1KTRL

Crystal structure of the anti-his tag antibody 3d5 single-chain fragment (scfv) in complex with a oligohistidine peptide
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
247
structure length
229
Chain Sequence
DILMTQTPSSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPFTFGSGTKLEIKRGGQVQLQQSGPEDVKPGASVKISCKASGYTFTDYYMNWVKQSPGKGLEWIGDINPNNGGTSYNQKFKGRATLTVDKSSSTAYMELRSLTSEDSSVYYCESQSGAYWGQGTTVTVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-his tag antibody 3d5 variable light chain, Peptide link
publication title Crystal structure of the anti-His tag antibody 3D5 single-chain fragment complexed to its antigen.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 61
structure length 229
sequence length 247
ec nomenclature
pdb deposition date 2002-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ktrL00
1XR8A 4NN5B 1VESA 4ELMF 4NBZB 5IJVA 4GAYA 2DBJA 2QSCL 3L3DB 4MS8D 1NBYB 5CKAA 2V7HB 3T04D 5KSVB 4NKMB 4XNQA 1DQLL 1UJ3B 2YPVL 4J3XA 3OKEA 5D2LE 4Z7UE 1IGJB 1NFIA 4X6DF 4PJCA 5KBNC 4GKZA 3Q48A 1NCAL 1MHPL 3QCUL 4DJMA 4OD2B 5KANG 1MJUL 2D9QB 2X42A 1T7XA 2X41A 2R8SH 1PAMA 5DZNA 2EKSB 4Q9RH 3KPMA 3ILQD 4PJAA 4MQXC 4R26H 3SCMC 2C4FU 3T08A 4JZOA 5I30L 5GS1A 1FGNH 1OSPH 5JNYB 5EU6B 5L6YL 3WHE0 2GJ6B 5HHME 2RCSH 5I9QC 4KFZC 1DSFL 4BH8A 1CFNA 5J6GA 3CXHK 2XQYK 1H0DB 4XCNA 1BBJA 1U6AH 5IROA 4LLUA 5JO5A 2ESVA 2CO6B 3DJ9A 1KLGB 1PG7L 4A2MA 1BFOB 1S78C 2BRRL 4X9GA 4XAKE 4WW2A 5C70A 5C08B 5T1DH 3C5ZA 1WCBA 3SKMA 3OKKB 4XNYL 1OM3L 2JTDA 4P23B 5F6HI 1MFCL 4YHZH 2DQFA 43C9A 4U6XB 5I2IA 3PNWA 4HJJH 1FVCB 3O81A 5EO9B 3TJHC 3GBML 1DBKL 3NCFB 4U1GB 1EZVX 1IGML 1U8HA 5JHDD 1S78D 1DQTA 5IJKA 3PV7A 4S2SB 3VE0B 3HAEA 2MTPA 4O51A 4HEPG 4HWEL 1VPOL 5DEZA 2VXSH 43CAA 3VG9B 4HK3J 1D6EA 3HNSH 4J23A 2Q8BH 5E00A 3ARDA 1MAMH 4Z95L 1BEYH 4YQXH 3WYRA 4KGJA 4PTUA 1LNUB 2ARJB 3DLQR 2BZDA 4P4KB 3K3QA 3TYFA 3TJHD 4H26B 2VLKE 1E4WH 4KHTH 4OZHF 4WHTB 4Y0GA 5EA0H 4N0CC 3KYNA 4HKBA 1NFDE 1REIA 3NZHL 4M3JA 4L9DA 4G43B 4NNYB 1GSMA 4WFHE 2JIXB 4UNTA 3RQ3A 1ORQA 2XWBA 4Z76B 1I1AA 5IVXA 2R8SL 2A73B 2I9TB 1RJYB 4Q9RL 4P2QB 4EUPB 4R26L 3PWNA 4MJIB 1FGNL 4BFGA 5CGTA 3L7FA 4LVOB 3LAFA 1K8IA 5F88B 4HUNB 3AVEA 3BW9A 1AO7B 2R39A 4MD4A 1XGPA 4NRZB 1ETZB 3GSUA 3BXNA 1UH2A 3QPXH 2RCSL 2R23B 2BCKA 3TIEA 3F7YB 2GUOB 3QQ3A 4I3RH 4K94H 3C8HA 4QHMA 2WV3A 4I5BA 4OGXH 1U6AL 5GGRY 5D1QA 5GGSA 5I19H 1OQXA 2ED8A 5F3BA 3CDCA 3PIQA 1NDMA 5K59E 1CLYH 3KPNA 3O8XD 1DQMH 5EZLB 3QUXA 1XGYH 5T1DL 2XICA 1MHCB 4H1LB 4YXHL 2HT4D 5F7MC 4Y4KA 2VLRA 2FGZA 3OR7A 4OGAC 2BOBA 4YHZL 4H25B 1ND0B 2NNAA 3RY5A 2GTZB 1FYTB 3GSRA 3RL1B 5D2LF 1CDCA 5ESAB 3MX0A 5CBAB 4Z7UF 2ENYA 1A47A 3ZTNL 1YEKH 3KPSE 4HJJL 4MCYA 2AK1H 2GQHA 1DQQA 3MFGB 4JFDE 1IQWL 3NIDE 5FGRA 4KK6C 4QHLA 2XN9A 3S5LG 4NO2A 5IR1B 3PJSB 2Z93A 1V7NH 4QRUB 2DI7A 4OGZA 5EO1A 2NXZD 2VXSL 4X6FB 4XPGH 4C56A 4JM2D 2FGWH 5KSBB 1MJJA 3DYOA 4WI2A 1IMHC 1WBZA 3HNSL 1S5HA 2Q8BL 5CEXA 4RZCB 1K9TA 1KT2A 5H2BB 1LE9A 4YQXL 1U58B 4EIZC 3MUJA 4F2MB 4M7ZB 2FO4B 2DLEA 4QOKD 1E4WL 3DURA 4KHTL 1DVFA 5EA0L 4CRPA 5IQ9B 1HHHA 3NPZB 3UJTH 5E8PA 2CO7B 3B3IB 5EOTB 2V2TB 1IGFL 1U8LA 1MI5D 2EO1A 2P8MB 4IIQC 1JWUB 5I0DA 4LARH 1C08B 5F7LB 5D5MB 4YBLC 1A3LH 4G9FA 1ZWIB 1U95A 1UWXH 1XIWA 2IFFH 4HS3B 1ZLWH 5I1IH 1K6QH 4L8SA 5HXMA 3K0WA 3QPXL 5T1KB 2QJDA 1BAFH 1KIUA 4HD9A 3VWKB 3PE9A 2J7LA 4I3RL 4P46C 4K94L 1DUZB 4OGXL 4WENB 5JOEA 3SKNB 1QFUH 1YUHA 5I19L 1GGTA 3NFNB 2ZOLA 5HGHB 4HIJA 1P5VA 5C07B 3GMPB 3PABA 3TVMB 4Y5XA 1MCCA 3VRLE 3AM8C 3WN5C 2KKQA 5AAMA 1CGXA 3OKNA 1CLYL 2NXYB 1DQML 1Y18A 1I8MB 1XGYL 2Q3AA 3ILPB 4AM0A 2FJHA 1A6ZB 1INQA 2EECA 3LS5L 1WT5A 1A9EA 2X4TA 4JZJB 5DD6B 4M4RA 2G2RA 5A43C 3K4ZA 3O41B 4P46D 5DHYB 2NLJA 2BNQD 5FDWA 4RSVA 2V5YA 5E5UB 5JPMA 4X98B 3V6FB 1YEKL 4JVWA 5DJ6B 2XZZA 1NFDF 4AT6B 3OKYA 3G6DH 4KQ3H 2X89D 1MCQA 2R1YB 1V7NL 3C9NA 4YIQA 5IW1B 4IHOA 5IMOB 4XPGL 2GY5A 2FGWL 2VZSA 2HT3D 1OB1A 1HZHL 1XGQA 4F58L 4OZGE 5JW4R 3GM0A 2Q7YA 5JZ7C 4YFEA 1G7MA 3GKZA 1YEFH 3BH9A 1HSBA 1PX4A 1R3KB 3MJ9H 2H1PH 3NZ8B 4PR5B 3MRHB 3TBYA 2XTJB 1AGFA 4HCRA 5CS7A 1NMBH 1KXQE 2UWEE 3SHSA 4PD4K 4LCWB 1H15A 5DD1H 1A7OL 3UJTL 4D94A 5K59F 4FA8A 3NABH 4QRTB 1ITBB 5ADPL 3VFWA 3OG6B 3HRZB 2ZUTA 2V7NB 3HI1A 3U46B 3L3GA 1EEYB 4NGHH 3HR5A 4LARL 1Q9OB 4Z0XB 2X44D 5J7CC 4L4VB 4LLQB 4X4ME 2QQQA 4MCZA 1A3LL 4ONOA 1DBJH 4WWKD 4D0DA 5ILTH 3DGGA 3QWOB 5I1IL 3CVHH 1IGCH 1K6QL 3GSVB 3KLDA 5JORB 3LDBB 3BMWA 4BFIA 5A2IH 5E4IA 5JW5B 2HT2D 4K2UH 4GW5B 5GJSH 4PRIE 1F4WL 4TSBH 3CPLA 1H8NA 2W9LA 3QUKB 4PV8B 3U79A 5HHOA 4Y4HC 3ZHKA 3HC0B 3PL6B 3NIDF 4G6MH 1Y0LA 1CIUA 1QFUL 3MUGB 4M02A 3P4LA 4N90D 1N5AB 4PY7B 5HBBA 1BVKB 3ZT6A 3BMVA 3AXLA 4R4BB 1FFRA 3V7AG 2CUHA 3T4YB 1LO0H 3W81A 4OZ4B 1TQCC 4PP1D 4TPRH 4XWOC 3P9MA 5BZDA 5D7LA 1GYAA 2CH8A 4LDEB 2EDJA 5FO7B 4Y4HD 1UENA 3SDCC 4WFFD 3E3QC 3D39D 3BRFA 3DSFH 3EO9H 1IZJA 1UKTA 2EDKA 3ARTA 3FMGH 4P5MA 4PGEB 3G6DL 3BUYB 5KZCB 2PXYD 4WO4A 5TDPB 3DROA 4KQ3L 4D9RE 4YJZL 1KTKE 4DAGH 1RIHH 3MJ7A 1T66C 4IMLB 4U1LB 1ERNA 5JQHC 2NY2B 5CJQH 1H3WM 4KPHH 3UTZA 1CICB 2EDHA 4RMSA 3QO1B 3DUSA 5I17B 4XWOD 3B5HA 4HT1H 1YMMD 4LASH 4FRWA 3FT4B 1YEFL 2ARJQ 2FLBT 3MJ9L 3QHTC 4AIZA 2H1PL 5C0IB 5LXGH 2FJFB 4ZDHA 4CUCA 4DUVA 1NMBL 4L3CA 4K71C 1J11A 3SJVB 2HJLA 3VRLF 2YBRB 5DD1L 2AJZA 3QDMD 3NABL 4NHUA 2J8UE 1YNTA 1U8KA 4RMWA 4HZLA 5KN5B 2F53E 1RVFH 1K3ZA 4L8CB 3C2AH 5CMAB 1DBJL 4UUJA 5ILTL 1FFPB 3S7GA 3EFFB 2DM3A 3CVHL 5FUCC 5DT1L 1IGCL 1H8OA 4B0MM 1EHXA 1QSFB 1QQDB 3FQNB 2OR8A 4P2OA 4LCIL 4QHUB 4K2UL 3MJ8B 5ICZB 5CZVH 2XKNA 3ZKNC 4HBCH 2Z8WC 3MV8E 4L8DA 2Z92B 4PJGB 4G6ML 5DFTA 3TFKC 3AS0A 3L3IB 3O2DA 3KDMA 1Z5LB 1EAPB 1Q9KA 3DXAA 1HCVA 3D5OF 3IDMA 3MRJB 3F7QA 4XBPA 1H3TA 3PQYD 3BJ91 3FN3A 4LAQH 4OZGF 1LO0L 5C0FA 3BP6A 1E6JH 2Y5EA 5TQ0H 4HWUA 3LKPA 4FTVE 1WEJH 4TPRL 1PYWA 5GRWA 5FCUH 1CR9H 5TDOB 3EKCA 3ZKND 4XCFH 1U42A 2VXUH 1U8MA 1U92A 4X7EC 4J6RH 2UWEF 1OLZA 3D0VB 3DSFL 4GG8B 3EO9L 1RUKH 1NLDH 2FR4B 3FMGL 3L3DA 1CFTB 1NBYA 2V7HA 4GBXC 3DVFA 4NKMA 4Y1AD 1UJ3A 4DAGL 1RIHL 4K8RC 4Y2DC 4HC1A 1RJZB 1IGJA 1FL3A 5CJQL 1N8ZA 3MRGB 4KPHL 4WFGD 1BGXH 3AY4C 3CDFA 2EXWC 1T1XB 3LQMA 4MXQC 1XF4B 3UBXA 1JNHB 3C8DA 1HXMB 4ODWA 3NPSC 4HT1L 4LASL 3FB7B 4KKCD 1L6ZA 3QH3B 2L4OA 2EKSA 1P6FA 3MGTB 1KJ3L 5LXGL 2VN7A 4FFZL 4QRPA 4XP5H 3GZKA 1CVSC 2DQCH 5EU6A 2GJ6A 1R5VA 3OKLB 3FN0H 5D7JA 4Y2DD 4PJBE 1D5ZB 3CVHB 3SCMB 1IQDB 4TOYH 1H0DA 4HG4J 1TJGH 4WGVB 4MXQD 1RVFL 5KSAC 3C2AL 2YS4A 5I9QB 2VYRE 1KLGA 1QLEH 3QXDB 5BMFH 1BFOA 1HHKB 3I2CH 2FLRT 5C08A 2BY2A 4X6BB 2EE2A 3BYYA 3GSQB 5CZVL 1QPXA 4HBCL 3OKKA 4MNQE 4I2XA 4UDUA 4Q7DA 4P23A 2D7MA 5JHDB 3E8UH 1WWAX 3QPQD 1JGEB 3BYTA 3X12B 4G8GD 2X7LB 1RMFH 4U6XA 1NJ9B 5E6IA 1FVCA 5KSAD 4LAQL 3C87A 3EDFA 1E6JL 3RI5K 4O2FB 1WEJL 1BP3B 1PY9A 3MUHL 4S2SA 3VE0A 5GRJH 3MYZA 5FCUL 3U7YH 1CR9L 1MCOL 4XCFL 1BFVH 3L3JB 5EC1B 2VXUL 5HGBB 5LVEA 5HYJD 4X4XB 4J6RL 3FOMB 4HZAA 2NX5D 4UMGA 1OCWH 4LHJB 1RUKL 3ZLQC 1NLDL 2ADJB 4GSDH 2HRLA 2J8UF 2HH0H 3MOBH 1NUNB 1LNUA 4U4BA 5ITFB 4EDXA 2ARJA 5C6WH 2FEEI 2OXGA 1A6WH 4P4KA 1VACA 3WJJC 4GQ9H 1YZZA 2OR9H 1RUQH 2YZ8A 4M7LL 1KYOK 4FP8H 3U7WH 4JY5H 4NNYA 1T0NB 2JIXA 1CK0H 3H9SE 4Z76A 2CR3A 3GBNH 4E0RB 5B8CC 1RJYA 4P2QA 2A6JA 4ELKB 1UT9A 4MJIA 3STZA 1EMTH 4OD1H 2ITCB 4XP5L 3Q3GB 4FQXA 5F88A 4U0RC 1AO7A 3S35H 3F7PC 4LPVA 1ETZA 2R23A 1F02I 3S36L 5KW9H 5LQBL 3FN0L 2ZCHH 3GIZH 5E9DD 3ULUD 4P57A 4XNUH 4PJ9D 4TOYL 2HVJB 2LQRA 1TJGL 2QEJA 4WNQB 4X80H 4D2NA 1S9YB 4J2XA 4MA1B 4PREB 3UTPD 1QLEL 5BMFL 5JOFB 2A0LC 4MB5A 3ARBC 3VFPB 3QWQB 1IE5A 4XNXH 4RFNC 1CGTA 2YD8A 3KLAB 1CD1B 3E8UL 2UUDH 3BKMH 2JJTC 3Q2CA 4H25A 4JQIH 1I4FB 2GTZA 1RMFL 5ESAA 3EHBC 1ITCA 1RIUH 2NXZB 1RK0B 5D4QA 3RFZC 5EU7E 1B6UA 1JE6A 2LAAA 5DVNA 5INCA 3A6CH 2NW2B 4LHQB 4BK4A 1GGCH 4IRJD 2C3GA 5IR1A 3KLHC 2VC2H 3BDBA 3PJSA 4QRUA 1YY9D 3S4SB 1I8IB 5MEPB 5GRJL 3AS3A 3U7YL 1YJDC 4X6FA 1BFVL 3QEQB 4QOKB 3IAGC 4WUKH 4OIBA 5KSBA 1OCWL 4RZCA 1IAKB 3BKCL 3VH8G 1FBIH 4GSDL 2EDBA 5H2BA 1B0RB 1JF5A 5KTEH 1OLLA 2E8ZA 1F4HA 2HH0L 4PJBF 3EHBD 3MOBL 5EUKB 1U58A 1Q72H 3TN0C 3CSBA 1UEYA 2O93L 2GT9B 4F2MA 2NY5C 2FO4A 1A6WL 1MLBB 4GS7C 4P2YA 1M05B 4GQ9L 5CJXA 5ID1B 2OR9L 1RUQL 3T2QA 4DW2H 5IQ9A 4LLAA 1IKNA 4FP8L 2GTWA 5B3NA 3U7WL 4JY5L 3B3IA 1BIIB 5EOTA 2RR3A 1RSFA 1CK0L 2NTSP 4OKVB 2P8MA 1JWUA 1JN6A 3GBNL 3OAZK 5I15H 3WS6A 5DJYB 3N1QC 4OLWH 5ANMB 1EMTL 5D5MA 2EIDA 1ZWIA 5IV2B 4HS3A 5AG9A 4JM4L 3S35L 4IIQB 3TN0D 4Y19E 5T1KA 4PJ8D 2PW2B 2ZCHL 3GIZL 5DJ0B 5EIVA 3VWKA 4XNUL 5I66B 4L8BB 2E7MA 1WTGT 4PLJD 1S7QA 3LMJH 1DUZA 4YBLB 3PV6B 3PP3K 2NY1D 5JOPD 3SKNA 5HGHA 3NFNA 4JFQA 4X80L 3KYOB 2PCPB 3TVMA 4BQCA 4P46B 3KGRA 4PJEB 5C86A 1Q94B 3LVEA 4ZOEA 3O6FC 1I8MA 3O11B 1ZGLP 5DTFB 1IC7L 4XNXL 4BM7A 5L8LB 2ZP0T 4KKAD 3GRWH 2M8XA 3D18A 3VMNA 1BZ9B 1HDMB 3BKML 1YC8A 3CFKB 4JQIL 4NDMB 3HHRB 1IEAB 4OF6A 5E95B 1MRCH 4YFLI 5DD6A 3RZCC 2P47B 3O41A 5DHYA 1RIUL 3CDYA 3VXOB 4X98A 3V6FA 3Q6GH 2AI0H 4QKXB 4AL8H 5ALBH 5DJ6A 1HH9A 5FYJU 4AT6A 5D7KD 1N6VA 1G7QA 3A6CL 5JXEC 1FVEB 1EZVY 2VLME 1GGCL 4OT1H 1KCSH 4ODHH 1K5NB 3QZWB 5CBEB 2R1YA 2VC2L 3L5HA 2HRPH 4WTZA 1CG9B 3CH1A 3O9WC 3H0TB 4XPTH 5FKAA 5IW1A 5IMOA 5JA8B 3VXRE 4WUKL 1RZFH 1HQ4B 3SKOB 1X5GA 1NUGA 1FBIL 1OW0C 3OB0H 4OCYH 5CJ5A 5KTEL 1Q72L 1H5BC 1R3KA 1INEH 3DMMC 4PR5A 5ECJE 3MRHA 3ZE1E 4OFVA 4BZ1H 1T04B 3D25B 5DQDH 1UZ6F 2K9UA 4WWKB 4DW2L 5KJRH 4K8RH 4LCWA 3NGBC 1GOFA 3U0TB 4QRTA 3MOAL 1OAKH 2IAND 3HRZA 4M9OA 5I8OH 1FG9C 2V7NA 3O9WD 4HK0B 4KRPD 4Q6IB 5E08H 2GI7A 1EEYA 1M7IB 1CU4H 4RISH 4Z0XA 3I9GH 3S3SA 5FYKE 5I15L 32C2B 2ADIB 4L4VA 4LLQA 5GRUH 2F8VA 3FQRB 4OLWL 3C08H 3T0AA 1CXKA 1EUTA 3QWOA 1IT9H 5JORA 3GSVA 4UTAH 1H3XA 1KPVB 2FX9H 5JW5A 4GW5A 3SDXE 1JZ2A 3MRNA 3QUKA 4PV8A 1WVZA 3RJDA 3LMJL 35C8L 3HC0A 3PL6A 2J4WH 5ISZB 3L6FB 5A2JH 1QRNE 1QBBA 5EUOE 4Q97A 2UZYB 2UY7A 2E7BA 4PGDB 3MUGA 1N5AA 5I8CB 1ACYH 2P8LB 4N0FB 1JUFB 2OTWB 4J8RB 4PY7A 1BVKA 5BS0E 3B8YA 4HLJA 1IC1A 4YGVB 4Y4HB 5IGXH 4G42B 3TA3C 3D39B 3WV0A 1S7RB 4OZ4A 5DUBB 3GRWL 1W8OA 5IBTL 3ZTJG 1MRCL 5CAYB 4JRYE 4U7SA 5SX4H 1UZ8A 3Q6GL 2AI0L 3HPJB 4AL8L 1TQCB 4R7NB 4PGEA 5EBLA 2I24N 1YMMB 3BUYA 3INUH 4KI5C 5TDPA 1FN4B 1KCSL 4ODHL 3P2TA 4YEEA 1UM4H 2HRPL 2GK0A 4IMLA 3SDCB 3TA3D 4WFED 4XPTL 2DQHH 5F9JA 4U1IA 4JHWH 1CICA 2G9HB 1I1FB 3QO1A 4UI2A 1RZFL 3RHWF 4O2EA 5DD3H 5I17A 1JIBA 3QDMB 4ZNEE 5DJ8B 4Y2OA 4OCYL 5B39G 2F54D 3MYJB 1WFOA 2IPTH 1M7XA 3FT4A 4GG6B 2GSIB 2MFNA 1Q9WA 4F9PA 1INEL 4NN6C 1C7SA 5T3ZE 1J86A 2EDYA 1KPUB 4XRCB 5C0IA 2VH5H 2FJFA 3ZSSA 4BZ1L 4HFUL 5DQDL 4R9HA 5KJRL 3SJVA 4K8RL 1NC4B 1OAKL 1LMKA 3TBSB 3VFTB 4CVZB 5I8OL 5I75C 5E08L 1UH3A 1WUNT 2VIRB 4UZGA 1CU4L 1LO4L 5KN5A 3I9GL 3GUTB 5GRUL 1S3KH 3A6BH 1A64A 5MP6H 1HKLH 1OTUD 3C08L 4L8CA 3WUZA 5CMAA 5SWSE 1FFPA 3EFFA 2OQJB 1CI5A 3MGOB 1IT9L 4UTAL 2VQTA 1A4KA 1BREA 1QQDA 1QSFA 3FQNA 4NM4H 3TYGH 4QHUA 1ES0B 3MJ8A 1MFDH 2YPLE 3K4DA 3PQYB 5ICZA 5D1XD 4PJGA 2J4WL 2OM5A 3L3IA 1ULVA 2AEQH 1Z5LA 1ACYL 2A1WH 3UBXI 5BO1L 3S36X 3TT3H 3RWCB 3MRJA 3T2NH 4MDJB 1G0XA 1D5MA 1JPGB 1P7HL 4UB0H 4JFED 3CD4A 2C9AA 3RPKA 4Y1AB 2PO6C 1UCBL 3F62A 5CEZH 5TDOA 5ALCH 3DWTA 3ZE1F 3T09A 1J8KA 3B9KD 4X83A 3OJDB 1TVDA 2CK0H 1BJ1J 4GG8A 5EZJB 1NMAH 1JHLH 2FR4A 4HWZB 3QI9C 2OLDA 1ZOXA 5LGJB 3INUL 1N0LA 1CFTA 4JZNB 3OTTA 3C60C 3EZJB 4PRBB 1UM4L 4LVNC 4G7VH 4NC0B 1A4JB 4QRRB 5KAQF 3ZDZE 3MRGA 1AC6A 2DQHL 5D2NC 3KPOB 3VW3H 4JHWL 1IJ9A 3MJ9A 4I0CC 5DD3L 5HHMD 1JNHA 3OR6B 3DPBA 4QNPE 3FB7A 3QH3A 2IPTL 4Y2DB 3SDXF 1OAZH 1KBGH 3FT2B 3MNVB 1QO3B 5C9KA 5EC2B 2EEBA 3C2SA 5EUOF 3QYCA 2VH5L 1LILA 4Y5YC 2A9NH 3QI9D 2NY5H 1WAAA 3NPSB 5IG7B 1J8HB 1V05A 1P7KB 4XAKD 5BW7C 2HLFD 2BHUA 3C60D 2D4DA 1D5ZA 3CVHA 2KQNA 1IQDA 3SCMA 2EIZB 3E6FA 4EI5C 4NNPH 1UH4A 3MACH 2Q8AH 1VFMA 1HKLL 3P0YH 2CIKB 4KDTA 3QXDA 3CX5K 5CD5C 2ZSVA 1HHKA 4IBLT 1U3HC 3KXFB 4QWWC 4NM4L 3TYGL 4UQ2B 2UYLB 4X6BA 5CINH 2X10A 4L3EE 1MFDL 3GSQA 5KSAB 3PHSA 1OD7A 1BLNB 2AEQL 1JGEA 3ZKXC 2VZVA 3X12A 2A1WL 2X7LA 3EDEA 1NJ9A 2EICA 4NQEE 3QUYC 3TT3L 1R3JA 3T2NL 4JO2H 1NBQA 2WW8A 3HUJA 4HUKB 4HIXH 4O2FA 1BJ8A 4UB0L 3TO2B 3QAZC 3CUPB 1U3HD 5EZOL 1W0VB 3FRUB 4MZ2A 5DMGC 1KSRA 4LP5A 4MDIB 2VLKD 5ALCL 3L3JA 5EC1A 5HGBA 4IMKC 3ZKSD 4X4XA 1OSZA 4PRHB 2Y23A 3FOMA 4XI5D 1IAIL 2CK0L 1XF5B 4WFHD 1NMAL 1JHLL 2LE9A 5ITFA 4PGBB 1KNOB 1MREH 2L7UA 3SDDD 4G7VL 3IETB 1K4CB 1LK3H 5J1AB 1EBPA 1N3NB 1R5IB 5HVWA 4WCYH 4JRWA 2FD6H 4LNRB 3VW3L 4U7MA 1L9MA 3TC9A 4YDLB 3S88H 1EXUB 1F3DH 1T0NA 1I3UA 2C1OB 5E9DB 1OAZL 1KBGL 4PJ9B 4OF5A 1PBYA 2CD0A 3RUGB 3TESA 4E0RA 1F3JB 3RVXC 2Z35B 3AB0C 3HG1B 3TP4A 4ELKA 4IOIB 3VFSA 3N50A 4YEFA 2VSCA 2HMIC 2A9NL 2ITCA 3Q3GA 4XAWH 2NY5L 4ZSOB 1YPZE 2R1WB 2OI9B 4U1JB 1ZE3C 1OP5K 3HI5H 1QVOA 4JREB 3BZ4B 3ZYIA 2WINB 4D3CH 2W9EH 1DN0B 4FQ1H 2HVJA 4WJ5B 4OLYH 1UFUA 4OCXH 4NNPL 1MY5A 3EZ8A 3LRSA 3MACL 5F7YC 2Q8AL 3IYLW 2EE3A 3FAWA 4HJ0C 1S9YA 1JP5A 4ZMAT 4PREA 1A3QA 1CQKA 5JOFA 2YXMA 4H0GA 4OBSA 2NW3A 5CCKH 2F5BH 3ME0A 3X3FH 4APQD 3KPSD 3C6LD 5FIEA 5CINL 4ZTPH 2XQBH 5DJAB 4JFDD 3P40A 4IS6A 1I9JH 3P4OB 5GIRB 2HMID 1TDQA 3IVKA 4L3AA 4CADB 1WLHA 3KLAA 1CD1A 1DN2A 3ARBB 2PKDA 4BYHA 5IHUH 4X9FA 1I4FA 4HIHB 1TXKA 2YKLH 4TVPH 5DURB 3B4NA 1RK0A 3ZDZF 1XGTB 3LKQB 4HH9A 5TGBB 1JGUH 1HE7A 1Q8MA 1IRAY 4JO2L 4PRPE 5DA0B 4HJ0D 3TPKA 4HIXL 3FQUB 5CZXC 2NW2A 4QNPF 3SBWC 1E27B 3LN5A 1MHHB 3BUTA 3S4SA 2P24B 5MEPA 4KRMB 3VXPB 1GGIH 4XGZB 1WIOA 3QEQA 4ENEC 3F58H 4N8VG 1IAKA 3EYQD 1KF9B 1B0RA 3TBVA 4M7JL 1MREL 2GT9A 4UV7L 1MLBA 1M05A 2BSED 2EXYC 5FO8B 1FO0H 4WCYL 5ID1A 3FFCE 5CUSH 3SDAD 3TN0B 1CFVH 3S88L 5CGMA 1BIIA 5EH1A 4LGPB 3VA6A 2AV7B 2B7DT 4GS7B 1S9XB 4OKVA 5E2WH 4RIRB 4G7YH 2D7NA 2NY1B 3MRCA 5DJYA 5ANMA 3V4VH 2I27N 1ZAGA 3B8SA 1QNZH 3PP4H 5IV2A 1ED3B 4WI3A 3M07A 1G7IB 1UXWA 5C6PB 1T1YB 4IIQA 3O3BB 3HI5L 4Y16C 5F3HB 2PW2A 4D3CL 1MVUB 2W9EL 2EXYD 1WCQA 3DI2B 3GDBA 3HMXH 4FQ1L 5DF0A 3FO1B 4L8BA 3TEUA 2EZ0C 2X6MA 4OLYL 4OCXL 3PV6A 5F7HA 1JTPA 1QSEE 2PCPA 4FMFA 3UJIH 2BNUB 4C58B 2W60B 4N0YH 4P46A 4YGAB 3BDXA 5CCKL 2F5BL 2M1KA 5IBLC 3JWDC 1OWWA 1NGQH 1F13A 3O11A 5B4MC 5C0BB 1I9JL 4NQCB 3KPRE 3N1GC 4LCYA 1EHNA 3AM8A 3WN5A 1HDMA 2X89A 5IHUL 4NDMA 1IEAA 2VAAB 4TVPL 2YKLL 1PVHA 3CSYB 4IOSD 3VXOA 5I6XC 3CZJA 1JGUL 3HZMB 3LKRB 5C0NC 3BWAB 4ELMB 3IDIB 3SKJH 4M7KH 4K55A 3AAZB 2LU4A 1A6TB 1FVEA 3JTTB 3RZCB 4F7TB 1F3RB 3QZWA 5JPNB 4ZTOH 5IF0B 1G9NC 5DMJB 1GGIL 4X6DB 1CG9A 3AMKA 3H0TA 3VD5A 1JNLH 1FIGH 3F58L 4U05A 1YPZF 1HQ4A 3SKOA 1OVZA 3RPIB 1IILE 1T21B 2ICEB 2IANB 1PW3A 3O9WB 4KRPB 1F6FB 3RWHB 4QHKJ 5CP7A 1I1YB 3AROA 1QR1B 3RWFB 4G6JH 1FE8H 1FO0L 5HI3C 5KAQG 5CUSL 1T04A 3D25A 1I8KB 1UEMA 1P5UA 3FONB 1CFVL 3U0TA 4PRID 1P4BH 5FEBA 4I9WE 4HK0A 2NY4C 5E2WL 3VXME 5IOPB 4RMVA 1CGVA 1JPFA 3MJGX 4ETYA 32C2A 5D8JH 2ADIA 2JELL 3NGBB 1NMCC 4XVUC 1QNZL 3PP4L 1ZEAL 3CCHB 1KPVA 1U8OB 1BQSA 4N1CA 4CGTA 3GFUA 5DVLA 3FHQA 1TFHA 3Q1SH 3HMXL 5ISZA 3UAJC 1ORSB 4PGDA 1NDGA 4YHYC 3QDHA 5I8CA 4N0FA 2P8LA 2BVPA 1JUFA 1RZJC 4J8RA 2CIIA 2NY4D 4N0YL 1MEXH 4F37F 4YGVA 4Y4HA 1NGQL 1N0XH 2QLVB 3U4AA 1U8PB 3U83A 3D39A 1JGDB 3EJZD 4K3EH 5DUBA 3LB6C 1DQJA 2J3SA 4D9RD 3HA0A 3L9RB 3C5SB 3JVGC 4OCMC 2YA2A 1B2WL 4PJ5B 4JG1H 3TA3B 4ZXBD 1T4KB 3GMRB 5F7NC 1OPGL 3HPJA 3MTRA 4M7KL 3SKJL 4HH8A 1T1ZB 5SV4A 1G7PB 2R0ZH 4LU5H 2IAMC 2X4UA 4X4YA 4LSRH 2F54B 3VGDA 4GLRH 2WK2A 2Y6SC 1RK1B 1NBVH 5GZND 2D31B 2AJ3B 3LRGA 3SDCA 4OZHB 4YUEH 1JNLL 1CBVH 1FIGL 1I1FA 5I0ZA 4HWNA 1FO0B 3IFOB 5HHPB 2P5EE 3KG5A 4XH2B 5DJ8A 2DAVA 5C0GA 2FIKB 4HAGA 4QGTA 3MYJA 3OKMB 4GG6A 2YA1A 1UM5H 2GSIA 2XA8H 3HTLX 3PF2A 3ZKQD 2F53D 4G6JL 1FE8L 3P9WB 1KPUA 2ZG3A 1X44A 2PYEE 3BD4A 1NEZG 2PTTB 1NC4A 4U2YA 2Y6SD 4ZPVB 4NN6B 4I0PD 1P4BL 3TBSA 3VFTA 4CVZA 4JFHE 4U7KA 5D1XB 2VIRA 5HPOA 3MNWB 3BSZL 3GGWB 4JFPB 4X6CE 5D8JL 3GUTA 2GYSA 2H26B 1DR9A 3V6OE 1EA9C 2NZ9D 2OQJA 4PPTA 5I75B 4GW1B 4FQHB 4XTRC 2NY6C 1JPTL 4PJDE 4N5EC 3Q1SL 3OQ3B 2AXHA 3MR9B 4KMTH 1J88A 5I74C 1HH6B 4JFEB 3ARXA 2Z31D 1FH5H 2W0LA 4YPGB 3ZYJA 2G5RA 3RWCA 1DL7H 1CDUA 4ODUB 4MDJA 4RFEB 1CDYA 1N0XL 1JPGA 5ACMA 2AEIT 2RBLA 5C2BH 5A2LH 4K3EL 1I9EA 1X4ZA 1LEGB 3QIUC 3BX7C 5DJ2B 4M6OH 1S7VB 4JG1L 2YD2A 3X11B 3MCG1 5GJTH 3CDGB 3S3PA 4PJCE 1NPUA 4S11A 3OJDA 5DXWA 4MJ6B 3HMWL 5HHMB 1DBMH 5EZJA 4KQ4L 2PO6B 2R0ZL 5IVOA 4LU5L 5LGJA 4M8QB 5DWUH 4GO6B 5TF1H 1ZHLA 2R0KL 3NCBB 2C4XA 4PRBA 5JQ6H 1NBVL 2E5EA 4JDZB 1A4JA 4ORGA 3RBSA 4QRRA 1UGNA 4YUEL 5MENE 5E2VH 4PJAE 3KPOA 3CNKA 1CBVL 3QI9B 1MCJA 3V79C 2V5SA 5FB8B 4WW2C 3C5ZC 3OR6A 1P2CB 1CDHA 5IK3B 3C60B 4LVNB 5GRXG 1AR1C 4Y2DA 4HMCA 3PHQB 3HZYB 1UM5L 2XA8L 3FT2A 1IGIH 3DRQB 3MNVA 1T0MB 5D2NB 1QO3A 4DZBA 3AY4A 4WEUD 5EC2A 1X6NA 1IVLA 4KMLB 2QL1A 4WUUB 1J8HA 2XY2A 3AC0A 1P7KA 2ESVE 1SY6H 3AU1B 3VGBA 1BF8A 5DGQA 4OZFG 2EIZA 2VLJB 4MNQD 5HHXH 5BZWA 4Y5YB 2AKRB 1GGYA 3LH2H 4Z7WA 2VDPH 4JFZH 4RAHA 2COQA 3J7HA 3WLWD 4S1DD 1M6OA 3ULVC 1JBJA 2CIKA 2GJJA 1OAUH 4M1GH 4QTIH 4YHNB 4CN6A 2I60H 1S9WB 2YWYA 3KXFA 3VFVB 4EI5B 1MCKA 2Y07H 2UYLA 4OFDA 3RY6C 4GRMB 5KSAA 4KMTL 4P5TC 5D7IA 2FDBP 5EIQA 1BLNA 1FH5L 1U3HB 2AXGB 3MXVH 1BQLH 2VLKB 1PZUB 1HYSC 2CQVA 7CGTA 2J6EH 1DL7L 3QHFH 1O5DT 5C2BL 3FB8B 3ZKXB 2R4SH 3JWDH 3QIWC 3QIBC 2C3VA 2PTVA 3TO2A 3CUPA 3G04B 4WY7H 1W0VA 3QUYB 4OQTH 1JWSB 5C0EB 3SDYH 4GW4A 4OSUH 4M6OL 5HDLA 3B9AA 2HKFH 5GJTL 1KYOJ 1JZ4A 4PRHA 1MFBH 4K7FA 3QAZB 1DBML 5HYSG 2UZIL 4GH7B 3H9SD 4LSQH 3RNKB 5TF1L 4PGBA 3Q6FA 4ZFZA 1HYSD 1KNOA 3EYVA 2PF6A 5JQ6L 4XCEB 3IETA 4J4PC 3VWJC 1K4CA 4NJ9H 3DHMA 5J1AA 1N3NA 1R5IA 4X6CF 5E2VL 2EH7L 4LNRA 2ADGB 1G9NH 2EDTA 3QIWD 3QIBD 1ZHBB 5C9JB 4OFYD 5EFIB 3EGSA 1EXUA 1FNAA 4PRDA 3WJJA 4PJDF 5E9DA 3MCKB 1IGIL 1A9BB 2JLLA 3RUGA 1NAMA 1F3JA 2VXTH 4WV1B 2N4IA 3T77B 2Z35A 3HG1A 5FM5M 1XF2B 1FP5A 1K8DB 2J88H 4KK8D 4ZSOA 2MWCA 2R1WA 1FGVH 5EULV 4FZ8L 4U1JA 1SY6L 3BRDA 2K3TA 3H7BB 2FWOB 5GS3A 5ETUA 3BZ4A 2WINA 2H41A 3VWJD 3KPSB 4APQB 1T80A 2MJWA 3L7EB 5B8CA 2ATKB 3AB0B 1DN0A 4JFDB 4XMPH 5HHXL 3T3PE 3BD5A 2Y36L 1LHZA 3LH2L 5F9AC 2VDPL 2VLRE 1U0QA 3BP4B 1OAUL 4M1GL 4QTIL 4M1CD 3U2SB 1WICA 4XCYB 4PLNC 2NY3C 3HKFA 1IGTA 2CDEB 5EBWB 3BZFB 4JN2B 4PJCF 4G6KL 2J12B 1W0WA 3P4OA 4TSAH 5GIRA 4CADA 1JVKA 4YHPB 5GGRB 2XOTA 3ARBA 2V5TA 3TJEH 1I9IH 5I1GH 2EDQA 2XN9E 4OAWA 4HIHA 1TLKA 3MXVL 4XB8A 4MJ2A 1BQLL 5KSUA 3MROA 4YX2H 3LKQA 4PJAF 2J6EL 3VH8B 2FECI 2V5MA 1W0YT 1RZJH 3K1DA 4Z8FL 2B2XH 5LGHH 3QHFL 2JJTA 1JGVH 1HILA 4QRQB 3ARFC 2R4SL 3JWDL 2ZUWA 5CJBA 2BVQB 1E27A 2BC4B 1T7WA 2QTEA 4WY7L 1MHHA 2DD8H 2P24A 3SDYL 4OSUL 3VXPA 4HX1A 4XGZA 4MB3A 1U93A 5DMIH 1T5WB 2HKFL 3SDAB 1MFBL 1FZMB 5F21B 1RZ8B 1P84K 2E9IA 3TPUB 4LSQL 4P9MH 4AZ8A 4HUVB 3OBAA 4P3DB 3SY0B 4NJ9L 2LU3A 2DLTA 4V2CB 5FO8A 1IKFH 1WJ3A 1ZK9A 2VJXA 2YD9A 4NP4H 3UC0H 1G9NL 3GB7B 2RJMA 2AW2A 4G9FE 5GS0D 2DKUA 2X70A 4Y19D 3TN0A 1EV2E 4X7SH 2AV7A 1SJEA 3UZEA 1S9XA 5JIIA 2OR7A 4RIRA 2YSSB 3OV6A 2ATPB 2J8OA 4HUUB 2VXTL 2VXQH 5GSRB 3O6LH 1BMGA 2J88L 3EIFA 5TE4H 5DVMA 1G7IA 1DDHB 5F8QC 1FGVL 3PHOB 1GGBH 4M93C 5IB4B 5F3HA 5GS2D 1TVHB 3SPVB 1OGTA 5HPMB 1MVUA 4DOHB 4XMPL 5HYFA 3B9DA 3FO1A 4U6TA 1UKQA 4BSWB 3GM8A 1RJLB 3LS4L 3OX8B 3C09C 2BNUA 1LWRA 2W60A 2X09A 2Q7NA 4HFWB 1KPRB 5JUEH 1ONQA 4JB9H 5C0BA 4NKIL 1H3VA 3VFUB 2EYTB 4TSAL 4NQCA 1DBBH 4GMTH 1QFWM 1KCLA 2R2BB 4JLRB 3TJEL 1I9IL 5DLMH 5I1GL 4CVWA 3O6FA 4LFHG 1AD0B 3K46A 5ELIA 1QBMH 5FM5O 4O4YH 1SEBA 3VXRD 3CSYA 4YX2L 2UWEB 3PWPB 3HZMA 3LKRA 1AC0A 1RUAH 3BWAA 3LKSB 1TJIH 2B2XL 4XHJC 5LGHL 1YN7B 1JGVL 3AAZA 3ECBA 3MLWH 1A6TA 1G9ML 3JTTA 3RZCA 1F4AA 4F7TA 5JPNA 4PB0H 2DKSA 1JZ8A 4JFOB 5IF0A 3GSXB 5I6XB 4UTBH 5DMIL 2ZUYA 4F7MB 4PS4H 4E42B 1LO5B 5JXEA 3RPIA 2BX5A 1SVZA 3MRFB 4OB5H 1T21A 2ICEA 4EDWH 2X4PA 3NCEB 4DUXA 2IANA 4P9ML 2CRMA 3O9WA 1JRHI 3EYFA 4UV4H 3RWHA 3T3PF 1I1YA 1QR1A 3TH2T 1IKFL 1CFBA 4XHJD 1OL0A 1MCWW 2YRPA 1OW0A 2IBBA 1QFWH 4K9EC 4NP4L 3UC0L 4M00A 5FFLA 1I8KA 2YD6A 3IDYC 3OAZH 3RX7A 2APBA 3HZKB 3DMMA 4P3CH 4P99A 2EDRA 3BVNA 2WLYA 1QRND 5HHOE 2VXQL 2X1PA 3QUZC 2HFTA 2VDRH 1LVEA 3O6LL 4JO3H 4POYA 4KXZI 5TE4L 4GQPH 1GGBL 2NY4B 3CCHA 3PP3H 2OYPA 2C7UB 5JXAH 5F8RC 2AAVA 1IFHH 4I4WA 3WFBL 5IMKB 4QY8B 3LPFA 3ZT5A 1NMCB 1V3MA 4JVUA 4LSSH 1FAIH 1T1WB 4QXGH 1ORSA 4MJ5A 1ZANH 4HUXB 4JRYD 5D7LE 3ULVH 5EBGA 3DOSA 2WUCL 1QOKA 5E5MB 3V0WH 1KIPB 3MRMB 5CHNB 3CK0H 5JUEL 1YEGH 4X0KB 1SYVB 3BPCB 4JB9L 1U8PA 2DLFH 3N9GH 3F7VA 1DBBL 4GMTL 1JGDA 4L1DA 1B88A 5L88H 4QTHB 1J12A 2Q3ZA 5C0DB 2AQ3A 3L9RA 5MEOB 5DLML 3WHE1 1M4KA 1R6VA 4PJ5A 1QBML 3TA3A 4O4YL 4EN3D 1T4KA 3GMRA 3KLSA 3NA9H 2HP4A 1TJIL 5B39B 3V9FA 1T1ZA 4P9HH 1G7PA 2YHGA 1FFQA 2A6DA 2HTLC 3JZ7A 2F54A 4LRNH 4PB0L 1SMAA 1MCPH 3HZVA 2D31A 4JQVC 1KACB 2AJ3A 4UTBL 2CK2A 5IIEB 3HNTL 4J3SA 4LGSB 4NC1C 5J13C 2IAMB 4DGYH 4PS4L 1EEUA 4LP4A 3IRZA 4WEBH 5HHPA 4XH2A 4OB5L 3P4MB 4EDWL 4JE4B 2FIKA 3OKMA 2D9CA 1R24B 3QWRD 4UV4L 4XVSH 3G6AA 1YEDB 4ZS6C 3PDGA 2E6PA 4WI5A 4Z9KB 4HUWA 5SWSD 3IAQA 4UQ3B 1QFWL 2PR4H 9CGTA 2PTTA 2X40A 3VFRB 1VERA 4ZPVA 3P30H 3RJQB 3VGFA 2YPLD 5F89B 2F74A 1OTTC 4P3CL 4Z7QE 1DTUA 3MNWA 2DQDH 5TQ2H 2QADD 3IJSA 3BHBB 3GGWA 4JFPA 2H26A 1NCDH 2VDRL 4ZODA 1UQSB 4PJ7B 5FGBC 5KOVC 3MNZB 3D0LB 3EYOB 3O4LB 5JXAL 2X4OB 4GW1A 3DXAE 4FQHA 2V17H 4NN5C 4Z77B 1IFHL 1U9KA 5T3XD 1NFKA 1MCBA 2D7OA 1FG2A 3MR9A 1FAIL 4Z7NE 3L5XH 3GIVB 4QXGL 1X3DA 3DX9B 3ZHDA 5IMMB 5IEHB 1HH6A 4JFEA 3RWGB 5CSZB 1ZANL 5ICYB 4NQXB 3ARED 4YPGA 1MPAL 3V0WL 3CK0L 4OUUB 4ODUA 4RFEA 5I74B 2DLFL 3MREB 3N9GL 4YFLF 5L88L 1X5JA 2Z8SA 4MZ3A 4JFYB 4PRNB 1LEGA 1AKJD 1EEQA 5DJ2A 3VI3E 1S7VA 1J1OH 3X11A 3DX6B 3CDGA 4MHHG 3AGVA 5DFWH 1F11B 2J5LB 3HN3A 4N5UA 3NA9L 4MJ6A 1WF5A 5F9DC 4P9HL 2PO6A 3QIUB 5DQ9B 4PJBB 4M8QA 4NQVB 4L4TA 4LRNL 3WO4B 1MCPL 3ARGD 3ROOA 4JDZA 4EXKA 4PP2B 5KS9B 3HS0A 2X4SB 2WZPD 4JVPA 4RMUA 1V3JA 3GO1H 3QI9A 1CE1L 4QRPE 4DGYL 5FB8A 4WEBL 3ESUF 1P2CA 4MQSB 5EU6E 5IK3A 4U6VH 3C60A 3K8MA 2GJ6E 4O00A 1PFCA 3HZYA 4MNQB 4P23C 2QQKH 3DRQA 3LEXB 5D2NA 5KOMC 2Z0BA 3UTOA 2CDFB 3DX8A 2ZWLT 4G8IB 3CX5J 4X4ZA 5GS2H 2PR4L 4WUUA 3DVGB 2HKHH 4FXKB 5SX4I 2EDXA 3P30L 4L3ED 3ARQA 4V1DD 2VLJA 4F3FB 2YA0A 4Y5YA 2DQDL 5HDBE 5JIKA 4I2XE 2EDNA 1NCDL 3U4EB 5BW7A 3DRTB 4FXLA 3VG9C 1OF2A 3LQZB 4YAQB 3L1OH 1S9WA 2YK1H 2V17L 3VFVA 4EI5A 3HAEG 5FYJE 1LEKA 4GRMA 1T20B 1JHTB 3L5XL 3G9AB 2P44B 2VR5A 5J11B 1U3HA 2AXGA 4MVBC 3X14B 5H35B 1OHQA 2HTKD 1ZMYA 4DGIH 1G0DA 3QR2A 3MRQA 4EOWL 5CGYD 2DLIA 4P5TB 5I73C 1FHGA 1MFAH 5DJZB 4UT9L 1BVLB 4X9IA 3V8OA 1ZLVK 3H9SB 4B7LA 1BZQK 1C5BH 4UBDD 3QUYA 4TRPH 3ZE2E 3RGHA 4HV8B 1J1OL 4LVOC 1LO2H 1WWBX 3MC0A 5DUPH 3QIWB 3QIBB 5E1AB 5D70H 4NCC2 2APXA 4FOMA 1XGRB 3TO4C 4MVBD 4AEEA 5IB1A 5IMLB 4HIEB 3RNKA 5J06A 4Z7QF 1XR9B 3IFPB 4IMKA 4XCEA 3JSSA 2UVFA 1GZQB 4LNVA 2XACC 5GS0L 4OLEA 4P2QE 3CFDB 3GO1L 1CXHA 1CD9B 2ADGA 4MJIE 5LWYH 1ZHBA 5T1LB 5C9JA 5HGAA 4LCUB 3TLRA 1AO7E 2APFA 4U6VL 4RDQF 3VWJB 1L7TH 1PSKH 3MCKA 4TSCL 2ZCKH 2QQKL 1A9BA 3KYAA 4WV1A 4Z7NF 5EPMB 3T77A 1KGCE 4OBRA 1P4LB 3O6KH 4Y4FC 1K85A 3EDDA 1XF2A 5CILH 1K8DA 3TO4D 3O3EB 3TWCH 3B83A 1CDBA 4OJFL 3H7BA 1PQZB 2FWOA 1TTFA 1T2JA 1A6PA 4QXWA 4K9EH 4APQA 3EJYD 3L7EA 5D1ZD 2JB5H 4LSTH 1ZTXH 1AGEB 4JFDA 4K3HA 4OI8A 3AS1A 1VEOA 2Y5TB 1FV1B 4RRPA 3U2SA 2VQUA 3VI3F 3X17A 4XCYA 3L1OL 2YK1L 3LRHA 2AXFB 2CDEA 5EBWA 2A9MH 4PRPD 1FL6B 2V2WB 1YEEH 2BNRB 2EIBA 4YHPA 4M7ZC 4JANB 3CLFH 5DSCB 2NY3B 3PWUA 1QBAA 4MX7B 3S3JA 4J3WA 3U9PH 4DGIL 5L8KB 3IGAB 1MFAL 5INDA 2GEEA 5KSBE 3OKDB 5IBUG 5E4EC 4YH6A 2ICCA 4QRQA 1SJVA 2X9XA 2MCPL 1C5BL 4LSUH 3WNNA 3N85H 1OAQH 4TRPL 2Y4SA 4KRLB 4LCCC 3KNBA 5BCAA 1LO2L 3NCMA 1MFEH 1T5WA 1V8HA 3O2WH 3WO3B 5FOBB 1TVBB 5DUPL 2WBJD 3LQAC 3IKCB 3SBWA 5D70L 1FZMA 4TUJB 3VWKC 1RZ8A 4JJ5B 3STBA 1OTSC 4HMDA 4HUVA 3MLXH 5BXFB 2CJUH 4P3DA 3SY0A 5HDBF 3NFPB 3TVMC 1XAUA 4ZAKD 3WFEH 3QQ9C 5LWYL 3GB7A 2AVGA 5D5ME 4R2GC 4P2CG 1FVDA 1ADQH 3WIFB 1YECH 1HI6B 2P5WB 1SJHA 4XXCC 1L7TL 1PSKL 1SY6A 4NUJA 2ZCKL 1OP5H 2ATPA 2D4FA 4HUUA 5E6ZA 4MSWA 4JZJC 3D69B 1FNHA 3O6KL 3JV4B 5E2JA 5GGQH 2EH8H 5GSRA 5CILL 3L5WB 2AGJH 4NWUH 2Z9TA 1OTSD 4YHLH 1DDHA 5T3XH 3PHOA 3TWCL 5IB4A 1Y6KR 5J1TC 3L3HB 1MQKH 1QEWA 4H8WH 1TVHA 3QULB 1FFOA 5HPMA 2JB5L 1ZTXL 2Y7QB 2VWEC 4NYLB 3DTXB 3KPRD 1JZ7A 3PUCA 4JPVH 4BSWA 4IRSC 2O26U 1Z2KA 4R2GD 4M93B 3UPRB 4Y16A 2R2HA 3ZE2F 4NZTH 1RI8A 4HFWA 1KPRA 2YMXH 5HYQB 2A9ML 4M03A 1AGCB 1LP9A 3V7MA 4Z7OE 2JCCE 1FNFA 2AJVH 2FIRT 2J6EA 1YEEL 3CVIH 1P9MC 2R2BA 3N0PB 1GZPB 3M1BB 4LFHD 1U8IB 3QQ4B 4JLRA 3CLFL 2YUVA 2XTJC 5B38A 3MV11 2VZOA 5DDHB 3U9PL 4OQTA 4Q74A 4BKLB 3PWPA 4IRSD 4UIMB 3LKSA 1KJMB 2H9GB 4MMXC 1G9EA 1KFAH 1I85C 2BK8A 4LSUL 7FABH 1CE6B 2FH8A 1FNGB 3SO5A 4TTGA 3N85L 1OAQL 4JFOA 3GSXA 1II4E 1MCEA 5IB3B 5HDQH 3MV9E 5K9KA 1MFEL 2X05A 3O2WL 5IHZB 3LN4B 1KB9J 4F7MA 1Y6NR 2DQIH 5BRZE 4E42A 1LO5A 3U0PB 1DBAH 1JYVA 3MLUH 4AQ1B 4LCWE 3K8LA 3MRFA 2R9HD 1BPVA 3SDXB 3BN9C 4I9WD 1F6AB 4DK6A 4J3UA 3VXMD 5F1IA 3MLXL 5HVHC 3PL6C 4U31A 2R4RH 2FBOJ 2CJUL 1U8QB 1K3IA 2ZUQC 3WNMA 1IBGH 1I7UB 4JY6B 1ACZA 5C09D 4L4VE 2H2PC 3WFEL 4FG6D 4JRXE 4GKOA 4MA8H 1ADQL 2DDQH 1YECL 2WQ8A 5E7BA 3HCVB 5HD8C 3WUWB 4Q9QH 4NJAH 4TTDC 4GKNB 4JAMB 1BZ7B 3IDYB 5GGQL 2EH8L 4NWUL 4JHAH 4JRYB 5T3XL 4YHLL 5GGVY 2C7UA 1MQKL 5DFVC 4YDIH 4H8WL 4PYHA 3T2OA 5IMKA 4QY8A 2CLRB 1TNMA 3MLRL 5KSBF 1L7IH 1B0GB 1T1WA 5DD0H 4JPVL 2KDGA 2NPLX 4ZO9A 3UEZA 4WHYH 1AHWB 4P3WA 4WW1A 1CCZA 2ZG2A 4HUXA 4YHMH 4WI8A 1CICC 1I3VA 4OF3A 2DIJA 4M1DH 5D7SH 5E5MA 1KIPA 4NZTL 3MRMA 4EJ1C 1UWGH 5CHNA 2YMXL 4X0KA 1SYVA 4WWID 3BPCA 4N0RA 5JA9A 2H2SC 3IF1B 1EVUA 2AJVL 3CVIL 4QTHA 5C0DA 4MXVE 2LVEA 5IEKA 5TH2B 5B3JE 3MFFA 5JR1L 2FRGP 5MEOA 2WUBH 5DFVD 4PY8I 1KTLB 4GXVH 3ES6B 1FAKT 2GJZB 1MCDA 1VADB 2H3NB 3O2VH 1NGZB 3PWVA 3Q0HA 5D5MF 1MVFA 2P5ED 4UT7L 4JGMA 1ZKAA 3KYMB 3JVGA 2KZ1B 5CLWA 5I30H 1G7LB 1KFAL 2F9BT 3VFGH 7FABL 1TIUA 3N1MC 2YUXA 4Y88A 2UVEA 5HDQL 3FQTB 2PYED 5DVOA 3ABZA 4U3HA 1CGUA 4LSVH 1MH5B 2DQIL 2IAMA 3PWJB 3F5WA 1DBAL 2FEDC 2QSTA 3MLUL 4KDWA 3SJVE 5CIPH 4U1KB 5IVNA 4JFHD 4F80A 1R24A 1OARH 1PG7H 2R4RL 5CKGA 3WFCH 1NEUA 1LEIA 2DJ4A 5J13B 4CNIB 5DR5H 5AYUH 3AFLA 5K93A 2DM4A 1OM3H 1Z9SA 4MA8L 3VFRA 4PIRF 3VMPA 5IB2B 4CU8A 1QSFE 4Q9QL 4JDVB 4Z7OF 4NJAL 2JCCF 5FGCE 2Q6WB 5F7KC 1MHEB 3BHBA 4PJGE 2FEDD 1DANU 4YBQD 1UQSA 4IJ3B 4PJ7A 3AREB 2YXFA 2VB5A 4JHAL 3MNZA 3D0LA 3EYOA 1X5HA 3O4LA 1KCVH 2X4OA 3SQOH 1T83C 4DWHA 4YDIL 4Z77A 4DCQA 1UYWH 4Z7VB 5HHNB 5GZOD 1L7IL 1HEZB 2YN5A 4PJXB 5DD0L 2YWZA 5DRZB 4ONGH 5C7XH 3DX9A 2KH2B 3E0GA 5IMMA 5IEHA 3I6LE 3RWGA 1A6AB 5ICYA 4NQXA 1AKJB 2QHRH 4YHML 3PGDB 4Z95H 3H3PL 3IJHB 4M1DL 5D7SL 3BD3A 4JCLA 1H3PH 1UWGL 2EIEA 3QP3A 4OUUA 1MWAA 4S1SH 3MREA 3M17B 1JHKL 2BXYA 1A14H 1EIBA 3CGTA 2A6KA 3UBXG 4JFYA 4PRNA 4R96B 3RIFF 2WUBL 2WQRA 4PLOB 3NZHH 3ARGB 5K33A 2OMNA 5MEND 4GXVL 4YXLL 1AIFA 5E6YA 3DX6A 1FSKB 4M6NH 4HGKC 2WIMA 2CRIA 3O2VL 1F11A 3VXSD 3QIUA 5IVZB 1A6UH 5DQ9A 3VFGL 5C0CB 2DS4A 5KS9A 2ZZUT 3MV7D 4KDTC 3K74B 2X4SA 4U1SA 4BSVB 1CYGA 1EFXD 4LSVL 3LSOB 2ESVD 1WAAE 2OMBA 4OZFB 3FRPA 4NQDE 4V1DB 2ZOKB 4L3EB 3LQAH 4QGYA 1OARL 2BHYA 2XPGB 4MNQA 3WFCL 2K1MA 1Y6MR 5F70A 5JTWA 2CDFA 5DR5L 5AYUL 1M7DB 1QSZA 3VFNB 4YXHH 3LEVL 4M61B 3ISWA 4NFDA 2XFXB 2VTFA 3NA4A 4FXKA 1AH1A 4ZO6A 1NBZA 5DYOB 4ZFFB 5DK2B 2B4CC 2BY3A 5CSGA 1JF6A 2X4RA 4AYFA 8FABA 3CFJB 4E41A 4LIQH 4GLRI 4MXVF 3ZTNH 3B5GA 3I6KB 2K7QA 4OUOA 3TBWB 5B3JF 1IEBB 3DRTA 1IQWH 3ALWA 4YAQA 1KCVL 3REVB 1J0HA 1T3FB 1YEHL 4ZPTB 3SQOL 1UYWL 1OGAA 4MMZC 2AJYL 4MQ7A 5DI8B 2H6PB 2NZIA 3DNKA 1T20A 1JHTA 3ARDD 4R4FH 3QDGA 4N1EA 3RNQA 3HUJE 4ONGL 5C7XL 4K07A 2GFBB 3BEWB 4KK5D 2QHRL 3WCYA 1FZKB 3X14A 3OL2A 3KHOA 1D6VH 5H35A 3RY6A 1H3PL 2VERN 5BVPH 4P5TA 4QHKI 1MAKA 5DJZA 4S1SL 1XCQA 1BVLA 1A14L 1CIDA 3QXTA 2DYPB 4ETQA 2HFFB 4HWBL 4DKFH 2GK2A 2CKBH 4N9OB 5HYEA 1I1AD 1NGWA 4HV8A 1ZLWK 1NC2B 5I73B 2VOTA 1IGFH 4FFVD 1U8NB 4M6NL 5HY9B 4JPKH 1J1XH 4HKZB 3QIWA 3QIBA 2OJEB 4OFYA 3O8XC 4HPOH 2VISB 1QYGH 5DQJA 3W0WB 1XGRA 1CLOH 1A6UL 2HT4C 5IMLA 4HIEA 4XVTH 2FB4L 1KLUA 5AUMB 1XR9A 5F7UA 5CIPB 2B20A 1TZHB 1GZQA 4MA1C 4O2CB 4PJGF 3WLBB 3CFDA 3EO0B 1J0YA 3T1FA 3TO4B 3DO3A 4RWYL 5DUMH 5T1LA 5BOPA 4K3DH 4LCUA 4KTYA 5TDNB 1VSCA 4D8PB 5F1KC 4J4PA 3VWJA 3JV5A 3LQAL 5SWZB 3QUXD 1S9KC 4UILL 4C54A 2AK4B 4XXDA 4Y4KD 2VLRD 3GMNB 3P0VH 4FS0A 5AZEH 5JLZB 1P4LA 1ODAA 1A1OB 4ODBD 5FV1L 3JXAA 5L2KA 3O3EA 2NXZC 4FQLH 5CZKA 2IPKB 4JM2C 3LS5H 3VGAC 1PQZA 5D96C 3O3UN 4PYGA 4A2LA 5HJ3B 1A2YB 2W1NA 1G6VK 4Y4FB 1AGEA 2X5PA 4LIQL 3EOYG 1NCUA 2IBZX 3SEPA 3UCRA 2Y5TA 1X5LA 5L0QC 2VZUA 1LK2A 4UNVA 2AXFA 2DIAA 4R4FL 4NO0D 3WFHB 2BNRA 4D0CB 4XZUB 1E4JA 4JANA 1Q0YH 3DECA 5DSCA 1HZHH 4F58H 2LVCA 4F15C 4MX7A 2VITB 4XPHH 1A7QH 3RDTC 4BZYA 1D6VL 3NCYS 2XNAB 3QEQE 5BVPL 1ZVSB 1MSPA 2I9LB 1CDJA 3OKDA 1WAAF 1XF1A 1TENA 4H0IA 4DKFL 1NH6A 2CKBL 1KOAA 5GRYA 3OMZA 2VAJA 2FL5A 1A7OH 1WC7A 1EFQA 1C8PA 3MJ6A 5ADPH 1JI1A 3OB8A 5I76A 4GXUN 4ODXB 5E4EB 3KPPA 3MRLA 4LPCA 3UO1H 4JPKL 1J1XL 1TVBA 2HG5B 1KLFA 3ARFA 3FO2B 3PWLB 5FOBA 3IKCA 5D6CB 3IS0X 1UACL 3QG7H 4HPOL 1Q9LB 1QYGL 1LE5B 4FXGB 1CLOL 3RDTD 4XVTL 4LCCB 4G9DB 5BXFA 3RKPA 5IW6B 1HSAA 2CGRH 1I7TB 1EO7A 1CTNA 2BVTA 1F4WH 2OZ4A 3REWB 5DJCB 5ANME 5DUML 1MCRA 4DQOH 4K3DL 3RTQC 3WIFA 1HI6A 4BH7B 2P5WA 3A67H 3GSNH 4U33A 4IOFC 4QLRA 3KPRB 1RUMH 2ZJSH 3OJ2C 1BX2A 4WRLA 3P0VL 3HUJF 3D69A 5AZEL 4R2GB 3JV4A 1C12A 5GRZA 4MB4A 3V0VB 3L5WA 4FQLL 1AXSB 5HHVH 4CDGC 1OY3B 4KKLD 2HT3C 3L3HA 5FA4A 4AMKH 3EBAA 5ACZB 5MHSE 4XPFH 5H94B 4NYLA 1FPTH 3I85A 1CN4A 3E1F1 4I48A 1A21A 3UPRA 3RTQD 4XWGL 1MCFA 2NY0D 1KUMA 1F6LL 4NT6B 1MFNA 4IOFD 4IRSB 3TH3T 2N56A 3KJ4C 2J2ZA 1VEMA 4NQTA 1ZSDB 1Q0YL 5KVGH 5E7FA 3QNXB 1HHJB 4XPHL 1A7QL 2CKBB 4WWKC 5JHLL 3ARYA 4EEEA 4BKLA 4K3JH 3MRPB 4UIMA 2MCG1 3P73B 1QZ1A 3MRBB 1WIUA 2HT2C 2VE6B 1KJMA 2H9GA 2YUWA 4Q6IC 4YFDB 1BQUA 3LN9A 4C4KO 1CE6A 4OTXH 1P69B 1FDLH 1VFUA 1RFDH 4J3OC 5IB3A 2VDKH 3MLYH 2PETA 3UTSA 4K7PX 5C09B 4RGNE 3LN4A 1MAJA 3UO1L 4OV5A 1AD9B 5JDSB 2OS7A 3U0PA 5IHLB 3G9VA 2D2OA 3QG7L 3BP5B 3BISA 4NOBA 3VXTB 3SDXA 5DC9B 1F6AA 4Y8AA 4W6XB 2NR6D 1LO3H 1U8QA 3WDIA 4NHCH 5DT1H 1O7VA 4PP1C 5HHOD 4P59L 4AENA 3B9EA 5C0JB 1I7UA 2CGRL 4J7RA 4JY6A 4LCIH 4OLZH 3NOIA 3G6JB 1N6UA 3WKMH 4OCRL 5HVHB 3QB7C 4DQOL 1T2QH 3D2UB 3QQNA 3HCVA 4EVNB 2ZUQB 3U0WH 3A67L 4B53A 3GSNL 3WUWA 5HGDB 1KTRL 3WMSA 3LV3B 4JFFE 2PXYC 1RUML 2ZJSL 4NM8H 4GKNA 3ESVF 1BZ7A 4JAMA 3HAEH 5ISZE 4L29A 5EB9A 5D7LD 4JRYA 1UM6H 5HHVL 4QRSA 3DIFA 4AMKL 3J8F7 4NZUH 4OCWL 3VRJB 2CLRA 4XPFL 4P5KB 3QUZA 3VXQB 1B0GA 1FPTL 3VDBA 2B4CH 1UA6H 4I0KA 4UINL 1AQKH 3SE3C 1AHWA 4WO4D 1PD6A 1UVQB 2YN3A 5EU3B 4QO1A 1G7HA 4ODVH 4NWTH 4XVJH 2FNBA 4U1HA 3G5VA 3KS0H 2BSTB 1G84A 1EHLH 1IAOB 2P5EB 3EYSH 3IF1A 4R0LB 3NAAH 4PJIE 5FXCH 4I77H 5HI4D 5TH2A 3T0WA 5KVGL 3BH8B 2RFXB 3T3ME 4L5FH 1KTLA 3QNZB 4MYWB 4NCDA 2PYEB 2GJZA 1QFHA 1VADA 2XWJB 4ONHA 4K3JL 3E3QE 2H3NA 1CXFA 1QFOA 1B6DA 1NGZA 4X99B 2DMCA 1ZVYA 3KYMA 4O58H 5A2FA 1KJ3H 4UIKH 4FFZH 1G7LA 3QWRA 4IDLA 4OTXL 3MRRB 3QXVA 1FDLL 1HQRB 1RFDL 1MCLA 4X6CB 3V6ZB 4EXPX 3MLYL 1XF3B 2VDKL 3WIHA 4F33B 3V5KB 2DJSA 5EU5B 1X5YA 3ARUA 1MH5A 2CXKA 3PWJA 4PJDB 5IFJA 4JQVA 4P2OD 5DO2D 1LO3L 1ADQA 4GAGH 4NHCL 4QHNB 2E7HA 4ZUTB 2C1PB 3GSNB 3VG0H 2ILLA 1PKQB 1BOYA 2Y9RT 4OLZL 2C3XA 3N1FC 3WKML 5J1SC 3IDUA 3ZT7A 3DXAD 3D3VD 2IMMA 3CAFA 1T2QL 4Z78B 3U0WL 4BUGA 1HN1A 4PJFB 3CLEH 2WAHA 5CSBA 2E7LC 1K4DA 4NM8L 2Q6WA 3ALPA 3I3BA 3UROR 1MHEA 4GAYB 3VU2A 4XX1E 2ZSWB 2YUZA 3MBED 1UM6L 4U1NA 1WGOA 2Z8RA 2B39A 1Z9MA 3T1WA 4PJCB 4Z7VA 4NZUL 5HHNA 4KKCC 4PJXA 4U1MA 5FGBA 1MCOH 5DRZA 4EIGB 2B4CL 1UA6L 3MV01 1AQKL 2WMPA 2DTMH 3DI3B 4HAFA 1A6AA 1AKJA 2GY7B 5MENB 1UG9A 3PGDA 5C0AD 1A02N 3IJHA 4PJAB 4ODVL 1QFWI 4NWTL 3BOVA 4XVJL 4OIIH 5GS1B 5KSVA 2ERJB 3VXSB 3EAKA 1EHLL 1VGKB 3M17A 3D48R 5DC0A 1QKZH 3EYSL 3V5DB 3NAAL 4I77L 4BH8B 1R3IH 4H88H 1CFNB 4R96A 4M7LH 4OD2A 4L5FL 6CGTA 3MV7B 4CDHA 1W2KT 4QRRE 5SX5K 5JO5B 1EFXB 2F58H 4QRPD 4NZDA 4NKDB 4JKPH 3IXTB 1TQBB 5EIIB 4O58L 2GJ6D 4H5SB 4UIKL 1K2DB 5DJDB 5D7JD 3QO0B 1T2XA 1WCBB 1QSVA 5C0CA 5JNYA 4ZUWB 5FAAA 3QPQC 3S36H 3KPLB 4HSQA 5LQBH 3THMH 3BRGC 5FM8A 4HG4K 3LSOA 4CN4A 1A1NB 3W9EB 3IXAB 1I3RB 1J8HE 4RMTA 4V1DA 2ZOKA 1ZLUK 1INDH 2XPGA 4GAGL 2DMBA 1A8JH 2MSPA 3VG0L 5TE7H 4Z7WE 2BVOB 1M7DA 1MCHA 1J18A 3VFNA 2XIDA 4M61A 2D3VA 3HAEB 2XFXA 5FYJD 1MCWM 43CAB 4ZFFA 5DK2A 5GPRA 3KXFE 3CLEL 5E6ID 4CBPA 2VN4A 3CFJA 4TYUA 5E00B 3ARDB 3FT3B 4PJIF 3FL7A 2H45A 3I6KA 3TBWA 5D7IE 5EO9A 1PEZA 2EYSB 4PBVC 3T3MF 3REVA 4LDLB 1T3FA 4ZPTA 1EX0A 1ZHKB 2C5DC 3ZKMC 4YE4H 1JZ6A 5DI8A 2H6PA 1ROWA 2VDML 1KN4H 5EOQH 2DTML 2GFBA 2XWBB 3BEWA 3MA9H 2P7TB 3BKCH 3MUY1 1WV7T 5CP3A 4OIIL 1GVIA 4LEXH 4YDLC 4FQJH 4PRHE 3K2MC 3P3YA 4CN1A 3TNMB 3RWDB 3ULUC 5DHXB 1QKZL 4H26A 3BXNB 1BECA 2DYPA 2BCKB 2HFFA 4PJ9C 4WHTA 2WLZA 1R3IL 4H88L 1PDKA 5F44A 1JTTA 4AEFA 4QHMB 3ZKMD 3FZUC 4G43A 1NC2A 4P2QD 4BA8A 1U8NA 4MJID 2OI9C 5HY9A 3VGEA 2F58L 4HKZA 4JREC 5F3BB 4FQXD 2A73A 2I9TA 1FL5B 4JKPL 2VISA 1AO7D 4EUPA 1E4KC 1KN2H 3H42L 4U0QB 1M71B 3W0WA 2IGFH 3QUXB 5CIPA 5E9DE 4QXUH 5EG6C 4Y4KB 4JM4H 2VLRB 1TZHA 4NRZA 1KGCD 4O2CA 3F7YA 2GUOA 3O8XB 3OR7B 3WLBA 3ARVA 1S7TB 2DQJH 3EO0A 3THML 3HG1E 4PB9H 3TO4A 1JI2A 3EUUA 4ZSOE 3UTPE 5TDNA 3S9DB 4D8PA 3OGOE 2YD5A 4N68A 5HVFB 3FZUD 5SWZA 4PFEA 1F42A 3GBLA 1INDL 4LLYB 2AK4A 4RAUB 4IRJC 3GHEH 3GMNA 1RU9H 5TE7L 3V8CA 5EZLA 1YY9C 4HMEA 1A1OA 1MHCA 4H1LA 3MO1B 2IADB 1X4YA 1IC7H 3RX8A 2IPKA 1UJTA 1RPQA 5HJ3A 1A2YA 4URTB 4KUCD 3FB6B 4FQCH 1ND0A 2ADFH 3Q5TA 4Y4FA 1RZIB 1FYTA 1S5HB 4N8PA 3RL1A 1B90A 1IGYB 1XH3B 5IT2H 5CBAA 4DZ8B 4NO0B 1LE9B 4XP4H 4JM2B 5SWQB 3VGAB 2PNDA 5D96B 1RY7B 2XG4A 1ZT1B 1NQBA 2O5ZH 2FJGB 3S4SG 5IBUB 2P4AB 2QV2A 4YE4L 3E6HB 5CEZE 4X5XB 5L0QB 3QT2A 1KN4L 4PLKD 3WFHA 4D0CA 4XZUA 5EOQL 1BVZA 3MA9L 4KY1H 2VITA 1F4XH 3B2UD 1ZLVH 1U91B 1T6WA 1MI5B 2XNAA 3HE7C 4LEXL 1ZVSA 4FQJL 4DEPB 4PJ8C 1NGXB 2XG5A 1D5BB 1MRDH 4DKDC 2CXGA 4AH2B 4F15B 3RDTB 4PLJC 3MZTA 8CGTA 2NY1C 2NTFB 4TQEH 2V2TA 5LJYH 3MOAH 4EZMA 4Z7WF 4ODXA 5IM7B 2HG5A 5F97E 3PWLA 3GMOB 4RGMB 5D6CA 3QHZH 1E6OH 1FNSH 1FC2D 5DJXB 1C08A 1KN2L 1LE5A 5T1KD 3QDJD 4X8JB 2J8HA 4RX4A 1KIRB 4LCCA 2IGFL 3WFDL 4G9DA 4ODTH 3KWWB 3ROLB 4KKAC 4QXUL 3HE7D 5JDJA 1EPFA 4AM0B 1I7TA 2DQJL 3REWA 5D7IF 4PB9L 1IC4L 4CVUA 35C8H 1ZHNB 1MELA 2EKJA 3QG6B 5FDWB 1I1RA 4ZFGH 4BH7A 1KENH 1S7UB 5JPMB 2DL9A 3OGCB 4G6AC 5C07A 3SGJC 4Z0BH 3GMPA 1IL1B 1HHGB 4ZYKB 4ZFOL 4K23L 3KPRA 3NACH 1F45A 2IQ9H 2B8OT 3S37X 2BNQB 3GHEL 1RU9L 4X5WB 3V0VA 3WSQH 3RTQB 2IG2L 3ILPA 2NY0B 4KWUA 4XXCA 1AXSA 1A6ZA 4S0SD 2DI9A 3BP7B 3M45A 4PGZA 5J3HD 5IBTH 4FQCL 4JZJA 2ADFL 1FYHB 5H94A 4F9LC 1XGQB 5C0BE 5IT2L 1JPST 1N5YH 4NQCE 4XP4L 4IEFB 1RZGB 1G7MB 2FO1A 5HI5D 2BMKB 2Q1EA 4NT6A 4G6AD 4XC3L 2VLLB 2CUMA 2O5ZL 4CMHC 5I16B 3DV6B 1LD9B 4IRSA 4ZOCA 1H15B 4KRPC 3V0AC 3VFWB 1JWMB 5M94B 1ZSDA 4GUPB 4NN7B 4HJGB 3QNXA 1HHJA 3L3GB 3MV9D 4KY1L 4RBPK 1F4XL 2CKBA 1HKFA 1I7RB 3I3DA 2AQ1A 3KJ4B 4R4NC 5E5RB 3MRPA 5BRZD 4BQ9A 2CMRH 1P9MA 3P73A 2VE6A 3K81A 4LCWD 3RVVD 3U82B 1MRDL 2NQCA 3NZ8A 2I07B 4HFUH 1BM3H 1L4IA 2IANE 4IDJH 2V6HA 5HHOB 2OBGA 4WIQA 4TQEL 3VDAA 4L4VD 3D87B 5C09A 3U46A 4DK3A 4JRXD 4E5XB 1AD9A 5JDSA 3QHZL 1E6OL 1I85A 1LO4H 1Q9OA 1FNSL 3VRIB 1AGDB 1J05B 1QPPA 3BP5A 3VXTA 3AXLB 3M8OL 4ODTL 1EEZB 4ZG1A 4R4ND 12E8L 2X9YA 4LPTA 4ZFOB 3S97C 2APVA 3P9MB 3G6JA 5D7LB 3LHPH 4HEME 3D2UA 4ZFGL 4EVNA 1KENL 4R8WL 5EOCH 5HGDA 4Z0BL 3BPLC 4HS8H 2Y1VA 2XXMB 3NACL 4YXKH 5BO1H 2IQ9L 1CFSB 1ZVHA 1DQDH 2NYYC 4FQIL 1NUFA 4R4BA 3BGMB 3WSQL 4WO4B 3DROB 3T4YA 3BIAX 3MJ7B 1QUNA 4L9LC 1U2CA 4KJQD 3L3KB 5HDOA 2PXYB 3IDGB 1UCBH 3VRJA 3H6JA 4TVPE 4P5KA 2YOCA 3TZVD 3VXQA 1N5YL 5FO7A 5E1HB 1N59B 1P7QD 5KZCD 2IBZY 1UVQA 1S5IL 2C26A 3MSPA 2H8PB 5EU3A 1FZOB 1NGYB 4ESKA 2NY2D 1ZXQA 4KROC 4PJ5E 4UNUA 2YD3A 2NYYD 2BSTA 1IAOA 1H8SA 4U1LA 4R0LA 3LPWA 2VMFA 4NOFA 2JK5B 3BH8A 3EFDH 3BKJH 2RFXA 1U8KB 3RVTD 3OF6A 3P11H 1OTUC 3RHWK 2VUYA 3QNZA 1T7ZA 4XNZC 5E8NB 5BJTB 1A5FH 1I75A 2XWJA 4HQQL 4LMQE 2CMRL 3DGCR 4LSPH 4MNGE 2Q86B 3T8XB 2PYFB 4KI5E 4PJHB 2FATH 5D1XC 1OWRM 2CUIA 3QRFM 1SVCP 1BM3L 4IDJL 1RAMA 2XKNB 4KROD 4AJ0A 3ULUH 2YBRA 2ZCLH 4Z6AT 3V6ZA 1XF3A 2GITB 1VFBB 3V5KA 1I7ZB 5EU5A 2QKIB 4PBXA 3O45B 3F6IA 4JQXC 1BIHA 3D3VB 5JW3H 1IAIM 2ORBH 4WHDA 1QSFD 2FZ3B 3Q5YA 1BOGB 4ZUTA 2C1PA 3BP6B 1PKQA 5J4MA 1BFSA 2DBLL 5FYJL 3SKUD 1PYWB 2AEWA 3HPLB 3LHPL 2Z92A 3MBEB 3B9KC 4XX1G 2FX8H 4Z78A 1U92B 1BWWA 4NBXB 5ABDE 5EOCL 4PJFA 1EAPA 4HS8L 1Z3GH 2AJSH 5C3LD 4YXKL 2B5IC 1DQDL 3I6LD 1ZA3B 1CXIA 2ZSWA 4JFEE 3HE6C 2MNUA 3VXUE 5C0AB 1BF2A 3T0EE 1QHOA 4X6EB 1FL3B 1N8ZB 3UYOD 5DRWB 5EZOH 1D9KC 4M62H 3LPGA 3QEUB 3UBXB 2MQCA 1C16B 4ODWB 2CLVB 2V9QA 5E8DH 4QCIB 15C8H 5E99H 3FOLB 5F1OB 1IAIH 1T83A 3D0VA 3IS1X 3SGEH 5MENA 3PDOB 3BEVB 4W4NA 5GGTH 4UT6H 2ID5A 4QRPB 2HLFC 3VXSA 1F3DJ 2V2XB 4D9QE 1VGKA 3DVNB 2G60H 1RJZA 1Q1JH 1TMCB 1R5VB 3V5DA 4NC2B 4YLQT 1RD6A 3HE6D 4J1UB 5D7JB 1GGUA 1T1XA 3EFDL 3BKJL 4L4TE 1XF4A 1HXMA 3P11L 3MV7A 1D9KD 4X7TB 3CXHJ 3G5XB 5DZOA 1A5FL 4OGYH 1EFXA 5F7FA 3TV3H 3CU7A 4NKDA 4LSPL 1S7XB 2AEPH 3IKKA 3IXTA 5DRXB 4NQDD 5EIIA 3MGTA 4H5SA 2FATL 2VZ1A 1K2DA 5DJDA 3QO0A 4MQXD 3SCMD 4U49A 1NCNA 4ZOBA 1QA9B 2OP4H 1G1YA 3ULUL 2CSPA 1J0JA 4ZUWA 2ZCLL 4I2XB 4UDUB 2XT1B 5BV7C 3OKLA 4ORZC 5D2NE 4ISVB 3KPLA 1QACA 4K7PY 3D6GA 1A1NA 3W9EA 3IXAA 1I3RA 4WUUE 5JW3L 2ORBL 4D9LH 2VL4A 5F7EH 5E6IB 3DARA 3QJFB 3FCTB 3H8NA 4G8GB 2VLJE 1AGBB 5AEAA 2WWKT 2BVOA 4LBEB 5DMYA 3MCLH 4XI5C 2FX8L 5JHDA 5LAXB 1Z3GL 2AJSL 4N0UB 3FT3A 2BY1A 5HYJB 3SDDC 3V95A 2NX5B 1YDPB 4EDXB 2EYSA 4X5LA 4LOUC 3HC3H 3FTGB 1S9VB 1VACB 5IESH 3QXUA 3HLAB 1P4IH 1ZHKA 4M62L 1YNLH 4MA3B 3EYUH 4KI5F 5E8DL 4WGWB 4HGWB 15C8L 1MCNA 5E99L 1P1ZB 2P7TA 4FQQB 4YHIB 2XZQH 2ADJA 2F15A 2VDNH 4KUZH 2A6JB 5GGTL 1RZKH 4NO5B 4UT6L 3STZB 2X1QA 4M7JH 1OSPL 4FQXB 3IFNH 4R97C 4UV7H 3C6SB 3UZVB 2X1WL 3RWDA 3TNMA 1A7PH 1GC1H 2G60L 1Q1JL 4ZQKB 4LOUD 5EZIH 2CPCA 2VZ3A 4WV1C 4KTDH 4P57B 4PY8J 4N0CD 2VR9A 1QLFB 4OGYL 5MERB 3TV3L 1YEJH 3SE8H 1UB6B 2E6JA 1FL5A 4APQC 2AEPL 3C6LC 1EVTC 5D71H 5D93C 1M71A 1ZLSH 1D3CA 2OP4L 4OCNC 2LV4A 1U36A 5C3TA 3S8WA 3O8XA 1S7TA 1FIEA 4FABH 4M5ZH 1DLFH 4MAYC 1WWCA 3IFLH 3B5TA 4WNQA 2Q87A 4D9LL 5F7EL 1EK3A 4LLYA 4UAOC 4RAUA 2D7PA 5INCB 1O7SA 3VFPA 1WFTA 1I1CA 3QISA 3MO1A 2IADA 1JTOA 4X8XA 4M6AA 3S5LB 4G8FB 3MCLL 1VGEH 3MRKB 1AXTH 4IRJB 3JV6B 3CXDH 3FB6A 3EYQC 1RZIA 4OGAD 2P1YA 1IGYA 1XH3A 4DZ8A 1MAML 2QBWA 4NO0A 2DL2A 1BEYL 4JM2A 4MAYD 3OAYK 5SWQA 2AERT 2ENSA 3VD4A 3HC3L 3U1SH 1ZT1A 3SDAC 1F97A 4BK5A 5IESL 1EO5A 2DLHA 2IH1B 1P4IL 3H2WA 3QEQD 2FJGA 2EE9A 3EOAB 4KK6D 4RMQA 1YNLL 3E6HA 1I8IA 3LY6A 2LU7A 2R69H 4X5XA 5GRVK 2GTWB 3EYUL 4QOKA 5DZLA 3D1MC 2GIYA 1JN6B 5GGVH 3H9YA 4YNYB 3QA3B 2V5RA 2XZQL 2VDNL 1U91A 4KUZL 4V2BA 1DEEB 1T7VA 1RZKL 1MI5A 1MUJB 5EUKA 3FQXB 1NGXA 3IFNL 4YO0B 1D5BA 1A7PL 1GC1L 4MJ4A 4AH2A 4XP9H 3QDJB 4KTEH 5EZIL 3RDTA 4J3TA 1SQ2N 4KTDL 4OFKA 3HE7B 2NTFA 1S7QB 3LKNB 4PJ8B 1AY1H 3N1PC 5IM7A 4JFQB 1YEJL 3SE8L 1XT5A 3GMOA 4AK1A 4KH2A 5DJXA 2RIKA 4ERSH 2KL6A 5D71L 3NTCH 2JELH 4X8JA 1KIRA 5SV3A 3KWWA 1ZLSL 1C5DB 3ROLA 1ZEAH 4NNXB 1RJCA 4FQPA 2XKUA 1NKRA 3D18B 5DJ0A 3EDJA 5I66A 1C7TA 3NVQA 4FABL 3GJFK 2DJUA 3RX5A 4M5ZL 1DLFL 1ZHNA 2X4QB 3IU3B 1A1MB 3IFLL 3QG6A 1DANT 5MHSD 4Q6YA 1S7UA 3OGCA 4OFPA 3WFZA 1IL1A 1HHGA 3KYOA 2JCCB 4ZYKA 1CLZH 1MIMH 2AK1L 1HH9B 4DOHE 3F12B 4PJEA 2BNQA 4YC2C 1G7QB 4H0HB 1Q94A 4OI7A 4YZFE 2DOCA 4X5WA 4OZIE 3IDNB 1AFVH 3RTQA 5DTFA 3B43A 2HVKB 4LPUA 3FKUS 1VEPA 3CH1B 3CMOH 1VGEL 5FKAB 1BZ9A 3BP7A 5K9QI 1AXTL 1E4XH 2VR4A 1VB9A 3CXDL 3CFKA 1T7YA 4RGNC 1B2WH 1LP9E 2QR0B 4R90H 2Y72A 4BFBD 2QQNH 1RZGA 1OPGH 5JIPA 2BMKA 4NRXB 3MV9B 3U1SL 2VLLA 5FKPB 1TZIB 5I16A 3U4BH 1Z0NA 3DV6A 1LD9A 1K5NA 5CBEA 5BRZB 3PWPE 1IAMA 2R69L 4KJPC 2VL5B 4PD4J 1JWMA 1GOGA 4GUPA 3QFJE 4CMHB 4UDTB 4HJGA 1IEHA 1J1PH 2C4FT 5GGVL 3HFMH 4RGND 1I7RA 3QFDB 4JRXB 5JZ7D 2FSEB 1IM3B 2IFFL 4XP9L 1BAFL 4KTEL 2I07A 4AEIH 4WWKA 3MRNB 3NH7H 4QXTB 2ICWJ 2XQYG 1OP3K 1DCLA 1AY1L 3SE4C 4CVXB 4KJPD 4Q6IA 1C1EH 4E5XA 3MGAA 2LAGB 1TTUA 1M7IA 4JPWH 3VRIA 1AGDA 1J05A 3BSZH 4ERSL 3NTCL 1YMHB 3FQRA 2BJMH 2ITDB 4JFFD 1EEZA 3EJZC 4DVRH 5ISZD 2E27H 2VQ1B 4KJYB 1JPTH 4ZFOA 4NIKB 1PG7X 4ZXBC 5BV7H 4XC1H 3L3OB 4KJWC 5BVJB 3HR6A 3L6FA 3I50H 1G6RH 3F6LA 3NCYP 3VMOA 2DQUH 2BERA 1UZ8B 2BSRB 2OTWA 4P48A 1CLZL 1MIML 3RWIB 3TZVB 4GXUM 4RA0C 2DQTH 1CFSA 1QHPA 1VFAB 1P7QB 5EBLB 3BGMA 4Y5VC 3TCXA 5GZNC 5B21A 4F37K 1G9MC 3DBXB 1AFVL 4G42A 2A6IB 5KVEH 1S7RA 3WDHA 4LPYA 3EJJX 4RGOH 2VO5A 2GK0B 3BPLB 3CMOL 3L3KA 1JJUA 2PXYA 3IDGA 5F9JB 4U1IB 1E4XL 5F93C 3WXVH 4F8QA 5DD5H 3V52H 4O2EB 3E2HB 4R90L 4KJWD 1IM9D 1N59A 2QQNL 4L9LB 4UOW0 1XCTB 2AS5M 2NY7H 3HMWH 1Q9WB 2H8PA 3BIBX 4KQ4H 4R7NA 1FZOA 4P2RE 1NGYA 3SDCD 1YMMA 3U4BL 3WS3B 1FN4A 4LL9A 2R0KH 4CJ0A 4HS6B 4I0PC 3SE3A 4MGXA 3A6OA 1T66D 3UTTE 2G9HA 2JK5A 5D72H 4KROB 1X5KA 1J1PL 4AY0A 4NGHL 3RVUC 3QDMA 3HFML 2IEPA 5E8NA 2NZ9C 5BJTA 4PGCB 5TFSH 4OCSH 5F1SA 2X2YA 2Q86A 3T8XA 1NC4D 1FJ1B 2PYFA 4PJHA 3PGCB 4XRCA 1A4KB 3V6BR 4AEIL 5GJSL 4XNZB 3QEHB 4TSBL 5JW4N 3NH7L 5FGCB 3O6MH 3LZFH 2Z31C 2GITA 1VFBA 4I3SH 1I7ZA 2QKIA 4YZFF 4OZIF 3MV8D 1C1EL 3O45A 3QRGH 5K9JH 4JPWL 3D3VA 6FABH 2BJML 2FZ3A 3RVUD 1U3ZA 5IKCB