7 A;  4AE4 B;  2NZ2 A;  3U5S A;  1ZW2 A;  2R7U A;  3RK2 B;  2LCH A;  2YKP A;  1Z7Q c;  3Q5S A;  3M0A A;  3R2P A;  1GU4 A;  3B5N B;  1N7S A;  3GM3 A;  4U5D E;  3GG2 A;  2HG5 D;  1KYO I;  2VH3 A;  2R7W A;  1PP9 D;  1NO4 A;  2X51 A;  3X1O A;  1FZF A;  2W6B A;  1SFC A;  4RKU J;  1A7E A;  3TD7 A;  2G3A A;  3VTP C;  2HLO A;  3S9O A;  5APX A;  3KXD A;  2DI3 A;  3TGU J;  2EIM C;  3EH2 A;  4MVQ A;  3U3F A;  1ST6 A;  3EFO B;  1BE3 G;  4CPG A;  1PGP A;  2OKU A;  1WT6 A;  3GOD A;  3GEI A;  3UMK A;  2EPL X;  3EZI A;  3U8P A;  2PX0 A;  5KLV D;  4D6T G;  1SQP E;  5C39 A;  2ZXP A;  3IQ5 A;  3L75 D;  4IGG A;  3BCC G;  3RK3 B;  1ZRT E;  1KOR A;  5JUA A;  4O7G A;  2FYN B;  1KIL A;  2WMM A;  4JC7 A;  1LI7 A;  4D4X A;  1YDI A;  2OQQ A;  5AW9 B;  2F22 A;  2WPQ A;  3DAG A;  3CXH E;  1E86 A;  2WVR A;  1RKC A;  3SWF A;  4B6I A;  2L7A A;  4ONS A;  2AXT H;  3RK3 E;  4GEH A;  3CC4 P;  4UDV A;  2JDI H;  3MP7 B;  3B0P A;  1GK6 A;  1LWU B;  1AA0 A;  3LW5 H;  3HD7 B;  1T6Q A;  5APT A;  1JY2 P;  1GL2 B;  1SQQ E;  1BBH A;  1EXJ A;  4BG0 A;  3PHL A;  1GD2 E;  2WPS A;  2E74 B;  3KH2 A;  4U5C E;  3AEF C;  1ZVZ A;  1OXZ A;  4ASV A;  1Q7Y Q;  2N9B A;  4HB1 A;  2EIK C;  2H7O A;  1NTK E;  2HMZ A;  2I8D A;  2X0C A;  1NU1 K;  3CWB J;  1RH5 B;  1MKM A;  2R03 A;  4H44 D;  1TU3 F;  3G4S P;  3AOU A;  2I1J A;  3II6 A;  5L3V A;  2BCC D;  1CGN A;  3L8I A;  3JRT A;  1IK9 A;  2FYU E;  1TR2 A;  5JT4 A;  1H8A A;  256B A;  3CCL P;  2OTL P;  3CLQ A;  2G3V A;  3ZQV A;  1KNY A;  1K05 A;  3AEA C;  2R7S A;  3JT1 A;  3GHG A;  1NU1 G;  1M6T A;  2WVN A;  4N78 D;  4YT4 A;  4A2N B;  4C7O A;  2XU6 A;  2DGJ A;  3VF0 A;  4AE4 A;  2H43 A;  2OEV A;  2ZJS E;  3TGU D;  2OCC C;  3Q7G A;  4M63 A;  3NFQ A;  2AXC A;  5CBO A;  3P8C D;  4CS9 A;  2WZG A;  3B5N A;  3CXH H;  2CNW D;  1EQ1 A;  1T8Z A;  4ER9 A;  2VCA A;  1KB9 D;  1W5C E;  4ANJ A;  2UUI A;  4E0I A;  1N2D C;  4OH8 B;  2Y3G A;  4U9E A;  1Y6D A;  3NG1 A;  2I8B A;  1BE3 J;  3TUL A;  3CCM P;  2FXP A;  3H1J E;  3I5Q A;  4W80 A;  3CL3 D;  2P6V A;  4D6T J;  1H9G A;  2LK4 A;  2KGO A;  1VQ5 P;  2E87 A;  3NKD A;  3W68 A;  1Q0D A;  3RF3 A;  2VAS A;  4H44 C;  5L8R J;  3BCC J;  3TK1 A;  2KLV A;  4PD4 I;  2YL0 A;  2KS1 B;  3GEE A;  3FDQ A;  4NC3 A;  2YZS A;  5BU8 B;  1YTZ I;  3SXZ A;  2Q1K A;  4LC1 A;  2XXA B;  2ZAE B;  1BCC G;  2Q9C A;  2WPV B;  3UR3 C;  2LFF A;  2W6A A;  4MVM A;  3M9Q A;  1FU1 A;  1T3U A;  4L73 A;  4Y28 J;  5GTI E;  1YI2 P;  1T2K D;  4J7T A;  1M56 D;  1V4A A;  2A6E F;  3OW2 O;  3U3B A;  1I4Y A;  1JUN A;  5APQ A;  1LWU A;  1YYC A;  5E79 E;  3HD7 A;  4Q4Z F;  5APW A;  1UII A;  4E0H A;  1S9K E;  2XLV A;  1GU5 A;  4YPC A;  2YRF A;  3S29 A;  1GL2 A;  3B71 A;  1UFB A;  2XL8 A;  3RYL A;  1Z63 A;  3I55 P;  2LFD A;  5H2F E;  2KI7 B;  2W27 A;  2XKM A;  1M57 D;  1PPJ G;  5JRA A;  2E43 A;  2CPS A;  2YL1 A;  4XA4 A;  2PFX A;  3C1L A;  3H1L D;  3KPH A;  1DEB A;  3M9H A;  3DE9 A;  2Z5I A;  1CPQ A;  1SR2 A;  2WSC H;  4N6J A;  3M15 A;  1DOW A;  3NMK A;  3LLK A;  1KQG B;  3G4Z A;  3EHM A;  2ZXO A;  1ZP0 C;  4F4B A;  3FOO A;  3W4Y A;  2J45 A;  2KK7 A;  3IQC A;  3TYY A;  3DD7 A;  1AFO A;  1NU1 J;  2Z4E A;  4IRU A;  1R4T A;  1Q82 Q;  1CGO A;  2HOD B;  3CCQ P;  4R32 A;  5JSL A;  3HNK A;  2FGY A;  2Y0D A;  3ITF A;  1RE4 A;  1WRG A;  2N1T D;  1VQ7 P;  4OIP F;  1BE3 D;  4AX2 A;  3AGT A;  1T2K C;  1Z23 A;  3S4R A;  1M56 C;  3ZTM A;  2KK1 A;  1NG1 A;  2FXO A;  1MMN A;  1DOV A;  2QY9 A;  4D6T D;  1HWT C;  2KP8 A;  2I15 A;  2Y0C A;  1VQ6 P;  1YA9 A;  2L81 A;  5GTI H;  4KJM A;  1JAF A;  2L5G B;  2WVQ A;  3EPV A;  3T6J A;  2QJP C;  2L6F A;  2Y3H A;  1QQ3 A;  2BC5 A;  3LJB A;  2VB6 A;  3U9M A;  2LKM A;  5E33 A;  4N4W A;  3MX3 A;  1W2W A;  1M57 C;  1NTM K;  1VDF A;  5E79 H;  3KYJ A;  4EIY A;  3L73 J;  1S1C X;  4EBB A;  4DRH B;  3JRM O;  3KHU A;  1BCC E;  1NWQ A;  3CEX A;  1NGM B;  4N6H A;  2HJ3 A;  5E2Q A;  2LR2 A;  4ZMD A;  5H2F H;  1N73 B;  4K7B A;  4JPZ B;  2E42 A;  3GM2 A;  1JY3 P;  1NTM G;  2KS1 A;  3C8V A;  3N0T A;  5DQZ A;  2O1J A;  4DRI B;  3G71 P;  2N9Y B;  4YJW A;  2L6G A;  2HS5 A;  2XXA A;  3L35 A;  2IXN A;  1BZ4 A;  2UWJ E;  3A0B E;  5L0F A;  1YQ3 C;  1EZV I;  4ZKU A;  2A45 H;  2N1T C;  3CX5 E;  2YKZ A;  3BEH A;  2ASR A;  4K1O A;  5CI8 A;  3L70 G;  2KQ9 A;  2E76 B;  4I1O B;  3KKB A;  2R3C A;  1SZI A;  2J8W A;  2J9W A;  3N4X A;  1G2C B;  3T97 B;  3V2N A;  2OG2 A;  1T3J A;  1U6H A;  4U5G A;  1PP9 G;  4QDL A;  5KLV K;  5DS4 A;  1ZOY C;  3L72 D;  1GW4 A;  2XSE A;  5EGY A;  3RVY A;  1JNM A;  3WUV A;  1TKN A;  2LD6 A;  1D1A A;  1HW1 A;  1EDI A;  2FY8 A;  1LE4 A;  3RKO F;  1IFI A;  3ASN C;  4QI0 A;  3RQG A;  4ZKP A;  5FCL A;  1NJI Q;  1NU1 D;  3EQL F;  2P58 A;  2OOC A;  1JMB A;  1SQX G;  3VOP A;  4IJJ A;  2YL7 A;  1FJK A;  3Q2Y A;  3N2Z B;  5KLV G;  4I44 A;  4WY4 D;  2IYO A;  3WOD F;  3H2V A;  3B0U X;  2C0W A;  3MUD A;  2W4M A;  3L8J A;  1J1E C;  1FAV A;  2R7Q A;  1M1K Q;  4R4L A;  4G7Z F;  3GAN A;  5F28 E;  4Q5S F;  1KD1 Q;  1A7D A;  1J8Y F;  1L7C A;  2WSF J;  4ULW A;  1T6A A;  3SXM A;  2KNH A;  3GF7 A;  3U1A A;  4EYY Q;  2R7X A;  2JX0 A;  2HOD A;  1HTL C;  3H1K G;  3HNL A;  4DVY P;  1KN7 A;  5BQH A;  1K9M Q;  2W6J H;  1V54 C;  1FS0 E;  2J46 A;  5JP7 A;  5AVX B;  2H88 C;  4JKV A;  4G7H F;  4JE9 A;  2NSF A;  3L73 D;  2A6H F;  3A0B H;  3S28 A;  3CX5 H;  2IZ1 A;  5TJ5 E;  2BEZ F;  3AG2 C;  2AEF A;  3VMY A;  3DXJ F;  3K1I A;  3FWL A;  1PIX A;  2WIT A;  3OA7 A;  3FVY A;  3ZVR A;  2QRX A;  3CAX A;  4CS7 A;  1NTM E;  2O1K A;  4KNV A;  2O01 J;  2C04 A;  1OCZ C;  3G4X A;  5M1B A;  4OGQ D;  1SYQ A;  1OR2 A;  5HV9 A;  1NTZ D;  2YO2 A;  1P84 I;  1RF1 A;  2K37 A;  2K3R A;  5AW1 B;  3PHF 2;  4WY4 C;  1HVV A;  2OYI B;  1NAF A;  3US6 A;  2FKW B;  3AE7 C;  1N73 A;  5AVU B;  1NTM J;  1EKY A;  5AVT B;  1OXK A;  2J9B A;  4FX5 A;  3M4B A;  2BCC G;  1VQ4 P;  2KNC A;  5A6B D;  1LI5 A;  3SXY A;  3U1C A;  5APV A;  2R05 A;  1R5I D;  3LAY A;  1GMJ A;  1Y8A A;  1SQB J;  2HR3 A;  3PH0 A;  2Z5H A;  3IN6 A;  2GAQ A;  4BXL A;  3IQ6 A;  3L70 J;  1WTY A;  1BDJ B;  3NKE A;  3KDP B;  1IFN A;  3TGU G;  1S4X A;  2NPS D;  3SXK A;  3A7O A;  1Q0K A;  1LNQ A;  1CI6 B;  1G2C A;  3G9R A;  3T97 A;  5A6J A;  1M90 Q;  1PP9 J;  2XLM A;  3LUT B;  3Q6N A;  1EI7 A;  3UGP A;  2C9N Y;  1S5L X;  5KLV E;  5KYY B;  3M91 A;  4NQF A;  4I3M A;  1MMG A;  4MN4 C;  2YWA A;  1OW6 A;  2HYN A;  4CJG A;  4MND A;  3L75 E;  3HUS B;  3JSZ A;  2YLI A;  1SQX J;  1NVO A;  1GS9 A;  5CBN A;  4JYC A;  1N86 A;  4OGQ C;  2ZXR A;  3RFY A;  3KZI E;  1A0B A;  2ZVN B;  4PFO A;  3NMJ A;  5AGF A;  2HV6 A;  4GQH A;  3VRC A;  2XL6 A;  1GTW A;  2XS1 A;  1AEP A;  1URQ D;  2W4B A;  3EGX B;  3CXH I;  3FXH A;  2YEV A;  1E5W A;  4QMA A;  4P9F A;  5AW4 B;  3M9B A;  2ZVO B;  4EBK A;  1OCO C;  2VRS A;  4JVS A;  1RJ9 B;  4KHX A;  1NKZ B;  1EC5 A;  3H1K J;  2Q5U A;  1X8Y A;  3C8G D;  2Q9I A;  4EKW A;  1J1D C;  1LT9 B;  5D92 A;  3JYH A;  1QL1 A;  2KB7 P;  2YVK A;  3C9I A;  3S27 A;  1E84 A;  4QI2 A;  3B9Q A;  4H44 B;  5CIV A;  3ABV C;  2YIU C;  2IBZ E;  3JSV C;  1S2E A;  1K73 Q;  2CPB A;  3O55 A;  4Z9I A;  2NPS C;  3WUU A;  2HSB A;  3AJM A;  3NRH A;  2O01 N;  3VYI A;  3T9O A;  2CYD A;  3UIA A;  2ZPA A;  3L74 E;  2WSE J;  1ZHW A;  4RJT A;  1I5N A;  3CCR P;  5CCG C;  1NAY A;  2BCC E;  1NOH A;  3K5B A;  2YO3 A;  4CIH A;  5KAI E;  3CME P;  2XS8 A;  4GDO A;  4ULV A;  4ZLD A;  1E79 H;  1BR1 A;  1SQB D;  3R4Y A;  3L71 G;  1LTB C;  4BJ5 C;  4GKG A;  4U9D A;  3BRV B;  3H1L G;  2EPK X;  2OYI A;  1URQ C;  1FZC C;  3L70 D;  3HLZ A;  3LNR A;  3NMD A;  4N78 E;  4L74 A;  2BCC J;  1DD3 A;  4YN0 B;  1ZXG A;  2ZXX A;  3TGU E;  4H4K C;  3VP8 A;  3BRJ A;  2QG4 A;  2V7Q J;  3KZI H;  1ZN5 A;  3AQB A;  3OA1 A;  1FC2 C;  1ZV8 A;  1RE3 A;  2PRR A;  3PJS K;  2AWC A;  2KIK A;  4E18 A;  4O9B A;  4JTD B;  3KYI A;  4CBE A;  3KPE A;  1LTI C;  1LS1 A;  2NSG A;  4XLP F;  4GOD A;  1ZYR F;  3H1H D;  4B86 A;  2WPR A;  2O3J A;  4U3F J;  2FXM A;  2OJE D;  4MTO A;  1EZV D;  5L0J A;  2ZYD A;  2IOQ A;  3C8Z A;  3JSE O;  1SQX D;  1U57 A;  4CX9 A;  1QL2 A;  1ZHX A;  1D0X A;  1CI6 A;  4JRZ A;  4U5E E;  1TWA A;  3OAK A;  3D6Y A;  2XM0 A;  4BEJ A;  2LQG A;  5KYY A;  1OW7 A;  3F46 A;  1H89 A;  3LID A;  1HJB A;  4JTA B;  1N7S D;  3HUS A;  1ZHY A;  3GM1 A;  4JJG A;  4AL1 A;  4XPX A;  4BJ6 A;  5T3W A;  3H1K D;  5B3I A;  3DZA A;  1SFC D;  1MZ9 A;  2QSI A;  4JEB A;  4EDF A;  5B66 E;  3H1I J;  2KSJ A;  3O6X A;  3CCV P;  2B88 A;  5KAF E;  5COF A;  2QJK B;  2OYH C;  4HJG H;  3WMM 0;  3K33 A;  1DH3 A;  2JD3 A;  3JZ0 A;  3EGX A;  3I4U A;  4C3D A;  2CGE A;  5KAI H;  2P2U A;  2QJP B;  1ZR4 A;  1ORS C;  1QKR A;  1RJ9 A;  3WU2 E;  1Z5Z A;  1SF8 A;  3TJ6 A;  1YJN P;  2V26 A;  4OIQ F;  1KQL A;  1JPN A;  2IX7 C;  2PAJ A;  2IYL D;  2Q9B A;  5CCH A;  3G6E P;  1LT9 A;  3U9J A;  5JLI A;  3IR9 A;  2J0W A;  3KQG A;  2W90 A;  3CWB E;  1LTJ C;  1BR2 A;  1KIL D;  1DX7 A;  2Y0E A;  1SQV J;  4J32 B;  4N6C A;  1XWJ A;  4MVZ A;  4NTA A;  3LS0 A;  3CCJ P;  1RXQ A;  3P7K A;  2IPP A;  3RVZ A;  1YIJ P;  1OQC A;  3HKK A;  1XTG B;  1BGY D;  2R5B A;  4EHP A;  5L0D A;  1VOM A;  2LIG A;  1YQ4 C;  2R7V A;  1HUC A;  1VF5 D;  3QVY A;  4L6R A;  1FJP A;  5FZT A;  3MZW B;  1GM5 A;  3L72 G;  3Q1M A;  1N7S C;  4XLN F;  3RL0 B;  3CC2 P;  1NLX A;  1RF0 A;  2M3E A;  3L71 J;  2A45 I;  1HBW A;  1LS4 A;  4WVZ A;  3D6Z A;  3GEH A;  1WMK A;  1SFC C;  4PAC A;  3H1L J;  2ZXW C;  1JY3 N;  5CJ4 A;  4WBA A;  3SNH A;  1YJ9 P;  1PD0 A;  3U2M A;  1P84 D;  4U3F D;  1SS1 A;  3DJN B;  4PV1 B;  4WGZ A;  5E3A A;  1BE3 E;  2QLA A;  2HSQ A;  1HW2 A;  2KC3 A;  5B66 H;  1G1I A;  4N06 A;  1Q0F A;  5KAF H;  2KXP B;  4XQ1 A;  1L0N K;  4D6T E;  2Y39 A;  3QW1 A;  3D71 A;  2CDQ A;  4HYT B;  2IXP A;  3AG1 C;  4H0L D;  3DM9 B;  1KIL C;  3BCC E;  1ZHZ A;  2RH0 A;  3NXS A;  4PJM A;  3PMR A;  1IC2 A;  3EFO A;  3WU2 H;  3UMI A;  2BAS A;  5AW5 B;  1KFN A;  3L73 G;  1L0N G;  1OX3 A;  3H1I D;  2VCC A;  2SPZ A;  1BDC A;  2ZD9 A;  3DE8 A;  3LNM B;  3EG9 B;  2XDJ A;  1NTZ K;  1JM0 A;  3HTK B;  1VF5 C;  3NYL A;  3RK2 D;  2FFH A;  4OIO F;  2W45 A;  4JYB A;  4TLF A;  4LDK A;  1L0L J;  2J59 M;  3E1I A;  2KW3 C;  3B5N D;  2RKL A;  1M1J C;  1VQ8 P;  2WTY A;  4K35 A;  4C46 A; 
#chains in the Genus database with same CATH homology
 4OGQ D;  2NZ2 A;  3Q5R A;  1KMI Z;  4PV1 C;  1MKM A;  2G8Y A;  4H44 D;  1TU3 F;  1YQ3 C;  3B71 A;  3H25 A;  1UFB A;  3K7D A;  3L8I A;  3AE7 C;  2WSE J;  3AEC C;  3JYY A;  1NYH A;  3RL0 g;  1HF9 A;  3Q5S A;  2E76 B;  2P10 A;  3GM3 A;  1RQU A;  5KLI C;  1KNY A;  1K05 A;  3AEA C;  3O10 A;  3U0C A;  1JB0 J;  2JO1 A;  3AEE C;  4GDO A;  3T97 B;  4RKU J;  2L6H A;  1GMJ A;  1VL2 A;  2G3A A;  3SFE C;  4YXD C;  2FYN C;  2ZT9 C;  3R4Y A;  1HJ0 A;  1KIL E;  3S9O A;  3IN6 A;  2E75 D;  3GLM A;  1ZOY C;  1KQG B;  3Q3D A;  2J5U A;  3U3F A;  1WTY A;  2YMK A;  1YQ4 C;  2QIW A;  2MKV A;  1ZP0 C;  3C18 A;  1VF5 D;  4H0L C;  1DD3 A;  4H13 D;  3AE4 C;  2QJK C;  2Q00 A;  2WSC J;  2IDB A;  3AE5 C;  3Q1M A;  3AE8 C;  1ZME C;  3BRJ A;  3RQG A;  1KQF B;  2V7Q J;  3MFN A;  1EXI A;  2WQY C;  3AE1 C;  2E75 B;  3G9R A;  1K40 A;  4R32 A;  2D2C C;  4PV1 D;  3D6Z A;  1WMK A;  2PBE A;  3Q2Y A;  1S5L X;  3Q5P A;  1VF5 B;  1ZRT E;  4NQF A;  3TUL A;  4H13 B;  1KOR A;  3L8J A;  2FXP A;  2ZT9 B;  2KK1 A;  2YWA A;  4R4L A;  4U7J A;  1OW6 A;  1Y9B A;  3EWK A;  2OQQ A;  5F28 E;  1IK7 A;  2E76 C;  3AE3 C;  4PV1 B;  2LK4 A;  2WSF J;  4YTP C;  1U57 A;  2BEQ D;  1DIP A;  2JP3 A;  2E74 C;  3GF7 A;  4OGQ C;  3AE6 C;  3AED C;  2K9Y A;  4Z1M H;  3FGA D;  1PL5 A;  3AE2 C;  2ZT9 D;  2JPU A;  2JX0 A;  4H44 C;  5L8R J;  3D6Y A;  1OMI A;  1O3U A;  1DD4 A;  1QVX A;  4I7Z C;  1UIX A;  1JOG A;  3AEG C;  4TT3 H;  3D71 A;  2QJP C;  3RK3 E;  2L6F A;  4XEF A;  2H89 C;  1OW7 A;  1PV3 A;  1Q90 D;  2D2C B;  1AJY A;  3GF3 A;  4IL6 X;  3C8G B;  2H88 C;  4H0L D;  2QJY C;  3D70 A;  1RQV A;  4R4M A;  1ZZP A;  4EBK A;  4XEV A;  1R8E A;  1S1C X;  3RQF A;  5KKZ C;  3GM1 A;  1FDI A;  3RQE A;  1K04 A;  4EBJ A;  2WPV B;  2D2C D;  4XFJ A;  2BEZ F;  2QSI A;  4KT0 J;  1NGM B;  3C8G D;  1KTM A;  1EXJ A;  4XEK A;  2E75 C;  1PIX A;  4H0L B;  3AJM A;  2E74 B;  1OW8 A;  3LW5 J;  4OGQ B;  1FDO A;  4Y28 J;  3AEF C;  3O6Q A;  1V4A A;  3AE9 C;  4H44 B;  3GM2 A;  1VF5 C;  1WWP A;  3C8V A;  3JZ0 A;  3ABV C;  2YIU C;  4H13 C;  3C8G A;  3GMA A;  4I7Z B;  3SFD C;  1WOL A;  3AEB C;  3IAO A;  2E76 D;  2O01 J;  2L6G A;  2HSB A;  2FBW C;  5M1B A;  2E74 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...