1KTMA

Solution structure of fat domain of focal adhesion kinase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
139
structure length
139
Chain Sequence
MANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDESLPVLPASTHREIEMAQKLLNSDLAELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMISQSRPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insight into the Mechanisms of Targeting and Signaling of Focal Adhesion Kinase
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
molecule keywords FOCAL ADHESION KINASE 1
total genus 53
structure length 139
sequence length 139
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2002-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ktmA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1ktmA02
3MFNA 5F28E 2PBEA 1OW7A 3BRJA 1KTMA 3JYYA 1O3UA 2HSBA 1OW6A 4YTPC 3AECC 2G3AA 2JPUA 2Q00A 3AJMA 2H89C 3AE6C 4EBKA 1ZOYC 1WOLA 1KNYA 2JX0A 1QVXA 1ZZPA 3AEFC 4NQFA 3S9OA 3JZ0A 1WTYA 1YQ4C 3AEDC 3AEBC 3RQEA 3SFDC 1K40A 1OW8A 3TULA 1K05A 4YXDC 3U0CA 1JOGA 4XEKA 3U3FA 2L6GA 3L8JA 3AE5C 3SFEC 3AE2C 3C8GA 1UFBA 1V4AA 2L6FA 3O10A 3AE1C 3RQFA 3AE4C 4XEFA 3C18A 3AEGC 2WQYC 3C8GB 2LK4A 1ZP0C 3C8GD 3AE7C 4EBJA 1WWPA 4R32A 1YQ3C 2H88C 1K04A 2L6HA 3GM3A 3GM2A 1PV3A 2KK1A 3AE9C 2YWAA 3L8IA 3RQGA 3AEEC 3GM1A 3K7DA 4XEVA 3ABVC 3AE3C 3B71A 3AE8C 3AEAC 2FBWC
chains in the Genus database with same CATH superfamily
4XPXA 2ZXRA 3TGUG 1EDIA 3BATA 1SFCA 1JOCA 3JRMO 2J46A 1LT9B 1O3UA 2KK7A 2HSBA 3K1HA 1OW6A 2Q5UA 1J8MF 2HZ8A 1SVFA 3UMKA 2Q9CA 1L4AB 5AVRB 4N78E 1ZHZA 1ZR2A 3WU2H 2I1JA 2YKZA 3C9IA 1LPEA 2KGOA 3IPMO 3MBGA 1JUNA 2N9BA 3EFOB 4MQ9F 3C8VA 3P7KA 2CPBA 3HD7B 3TGUD 3JSVC 3H1HJ 3CX5I 2KSEA 3S4RA 1K8AQ 3B0PA 3G50A 3AEBC 5JT4A 5COMA 4WJ0A 2DI3A 4Z9HA 2IYOA 5H2FE 3U0CA 1N2DC 5CBOA 4U3FE 3QVYA 2DB4A 2WMMA 3I56P 1WN0A 5E3AA 1VQPP 1VYKA 1KILA 2A45I 1LNQA 3AE2C 4PJMA 2WSCH 4H4KC 3AE1C 1NU1K 4E0HA 4O6MA 1T8ZA 4E0IA 1G1IA 4H0LB 1HMOA 3RYLA 1CI6B 4Y28J 3QMKA 1BR2A 2Y3BA 3W8HA 1SQPK 4LERA 4U5GA 5TJ5E 3MUDC 5BVZA 4PJ0E 1E2XA 1GS9A 1LS4A 1MMNA 3BVHA 5A69A 1C02A 4EIYA 3R2PA 4P9FA 4DRHB 2WITA 1D1BA 5HV9A 1N1CA 4BWNA 1OKKD 3EFFK 4BJ5C 256BA 2M5AA 1BR1A 5DQTA 2FY8A 4EOTA 3EG9B 1YZAA 3R4YA 3NFQA 3T6GB 5KYWA 4PD4E 3AG1C 2FKWB 2Q9AA 3LUTB 3U2MA 1OXZA 1J8YF 3T97B 2JWAA 2V26A 3VMAA 4EYYQ 3VMZA 3ZTZA 2R7RA 3B5NA 1SQXK 2BEZF 2JEEA 3ZIBA 2R7UA 1T3UA 3VMYA 1SQQG 1U89A 4WWIA 2H8PD 4MS2A 1A0BA 1SQXG 3G6EP 3FX0A 2PX3A 4LGDE 2FAPB 2XLEA 3NKDA 3EJNA 2Q00A 3H1ID 4IOIH 1H7IA 3M0DC 3G4SP 1LTAC 3FOPA 5B1BC 1OCRC 3ABKC 4H13C 5D91A 2K88A 3G4XA 1D0YA 3B5ND 4YL3A 4L76A 1ZVZA 4QI0A 3FWLA 2R02A 3L70D 1M56C 2WB7A 1NTKD 1GL2B 4N3YB 3E1IA 4C3BA 2A69F 3NTNA 3S29A 1SQPE 2WPSA 2IOQA 5T1DB 1FAVA 1BDDA 4A2NB 3RK3B 2CYDA 5BQIA 5KKZC 3RQEA 1QZXA 1I4ZA 1OR2A 2LP4A 3LEOA 5AVYB 2FYZA 5E2QA 2GA1A 1FDMA 2I15A 3L34A 3KXDA 1Z3IX 1LP1B 1TWHA 3AOUA 1BBHA 2PF4E 1JOGA 1FAPB 4EWCA 3P8CD 1XZQA 4PJNA 1FDOA 5AW3B 1ZHXA 1CPRA 5CJ0A 1KQLA 3SFEC 3H1JG 2OYHC 2A06G 3FDQA 2EPNA 2RSEB 1WATA 1RKEB 3C8GA 4I3MA 1UFBA 4I6MC 3VAYA 1LVKA 3Q7GA 3TOLA 2HLOA 1PGQA 5APVA 1JPNA 3L72E 4D6TE 1V54C 3ZTMA 2WSEH 3X1OA 1SQXE 2CDQA 1HGVA 2AXTE 1A7VA 3RK3D 4BJ6A 4HEAJ 5DS6A 1L0LG 1O5HA 3B0VC 3PHLA 3KPEA 1WWPA 1X22A 2GA0A 2H88C 3SYNA 1S7ZA 2L6HA 1S9KE 5KJ7A 2H7VC 5CIVA 2C0XA 3L71E 2K3RA 2JJLA 5CMZA 3KYJA 1HW1A 3RK2B 2D4UA 4CS8C 4K35A 3RF3A 4YXWH 2XL8A 3ZQVA 3TNUA 2FXOA 4W8PA 2E74D 3CWBG 3H32B 3HE4A 1C17M 3KMIA 3NRHA 3GWNA 3L74J 1J1DB 2H7HA 2XNDH 2GM4A 1HF9A 1IK7A 1ZXGA 2J7PA 1HBWA 3GHGB 4XLPF 1LM3B 1LTJB 3WU2E 3HNLA 4U5BE 3V5BA 2HV7A 5APUA 1J2JB 3HTKC 2OYIB 3KPHA 3WAQA 1HWTC 2AXTH 4WABA 3JC22 3IHUA 2O01H 3H1JJ 2M5AB 1RF1B 5DJTB 1ZU4A 5JUAA 2WSEJ 1OWAA 1IFDA 2JX0A 4B6IA 1FC2C 2QJPC 3T97A 3WUTA 3AEFC 3S9OA 4WY4C 3CXHI 2ETSA 2K1AA 3IR9A 1T5OA 4M3LA 1Z63A 3L75D 1HVVA 1NTZK 2YKQA 4AE4A 4QMAA 2P67A 5APXA 2PX0A 1PPJG 2AEFA 2FGYA 1Q0DA 4LLEA 1KU2A 1L4AA 2W4MA 4XTKA 1X8YA 3FVYA 2XS1A 2QE7H 1ORSC 3A9CA 4FX5A 3L75E 4PACA 3V2PA 1LE4A 2R5BA 1L0NE 3E70C 1PGOA 5E79E 2J45A 4LDRA 2R7WA 3LS1A 3DZAA 2L7AA 3GANA 4MVQA 3NKEA 2AWYA 2R05A 5JLIA 2E74C 1CPQA 3U8PA 3AEGC 1YYXA 1GDTA 3UR3C 2PRRA 3L74E 2WVNA 2KI7B 1JO5A 4LLCA 1Q86Q 3Q5SA 4N6JA 4GIFA 4C3DA 1YQ3C 1D1AA 2Q3EA 2KP8A 3DXJF 2OTLP 2P10A 1JMBA 1VQMP 3CC2P 4DRIB 3K5BA 3H1IJ 2YQYA 1SQBE 2O01J 2MJZA 2XLOA 3O39A 2KLUA 5AW6B 3HLZA 2AEMA 3H1IG 3K7DA 2B9BA 1M57C 1URQD 2N1TD 3AE3C 1SQPG 3H1IE 5A6KA 2P1JA 3EZHA 1RE3A 1RH5B 2J9WA 5B66E 1HW2A 3T4RA 3CD6P 1JY3P 2KYVA 3L71D 1RE4C 1DD3A 1BDCA 3B9QA 4E17A 1FMVA 2KLVA 5GTHH 4Z1MH 3EQLF 2Q3TA 3L70J 2LFFA 3RK2C 2H8AA 2HMZA 4WGZA 2KW3C 3W4YA 4GYTA 2XZRA 3FAPB 4JIOA 2W9YA 2B87A 2W6JH 1PP9G 3S28A 1A7DA 1LE2A 3O6XA 3EQ2A 4OGQD 3P32A 1V55C 3PTZA 3RFYA 1NU7D 4U5EE 3U8VA 1NTZG 2JKVA 4CBEA 5KLIB 2XM4A 1SQVG 1WTYA 1QVGO 4C7OA 1G5ZA 4PK4A 5L8RJ 3EGXB 1JCDA 1T6QA 2NRGA 4NTFA 1K05A 1SP4A 1A02F 1OCCC 4Y99C 3DKAA 1R5LA 2CCYA 1MZ9A 3GORA 1N86A 1SQQK 1FS0E 4FWVA 2YKOA 1FJKA 4CX9A 3H1KG 1OVRA 4RO0A 4U9DA 4NY3A 3B5NB 3L36A 2L9JA 2WWWA 1VQKP 4B86A 1A02J 2E76C 3MD0A 3WUUA 1AQ5A 1YIJP 1YA7O 3TGUJ 1JM0A 2GUSA 1MUUA 3H1LG 3PRJA 3SEOA 3SXZA 4JCZA 1MMAA 4U3FG 1D0XA 3H1LE 1LTGC 4JTCB 1RY3A 2EIKC 3HUSB 3AE9C 1KB9E 4C46A 2R7VA 4BJ6C 2HR3A 1DEEG 2GFHA 1KFNA 2QJKC 1FOSF 3MLGA 1T6AA 3F89A 1USDA 1N73B 2QM8A 4JRZA 1S5LX 3AE8C 3AEAC 5T3WA 2HUJA 4QDLA 1URQB 2N1TB 3FMSA 4J7TA 1BCCE 3AGTA 3BRJA 1NZEA 5GTIE 2AXCA 1KTMA 3C8ZA 4CS9C 2A0BA 1CGNA 2X51A 2DYRC 2KC3A 3W8IA 3UMHA 2YVKA 3L75G 1YTZI 2BASA 3HTKA 3UMIA 2EPKX 5F5HA 2Y39A 2Y9ZA 4K0DA 1LTSC 4YT2A 1CGME 2G8YA 5DJUB 3LAYA 1SR2A 5JSLA 2OYIC 2LXBA 2I8BA 2E76B 4IFMA 5AW8B 1SQVJ 1S72P 2LIGA 3JRTA 2R44A 1MNDA 1VF5D 2CNWD 4EKWA 4MVZA 1LP1A 4UB8E 4JPZB 5KYUB 2QM7A 1GTWA 3M15A 4H0LC 4MVRA 3CC7P 4LLHA 4PV1C 5AW4B 1SS1A 2NPSD 2M64A 1EZVG 2EIJC 2XXAB 2LKMA 3SFDC 1N7SD 1T6UA 3QWOC 1Y4CA 5KYNA 2CPSA 2QSIA 1KV4A 2L6GA 3AE5C 3I5QA 3H1KJ 4GKGA 1PP9E 2YL3A 2I1KA 3ECSA 3N0TA 1NO4A 2KYHA 1Q81Q 1P84D 1Y8AA 3OEOA 2P2UA 3IFMA 2QNLA 5AC5A 1VLTA 3G9RA 1ZHYA 3AE4C 3ATPA 1ZHWA 1NBBA 3H1HD 1PIXA 1C03A 1EXIA 3HKKA 4IWBA 3BCCJ 1RQUA 5CCGC 4JBZA 3C8GD 4OGQC 4G0HA 1MFZA 1Z56A 1KILD 4IL6X 2E74B 1PD1A 3PMRA 2ZT9D 3LIDA 2WZ7A 5FZTA 1NU1G 3VM6A 2A6HF 1YJGA 2PAJA 3GM3A 1NTZJ 1NHLA 1NU1E 3CCVP 2VC9A 4W7ZA 3ZQYA 2KNCB 1T6IA 4PJJA 2WSCJ 1BSHA 4EBBA 3PLNA 2BL2A 4HFKB 3RGUA 2XL6A 1R5ID 3SNHA 4OWFA 3M9HA 2G3VA 4BJ5A 1OZHA 2G62A 1JY3N 3R7CA 4HE8D 1TQGA 5B5EH 1YJNP 1S3JA 1LTJC 3C63A 3HD7D 2OG2A 3RL0g 2QG4A 2QIWA 3IN6A 1ORYA 1H6GA 2DGJA 3DD7A 3TQOA 2ZYAA 3QH9A 3RK2D 1ZW0A 4MW8A 5H2FH 3CL3D 2C03A 4U5FE 1BGYG 3JT1A 1SFCB 4G78A 2HMQA 1ZOYC 3G3ZA 3BEHA 1HTLC 4AE4B 3GW6A 4AL0A 5KLVK 5AW5B 2H7BA 5L0IA 5APYA 1WRGA 2AP3A 1QPUA 1EA8A 2NZ2A 1JEKA 1L3PA 1JB0J 3LLIA 1PGPA 4K1OA 1NTMK 5GPGB 2ZYGA 2YO2A 4OVNF 4O6NA 1RJ9B 1IC2A 1OKKA 1EZVI 2YMKA 1BGYE 2LXCB 2E75D 3UIAA 3V2NA 3J06A 1OX3A 2J9UA 2M4EA 3L35A 3WMM0 3L8JA 4NPDA 3AGUA 4U7JA 3V5ZA 4IJJA 3W2WA 1OQCA 2XLMA 3HUSA 1YYCA 4M63A 2O9XA 4N06A 1V4AA 4OIQF 4WY4B 2JP3A 3LNRA 3L75J 4DBQA 3RQFA 4GQHA 4JEAA 3CWBJ 1H9GA 1EQ7A 5CJ4A 1LJ2A 1BCCD 1ZN5A 3LW5H 5AVZB 5CCHA 3GHGC 3QZCA 5KAFE 2MHRA 3KL4A 1LTBC 2R9RB 2OKUA 1KILE 2ZXXA 4ER9A 3FOOA 4NPFX 5KYYA 1ZLLA 2O3JA 5A6AA 4XFJA 3F5HA 3CSKA 3NYMA 2XDJA 2BCCG 2OYHB 2OU6A 2HG5D 5CHXA 4W80A 2DYSC 4JURI 1UIXA 1LWUC 4MNDA 4JEBA 2BCCE 5AW9B 1JY2O 5KYXA 4ZKUA 1RF1C 2POHA 3U5SA 2EPLX 4UB8H 3DAGA 1USEA 1RE4A 1LS1A 1OMIA 3H2VA 1SQVK 1NTKE 1KQFB 1IW7F 4XE5B 3EGXA 1NH4A 1FZFA 4BRYB 3TOMA 1JPJA 1Y6DA 2YLDA 1PD0A 1QQ3A 3TYYA 1S1CX 2R7SA 3MYFA 4L6RA 4PJ0H 1G4US 4I44A 1HUCA 3SWYA 1BGYD 2IBZD 3EGDB 1M2OA 2BE5F 3K66A 4N6HA 4EBKA 2B88A 3L70G 2K9JB 2IPPA 2EINC 2AVKA 1CSBA 1KILB 4ZNCA 1KNYA 3A0BE 2E42A 2Y3HA 3LW5J 3CCEP 2HJ3A 1WMKA 5AW1B 3JZ0A 3CPWO 3EZIA 1SQXD 2R5DA 1HMDA 1GQAA 4DCKA 2B87B 4WBAA 2QJKB 2HFIA 4MTGA 2A45H 1QL2A 1GZLA 2IFMA 1T01A 4JVSA 1KB9H 4EUKB 5KAIH 1B68A 5KLVE 2C9LY 3CC4P 1LTTC 3K1IA 3CWBE 5JRAA 1VYIA 4G7OF 3K1IC 2PP6A 2QJYC 3FGAD 1NGMB 3EPVA 2NUPB 1JNMA 2KNCA 1HY5A 1SQVE 3F47A 1JY2P 4I2LC 2WSSH 2XS8A 2RH0A 1JMMA 1RQVA 4CJGA 1G8XA 1OCZC 4OH8B 3US6A 2PFDA 1RKEA 3C8GB 2KSFA 2J58A 3SWKA 1QL1A 1M6TA 3CCMP 1ORJA 1QX8A 2WVOA 1PCXA 3GM2A 2NSFA 3EHMA 2QJYB 2ITAA 1LKXA 2YZSA 1IZMA 1SF8A 3CLQA 3FWNA 2C0WA 1X9VA 2NPUA 1VQ9P 1NU9C 1T9KA 4O9BA 1H89A 2ZXPA 5BQGA 5KYUA 3H1HE 3Q6MA 1KYOH 1SQXJ 3U3BA 4EDFA 5KLIC 1QKRA 1TWCA 3KZIH 1Y9BA 4MTFA 1SQBK 3V2RA 3CMEP 3TNUB 2ZT9B 1EDKA 3K33A 3L0IA 1EC5A 2IXPA 3H1LJ 4PD4D 5L0GA 3JCUE 1QVFO 2J7PD 1W2EA 3DMDA 5E3CA 1L0LJ 1LWUA 5HSWA 4JYCA 3I55P 2EPMX 1VQ4P 2OYHA 4OD4A 1AQTA 4AUWA 1LTJA 1YYJA 3ASNC 1NTMJ 1RE3C 1FZCC 3TD7A 2DW3A 1VMAA 1TWAA 4AL1A 1BE3G 4E18A 1FR0A 1CW5A 4YT8A 3EFGA 3PP5A 4OD5A 2JDIH 5AVWB 5K0IA 3LEVA 4ZLDA 1H9TA 1ZW3A 1BZ4A 1AV1A 1JRAA 2WPVB 1HJBA 1Q0FA 1TFOB 1KMIZ 1OCOC 4U5DE 1NLXA 2WVQA 2W8ZA 1NAYA 3PHF2 4IAQA 2E87A 3DE9A 4RD9A 1NKZB 2NG1A 2Q7RA 4H54A 4DT0A 2Q7CA 3CXHD 1VTMP 3RL0B 1RHZB 3USSA 4KT0J 5A6BD 1SQQD 3V4QA 1VQ6P 1V74B 1YA9A 3MX3A 3VN0A 2FXPA 2L6FA 3IQCA 2QLAA 1M1KQ 1RF1A 2UUIA 4YN0B 1S5LE 4PD4I 1SQBD 3OA7A 2L81A 3MYIA 4I1OB 3EHNA 1XZPA 1N7LA 3L73J 1RJ9A 1BCCJ 2P6VA 1ZP0C 1EZVE 4PV1D 5E79H 3TDKA 4R32A 1PFIA 2OQMA 1EI7A 1HGZA 2YHSA 4O79A 4RESB 2Z5IA 3HNKA 3MHVA 1TU3F 4LDQA 1MMDA 1DIPA 1DEBA 3VYWA 4IL6H 1VQ5P 1E84A 3CI9A 4BJTA 2XLHA 3M9QA 2WL8A 4J7YA 2E75B 3E1RA 1MQVA 3FXHA 4Y99B 2KB7P 4IFFA 1U7JA 1R8EA 3KZIE 1VQNP 1ZRTE 2P7JA 3L37A 2XV5A 1S05A 1GK6A 4D4XA 1WT6A 2YO3A 2R7TA 1M56D 4BPMA 3D70A 1VQ8P 3I5PA 3JYHA 2B0HA 2LSEA 2UUHA 1SZIA 1Q7YQ 3VF0A 1RKCA 1OFCX 1KQGB 5B66H 3JYYA 3S0XA 2BCCD 1KFMA 4JYBA 2B0JA 3QW0A 4YTPC 2FYUJ 1L0NK 5KYWB 1RF0C 1G2CA 2I8DA 1NU1J 3RIPA 4MVMA 3RBXA 4XLNF 5TISH 2LCHA 3GF7A 3CXHH 3CMAP 2IZ0A 3IF4A 1WASA 2RKLA 3K6BA 4L74A 2IXNA 5AW2B 2KNHA 1YBKA 1Z23A 1GL2C 1FZCB 3L72J 4D6TJ 2YLIA 5T3TA 1FOSE 1M1JB 2F22A 1L0ND 2BEQD 4BRYA 1M90Q 4YT5A 5JP7A 4A4AA 1Q0KA 3ABLC 4DZOA 2QY9A 3M4BA 5CCGD 4ZLCA 2Y0DA 4BXLA 1PP9J 2NPSB 4UDVA 1FNTc 1QLEC 1K40A 4MN4C 2FFDC 3NYJA 5A6BA 1FZAA 3OAKA 2HODB 3M1CB 3LNMB 2IFNA 2J8WA 1VB5A 1L0NJ 3VYIA 3VP8A 3EH1A 5KAFH 2J9VA 4WGYA 3RVYA 3AE7C 5AVSB 3FAJA 3MZWB 3D71A 1KYOD 1L0LK 1FDIA 1DD4A 2Y3GA 3DE8A 2KXPB 1KN7A 1VF5C 2K37A 3H6PA 4FAPB 1QSPA 1UG7A 2FYUD 2JWDA 4OIPF 3MGNA 3H2UA 2QTVA 1N7SB 3GMAA 2EPOA 2XRHA 4NTBA 1JTHB 4HKZH 3A7OA 1YTZT 1E79H 2P58A 3SP1A 1KQSO 3DM5A 3CXHE 2FYNB 3HJCA 2B89A 2NUTA 3T6JA 3U2LA 4YL0A 5AVUB 2IZ1A 1AVOB 4YK5A 1XTCC 4P9TA 2E43A 4D4NA 4DOJA 2YKPA 4CSAC 5GTHE 4JE9A 2IM8A 3AG2C 3S27A 5AVVB 3IEEA 2JPUA 1URQA 2N1TA 5KYXB 1EKYA 3PDMP 3POVA 1BCCG 2E76D 1M57D 3HNIA 2W83C 4RDAA 3EWKA 2LQGA 1WOLA 5BQHA 1SLQA 1P84I 2WZFA 3B4SA 2OGUA 5IY5C 1JY2N 1Q82Q 2A45G 1A7EA 1E5WA 1NWQA 3L73D 3A0HH 1X79B 1GMJA 1AJYA 5B5EE 2X0CA 5B3SC 1SQQJ 3BRTB 3E7KA 4C7NB 4JJFA 3DWWA 1Q2NA 2D2CB 5APSA 3T9OA 2W6AA 2UWJE 2FFDB 3ZWIA 4BJ1A 2XM0A 4W7YA 5CI8A 1NTME 2AU5A 1NVOA 1D1CA 2FYUG 2VCCA 3NMDA 3O10A 2R3CA 2EILC 3C18A 4DOZA 4FESA 1G4WR 5EFWB 1YI2P 1M2VB 3CX5E 2LK4A 4KBLA 1GL2D 4J32B 1UIIA 4IRUA 3V7OA 1J1DC 3CCUP 3VTPC 5B1AC 2YMYA 4MVSA 3V4WA 5DS5A 2V7QH 5C39A 4NC3A 3DI5A 1NTKK 1TWGA 2Y69C 3L8IA 4JW1A 1KYOI 2MKVA 3Q3DA 3WG7C 5CCGA 1YVIA 4DRJB 2VCBA 3ABVC 3SXKA 3OWTA 1H0TB 1URQC 2N1TC 3JSZA 5L0FA 1M8OB 3HE5A 1O87A 1XWJA 2OCCC 3WODF 5F28E 1BE3D 3UNGC 2Y0CA 3LESA 5TISE 1JCCA 2WT7A 5L0DA 3GWLA 1Q90D 2KOGA 5AVTB 3VRCA 1YLMA 3RW0A 5AC4A 3U1AA 5DLJA 1VQOP 3FHDA 1N8RQ 4C3EA 1WGWA 5JS5A 3AE6C 2IBZG 3F46A 1VK5A 4KJMA 1EDLA 3A11A 3H1LD 1KB9D 3AG3C 4JZAA 5KJ7D 5L3VA 2IBZE 4WVZA 3ZDMA 2ZXEB 2V3CC 2R32A 4H44B 1FBMA 4ASWA 4JC7A 2YL1A 1BE3J 2NUTB 4BEJA 1NSGB 2OJED 4QI2A 4JQ0D 1LI7A 1AVOA 5KLVJ 4PFPA 4PJLA 4F4BA 2W45A 3GLMA 3X2QC 3CX5H 1JR8A 2G3KA 2D2CC 4AQRD 3RKOF 5CI9A 3EFOA 3QTHA 5BU5A 4H13B 3VOPA 4WY4D 2WTYA 1K9MQ 4YT4A 3RBZA 3CAXA 3TGUE 3N24A 3TK1A 2J5UA 2GWWA 2OQQA 4PV1B 2KJGA 2RD9A 3SZRA 4KNWA 5APTA 1IZNB 1VQ7P 2NPSA 3CZ6A 1A41A 4P6IC 3CWBD 2KQ9A 1GM5A 5AVQB 4I7ZB 4UB6H 4WY4A 3IQ5A 4JTDB 2O1KA 2Z4EA 3L73E 1X0TA 2CGEA 2GAQA 1NFNA 3NMIA 2KIKA 1M2VA 2KK1A 3NG1A 1IFIA 2XLDA 3GM1A 1AA0A 1E85A 4GOFA 2W27A 1NKNA 4I7ZC 2FFHA 1LT9C 3G4ZA 4U9EA 3MTUE 4EHPA 4O6YA 2HSQA 2KS1B 1LTIC 1GGQA 2PBEA 1H0TA 4CJOA 2XXAA 1FZGA 1YARO 2A1DD 3C1LA 5AVXB 3JCUH 3S84A 1YZCA 2HPCA 2BC5A 4CDAA 3CX5D 2YXQB 1NJIQ 4JTAB 1U0BB 3II6A 3A0BH 1T2KC 1KORA 1NTMG 2E5YA 3M91A 3ZVRA 2PGDA 2ZD9A 1IFPA 3OJAB 2CK3H 1NOHA 4H44C 3TF5A 3HE5B 2R03A 4KNVA 4OINF 2Q6QA 4ASVA 5KLVG 4JKVA 5JVEA 1KYOE 2NUPA 1YQ4C 2XL4A 5CCHC 1HE1A 3ZDLA 3DAFA 3DJUB 3U9MA 3HTKB 3ZG1A 5L0CA 3Q5PA 3RK3C 1HE9A 3W2VA 1LIHA 4CDVA 3TULA 4K7BA 2EIMC 4YPCA 4IGGA 3I5CA 3W68A 2WPQA 2J59M 2FXMA 3OW2O 2R25A 1NTZD 2VASA 4E7SA 3KDPB 2R7QA 2AWCA 2WZLA 3P8MC 4CDYA 4Z9JA 5E33A 1GU4A 2A6EF 2QJPB 1OVUA 3ITKA 4UB6E 4XWJA 2WQYC 4OGQB 1Z7Qc 3L72D 4D6TD 2C9NY 3HNJA 4AYCA 4GEHA 3A2AA 3HE4B 4CIPA 1DOVA 5KTBA 2P7VA 3RVZA 4BG0A 2XSEA 1PV3A 1VL2A 2XLVA 5AW7B 4IB4A 2Y9YA 3RH3A 3I4UA 2ZAEB 4EI2A 3EH2A 3RQGA 2VRSA 3JCUQ 1Y47A 2ZPAA 2GUVA 3CCJP 4N6CA 1PP9D 4PR9A 4RKUJ 1ZHTA 2VB6A 3C7JA 1SFCD 2FBWC 5K5GB 1IFNA 5DQZA 1MMGA 4CSAA 1J1EB 2FYUK 2SPZA 1FZBA 1ZU5A 3H1JE 3VP9A 4DJGA 2ICWG 1SQBG 4C7OB 1FTSA 1P84H 3S1KA 3AJMA 1JTHA 4RJTA 4H13D 3CCSP 1IJDB 2H89C 1W5CE 3M0AA 4RBNA 2KUBA 3BRVB 2BCCJ 1KC8Q 1D0ZA 2ZT9C 1FFTC 2M3BA 3GF3A 2ZJSE 1NTKG 2OOCA 4ULVA 4KC9A 4DBRA 2XKMA 3A0HE 1TR2A 1YITP 1T3JA 1KB9I 3AEDC 1OVVA 2M0BA 2IBZI 1GW4A 2HV6A 4GT1A 1XTGB 1AVYA 2WZGA 2LR2A 1DOWA 2OARA 1GU5A 3S90A 3L74G 2KZJA 1OXKA 3AQCA 2YIUC 2HKVA 3GODA 1S2EA 4WB4A 2ZVNB 3CCRP 2IDBA 4AX2A 2P1AA 3JTLO 2J9BA 3SSUA 4DJ9A 1L0LE 4C7RA 2P61A 2H43A 3L1MA 4HJGH 1VLSA 3Q1MA 1AFOA 4ZMDA 1L0NG 3LJBA 5CCHD 1L4AC 1OXBA 4EIJA 3D6ZA 4H44D 1L4AD 2JR8A 4GODA 3ASOC 2YL7A 4PFOA 4O7GA 4H0LD 1M7LA 4CS8A 2HYNA 5M1BA 2R3SA 1N73A 4EBJA 3SXYA 3Q7LA 1SQBJ 2JO1A 1RXQA 3G71P 3PCVA 1EXJA 4IL6E 1FJPA 3L70E 4R4MA 3UGOA 1K04A 3MUDA 2OYIA 1ZMEC 1NU1D 1JAFA 1U6HA 3H1KD 2Q9BA 3A5TA 4DVYP 2YLGA 1QGKB 1GW3A 3AEEC 4U5HA 3NXSA 2JD3A 2HJMA 1FE6A 3H1HG 2IXOA 3O6QB 2ZXOA 2A68F 3CEXA 4LACB 1RCPA 3U59A 2J0XA 3TJ5A 1HJ0A 1MKMA 1QEXA 3L72G 4JF7A 1JY3O 4D6TG 1PPJE 4HB1A 2CW0F 3QVZA 5L0JA 3KHUA 1LGHB 5D92A 4OIRF 2H7OA 3ZSUA 1T2KD 2NSGA 1ZYRF 2QA4P 1P84E 1SQVD 2HFED 1KD1Q 1W2WA 3KKBA 1HH0A 3KQGA 4TT3H 1D7MA 2QVAA 4BEMJ 4I1LA 3M79A 4G7ZF 1ZW2A 1EZVD 1L0LD 2A06E 5APQA 1QLED 3B29A 3IQTA 3H65A 4IAOA 1VF5B 1FU1A 1BE3E 3NYLA 1CZQA 2O1JA 4YWQA 1KILC 3OA1A 3L71G 3HRNA 1ZZPA 2A06D 4Z9IA 4GDOA 3PJSK 4R4LA 1ST6A 3JSEO 2IXMA 2ZXWC 2O01N 1PZQA 1JMWA 3N2ZB 1RF0A 1SMYF 4YJWA 3L4FA 3AQBA 1SQPJ 3IQ6A 4X0RA 4AK9A 1SYQA 2QE9A 2D2CD 3W67A 2YIUB 1LI5A 1EDJA 4PD4H 4MW3A 2K9YA 1YDIA 3GEEA 4U3FD 3ZC4A 3CCLP 4MVUA 1IFJA 5EK0A 1VPCA 2M3EA 2NPSC 2WPRA 2HS5A 1KZUB 5KLVD 1U7MA 4LDKA 5F5FA 3H1KE 2IYLD 3O6QA 5KJ7C 1NTMD 2Q1KA 1BGYJ 4G7HF 4I1MA 3RL0D 1RMVA 1LT9A 5DS4A 1W2BO 3GEHA 2VCAA 1NYHA 4LC1A 1PPJD 4XEVA 2E75C 4N78D 2XNXA 5DVWA 5CBNA 2YNYA 2E5TA 3WUVA 1Z5ZA 1F1MA 3TJ6A 1MV8A 3V5YA 2YXRB 3L71J 3B71A 5BU8B 2CNWA 2Q9IA 4N4WA 3UGPA 2W6BA 2VH3A 2W4BA 5COGA 3CQZA 3MFNA 3D6YA 3HD7A 1R5SA 2RMZA 1ZR4A 1IFMA 3L73G 1LWUB 2V7QJ 3V5XA 3FXDA 3GEIA 4Q5SF 2OTKE 2PFXA 1Q0GA 3AECC 3O8ZA 2G3AA 2Z15A 2OYOA 1NTZE 4JJGA 4NTAA 1H88A 4CS9A 1IO4A 2W90A 2ZFCA 2WSFH 4NCQA 4HH2A 1YJ9P 3M06A 5B3IA 3BCCG 3RL0C 2KS1A 2HODA 3DM9B 3HD7C 1CGOA 4KHXA 4L73A 1PL5A 4NQFA 4CS7A 2HPCB 1VQLP 2ZVOB 4KI2A 2MYSA 5KAIE 1G2CB 2FYUE 3ABMC 1YHQP 2Q4FA 3M4CA 3B5NC 4XEKA 1YJWP 5L0HA 3V2QA 1PGJA 1FZCA 4U5CE 1FFHA 2YL0A 4DVZA 3KYIA 3EG9A 5AGFA 1N7SA 3KH2A 2Y0EA 2ZYDA 3A3YB 3NDBB 2YEVA 2QEXP 2Q3IA 4CIHA 5AW0B 1GK4A 1L2PA 1FMWA 2C04A 4YL1A 1NAFA 3HUSC 3H32A 3AG4C 1NG1A 3CCQP 3H1JD 1Q0MA 2QUPA 5EHHA 4XPWA 3BCCE 4C7NA 2XU6A 1BSNA 4ULWA 2WSFJ 4W8KA 1S4XA 5APWA 3E9VA 3T6BA 1J1EC 2M8RA 1DX7A 2OEXA 1N7SC 1VDFA 2P0NA 5GTIH 2ASRA 5BUOA 3L74D 3P8CE 2K9JA 1APCA 3H25A 2OEVA 2AEJA 2PP4A 4CPGA 5EGYA 1OW7A 1MFTA 4IFDK 3GG2A 1FZEA 2L91A 3BASA 4ZKPA 2OTJP 2IBFA 2QRXA 1OIPA 3B8EB 2MWQA 1GD2E 1K73Q 1TFKB 5FCLA 2RN0A 1LT1A 2IX7C 3VMXA 1M1JA 1I5NA 5L3QA 3ITFA 1R4TA 2A0UA 3TSIA 3MIWA 2R7XA 3BCCD 1NFOA 1QVXA 4HFFB 1S5LH 1ZV8A 1MNEA 3Q6NA 3WHNA 5A6JA 3TK0A 1ZRTD 4A7PA 4DXWA 1TKNA 1S9KD 2WT7B 4Q4ZF 1L7CA 3O55A 2V4HA 3QW1A 3DJNB 4ANJA 4YXDC 4NPEA 4MTOA 3SXMA 3U3FA 3N7NA 5KYYB 1VOMA 3KYQA 1GL2A 1AEPA 2J0WA 2LFDA 2N9YB 4MVOA 3MP7B 2WVRA 1CI6A 1AUEA 1U57A 4K3AA 3EGDA 3RK3E 5COFA 3SWFA 4Q7CA 3FXEA 3V6IA 1N73C 1YAUO 4XA4A 5KKZB 4ONSA 3U1CA 3LIEA 4XEFA 2GDCA 1H8AA 1DH3A 1OR3A 4E7ZA 4XPYA 1E83A 4GOEA 1I4YA 2D5RB 3PH0A 2YRFA 2XLWA 3Q5RA 1IK9A 1NTKJ 2Z5HA 2TMVP 5TJHA 1Z6AA 4JCHA 3N4XA 4L75A 1SFCC 2PNOA 4XQ1A 3LLKA 1SQQE 2FFDA 4HYTB 2Y3DA 2KZIA 2OJQA 3M9BA 4IARA 3B0UX 3U9JA 4U3FJ 1M1JC 2YWAA 3GHGA 3C62A 3Q2YA 1BDJB 3M0DA 2IYPA 4J30B 2L5GB 1G1JA 3LS0A 3IAOA 1EQ1A 1BR4A 1SQPD 2R7OA 2KSJA 3NMKA 1E86A 2FYNC 2LD6A 3NMJA 1OW8A 4OIOF 4TLFA
chains in the Genus database with same CATH topology
5KLIC 3MFNA 1OMIA 3H25A 1Y9BA 3D6YA 5F28E 1DD3A 2PBEA 1KQFB 2BEZF 1OW7A 3BRJA 1HF9A 2V7QJ 3AEAC 3RL0g 1KQGB 1IK7A 2ZT9B 1Q90D 4Z1MH 2QIWA 1KTMA 3JYYA 3IN6A 1O3UA 4TT3H 2HSBA 1OW6A 1S1CX 4YTPC 3AECC 2G3AA 2JPUA 2Q00A 3AJMA 2E76D 4H13D 4H13C 2H89C 3AE6C 1VF5B 2G8YA 3GF7A 1KORA 4EBKA 1ZOYC 3EWKA 4OGQD 2ZT9C 1WOLA 3C8VA 2E76B 2WSEJ 3GF3A 1KNYA 2JX0A 1VF5D 1QVXA 1ZZPA 3LW5J 4H44B 4GDOA 2QJPC 4H44C 1WMKA 3AEFC 1PL5A 2BEQD 4NQFA 3S9OA 4R4LA 4H0LC 2NZ2A 3JZ0A 1WTYA 1YQ4C 3AEDC 1GMJA 3AEBC 1JB0J 2WPVB 1AJYA 4PV1C 5KKZC 3RQEA 1KMIZ 5L8RJ 3GLMA 3Q5PA 2YMKA 3SFDC 2E75D 1K40A 3TULA 2D2CB 2YIUC 1K05A 4YXDC 2D2CD 3U0CA 2D2CC 1JOGA 4XEKA 2IDBA 3U3FA 2QSIA 2L6GA 3L8JA 1FDOA 2K9YA 3AE5C 4U7JA 4H13B 3SFEC 3AE2C 2QJYC 3FGAD 4KT0J 3C8GA 3Q1MA 1UFBA 1U57A 3RK3E 1NGMB 1V4AA 2FXPA 2L6FA 2JP3A 3G9RA 2J5UA 3O10A 3AE1C 3RQFA 2OQQA 4PV1B 3D6ZA 3AE4C 4H44D 4XEFA 3C18A 1RQVA 2E74C 4H0LD 4H0LB 3AEGC 3O6QA 5M1BA 1PIXA 2E76C 1EXIA 2WQYC 3C8GB 4OGQB 2LK4A 1RQUA 1ZP0C 4Y28J 4PV1D 4OGQC 3Q5RA 3C8GD 3AE7C 4EBJA 1WWPA 2JO1A 4I7ZB 4IL6X 2E74B 3D71A 3Q5SA 1KILE 1EXJA 1YQ3C 2H88C 2ZT9D 1FDIA 4R32A 1DD4A 4R4MA 1K04A 1TU3F 1VF5C 1ZMEC 2P10A 1DIPA 2L6HA 3GM3A 4XFJA 3GM2A 1PV3A 1VL2A 2KK1A 2WSFJ 3AE9C 2YWAA 2O01J 3L8IA 3RQGA 3Q2YA 1NYHA 3AEEC 2MKVA 3Q3DA 2WSCJ 1UIXA 2E75B 3R4YA 3GM1A 3K7DA 3GMAA 4XEVA 4I7ZC 2E75C 2QJKC 3ABVC 3IAOA 3AE3C 1R8EA 1ZRTE 1HJ0A 1MKMA 3T97B 4RKUJ 2FYNC 3B71A 1S5LX 2E74D 3AE8C 1OW8A 3D70A 2FBWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MFN A;  5F28 E;  2PBE A;  1OW7 A;  3BRJ A;  1KTM A;  3JYY A;  1O3U A;  2HSB A;  1OW6 A;  4YTP C;  3AEC C;  2G3A A;  2JPU A;  2Q00 A;  3AJM A;  2H89 C;  3AE6 C;  4EBK A;  1ZOY C;  1WOL A;  1KNY A;  2JX0 A;  1QVX A;  1ZZP A;  3AEF C;  4NQF A;  3S9O A;  3JZ0 A;  1WTY A;  1YQ4 C;  3AED C;  3AEB C;  3RQE A;  3SFD C;  1K40 A;  1OW8 A;  3TUL A;  1K05 A;  4YXD C;  3U0C A;  1JOG A;  4XEK A;  3U3F A;  2L6G A;  3L8J A;  3AE5 C;  3SFE C;  3AE2 C;  3C8G A;  1UFB A;  1V4A A;  2L6F A;  3O10 A;  3AE1 C;  3RQF A;  3AE4 C;  4XEF A;  3C18 A;  3AEG C;  2WQY C;  3C8G B;  2LK4 A;  1ZP0 C;  3C8G D;  3AE7 C;  4EBJ A;  1WWP A;  4R32 A;  1YQ3 C;  2H88 C;  1K04 A;  2L6H A;  3GM3 A;  3GM2 A;  1PV3 A;  2KK1 A;  3AE9 C;  2YWA A;  3L8I A;  3RQG A;  3AEE C;  3GM1 A;  3K7D A;  4XEV A;  3ABV C;  3AE3 C;  3B71 A;  3AE8 C;  3AEA C;  2FBW C; 
#chains in the Genus database with same CATH topology
 4XPX A;  2ZXR A;  3TGU G;  1EDI A;  3BAT A;  1SFC A;  1JOC A;  3JRM O;  2J46 A;  1LT9 B;  1O3U A;  2KK7 A;  2HSB A;  3K1H A;  1OW6 A;  2Q5U A;  1J8M F;  2HZ8 A;  1SVF A;  3UMK A;  2Q9C A;  1L4A B;  5AVR B;  4N78 E;  1ZHZ A;  1ZR2 A;  3WU2 H;  2I1J A;  2YKZ A;  3C9I A;  1LPE A;  2KGO A;  3IPM O;  3MBG A;  1JUN A;  2N9B A;  3EFO B;  4MQ9 F;  3C8V A;  3P7K A;  2CPB A;  3HD7 B;  3TGU D;  3JSV C;  3H1H J;  3CX5 I;  2KSE A;  3S4R A;  1K8A Q;  3B0P A;  3G50 A;  3AEB C;  5JT4 A;  5COM A;  4WJ0 A;  2DI3 A;  4Z9H A;  2IYO A;  5H2F E;  3U0C A;  1N2D C;  5CBO A;  4U3F E;  3QVY A;  2DB4 A;  2WMM A;  3I56 P;  1WN0 A;  5E3A A;  1VQP P;  1VYK A;  1KIL A;  2A45 I;  1LNQ A;  3AE2 C;  4PJM A;  2WSC H;  4H4K C;  3AE1 C;  1NU1 K;  4E0H A;  4O6M A;  1T8Z A;  4E0I A;  1G1I A;  4H0L B;  1HMO A;  3RYL A;  1CI6 B;  4Y28 J;  3QMK A;  1BR2 A;  2Y3B A;  3W8H A;  1SQP K;  4LER A;  4U5G A;  5TJ5 E;  3MUD C;  5BVZ A;  4PJ0 E;  1E2X A;  1GS9 A;  1LS4 A;  1MMN A;  3BVH A;  5A69 A;  1C02 A;  4EIY A;  3R2P A;  4P9F A;  4DRH B;  2WIT A;  1D1B A;  5HV9 A;  1N1C A;  4BWN A;  1OKK D;  3EFF K;  4BJ5 C;  256B A;  2M5A A;  1BR1 A;  5DQT A;  2FY8 A;  4EOT A;  3EG9 B;  1YZA A;  3R4Y A;  3NFQ A;  3T6G B;  5KYW A;  4PD4 E;  3AG1 C;  2FKW B;  2Q9A A;  3LUT B;  3U2M A;  1OXZ A;  1J8Y F;  3T97 B;  2JWA A;  2V26 A;  3VMA A;  4EYY Q;  3VMZ A;  3ZTZ A;  2R7R A;  3B5N A;  1SQX K;  2BEZ F;  2JEE A;  3ZIB A;  2R7U A;  1T3U A;  3VMY A;  1SQQ G;  1U89 A;  4WWI A;  2H8P D;  4MS2 A;  1A0B A;  1SQX G;  3G6E P;  3FX0 A;  2PX3 A;  4LGD E;  2FAP B;  2XLE A;  3NKD A;  3EJN A;  2Q00 A;  3H1I D;  4IOI H;  1H7I A;  3M0D C;  3G4S P;  1LTA C;  3FOP A;  5B1B C;  1OCR C;  3ABK C;  4H13 C;  5D91 A;  2K88 A;  3G4X A;  1D0Y A;  3B5N D;  4YL3 A;  4L76 A;  1ZVZ A;  4QI0 A;  3FWL A;  2R02 A;  3L70 D;  1M56 C;  2WB7 A;  1NTK D;  1GL2 B;  4N3Y B;  3E1I A;  4C3B A;  2A69 F;  3NTN A;  3S29 A;  1SQP E;  2WPS A;  2IOQ A;  5T1D B;  1FAV A;  1BDD A;  4A2N B;  3RK3 B;  2CYD A;  5BQI A;  5KKZ C;  3RQE A;  1QZX A;  1I4Z A;  1OR2 A;  2LP4 A;  3LEO A;  5AVY B;  2FYZ A;  5E2Q A;  2GA1 A;  1FDM A;  2I15 A;  3L34 A;  3KXD A;  1Z3I X;  1LP1 B;  1TWH A;  3AOU A;  1BBH A;  2PF4 E;  1JOG A;  1FAP B;  4EWC A;  3P8C D;  1XZQ A;  4PJN A;  1FDO A;  5AW3 B;  1ZHX A;  1CPR A;  5CJ0 A;  1KQL A;  3SFE C;  3H1J G;  2OYH C;  2A06 G;  3FDQ A;  2EPN A;  2RSE B;  1WAT A;  1RKE B;  3C8G A;  4I3M A;  1UFB A;  4I6M C;  3VAY A;  1LVK A;  3Q7G A;  3TOL A;  2HLO A;  1PGQ A;  5APV A;  1JPN A;  3L72 E;  4D6T E;  1V54 C;  3ZTM A;  2WSE H;  3X1O A;  1SQX E;  2CDQ A;  1HGV A;  2AXT E;  1A7V A;  3RK3 D;  4BJ6 A;  4HEA J;  5DS6 A;  1L0L G;  1O5H A;  3B0V C;  3PHL A;  3KPE A;  1WWP A;  1X22 A;  2GA0 A;  2H88 C;  3SYN A;  1S7Z A;  2L6H A;  1S9K E;  5KJ7 A;  2H7V C;  5CIV A;  2C0X A;  3L71 E;  2K3R A;  2JJL A;  5CMZ A;  3KYJ A;  1HW1 A;  3RK2 B;  2D4U A;  4CS8 C;  4K35 A;  3RF3 A;  4YXW H;  2XL8 A;  3ZQV A;  3TNU A;  2FXO A;  4W8P A;  2E74 D;  3CWB G;  3H32 B;  3HE4 A;  1C17 M;  3KMI A;  3NRH A;  3GWN A;  3L74 J;  1J1D B;  2H7H A;  2XND H;  2GM4 A;  1HF9 A;  1IK7 A;  1ZXG A;  2J7P A;  1HBW A;  3GHG B;  4XLP F;  1LM3 B;  1LTJ B;  3WU2 E;  3HNL A;  4U5B E;  3V5B A;  2HV7 A;  5APU A;  1J2J B;  3HTK C;  2OYI B;  3KPH A;  3WAQ A;  1HWT C;  2AXT H;  4WAB A;  3JC2 2;  3IHU A;  2O01 H;  3H1J J;  2M5A B;  1RF1 B;  5DJT B;  1ZU4 A;  5JUA A;  2WSE J;  1OWA A;  1IFD A;  2JX0 A;  4B6I A;  1FC2 C;  2QJP C;  3T97 A;  3WUT A;  3AEF C;  3S9O A;  4WY4 C;  3CXH I;  2ETS A;  2K1A A;  3IR9 A;  1T5O A;  4M3L A;  1Z63 A;  3L75 D;  1HVV A;  1NTZ K;  2YKQ A;  4AE4 A;  4QMA A;  2P67 A;  5APX A;  2PX0 A;  1PPJ G;  2AEF A;  2FGY A;  1Q0D A;  4LLE A;  1KU2 A;  1L4A A;  2W4M A;  4XTK A;  1X8Y A;  3FVY A;  2XS1 A;  2QE7 H;  1ORS C;  3A9C A;  4FX5 A;  3L75 E;  4PAC A;  3V2P A;  1LE4 A;  2R5B A;  1L0N E;  3E70 C;  1PGO A;  5E79 E;  2J45 A;  4LDR A;  2R7W A;  3LS1 A;  3DZA A;  2L7A A;  3GAN A;  4MVQ A;  3NKE A;  2AWY A;  2R05 A;  5JLI A;  2E74 C;  1CPQ A;  3U8P A;  3AEG C;  1YYX A;  1GDT A;  3UR3 C;  2PRR A;  3L74 E;  2WVN A;  2KI7 B;  1JO5 A;  4LLC A;  1Q86 Q;  3Q5S A;  4N6J A;  4GIF A;  4C3D A;  1YQ3 C;  1D1A A;  2Q3E A;  2KP8 A;  3DXJ F;  2OTL P;  2P10 A;  1JMB A;  1VQM P;  3CC2 P;  4DRI B;  3K5B A;  3H1I J;  2YQY A;  1SQB E;  2O01 J;  2MJZ A;  2XLO A;  3O39 A;  2KLU A;  5AW6 B;  3HLZ A;  2AEM A;  3H1I G;  3K7D A;  2B9B A;  1M57 C;  1URQ D;  2N1T D;  3AE3 C;  1SQP G;  3H1I E;  5A6K A;  2P1J A;  3EZH A;  1RE3 A;  1RH5 B;  2J9W A;  5B66 E;  1HW2 A;  3T4R A;  3CD6 P;  1JY3 P;  2KYV A;  3L71 D;  1RE4 C;  1DD3 A;  1BDC A;  3B9Q A;  4E17 A;  1FMV A;  2KLV A;  5GTH H;  4Z1M H;  3EQL F;  2Q3T A;  3L70 J;  2LFF A;  3RK2 C;  2H8A A;  2HMZ A;  4WGZ A;  2KW3 C;  3W4Y A;  4GYT A;  2XZR A;  3FAP B;  4JIO A;  2W9Y A;  2B87 A;  2W6J H;  1PP9 G;  3S28 A;  1A7D A;  1LE2 A;  3O6X A;  3EQ2 A;  4OGQ D;  3P32 A;  1V55 C;  3PTZ A;  3RFY A;  1NU7 D;  4U5E E;  3U8V A;  1NTZ G;  2JKV A;  4CBE A;  5KLI B;  2XM4 A;  1SQV G;  1WTY A;  1QVG O;  4C7O A;  1G5Z A;  4PK4 A;  5L8R J;  3EGX B;  1JCD A;  1T6Q A;  2NRG A;  4NTF A;  1K05 A;  1SP4 A;  1A02 F;  1OCC C;  4Y99 C;  3DKA A;  1R5L A;  2CCY A;  1MZ9 A;  3GOR A;  1N86 A;  1SQQ K;  1FS0 E;  4FWV A;  2YKO A;  1FJK A;  4CX9 A;  3H1K G;  1OVR A;  4RO0 A;  4U9D A;  4NY3 A;  3B5N B;  3L36 A;  2L9J A;  2WWW A;  1VQK P;  4B86 A;  1A02 J;  2E76 C;  3MD0 A;  3WUU A;  1AQ5 A;  1YIJ P;  1YA7 O;  3TGU J;  1JM0 A;  2GUS A;  1MUU A;  3H1L G;  3PRJ A;  3SEO A;  3SXZ A;  4JCZ A;  1MMA A;  4U3F G;  1D0X A;  3H1L E;  1LTG C;  4JTC B;  1RY3 A;  2EIK C;  3HUS B;  3AE9 C;  1KB9 E;  4C46 A;  2R7V A;  4BJ6 C;  2HR3 A;  1DEE G;  2GFH A;  1KFN A;  2QJK C;  1FOS F;  3MLG A;  1T6A A;  3F89 A;  1USD A;  1N73 B;  2QM8 A;  4JRZ A;  1S5L X;  3AE8 C;  3AEA C;  5T3W A;  2HUJ A;  4QDL A;  1URQ B;  2N1T B;  3FMS A;  4J7T A;  1BCC E;  3AGT A;  3BRJ A;  1NZE A;  5GTI E;  2AXC A;  1KTM A;  3C8Z A;  4CS9 C;  2A0B A;  1CGN A;  2X51 A;  2DYR C;  2KC3 A;  3W8I A;  3UMH A;  2YVK A;  3L75 G;  1YTZ I;  2BAS A;  3HTK A;  3UMI A;  2EPK X;  5F5H A;  2Y39 A;  2Y9Z A;  4K0D A;  1LTS C;  4YT2 A;  1CGM E;  2G8Y A;  5DJU B;  3LAY A;  1SR2 A;  5JSL A;  2OYI C;  2LXB A;  2I8B A;  2E76 B;  4IFM A;  5AW8 B;  1SQV J;  1S72 P;  2LIG A;  3JRT A;  2R44 A;  1MND A;  1VF5 D;  2CNW D;  4EKW A;  4MVZ A;  1LP1 A;  4UB8 E;  4JPZ B;  5KYU B;  2QM7 A;  1GTW A;  3M15 A;  4H0L C;  4MVR A;  3CC7 P;  4LLH A;  4PV1 C;  5AW4 B;  1SS1 A;  2NPS D;  2M64 A;  1EZV G;  2EIJ C;  2XXA B;  2LKM A;  3SFD C;  1N7S D;  1T6U A;  3QWO C;  1Y4C A;  5KYN A;  2CPS A;  2QSI A;  1KV4 A;  2L6G A;  3AE5 C;  3I5Q A;  3H1K J;  4GKG A;  1PP9 E;  2YL3 A;  2I1K A;  3ECS A;  3N0T A;  1NO4 A;  2KYH A;  1Q81 Q;  1P84 D;  1Y8A A;  3OEO A;  2P2U A;  3IFM A;  2QNL A;  5AC5 A;  1VLT A;  3G9R A;  1ZHY A;  3AE4 C;  3ATP A;  1ZHW A;  1NBB A;  3H1H D;  1PIX A;  1C03 A;  1EXI A;  3HKK A;  4IWB A;  3BCC J;  1RQU A;  5CCG C;  4JBZ A;  3C8G D;  4OGQ C;  4G0H A;  1MFZ A;  1Z56 A;  1KIL D;  4IL6 X;  2E74 B;  1PD1 A;  3PMR A;  2ZT9 D;  3LID A;  2WZ7 A;  5FZT A;  1NU1 G;  3VM6 A;  2A6H F;  1YJG A;  2PAJ A;  3GM3 A;  1NTZ J;  1NHL A;  1NU1 E;  3CCV P;  2VC9 A;  4W7Z A;  3ZQY A;  2KNC B;  1T6I A;  4PJJ A;  2WSC J;  1BSH A;  4EBB A;  3PLN A;  2BL2 A;  4HFK B;  3RGU A;  2XL6 A;  1R5I D;  3SNH A;  4OWF A;  3M9H A;  2G3V A;  4BJ5 A;  1OZH A;  2G62 A;  1JY3 N;  3R7C A;  4HE8 D;  1TQG A;  5B5E H;  1YJN P;  1S3J A;  1LTJ C;  3C63 A;  3HD7 D;  2OG2 A;  3RL0 g;  2QG4 A;  2QIW A;  3IN6 A;  1ORY A;  1H6G A;  2DGJ A;  3DD7 A;  3TQO A;  2ZYA A;  3QH9 A;  3RK2 D;  1ZW0 A;  4MW8 A;  5H2F H;  3CL3 D;  2C03 A;  4U5F E;  1BGY G;  3JT1 A;  1SFC B;  4G78 A;  2HMQ A;  1ZOY C;  3G3Z A;  3BEH A;  1HTL C;  4AE4 B;  3GW6 A;  4AL0 A;  5KLV K;  5AW5 B;  2H7B A;  5L0I A;  5APY A;  1WRG A;  2AP3 A;  1QPU A;  1EA8 A;  2NZ2 A;  1JEK A;  1L3P A;  1JB0 J;  3LLI A;  1PGP A;  4K1O A;  1NTM K;  5GPG B;  2ZYG A;  2YO2 A;  4OVN F;  4O6N A;  1RJ9 B;  1IC2 A;  1OKK A;  1EZV I;  2YMK A;  1BGY E;  2LXC B;  2E75 D;  3UIA A;  3V2N A;  3J06 A;  1OX3 A;  2J9U A;  2M4E A;  3L35 A;  3WMM 0;  3L8J A;  4NPD A;  3AGU A;  4U7J A;  3V5Z A;  4IJJ A;  3W2W A;  1OQC A;  2XLM A;  3HUS A;  1YYC A;  4M63 A;  2O9X A;  4N06 A;  1V4A A;  4OIQ F;  4WY4 B;  2JP3 A;  3LNR A;  3L75 J;  4DBQ A;  3RQF A;  4GQH A;  4JEA A;  3CWB J;  1H9G A;  1EQ7 A;  5CJ4 A;  1LJ2 A;  1BCC D;  1ZN5 A;  3LW5 H;  5AVZ B;  5CCH A;  3GHG C;  3QZC A;  5KAF E;  2MHR A;  3KL4 A;  1LTB C;  2R9R B;  2OKU A;  1KIL E;  2ZXX A;  4ER9 A;  3FOO A;  4NPF X;  5KYY A;  1ZLL A;  2O3J A;  5A6A A;  4XFJ A;  3F5H A;  3CSK A;  3NYM A;  2XDJ A;  2BCC G;  2OYH B;  2OU6 A;  2HG5 D;  5CHX A;  4W80 A;  2DYS C;  4JUR I;  1UIX A;  1LWU C;  4MND A;  4JEB A;  2BCC E;  5AW9 B;  1JY2 O;  5KYX A;  4ZKU A;  1RF1 C;  2POH A;  3U5S A;  2EPL X;  4UB8 H;  3DAG A;  1USE A;  1RE4 A;  1LS1 A;  1OMI A;  3H2V A;  1SQV K;  1NTK E;  1KQF B;  1IW7 F;  4XE5 B;  3EGX A;  1NH4 A;  1FZF A;  4BRY B;  3TOM A;  1JPJ A;  1Y6D A;  2YLD A;  1PD0 A;  1QQ3 A;  3TYY A;  1S1C X;  2R7S A;  3MYF A;  4L6R A;  4PJ0 H;  1G4U S;  4I44 A;  1HUC A;  3SWY A;  1BGY D;  2IBZ D;  3EGD B;  1M2O A;  2BE5 F;  3K66 A;  4N6H A;  4EBK A;  2B88 A;  3L70 G;  2K9J B;  2IPP A;  2EIN C;  2AVK A;  1CSB A;  1KIL B;  4ZNC A;  1KNY A;  3A0B E;  2E42 A;  2Y3H A;  3LW5 J;  3CCE P;  2HJ3 A;  1WMK A;  5AW1 B;  3JZ0 A;  3CPW O;  3EZI A;  1SQX D;  2R5D A;  1HMD A;  1GQA A;  4DCK A;  2B87 B;  4WBA A;  2QJK B;  2HFI A;  4MTG A;  2A45 H;  1QL2 A;  1GZL A;  2IFM A;  1T01 A;  4JVS A;  1KB9 H;  4EUK B;  5KAI H;  1B68 A;  5KLV E;  2C9L Y;  3CC4 P;  1LTT C;  3K1I A;  3CWB E;  5JRA A;  1VYI A;  4G7O F;  3K1I C;  2PP6 A;  2QJY C;  3FGA D;  1NGM B;  3EPV A;  2NUP B;  1JNM A;  2KNC A;  1HY5 A;  1SQV E;  3F47 A;  1JY2 P;  4I2L C;  2WSS H;  2XS8 A;  2RH0 A;  1JMM A;  1RQV A;  4CJG A;  1G8X A;  1OCZ C;  4OH8 B;  3US6 A;  2PFD A;  1RKE A;  3C8G B;  2KSF A;  2J58 A;  3SWK A;  1QL1 A;  1M6T A;  3CCM P;  1ORJ A;  1QX8 A;  2WVO A;  1PCX A;  3GM2 A;  2NSF A;  3EHM A;  2QJY B;  2ITA A;  1LKX A;  2YZS A;  1IZM A;  1SF8 A;  3CLQ A;  3FWN A;  2C0W A;  1X9V A;  2NPU A;  1VQ9 P;  1NU9 C;  1T9K A;  4O9B A;  1H89 A;  2ZXP A;  5BQG A;  5KYU A;  3H1H E;  3Q6M A;  1KYO H;  1SQX J;  3U3B A;  4EDF A;  5KLI C;  1QKR A;  1TWC A;  3KZI H;  1Y9B A;  4MTF A;  1SQB K;  3V2R A;  3CME P;  3TNU B;  2ZT9 B;  1EDK A;  3K33 A;  3L0I A;  1EC5 A;  2IXP A;  3H1L J;  4PD4 D;  5L0G A;  3JCU E;  1QVF O;  2J7P D;  1W2E A;  3DMD A;  5E3C A;  1L0L J;  1LWU A;  5HSW A;  4JYC A;  3I55 P;  2EPM X;  1VQ4 P;  2OYH A;  4OD4 A;  1AQT A;  4AUW A;  1LTJ A;  1YYJ A;  3ASN C;  1NTM J;  1RE3 C;  1FZC C;  3TD7 A;  2DW3 A;  1VMA A;  1TWA A;  4AL1 A;  1BE3 G;  4E18 A;  1FR0 A;  1CW5 A;  4YT8 A;  3EFG A;  3PP5 A;  4OD5 A;  2JDI H;  5AVW B;  5K0I A;  3LEV A;  4ZLD A;  1H9T A;  1ZW3 A;  1BZ4 A;  1AV1 A;  1JRA A;  2WPV B;  1HJB A;  1Q0F A;  1TFO B;  1KMI Z;  1OCO C;  4U5D E;  1NLX A;  2WVQ A;  2W8Z A;  1NAY A;  3PHF 2;  4IAQ A;  2E87 A;  3DE9 A;  4RD9 A;  1NKZ B;  2NG1 A;  2Q7R A;  4H54 A;  4DT0 A;  2Q7C A;  3CXH D;  1VTM P;  3RL0 B;  1RHZ B;  3USS A;  4KT0 J;  5A6B D;  1SQQ D;  3V4Q A;  1VQ6 P;  1V74 B;  1YA9 A;  3MX3 A;  3VN0 A;  2FXP A;  2L6F A;  3IQC A;  2QLA A;  1M1K Q;  1RF1 A;  2UUI A;  4YN0 B;  1S5L E;  4PD4 I;  1SQB D;  3OA7 A;  2L81 A;  3MYI A;  4I1O B;  3EHN A;  1XZP A;  1N7L A;  3L73 J;  1RJ9 A;  1BCC J;  2P6V A;  1ZP0 C;  1EZV E;  4PV1 D;  5E79 H;  3TDK A;  4R32 A;  1PFI A;  2OQM A;  1EI7 A;  1HGZ A;  2YHS A;  4O79 A;  4RES B;  2Z5I A;  3HNK A;  3MHV A;  1TU3 F;  4LDQ A;  1MMD A;  1DIP A;  1DEB A;  3VYW A;  4IL6 H;  1VQ5 P;  1E84 A;  3CI9 A;  4BJT A;  2XLH A;  3M9Q A;  2WL8 A;  4J7Y A;  2E75 B;  3E1R A;  1MQV A;  3FXH A;  4Y99 B;  2KB7 P;  4IFF A;  1U7J A;  1R8E A;  3KZI E;  1VQN P;  1ZRT E;  2P7J A;  3L37 A;  2XV5 A;  1S05 A;  1GK6 A;  4D4X A;  1WT6 A;  2YO3 A;  2R7T A;  1M56 D;  4BPM A;  3D70 A;  1VQ8 P;  3I5P A;  3JYH A;  2B0H A;  2LSE A;  2UUH A;  1SZI A;  1Q7Y Q;  3VF0 A;  1RKC A;  1OFC X;  1KQG B;  5B66 H;  3JYY A;  3S0X A;  2BCC D;  1KFM A;  4JYB A;  2B0J A;  3QW0 A;  4YTP C;  2FYU J;  1L0N K;  5KYW B;  1RF0 C;  1G2C A;  2I8D A;  1NU1 J;  3RIP A;  4MVM A;  3RBX A;  4XLN F;  5TIS H;  2LCH A;  3GF7 A;  3CXH H;  3CMA P;  2IZ0 A;  3IF4 A;  1WAS A;  2RKL A;  3K6B A;  4L74 A;  2IXN A;  5AW2 B;  2KNH A;  1YBK A;  1Z23 A;  1GL2 C;  1FZC B;  3L72 J;  4D6T J;  2YLI A;  5T3T A;  1FOS E;  1M1J B;  2F22 A;  1L0N D;  2BEQ D;  4BRY A;  1M90 Q;  4YT5 A;  5JP7 A;  4A4A A;  1Q0K A;  3ABL C;  4DZO A;  2QY9 A;  3M4B A;  5CCG D;  4ZLC A;  2Y0D A;  4BXL A;  1PP9 J;  2NPS B;  4UDV A;  1FNT c;  1QLE C;  1K40 A;  4MN4 C;  2FFD C;  3NYJ A;  5A6B A;  1FZA A;  3OAK A;  2HOD B;  3M1C B;  3LNM B;  2IFN A;  2J8W A;  1VB5 A;  1L0N J;  3VYI A;  3VP8 A;  3EH1 A;  5KAF H;  2J9V A;  4WGY A;  3RVY A;  3AE7 C;  5AVS B;  3FAJ A;  3MZW B;  3D71 A;  1KYO D;  1L0L K;  1FDI A;  1DD4 A;  2Y3G A;  3DE8 A;  2KXP B;  1KN7 A;  1VF5 C;  2K37 A;  3H6P A;  4FAP B;  1QSP A;  1UG7 A;  2FYU D;  2JWD A;  4OIP F;  3MGN A;  3H2U A;  2QTV A;  1N7S B;  3GMA A;  2EPO A;  2XRH A;  4NTB A;  1JTH B;  4HKZ H;  3A7O A;  1YTZ T;  1E79 H;  2P58 A;  3SP1 A;  1KQS O;  3DM5 A;  3CXH E;  2FYN B;  3HJC A;  2B89 A;  2NUT A;  3T6J A;  3U2L A;  4YL0 A;  5AVU B;  2IZ1 A;  1AVO B;  4YK5 A;  1XTC C;  4P9T A;  2E43 A;  4D4N A;  4DOJ A;  2YKP A;  4CSA C;  5GTH E;  4JE9 A;  2IM8 A;  3AG2 C;  3S27 A;  5AVV B;  3IEE A;  2JPU A;  1URQ A;  2N1T A;  5KYX B;  1EKY A;  3PDM P;  3POV A;  1BCC G;  2E76 D;  1M57 D;  3HNI A;  2W83 C;  4RDA A;  3EWK A;  2LQG A;  1WOL A;  5BQH A;  1SLQ A;  1P84 I;  2WZF A;  3B4S A;  2OGU A;  5IY5 C;  1JY2 N;  1Q82 Q;  2A45 G;  1A7E A;  1E5W A;  1NWQ A;  3L73 D;  3A0H H;  1X79 B;  1GMJ A;  1AJY A;  5B5E E;  2X0C A;  5B3S C;  1SQQ J;  3BRT B;  3E7K A;  4C7N B;  4JJF A;  3DWW A;  1Q2N A;  2D2C B;  5APS A;  3T9O A;  2W6A A;  2UWJ E;  2FFD B;  3ZWI A;  4BJ1 A;  2XM0 A;  4W7Y A;  5CI8 A;  1NTM E;  2AU5 A;  1NVO A;  1D1C A;  2FYU G;  2VCC A;  3NMD A;  3O10 A;  2R3C A;  2EIL C;  3C18 A;  4DOZ A;  4FES A;  1G4W R;  5EFW B;  1YI2 P;  1M2V B;  3CX5 E;  2LK4 A;  4KBL A;  1GL2 D;  4J32 B;  1UII A;  4IRU A;  3V7O A;  1J1D C;  3CCU P;  3VTP C;  5B1A C;  2YMY A;  4MVS A;  3V4W A;  5DS5 A;  2V7Q H;  5C39 A;  4NC3 A;  3DI5 A;  1NTK K;  1TWG A;  2Y69 C;  3L8I A;  4JW1 A;  1KYO I;  2MKV A;  3Q3D A;  3WG7 C;  5CCG A;  1YVI A;  4DRJ B;  2VCB A;  3ABV C;  3SXK A;  3OWT A;  1H0T B;  1URQ C;  2N1T C;  3JSZ A;  5L0F A;  1M8O B;  3HE5 A;  1O87 A;  1XWJ A;  2OCC C;  3WOD F;  5F28 E;  1BE3 D;  3UNG C;  2Y0C A;  3LES A;  5TIS E;  1JCC A;  2WT7 A;  5L0D A;  3GWL A;  1Q90 D;  2KOG A;  5AVT B;  3VRC A;  1YLM A;  3RW0 A;  5AC4 A;  3U1A A;  5DLJ A;  1VQO P;  3FHD A;  1N8R Q;  4C3E A;  1WGW A;  5JS5 A;  3AE6 C;  2IBZ G;  3F46 A;  1VK5 A;  4KJM A;  1EDL A;  3A11 A;  3H1L D;  1KB9 D;  3AG3 C;  4JZA A;  5KJ7 D;  5L3V A;  2IBZ E;  4WVZ A;  3ZDM A;  2ZXE B;  2V3C C;  2R32 A;  4H44 B;  1FBM A;  4ASW A;  4JC7 A;  2YL1 A;  1BE3 J;  2NUT B;  4BEJ A;  1NSG B;  2OJE D;  4QI2 A;  4JQ0 D;  1LI7 A;  1AVO A;  5KLV J;  4PFP A;  4PJL A;  4F4B A;  2W45 A;  3GLM A;  3X2Q C;  3CX5 H;  1JR8 A;  2G3K A;  2D2C C;  4AQR D;  3RKO F;  5CI9 A;  3EFO A;  3QTH A;  5BU5 A;  4H13 B;  3VOP A;  4WY4 D;  2WTY A;  1K9M Q;  4YT4 A;  3RBZ A;  3CAX A;  3TGU E;  3N24 A;  3TK1 A;  2J5U A;  2GWW A;  2OQQ A;  4PV1 B;  2KJG A;  2RD9 A;  3SZR A;  4KNW A;  5APT A;  1IZN B;  1VQ7 P;  2NPS A;  3CZ6 A;  1A41 A;  4P6I C;  3CWB D;  2KQ9 A;  1GM5 A;  5AVQ B;  4I7Z B;  4UB6 H;  4WY4 A;  3IQ5 A;  4JTD B;  2O1K A;  2Z4E A;  3L73 E;  1X0T A;  2CGE A;  2GAQ A;  1NFN A;  3NMI A;  2KIK A;  1M2V A;  2KK1 A;  3NG1 A;  1IFI A;  2XLD A;  3GM1 A;  1AA0 A;  1E85 A;  4GOF A;  2W27 A;  1NKN A;  4I7Z C;  2FFH A;  1LT9 C;  3G4Z A;  4U9E A;  3MTU E;  4EHP A;  4O6Y A;  2HSQ A;  2KS1 B;  1LTI C;  1GGQ A;  2PBE A;  1H0T A;  4CJO A;  2XXA A;  1FZG A;  1YAR O;  2A1D D;  3C1L A;  5AVX B;  3JCU H;  3S84 A;  1YZC A;  2HPC A;  2BC5 A;  4CDA A;  3CX5 D;  2YXQ B;  1NJI Q;  4JTA B;  1U0B B;  3II6 A;  3A0B H;  1T2K C;  1KOR A;  1NTM G;  2E5Y A;  3M91 A;  3ZVR A;  2PGD A;  2ZD9 A;  1IFP A;  3OJA B;  2CK3 H;  1NOH A;  4H44 C;  3TF5 A;  3HE5 B;  2R03 A;  4KNV A;  4OIN F;  2Q6Q A;  4ASV A;  5KLV G;  4JKV A;  5JVE A;  1KYO E;  2NUP A;  1YQ4 C;  2XL4 A;  5CCH C;  1HE1 A;  3ZDL A;  3DAF A;  3DJU B;  3U9M A;  3HTK B;  3ZG1 A;  5L0C A;  3Q5P A;  3RK3 C;  1HE9 A;  3W2V A;  1LIH A;  4CDV A;  3TUL A;  4K7B A;  2EIM C;  4YPC A;  4IGG A;  3I5C A;  3W68 A;  2WPQ A;  2J59 M;  2FXM A;  3OW2 O;  2R25 A;  1NTZ D;  2VAS A;  4E7S A;  3KDP B;  2R7Q A;  2AWC A;  2WZL A;  3P8M C;  4CDY A;  4Z9J A;  5E33 A;  1GU4 A;  2A6E F;  2QJP B;  1OVU A;  3ITK A;  4UB6 E;  4XWJ A;  2WQY C;  4OGQ B;  1Z7Q c;  3L72 D;  4D6T D;  2C9N Y;  3HNJ A;  4AYC A;  4GEH A;  3A2A A;  3HE4 B;  4CIP A;  1DOV A;  5KTB A;  2P7V A;  3RVZ A;  4BG0 A;  2XSE A;  1PV3 A;  1VL2 A;  2XLV A;  5AW7 B;  4IB4 A;  2Y9Y A;  3RH3 A;  3I4U A;  2ZAE B;  4EI2 A;  3EH2 A;  3RQG A;  2VRS A;  3JCU Q;  1Y47 A;  2ZPA A;  2GUV A;  3CCJ P;  4N6C A;  1PP9 D;  4PR9 A;  4RKU J;  1ZHT A;  2VB6 A;  3C7J A;  1SFC D;  2FBW C;  5K5G B;  1IFN A;  5DQZ A;  1MMG A;  4CSA A;  1J1E B;  2FYU K;  2SPZ A;  1FZB A;  1ZU5 A;  3H1J E;  3VP9 A;  4DJG A;  2ICW G;  1SQB G;  4C7O B;  1FTS A;  1P84 H;  3S1K A;  3AJM A;  1JTH A;  4RJT A;  4H13 D;  3CCS P;  1IJD B;  2H89 C;  1W5C E;  3M0A A;  4RBN A;  2KUB A;  3BRV B;  2BCC J;  1KC8 Q;  1D0Z A;  2ZT9 C;  1FFT C;  2M3B A;  3GF3 A;  2ZJS E;  1NTK G;  2OOC A;  4ULV A;  4KC9 A;  4DBR A;  2XKM A;  3A0H E;  1TR2 A;  1YIT P;  1T3J A;  1KB9 I;  3AED C;  1OVV A;  2M0B A;  2IBZ I;  1GW4 A;  2HV6 A;  4GT1 A;  1XTG B;  1AVY A;  2WZG A;  2LR2 A;  1DOW A;  2OAR A;  1GU5 A;  3S90 A;  3L74 G;  2KZJ A;  1OXK A;  3AQC A;  2YIU C;  2HKV A;  3GOD A;  1S2E A;  4WB4 A;  2ZVN B;  3CCR P;  2IDB A;  4AX2 A;  2P1A A;  3JTL O;  2J9B A;  3SSU A;  4DJ9 A;  1L0L E;  4C7R A;  2P61 A;  2H43 A;  3L1M A;  4HJG H;  1VLS A;  3Q1M A;  1AFO A;  4ZMD A;  1L0N G;  3LJB A;  5CCH D;  1L4A C;  1OXB A;  4EIJ A;  3D6Z A;  4H44 D;  1L4A D;  2JR8 A;  4GOD A;  3ASO C;  2YL7 A;  4PFO A;  4O7G A;  4H0L D;  1M7L A;  4CS8 A;  2HYN A;  5M1B A;  2R3S A;  1N73 A;  4EBJ A;  3SXY A;  3Q7L A;  1SQB J;  2JO1 A;  1RXQ A;  3G71 P;  3PCV A;  1EXJ A;  4IL6 E;  1FJP A;  3L70 E;  4R4M A;  3UGO A;  1K04 A;  3MUD A;  2OYI A;  1ZME C;  1NU1 D;  1JAF A;  1U6H A;  3H1K D;  2Q9B A;  3A5T A;  4DVY P;  2YLG A;  1QGK B;  1GW3 A;  3AEE C;  4U5H A;  3NXS A;  2JD3 A;  2HJM A;  1FE6 A;  3H1H G;  2IXO A;  3O6Q B;  2ZXO A;  2A68 F;  3CEX A;  4LAC B;  1RCP A;  3U59 A;  2J0X A;  3TJ5 A;  1HJ0 A;  1MKM A;  1QEX A;  3L72 G;  4JF7 A;  1JY3 O;  4D6T G;  1PPJ E;  4HB1 A;  2CW0 F;  3QVZ A;  5L0J A;  3KHU A;  1LGH B;  5D92 A;  4OIR F;  2H7O A;  3ZSU A;  1T2K D;  2NSG A;  1ZYR F;  2QA4 P;  1P84 E;  1SQV D;  2HFE D;  1KD1 Q;  1W2W A;  3KKB A;  1HH0 A;  3KQG A;  4TT3 H;  1D7M A;  2QVA A;  4BEM J;  4I1L A;  3M79 A;  4G7Z F;  1ZW2 A;  1EZV D;  1L0L D;  2A06 E;  5APQ A;  1QLE D;  3B29 A;  3IQT A;  3H65 A;  4IAO A;  1VF5 B;  1FU1 A;  1BE3 E;  3NYL A;  1CZQ A;  2O1J A;  4YWQ A;  1KIL C;  3OA1 A;  3L71 G;  3HRN A;  1ZZP A;  2A06 D;  4Z9I A;  4GDO A;  3PJS K;  4R4L A;  1ST6 A;  3JSE O;  2IXM A;  2ZXW C;  2O01 N;  1PZQ A;  1JMW A;  3N2Z B;  1RF0 A;  1SMY F;  4YJW A;  3L4F A;  3AQB A;  1SQP J;  3IQ6 A;  4X0R A;  4AK9 A;  1SYQ A;  2QE9 A;  2D2C D;  3W67 A;  2YIU B;  1LI5 A;  1EDJ A;  4PD4 H;  4MW3 A;  2K9Y A;  1YDI A;  3GEE A;  4U3F D;  3ZC4 A;  3CCL P;  4MVU A;  1IFJ A;  5EK0 A;  1VPC A;  2M3E A;  2NPS C;  2WPR A;  2HS5 A;  1KZU B;  5KLV D;  1U7M A;  4LDK A;  5F5F A;  3H1K E;  2IYL D;  3O6Q A;  5KJ7 C;  1NTM D;  2Q1K A;  1BGY J;  4G7H F;  4I1M A;  3RL0 D;  1RMV A;  1LT9 A;  5DS4 A;  1W2B O;  3GEH A;  2VCA A;  1NYH A;  4LC1 A;  1PPJ D;  4XEV A;  2E75 C;  4N78 D;  2XNX A;  5DVW A;  5CBN A;  2YNY A;  2E5T A;  3WUV A;  1Z5Z A;  1F1M A;  3TJ6 A;  1MV8 A;  3V5Y A;  2YXR B;  3L71 J;  3B71 A;  5BU8 B;  2CNW A;  2Q9I A;  4N4W A;  3UGP A;  2W6B A;  2VH3 A;  2W4B A;  5COG A;  3CQZ A;  3MFN A;  3D6Y A;  3HD7 A;  1R5S A;  2RMZ A;  1ZR4 A;  1IFM A;  3L73 G;  1LWU B;  2V7Q J;  3V5X A;  3FXD A;  3GEI A;  4Q5S F;  2OTK E;  2PFX A;  1Q0G A;  3AEC C;  3O8Z A;  2G3A A;  2Z15 A;  2OYO A;  1NTZ E;  4JJG A;  4NTA A;  1H88 A;  4CS9 A;  1IO4 A;  2W90 A;  2ZFC A;  2WSF H;  4NCQ A;  4HH2 A;  1YJ9 P;  3M06 A;  5B3I A;  3BCC G;  3RL0 C;  2KS1 A;  2HOD A;  3DM9 B;  3HD7 C;  1CGO A;  4KHX A;  4L73 A;  1PL5 A;  4NQF A;  4CS7 A;  2HPC B;  1VQL P;  2ZVO B;  4KI2 A;  2MYS A;  5KAI E;  1G2C B;  2FYU E;  3ABM C;  1YHQ P;  2Q4F A;  3M4C A;  3B5N C;  4XEK A;  1YJW P;  5L0H A;  3V2Q A;  1PGJ A;  1FZC A;  4U5C E;  1FFH A;  2YL0 A;  4DVZ A;  3KYI A;  3EG9 A;  5AGF A;  1N7S A;  3KH2 A;  2Y0E A;  2ZYD A;  3A3Y B;  3NDB B;  2YEV A;  2QEX P;  2Q3I A;  4CIH A;  5AW0 B;  1GK4 A;  1L2P A;  1FMW A;  2C04 A;  4YL1 A;  1NAF A;  3HUS C;  3H32 A;  3AG4 C;  1NG1 A;  3CCQ P;  3H1J D;  1Q0M A;  2QUP A;  5EHH A;  4XPW A;  3BCC E;  4C7N A;  2XU6 A;  1BSN A;  4ULW A;  2WSF J;  4W8K A;  1S4X A;  5APW A;  3E9V A;  3T6B A;  1J1E C;  2M8R A;  1DX7 A;  2OEX A;  1N7S C;  1VDF A;  2P0N A;  5GTI H;  2ASR A;  5BUO A;  3L74 D;  3P8C E;  2K9J A;  1APC A;  3H25 A;  2OEV A;  2AEJ A;  2PP4 A;  4CPG A;  5EGY A;  1OW7 A;  1MFT A;  4IFD K;  3GG2 A;  1FZE A;  2L91 A;  3BAS A;  4ZKP A;  2OTJ P;  2IBF A;  2QRX A;  1OIP A;  3B8E B;  2MWQ A;  1GD2 E;  1K73 Q;  1TFK B;  5FCL A;  2RN0 A;  1LT1 A;  2IX7 C;  3VMX A;  1M1J A;  1I5N A;  5L3Q A;  3ITF A;  1R4T A;  2A0U A;  3TSI A;  3MIW A;  2R7X A;  3BCC D;  1NFO A;  1QVX A;  4HFF B;  1S5L H;  1ZV8 A;  1MNE A;  3Q6N A;  3WHN A;  5A6J A;  3TK0 A;  1ZRT D;  4A7P A;  4DXW A;  1TKN A;  1S9K D;  2WT7 B;  4Q4Z F;  1L7C A;  3O55 A;  2V4H A;  3QW1 A;  3DJN B;  4ANJ A;  4YXD C;  4NPE A;  4MTO A;  3SXM A;  3U3F A;  3N7N A;  5KYY B;  1VOM A;  3KYQ A;  1GL2 A;  1AEP A;  2J0W A;  2LFD A;  2N9Y B;  4MVO A;  3MP7 B;  2WVR A;  1CI6 A;  1AUE A;  1U57 A;  4K3A A;  3EGD A;  3RK3 E;  5COF A;  3SWF A;  4Q7C A;  3FXE A;  3V6I A;  1N73 C;  1YAU O;  4XA4 A;  5KKZ B;  4ONS A;  3U1C A;  3LIE A;  4XEF A;  2GDC A;  1H8A A;  1DH3 A;  1OR3 A;  4E7Z A;  4XPY A;  1E83 A;  4GOE A;  1I4Y A;  2D5R B;  3PH0 A;  2YRF A;  2XLW A;  3Q5R A;  1IK9 A;  1NTK J;  2Z5H A;  2TMV P;  5TJH A;  1Z6A A;  4JCH A;  3N4X A;  4L75 A;  1SFC C;  2PNO A;  4XQ1 A;  3LLK A;  1SQQ E;  2FFD A;  4HYT B;  2Y3D A;  2KZI A;  2OJQ A;  3M9B A;  4IAR A;  3B0U X;  3U9J A;  4U3F J;  1M1J C;  2YWA A;  3GHG A;  3C62 A;  3Q2Y A;  1BDJ B;  3M0D A;  2IYP A;  4J30 B;  2L5G B;  1G1J A;  3LS0 A;  3IAO A;  1EQ1 A;  1BR4 A;  1SQP D;  2R7O A;  2KSJ A;  3NMK A;  1E86 A;  2FYN C;  2LD6 A;  3NMJ A;  1OW8 A;  4OIO F;  4TLF A; 
#chains in the Genus database with same CATH homology
 5KLI C;  3MFN A;  1OMI A;  3H25 A;  1Y9B A;  3D6Y A;  5F28 E;  1DD3 A;  2PBE A;  1KQF B;  2BEZ F;  1OW7 A;  3BRJ A;  1HF9 A;  2V7Q J;  3AEA C;  3RL0 g;  1KQG B;  1IK7 A;  2ZT9 B;  1Q90 D;  4Z1M H;  2QIW A;  1KTM A;  3JYY A;  3IN6 A;  1O3U A;  4TT3 H;  2HSB A;  1OW6 A;  1S1C X;  4YTP C;  3AEC C;  2G3A A;  2JPU A;  2Q00 A;  3AJM A;  2E76 D;  4H13 D;  4H13 C;  2H89 C;  3AE6 C;  1VF5 B;  2G8Y A;  3GF7 A;  1KOR A;  4EBK A;  1ZOY C;  3EWK A;  4OGQ D;  2ZT9 C;  1WOL A;  3C8V A;  2E76 B;  2WSE J;  3GF3 A;  1KNY A;  2JX0 A;  1VF5 D;  1QVX A;  1ZZP A;  3LW5 J;  4H44 B;  4GDO A;  2QJP C;  4H44 C;  1WMK A;  3AEF C;  1PL5 A;  2BEQ D;  4NQF A;  3S9O A;  4R4L A;  4H0L C;  2NZ2 A;  3JZ0 A;  1WTY A;  1YQ4 C;  3AED C;  1GMJ A;  3AEB C;  1JB0 J;  2WPV B;  1AJY A;  4PV1 C;  5KKZ C;  3RQE A;  1KMI Z;  5L8R J;  3GLM A;  3Q5P A;  2YMK A;  3SFD C;  2E75 D;  1K40 A;  3TUL A;  2D2C B;  2YIU C;  1K05 A;  4YXD C;  2D2C D;  3U0C A;  2D2C C;  1JOG A;  4XEK A;  2IDB A;  3U3F A;  2QSI A;  2L6G A;  3L8J A;  1FDO A;  2K9Y A;  3AE5 C;  4U7J A;  4H13 B;  3SFE C;  3AE2 C;  2QJY C;  3FGA D;  4KT0 J;  3C8G A;  3Q1M A;  1UFB A;  1U57 A;  3RK3 E;  1NGM B;  1V4A A;  2FXP A;  2L6F A;  2JP3 A;  3G9R A;  2J5U A;  3O10 A;  3AE1 C;  3RQF A;  2OQQ A;  4PV1 B;  3D6Z A;  3AE4 C;  4H44 D;  4XEF A;  3C18 A;  1RQV A;  2E74 C;  4H0L D;  4H0L B;  3AEG C;  3O6Q A;  5M1B A;  1PIX A;  2E76 C;  1EXI A;  2WQY C;  3C8G B;  4OGQ B;  2LK4 A;  1RQU A;  1ZP0 C;  4Y28 J;  4PV1 D;  4OGQ C;  3Q5R A;  3C8G D;  3AE7 C;  4EBJ A;  1WWP A;  2JO1 A;  4I7Z B;  4IL6 X;  2E74 B;  3D71 A;  3Q5S A;  1KIL E;  1EXJ A;  1YQ3 C;  2H88 C;  2ZT9 D;  1FDI A;  4R32 A;  1DD4 A;  4R4M A;  1K04 A;  1TU3 F;  1VF5 C;  1ZME C;  2P10 A;  1DIP A;  2L6H A;  3GM3 A;  4XFJ A;  3GM2 A;  1PV3 A;  1VL2 A;  2KK1 A;  2WSF J;  3AE9 C;  2YWA A;  2O01 J;  3L8I A;  3RQG A;  3Q2Y A;  1NYH A;  3AEE C;  2MKV A;  3Q3D A;  2WSC J;  1UIX A;  2E75 B;  3R4Y A;  3GM1 A;  3K7D A;  3GMA A;  4XEV A;  4I7Z C;  2E75 C;  2QJK C;  3ABV C;  3IAO A;  3AE3 C;  1R8E A;  1ZRT E;  1HJ0 A;  1MKM A;  3T97 B;  4RKU J;  2FYN C;  3B71 A;  1S5L X;  2E74 D;  3AE8 C;  1OW8 A;  3D70 A;  2FBW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...