1KTRL

Crystal structure of the anti-his tag antibody 3d5 single-chain fragment (scfv) in complex with a oligohistidine peptide
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
247
structure length
229
Chain Sequence
DILMTQTPSSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPFTFGSGTKLEIKRGGQVQLQQSGPEDVKPGASVKISCKASGYTFTDYYMNWVKQSPGKGLEWIGDINPNNGGTSYNQKFKGRATLTVDKSSSTAYMELRSLTSEDSSVYYCESQSGAYWGQGTTVTVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the anti-His tag antibody 3D5 single-chain fragment complexed to its antigen.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Anti-his tag antibody 3d5 variable light chain, Peptide link
total genus 61
structure length 229
sequence length 247
ec nomenclature
pdb deposition date 2002-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ktrL00
4HUXA 4ZPVA 1GAFH 3JTTB 3LPGA 3DRTA 4PJ9C 1TZHA 5KSVB 2WUBH 1BGXL 4TTDC 2ARJB 1NCNA 5GIRB 1AY1H 5L8KB 5T1KB 4M7JH 1F4AA 1IFHH 2XPGB 1WBZB 1NC2A 3S37H 3VCLB 5TF1H 1T66D 2BDNL 1G7JB 4LL9A 3EOTL 3BO8A 2HT3C 3LKPA 4L4TE 3WBDA 3ULUF 4P23D 5EO0A 5IP4A 4MB4A 1HQ4A 2BX5A 2DD8L 2FX8H 3C6LB 3BZEB 5EA0L 3MUY1 3CMOH 4WW2A 3BP7B 4MMXC 3QBTB 1T5WA 2DJUA 1BD2B 2ICWI 5D7LD 2YMXH 3NPSB 4MNGB 4LSVH 3HZMB 4WI4A 5IBLD 5K9KA 4WCYH 5C1MB 4ODBD 3KJ6L 4K9EH 2ATPA 3IJHB 1MOEA 1NCUA 3PV6B 1J8HE 2MHAA 3MV7D 4EVNA 2ADFL 4U1IB 4XHJD 2BNQB 2ED7A 4OSUH 4LLVB 1T20A 4TPRH 2QADB 3ZYJA 4OTXH 1WCQA 3IXAB 2DBLH 4J3OC 5LAXB 4CMMA 4EXPX 5KAQF 1JTOA 1SY6A 1ERNA 4X6FB 1ORQB 5D7IA 4O2CA 1F3RB 4XNQA 3VFNA 3CDGA 3T0XA 1NUDA 3C5JB 1SQ2N 2F8OA 5JHDD 2NZIA 2BRRL 1C1EH 3IAQA 1W72A 1XF4B 1G6RA 3ET9F 1CFNB 4GT7A 2NXYB 4FQHA 4ENEC 1GC1C 1QSED 4J4PD 4HS3B 3BGFC 5F7HA 3FO2B 3W5NA 1WLHA 2VDNH 1FAIL 5GGUB 1I9EA 1KC5L 1RZFL 4QHNB 3NGBB 4I0PC 4F9PA 4NM8L 3U36A 3A67L 2H26A 5B8CB 5HHOD 3DUUB 1XGRA 4JLRA 1NCCL 4OIAA 4OGAC 1MAJA 3IJSB 3QIUD 1DE4A 2FECI 4JFDB 1UVQB 5JW4M 3IKKA 5IVZA 1NFDF 3G6JE 1G0DA 4KV5F 3FO0H 4JDTL 3QUKA 1T89A 1Z3GH 3FQTB 5EN2A 1BFTA 3SDYH 1LO3L 4KQ4H 3H42L 5C08A 4ONOA 2AK4A 2GJZB 3DURA 1FBIH 5H37G 1NCTA 1ZHNA 1J1XH 4MQ7A 1I1AD 1J87A 1NFIA 1JGUL 2MCPH 1RVFH 3HHRB 4PGDA 2VDLL 4MMZC 4HWBH 4RZCA 2NTSP 4Y1AB 4LOUD 4PJ8A 2VQ1B 4XNMB 4LVHC 1FG2B 4OFDA 3HLAB 4CVUA 1NMBL 1X5ZA 4L3CB 1JF1B 4GFTB 4NKOA 3ZYOA 3MREB 3O11A 4CU6A 3LMJH 2VIRB 2FX9L 4AYFA 5DRZA 1YNLH 5J11C 3BP6A 5KOMC 3V79C 4DGIH 1NCDL 3AS2A 3BUTA 4Q2ZA 2P8LB 4LLUA 3QXVA 4M4PA 3QDGE 4Z6AT 2Y7QA 3DX8A 1DQLH 4KUCD 4Y19B 1QO3B 3F7QA 1I1AB 3MRFA 1VB9A 2AW2A 3GMRB 4I3RH 3MNZB 1M7IA 2ZUXA 4QEGA 3NFSL 4NO0B 3UJTL 1T89C 1FZJA 1HOCA 5I66B 3IU4H 1MCPH 3LRSA 5ISZA 4CVXA 1IC7L 1OF2A 4ETYA 3F6IA 3I02A 5CSZA 3FCTA 4PR5A 1T6WA 4BKLA 3T3PE 2NY3D 1JYXA 1Q0YH 3KNBB 2EC9T 5BOZG 5JA9A 2QSQA 4P9ML 4O4YH 3RUGA 3BDBA 4U6VL 4WU7B 3PNWB 3PWUB 4OZIA 1R3JB 1HINL 4GMSH 4HIJB 3QI9A 1DN0A 3EFFA 4JN2A 1KBGH 5IJKC 3BX7C 1A1MB 4AL8H 3TZVB 3B8YA 3ILQD 1CGSH 1P84K 1IT9L 3RZCD 4OF5A 2E7HA 4HSQA 4WUUE 3I50H 4WU5B 4RNRB 4PJXA 1G7LB 43CAA 2CR6A 2ED8A 3P9WB 2IQ9H 3R8BB 5GGTH 4I2XA 4MD5B 1I3VA 1EFQA 1SVZA 1PLGL 4NN5C 3H9SB 2FHCA 4XAKD 3RTQC 2IALB 4OD2B 2APFA 3PXHA 3K2UH 5JQ6L 1FAKT 1HE7A 4GRLC 3BDYH 3H3PL 5EBWB 1CBVL 3BN9C 4GG6E 3TA3A 3M8OL 3MXWL 3OKNA 5HVHC 1GH7A 1I9JH 1EZVY 1XGYH 3EYUL 1S7QB 1XCQA 2W65A 4RMSA 2P24A 3R1GL 2D03H 3OTTA 1F5WA 3ZKMD 1RZFH 4RWYL 4FFVD 1KFAH 3FAWA 1NAML 4M43L 4N0YL 2DMKA 3FTGB 1U8LA 4K3EL 1S78D 3NFPA 3WIHL 4XH2B 5T1LB 2AKRB 1BFVL 2WBKA 4XVSL 4DOHE 4JDZA 2BVTA 4ORZC 1F2XK 1F6AA 1IGMH 1UYWH 5D2NB 2XPGA 3GI9H 5EIQA 4IS6A 5FV2A 2X4UB 3J7HA 5I71C 1GPOH 2X44D 1A47A 2V9TA 3MMEB 1EA9C 1F90H 5F7YC 3D69B 3LN4B 4PTUA 3FOMA 4Y16B 3RWJA 4P5KB 4NIKB 1KTKE 4NKOB 3D3VB 1PZUB 4U1NA 5KTEH 5DVKA 4BFIA 4E42B 1UYWL 4OFYD 4OM1H 3MRJA 4DN3L 4JO1H 1CCZA 4Z18A 3K80A 3WE6B 1I75A 1I3GL 1YZZA 4XVUC 4FABH 1UWEH 2KUTA 4HFWB 1CR9H 5GRWA 1T6VN 2F5AL 4IJ3C 4H1LH 3SBWA 1O7VA 3BDXA 1NFKA 2DKUA 3BN9D 3W0WE 4ZSOB 2IAND 3UTTD 5HPMB 2HLFD 3VWKD 2J4WL 2I60L 4IIQC 3O0RH 1EV2E 5DEGB 5MEPA 1KN2H 3M07A 1I7ZA 3NOIA 4QCIB 2HA1A 5FOBB 1NUGA 3C08H 4ZFOL 5LBSL 4JRXD 1BZ9A 3MA7B 4R7DA 2OP4L 2ZUSA 3EOBA 5JHLH 5C8JB 1RUQH 5AWNH 3CLFH 1XGPA 2EDKA 1YY9D 4POZC 3H3KA 5I0ZA 4AM0B 4QRRA 4F8QA 4Z95H 4XPGH 4GRWH 3GSXB 1TQBC 5JPMA 4NQSB 1T83C 2IAMA 4WGWB 2EO1A 4Y5XB 3MJ7B 2IQAB 1MVUB 4GW4B 1A0QH 3ZDZE 1JF6A 1MY7A 4PJ5D 5D1XC 3VXTB 4P5KA 4Q6YA 4FFZH 5FYKU 4UUJA 3SKJL 4OKDA 3MUJA 3CVHB 1B6UA 4UILL 4L3EB 4OIIH 3O3EB 1IM9B 4JJ5B 5C07E 3SDCA 1EUTA 2VUYA 1CF8H 3QUZB 4LU5L 5I8EA 3NCFB 2ICES 1K3ZA 3L1OH 3U48A 4E9LA 3VD9A 2R29H 1N0LA 2BVUA 2SEBA 4J12A 5ANMA 4P48A 2OL3B 3QUYA 1KPVA 3PQYD 4F7CB 3MCKA 5C2UB 5HHOA 3EJZC 4ZS7H 2XZZA 2VAAB 3NBNA 2FHFA 3E0GA 4JN2B 2AK1H 5KG9A 3TBVA 5HHOE 3KYOA 5C3TA 5T3ZD 3S4SG 1RJCA 1IGTA 1BBDH 2YSSB 3MPCA 3GSVA 3W9DB 1HEZB 4FQLH 2HTKC 3PDOB 3GIVB 4TNVK 1JZ7A 3VWKA 4X6DB 1RUPH 1RUMH 5J1TC 2JELH 1UT9A 3P30L 4WO4D 4BQ9A 3VMNA 3ZDYE 3ARBC 4IOIA 5JHDE 1UG9A 2AK4E 2APXA 4K3HA 3DX6B 4Z7WB 2VJXA 1U91B 3BGAA 4Y5VA 1FG9C 5C0CE 3QG7L 4XP9H 1JTTA 3Q1SL 2PR4H 4JKKA 4HKJB 5F1NA 4NN6C 3MCG1 4I13B 5GS2D 3VXMD 3KNBA 1BIIA 2BNRD 4UILH 3MOQA 1QKZL 2A73A 1IM3A 4DQOL 2NQCA 3REWB 1A6VH 2BY0A 2X89D 3MBED 1HH6B 4ELMA 4M7ZC 5CEZL 2R56H 3WDHA 1LWRA 1F11A 1MFDL 1W0WB 3TM6A 2NLJB 1MF2L 2R4SL 4R4ND 5HDBE 4NNXB 4YHKH 4QRTA 2ADIA 1NFDE 3VH8G 1K2DA 1PDKA 1GVIA 2X7LB 5FF6B 3IS1X 2IPTL 2AK1L 3CFDB 4NNPH 1KNOB 1OAZL 5C0BD 1NEZA 3U0TA 1N7ML 4M6NH 1BJ1H 4JJHA 2KZ1B 1IBGH 3X13B 3MRIB 2IBGA 1E6OL 4RGMB 2FDBP 1FCCA 2WLZA 3U0TB 4ODVH 4UT6H 5H37H 1T2XA 1OAYL 3BGFB 3HC0A 1HYSC 1JGVH 4F37F 1B4JH 2VQ1A 4J3XA 1OGAD 3LD8C 4Y4FA 2ESVB 3BZFA 1A7RH 1ORSA 4U2YA 5T33L 3TYFB 3CC5A 4F7TB 4U3CA 5FKAB 1S7UA 4OZHE 5T3XH 2AGJL 5HI5C 1YYML 4U31A 5I9QC 3WHXB 4HQQL 5ACLA 1WWBX 3QWRD 3GKWL 3ZE1E 1RZJH 2P8LA 1XR8A 5I1HH 3EDKA 5EORH 3FN9A 3ZYIA 2EH7H 4KVNH 3OF6A 3JSSA 4U1KA 5I1DA 1IAII 3T2QA 3NZ8B 4PUBL 4B5EA 1HNFA 2A74B 4XC1H 4XNMA 4Y4KB 4OI9A 4XWGL 2GJ6E 4BK4A 1ZGLM 4HPYL 5AZ2L 5JMRA 5HHVH 4PJ9A 4F37K 1Q94B 3B6SB 1UM6H 4Y16C 5DK0A 3IGAB 5HYSB 5D8JH 1Y6NR 4YQXL 1CXFA 2DWEA 4RFOL 1WCBA 3VD4A 1TJGL 4ODHH 1DEDA 3C5JA 1IFHL 2YUXA 3UDWA 4L4TB 2J6EH 3DVGA 3QP3A 4GG6A 2ENYA 5IQ7L 5IFHH 5DSCA 1CI5A 3M17A 5J6GA 1CTOA 2X4QA 3GBNH 3ROOB 5T33H 2H26B 4HC1L 4P9HC 1FC1A 2GI7A 5DJAA 4P59H 5EPMA 2MSPA 3BPNC 1ZT1B 3BPNB 1MCWM 3KYAA 1CDGA 1S9YB 1O7SA 3K4ZA 3QQ9C 1AGBA 4J3SA 3BKJH 3RIAK 1NC2B 4PJGB 3O3BA 4XMPL 2F53B 4QXUL 3VCLA 2YMXL 5F7DA 2VLME 1G1CA 5TQ0H 4WV1C 2RCSH 1E6OH 3MTRA 4ZXBB 1A4KA 5KSAD 3ZMRA 4MB5A 1A9EA 4FZ8L 4JAMB 4YDJB 2YD1A 4JPWH 3RHWK 1S8DA 2NX5B 3D5OF 3J8F7 5CEYB 1BZ7B 4LNRB 3VXPB 1QR1B 3B4NA 2JKXA 3RZWA 3LKSA 3VI3E 4LLVA 5BS0B 1YECH 3ES6A 5GZOD 4NP4L 5T1KA 2EIBA 3QG7H 4PJ8B 5DHYB 2Q8BH 4H0IA 1FVDA 4XCFH 5IVXE 4K3JL 4C57C 4PJ9B 3I75B 2IG2L 4EBQH 4XCCH 2AK4B 1P4IL 2DF3A 1NAMB 5J56B 3BP7A 1NLDH 4Z0XB 2OK0L 3IVKB 1KYOK 1RZ8B 2AXJA 3PWPE 4E5XB 5BMFH 3D9AL 3OPZH 3EDEA 5TGBB 3RBGA 5D1QC 4ZFOA 1A1OB 1FNGB 1JPFA 5CEYA 2CRYA 2VKXA 3VJ6A 1RFDH 5DO2C 1I7TB 3IVKA 4LARL 5TQ2H 4G5ZL 5F7WC 1VKXB 1HIMH 4DWHA 2YPVL 5GGSB 5FGSA 2RB8A 2YZ1A 1PLGH 5HHPB 2IANE 3DRQB 4GRLB 2BRQA 4X0KA 7FABH 3LV3A 3RDTD 1KXQE 2ESVA 1QVOA 1EERB 2XV6B 3G5YA 2I25N 1RZ7H 1RZJC 1K8IA 3RWDB 3IU3A 3LKSB 5CCKH 3IYLW 1FL6B 4XNQB 3S4SA 2A9NH 4G6MH 1JPSL 2EXYC 4ZTPH 2CLZA 2XG5A 5GZOC 3LH2H 4LHQB 1NFDB 5IW6B 2JJSA 4U1IA 3NFNA 3RFZC 3GGWA 3IU4L 4LVEA 2JJSC 4GO6B 5GS0L 5D4QA 2FECL 2X10A 2X6MA 4KH2A 3G5ZA 3L95B 4KKLD 4GKOA 1JN6A 1Q94A 3B6SA 4MD0A 5DJ2B 1OAUL 4WRLA 4IOFD 1E28A 3HPJA 1AGEA 3QFDA 5JZ7D 4MHHI 4RFEB 5FCUH 5CUSL 1MI5E 5DHXB 2ZCLH 5I17A 2EICA 5IB2A 3ULUL 4V2BA 1K8DB 4ZS6D 1CE6A 4OUOA 1UC6A 2WNGA 2BNQD 1EJOL 1MHHB 4R7DB 3KAAA 2O5XH 3QO1B 3OKEB 4EOWH 5K59E 2ZSVA 1OPGL 5E8DH 1RUAH 1P1ZA 4DN4H 4PJFF 4LCCB 1U6AH 2XWBB 3ARZA 1VFAA 1KPRB 3K74B 3CFJA 4JRWA 2PO6D 4GG8A 3PV7A 5KAQG 5EBWA 1I7RB 2EDTA 4OQTL 5LXGH 4MA7L 2GSIA 2D7MA 4X9BA 3QUXA 2B0SL 2IAMC 5INCA 8FABA 4NZDA 1KV3A 2FJHB 4XPHH 3UP1A 5FECA 1C5DB 4Y89A 5BZWA 1W72H 3WDJA 3SGKC 5E4EB 2FL5A 1TTFA 5J1SC 1SJEB 4BFIB 1I8LA 4KTDH 1U0QA 2Y06H 4HIEA 3U0WH 2EKJA 1QFHA 1QFWI 4HDIB 1UJ3A 1WQVT 2E9WA 4FQ1H 3QDAA 1RV6X 3FRPG 1MFBL 4JFXB 2D9CA 4S0TD 2V7NB 3GSUB 35C8H 4WO4C 5ESQA 3QXDA 5DD1H 3W39A 4J8RB 3BP5B 1S7UB 5DMJB 1T7VA 3KWWA 1DQQB 3IFPB 3VE0B 4F7PA 2ZCHH 4RFEA 5E8OB 1I1AA 4NM4L 4MD0B 3P4LA 4S1SH 1XAUA 3KG5A 3PWUA 4OZIB 2J8UA 1FO0B 1IARB 4IIQB 4G9FE 4QHKI 5C0EA 4L3EA 3SGDI 4X9GA 4FQXC 2YD6A 4OKVA 4EI5B 4P4RB 4JB9L 5K93A 1NBQA 3OXRB 3ROLA 4IIQA 3TA3B 1PAMA 2GFBA 1KJMA 5J1AA 5F7FA 2EDDA 1YPZF 2FJFA 3PWPD 4DZBA 4NO2B 4K7PY 4BUGA 4U1JB 1T0NB 3HC3H 4J4PA 3WNLA 3S8WA 3DRQA 1M05B 4F58L 3ECBB 5KSUB 4U3HA 3DMMA 3DX7B 1UKQA 2YZ8A 4MB3A 1MHEB 3CU1A 1V05A 4P2RA 4XBEL 4NZTL 4Z77B 2J8UB 3FQTA 3REWA 2WK2A 4OTXL 4JRYA 3NPZB 2CGRL 4Z7QE 3MRLB 5I1CH 1X5XA 3OR7A 4CJ1A 4JFDA 4OIBA 4HUUB 3LZFH 4JZJA 1BWMA 4TRPH 3KLDA 2ZOLB 5EU6A 4XAWH 4MJID 3MFGB 4LEOA 5DRNA 4Z7WA 2YUVA 4S0SD 3UZEA 5FDWA 3QUYB 4XNZC 1MCDA 1HZHH 5CSBA 4GKNA 1JZ8A 1I8MA 5DK2B 4L8CB 5I1GH 4FXLA 2L7UA 3D25A 2AS5M 2GJZA 3DURB 3GK8L 4MNHB 5D5MB 1U3HD 2XWJB 3VXSA 2YSSA 3UZVB 3OJMB 1P1ZB 32C2B 4WWKC 3N85H 2W07A 4GAYA 1G84A 3EUUA 3DXAE 1M7DB 4U0RC 2EEAA 4TNWF 2ZSVB 2C9AA 4YHZH 2EC9U 2ZPKH 4AY0A 3RVWC 4ONGL 1J8KA 1EEZB 2D03L 4UAOC 2BOCB 1K8IB 3WFHB 5I1EH 4F7CA 1IKNC 1LP9F 3SPVA 2AXGA 1CDHA 5IVOA 4DZ8B 3HE6C 2FSEB 3HZMA 5IM7B 2NX5D 1AGDB 1BHGA 4XGZA 2R4SH 3QUXD 2YS4A 1RPQA 5D96C 4GW1B 2JB6A 4GBXD 1KN4H 2Y1VA 1K85A 1CXEA 3O2VH 2RQ8A 3GGWB 3MUGA 4L8SB 2EDRA 3MLVL 4Q74A 4R0LA 3LKQB 1UGNA 3DHMA 3D18A 1DBAH 4TSAH 4YHIA 3VFWA 2K9UA 2HWZL 1VERA 4WUKH 1AC0A 1M7DA 1OSPL 3IXAA 3KPMB 3CPLB 5IMMB 1F02I 1OAZH 4YFLI 5E2WH 1IE5A 3QUXC 5IVXF 1JHTA 1FO0L 2H45A 3TCLA 1IKFH 5DJ0B 4O51B 3PE9A 4LSUH 1DLHA 3WLWD 2OQJB 35C8L 5KVEH 5JNYA 2PYEE 5CGYD 5E00A 4Z7NF 4GKSA 5BOPA 3VXOB 1YEKH 4L8SC 2DQGL 2HFEB 4ELME 1ES0A 3DBXA 1MFCH 1A7QL 3BPCB 4JRYD 1WZLA 3SOBL 1I4FB 1DZBA 3BD4A 1QYGL 3MCLH 1TPXC 1WBXA 5F7DB 2VWEE 3X12B 1LEKA 1UZ8A 4NQED 1KN4L 2QTEA 1MNUH 3F5WA 4M02A 4ZDHA 3MJGX 3UTTB 2Y4SA 2DTSA 3WL9A 4DKFH 3WV0A 2PYFA 1AIFA 4X8XA 5D1ZC 2JLLA 5INDB 3EW3B 1EDQA 4LDLB 2R2HA 3L6FA 5J13C 3AB0C 4JPIA 4HK3N 3OJVC 2AXHA 5DQDL 5TE7L 4OLUL 3BW9B 1YNTB 3FONA 4ZOCA 2J6EL 3MA9L 2VQUA 4NQCB 2P8PB 5DLMH 4U1LA 5CSZB 3O81A 1TJGH 1D5IL 2MFNA 3MZGB 4XXCC 4C4KT 1ZSDA 2J12B 5DI8B 5IMMA 1K3IA 2BZDA 3PGCA 4OF8A 4PRHE 3TPKA 1A14L 1QFWH 2HFGL 5IROC 4ETQA 3GDBA 1BD2A 1YJDL 1J0YA 3C6SA 1JWMB 2G5BA 4HH9A 1OM3H 1R3LB 4Y4HD 4Z5RB 1A6WH 1BFOB 4PLKD 4GAJH 4HGMA 3RGVD 4BH7B 2R1XB 5IJVA 1FYTA 3O3BB 5DFVC 3WXVH 1BD2D 3TJEH 1J11A 2CO6B 4JFYA 2A9NL 5D93C 3PABB 1PEWA 4WI6A 2X4SA 4KVNL 3UTQA 1AP2B 3UJIL 3HS0A 4X99B 2DI9A 3MODL 3GK8H 3EZJB 3WD5H 2AJYH 4L3ED 1T3FA 3QFJD 2VXSL 4F9PC 1JZ2A 1IC5H 1N6UA 3ARSA 1ROWA 3G6JA 4G9DB 4JPWL 4WFHD 4XZUA 3GMQB 15C8L 1TETL 5DRWA 3D1MC 2PW2B 3BEWA 5EB9A 2OYPA 2W60A 2MJWA 4UNTA 4ZXBC 2V17L 3BKMH 5DDHB 5ELIA 1IC4H 4Y4KC 3DXAD 4L4TA 1WT5A 1EO7A 4MA8H 3WNNA 3DV4B 1FAIH 1IGML 4RBPK 4XWOC 5IW1B 5SV3A 3G6JB 3KPRB 4MSWB 1BFSA 3TT3H 3T0DA 1MEXL 4PRBB 3STLB 5L2JA 2VDQL 1RUQL 4YDIL 4RISL 4Y2OA 1KCRH 1TFHA 4PRHD 2O61B 3DHJA 1CLYL 1FPTL 1ZWIA 4PREA 1FJ1A 5CEZE 2FO4B 5KW9H 5DT1L 4WW1B 1DBKH 5C08E 4FRWA 2X1PA 3U6RA 1OGAA 2FIKB 4HJJL 5H35B 2BSTA 2FX7L 4JHAL 2A2QT 3HUJA 1GGIH 4DUXA 1CE6B 2XZQL 1T0MA 1BQSA 1TDQA 2VDNL 1I9RL 3BYTA 2YKLH 3NCJL 4OLVL 4WO4B 4UIKH 5EO1B 5IOPB 5I1DB 1AGEB 1WFTA 4XP1H 5GGRB 1NMCB 5CKGA 5DJ8B 5E8PB 4ZUTB 4RRPG 2C3XA 5EZJA 1HXMA 1DBJH 4JKPL 4G8IA 1S5IL 5MEND 3SKNB 2P1YA 2XZQH 3IDGB 4M1GL 4E41A 1MRCH 4MWFA 3RZCC 1HKLL 3QQNA 2VABB 5IT2H 3OKYA 1FL6A 4Y1AD 3QWRA 4ZMAT 3KHOA 1CZ8L 4H5SB 1DL7H 1FFRA 1FIGH 1DBJL 1G7HB 3NA4A 2I9TB 4OGZA 2B1HL 5IESH 3VW3H 4YC2B 3RDTA 4I18B 4PRPA 2VH5L 4M6AA 5I8CB 4OZ4B 1UXSB 3HNSH 4KWUA 3MRIA 3QPXH 4MAUL 3GJFB 4YPGA 2DLTA 4P57B 4Y19A 1T03H 3IETA 1MWAH 1OLZA 4JY6A 4KFZC 1DQDL 1IGYA 4QXTB 2V5MA 5J13B 1RZGB 3R8QA 3V8CA 2EIEA 1HH6A 4ZAKA 1KGCD 1MIEL 3W9DA 2XZAL 2C3WA 3V7MA 4FNLL 1A5FH 5KVGH 5FHBL 3MLYH 2JIXB 1ADQH 2YRZA 4WO4A 3GSWA 5C2BH 3BAEH 2VC2H 3U79A 4BK5A 1AY1L 1BX2A 2Y06L 2BSTB 3QXDB 5E2UL 1BWWA 2EDHA 3Q6FB 5KSVA 1KF9B 1UB6A 2XT1B 2ESVD 4A2LA 1JIBA 2HVJA 1DR9A 3K2UL 1EBAA 3ARDC 1L0YA 1RFDL 3HMWL 4N90E 1H15A 2Y5EA 4K8RC 1WAAA 1MAKA 5I19H 5DHYA 4G7YL 3KLAB 4OQTH 1IQDA 1N2RA 1RJLB 3BD5A 2V2TA 4G43A 2WSKA 4JZOB 1SJHB 5JLZB 5JXED 2A38A 2R56L 3D85B 1C5DA 1IT9H 3JWNC 5SWZB 4M7ZB 4OF0A 3T08A 1UVQA 3WLBA 4LLQA 1JPSH 2DI7A 3GM8A 2CDFA 1OTSD 3QUXB 5HGHB 4LCCC 5E5RB 1X6NA 1N26A 2WWKT 2VXQL 4G9DA 1EHXA 2RIKA 3HNSL 1KPVB 2BHYA 4GAJL 3U4BH 4KY1L 1RAMA 1T1WB 4PJGA 2PTTA 4Y5YC 5C70A 5B3NA 3KDMB 1YEIL 1OAUH 3LHPH 4HWBL 3W2DL 2JCCE 1AXIB 2BC4B 1KPUB 2DQJL 2DTMH 3LRGA 1A6AA 1D5XB 3QZWB 4DW2H 5TH2A 2SEBB 1OTSC 5ANMB 5IB2B 3QJHB 3PGFL 1FZMA 4MNQD 4ETQB 2WMPA 2CD0A 1RZIA 1EXUA 5DJ6A 2P24B 3UJJL 1FLTX 3HZVA 1IGCH 5EU3B 3C8DA 3TT3L 2R69L 4G7VL 2FATH 1RHHB 3KJ4C 5SWSB 4LMQE 1UWGH 3CXHK 4YHOL 2XKSA 2JCCB 1RVFL 3OR6B 3FQXA 4TVPD 1DBKL 1P69B 2R0WH 4AEFA 3L6FB 3A6CH 1U93B 2EXWD 1CLYH 3JWOL 3N9GH 4NWTH 1NL0L 2AJUH 4JPVH 4MJ6B 4KKAD 3MV8A 3TA3C 4F7MA 4OIIL 4HXAH 1PVHA 3LN4A 3LMJL 5HHXL 3RY4A 4OLWH 3C60C 4QF1B 3QUYC 4XNZB 1XR8B 2I24N 1C8PA 5GJSL 5I18L 2Q3ZA 2EE2A 4JFQB 1WC7B 3RVUC 5JO5A 4ERSL 1XGUB 2CQVA 2C7UA 3ARQA 5HTSA 2NW3A 3AM8A 3QNXB 3OKKA 4LP4A 2BXYA 4K71B 4OB5L 1B6DA 4Y4FD 4G8GA 1YN7B 4HAGA 4EQ2A 5KS9A 1I1FB 1W8NA 3GBNL 3TPUB 4EXKA 4HS8H 1HK6A 2C1PA 1G7PA 4WHYG 1LO0L 2W0PA 3KPTA 5BJTB 2C4XA 1VFBB 1T83A 5L6YH 1CGXA 3PHSA 2UZXB 4J3TA 2UZIH 5E7BA 3V9FA 1S9VB 5D1XD 5DZNA 5KANG 1MQKL 3QEQD 4GG6F 5C0ND 5EUKB 3B9DA 3L1OL 4K7FA 5EU4A 1EPFA 5TPWL 4PJ7B 3E6FA 3VGFA 2X4TA 2DQTL 3RP1A 2PCPA 5GRXG 5H2BB 4X9HA 4OFYA 5EA0H 2Q7YB 5D7SH 1CLZH 4APQA 1UKSA 4YHLL 2FATL 5CBEB 5D7KE 1OW0C 1Q0XH 3H7BA 4ZTOH 2G75A 5C0DB 1JPTL 3BESR 5F70A 5D7IF 1EEUA 4FXKA 4WI5A 3T4AB 2NY0B 3BP5A 3GB7A 4OGYH 4WCYL 2BSSA 3P4MB 5BS0D 5FO8A 1MCWW 4HGKC 1MJ7L 4G8FA 3HC4L 4Y5VC 1FSKB 3QDJB 1U8KA 4P3CH 1NUNB 1PZ5B 4ZNEE 1A6UL 1FZKB 1YEGL 3MRPA 1AR2A 1A4JA 3PP4H 4JFOA 1FFNA 1H8OA 5FAAA 1R0AL 1I7UA 3BWAB 4UDUB 2QQNH 1ED3A 5SX5K 4L5FH 5HSFA 3BZ4A 3LB6D 3VRIA 2FL5B 1U3HA 3D25B 3QRFM 5HYSA 4PJXB 4WW2F 5K9QG 2ZUYA 3ARFC 1YN6B 5ESVA 5KG9B 5CGMA 1JGEA 3VRJB 3GMMB 4JFHE 3HN3A 3B9KB 3QIBC 4Z7VE 2QSCH 2A74A 2EDEA 3FKUS 5FK9A 4UIMA 1AO7E 2CLVA 4PS4H 1A7NL 5ECJE 2WV3A 1YPZB 4GQPH 4U1SB 4QTIH 1LK3H 4JQVC 4BFEA 2IWGA 1AXSB 5F7LB 5H2BA 3RTQB 3IDNB 2UZIL 2J8HA 3K8MA 1MNUL 3QHZL 4W4OA 5JXAH 1F58L 4KI5F 2BVEA 2HJFA 2X70A 3HC0B 2AABL 3FT3B 5IVXA 5A2IH 2DOCA 1UXWB 4UQ3A 3VXUB 2AJUL 4U1LB 3MNZA 1T7YA 5HY9B 1A6ZB 1CXLA 2QQKH 2RGSA 4Z76A 1AFVL 3CZFB 5ENWA 1FQ9C 1OTTD 5J3HC 5IHLB 1VENA 4KI5C 1U8NA 4UV7L 2UY6A 2YBRA 2G2RA 4LF3A 4PJEB 3GMRA 4NYLB 4X6CF 1A7QH 2P43B 3BKYH 1RZ8A 4OJFL 1S9VA 2XA3A 3EOAB 4NQCE 5FYJH 1WBZA 3LB6C 1CD1B 2AP2A 1MHPL 2FIRT 3W81A 1OAKH 4YFEA 1E4KC 1TZHB 2RCSL 1S9XB 4OZHB 3I75A 2A73B 3DSNA 1O0VA 4PREB 3MBEC 2XQBH 5BV7L 2HAZA 1N4XH 1F00I 4IRJB 2CDGA 1S7XB 3ARDB 3D39A 1DBBH 3ARUA 4UOW1 1NQBA 1LNUB 1MIEH 2OJZH 4XBGB 3D3VA 2Y36L 2W38A 1DE4B 2Z31C 4LASL 3IRZA 4ZS7L 4Q9QH 3QULA 1F4XH 3EJYD 2CUMA 3QDHA 4BYHA 2VZUA 1JRHH 1PKQE 5TPWH 4G8EA 1ZHNB 3ZSSA 3Q5YA 3MRDA 3L9RB 3L3JB 4FQCH 5DD6B 1DDHB 2FYYA 2P5WB 2EDBA 4ZODA 5FM4A 5DJDA 4UU9A 1MCEA 4KMTH 1AXTH 1QSEE 2F74A 1WVZA 4IRJD 3ROOA 5HDQH 4WV1B 4V1DA 5GGVL 3VFNB 2M1KA 4X5WA 3T4YB 1JWMA 2F74B 5EC2B 2HJKB 2JB6B 4GW1A 5HI4D 3UTSD 1JV5B 1NGWB 1U8PA 1GXEA 1ZT7B 1FDLL 1NSNH 1A6PA 1HYRC 1QTYT 4MA1C 4XI5D 2NY2C 1U8QA 2P5WA 5K33A 2HN7A 3MFFB 4NZTH 5HHMB 2UY7A 3MRCB 5CINH 3GSOA 2P5WE 4RMRA 4X4YA 2VDKH 3I2CL 1QEWA 5EUOF 2F8VA 4NDMA 1EX0A 5LAXA 3VXSE 4KKCD 4N0UA 5IR1B 3DROB 2AJYL 4P2QE 1JPST 3SKUD 4LPVA 4P2RD 4RFNB 1GGCH 3QH3A 1PSKL 1R5WA 5I1AA 1H5BB 3CDCA 1J05B 4GRLD 3F7YA 5GGSY 1G7QA 4TUKL 2EDLA 1FLRL 4Y7MA 1ZTXL 4KTEL 4WI8A 4FQJL 5DYOB 2FYYB 1QPPA 4AEHL 3L3IB 4R0LC 3DARA 3RY5A 3W82A 1T80A 5F9OH 4G6KL 1ZLWH 2E6JA 2WBWB 4I0KA 5IB1A 2I07B 2HRPH 1PFCA 4Y2DA 5E8DL 3G04A 1NGZB 1ZLVH 5FFLA 1NAMA 5FHAH 1XF5B 3EYSL 4ESKA 3UROR 3SDXF 3UC0H 4C56B 1T7ZA 1I9RH 3AXLB 3NCJH 4OLVH 5EBGA 3B83A 4GQ9L 3TO4B 1MCQA 8CGTA 2W0FB 1KXVC 4NO2A 1ZHBB 5GGQL 4AEIH 3VWJC 1D9KB 2XACC 5IQ7H 3E2HB 5ISZB 5F96H 2AEWA 2W9EL 5GSVB 4FTVD 5DMKB 4RFNC 1S7SA 5FHAL 5GXBB 5IVNA 4L4VB 4KY1H 5DJXB 5D71L 1EEYB 2YA0A 1URLA 4NNXA 3ARGC 5I71B 1D5BA 3KPSB 1NANH 3T0BA 1CDYA 4JKMA 3U4EA 2XNAA 3PL6A 3ZE0E 5C0EB 4GAGH 4NT6B 2BERA 5DJCA 1IC7H 4Q2ZB 1JNJA 5CCKL 1BVLB 4N8VG 4PJDF 1CGYA 2CMRL 1F8TH 5B3JE 5JORA 1CE1H 4LNVA 5T1LA 1T0MB 4X7FC 3HNTH 1CICD 4QT5B 1KCRL 5DMKA 1U91A 4UT9H 3RY6A 1QQDA 2NY4B 1B2WL 3LQAL 4WENB 5DFVD 5I8OL 3RWHA 4FQPA 3VFUB 5ESVB 2VLRB 2Z0BA 3E3QC 3BAEL 1EBPA 1MJUH 3TBTB 3B9KD 1QYGH 3MCLL 3LSOB 4V1DE 4XPTL 5MEQA 3ZYZA 4LLMB 2AQ3A 2XZAH 3KYOB 5GGRA 1XGTA 3L5XH 3V7AE 1LK2A 5F1KC 5T1MB 4L8DA 3OKKB 3TYGH 4C83B 4F3FA 4TNWK 4YZFF 2Z31B 4FQCL 4K3DL 3KPNA 1WITA 1KENL 3U9UA 1BECA 1HQRB 4WI7A 3WUWG 4OZIF 4ELKA 3HRZB 1Z6JT 5J9PB 2MMXA 4M5YH 3OB8A 5T1MA 1TNMA 5GGUA 3I85A 3Q3GA 3GI8H 4HMCA 5JW4R 5L9DH 1GRWA 2IH3B 3OZ9H 2NY1C 3NCCB 3W11C 4B7LA 5ADOH 4I77L 3P0VL 4JPKH 1XF4A 5E6ZA 5IW3A 3TBTA 3LEYH 1TZIA 5D7JC 3U4BL 2AJ3A 5HYEA 1NCDH 1ZOXA 2Z4QA 4NKMB 4S1DD 3P11L 2OTUA 1EEQA 2XFXA 4DW2L 3BZFB 1NUFA 4QXUH 4ZTPL 3Q0HA 4PJ7E 4A2MA 5JOEA 1NAKL 4OUUB 4LLYB 2FEEL 5FO8B 3O3DA 4QRPA 4QHMB 4PJCF 2YUZA 5IMOA 4P9HH 5FUCC 5KJRH 3MLYL 5SX4I 1YY8B 4AT6A 4UQ2A 2QQLH 4WFGE 1CS6A 2AAVA 4QRRB 4WDIB 3D6GA 4ZO7A 1FNSH 4OM0H 1OF2B 4ZQKA 1JBJA 1T7XA 2ZPKL 3EOBB 3BZEA 4H25A 3KPLA 1RMFH 2BCKB 2CGRH 4S2SB 1TCMA 5SV4A 3RWGB 1D5ZA 2X9YA 1H5BC 5BV7C 3IF1A 3FO0L 2XICA 3HAEG 3JUZA 3U30C 4XNYH 1FBIL 4OCNC 1AD9B 3ZKMC 3QULB 1SYVB 2VDLH 1FN4A 4WVRA 3C08L 4Z7UA 2HT3D 4APQD 3D85A 2WWMC 5JNYB 3QPQD 5KTEL 1JVKA 4PP2A 3TVMA 4MDIB 4MA1B 4R26L 4G8GB 4EIZC 1E4XL 2YKLL 5JOFA 3FQXB 2AI0L 5IB4A 2YPLE 4FZEL 4XPAL 3QEQA 1H3UA 4J6RH 1J10A 4M5ZH 4BSVB 1PGRB 2EEDA 3PDOA 1RJZA 1PD6A 4JQXC 1CQYA 5HJ3B 5F9DC 3SDCC 3H3PH 3LKNB 3WJJC 3NIGE 2VLKE 5E2TH 1NCAL 5HXMA 4PLNC 2G2RB 2R23B 4LLDB 4X6BA 4WUUA 3S35L 3MNWA 3PP4L 3MRBA 4L9DA 2H3NA 3OAYH 4U1MA 4HIXL 1G9MC 4CN4A 3CLFL 2JCCA 1MHCA 4WFEE 1MIMH 3UYRH 4XAWL 4DN4L 4H88H 3WFDL 1SMOA 5F9WC 2BDNH 1AGCB 3ARFD 4JFFE 3SDCD 5D8JL 5ABDE 1RZKL 4WUUD 5JQ6H 4H5SA 3DNKA 4IDJH 2FO1A 4ZFZA 3WXWL 5AUMA 5J6HB 2BSED 5E2VH 2CO7B 3WLBB 1I8LC 1UQSA 1UA6H 4P2CG 3DSFL 4K55A 4KXZH 2R0KL 2WWKO 1A9EB 1DEEB 2GYSA 3WJLC 4NO3A 1TMCB 1MJ7H 5D6DA 5K9KB 5CZKA 4JGMA 1DBML 1JK8A 5L0QB 3V8OA 1MHCB 5D7LE 4GBXB 4V2CB 5IGXL 4GXVH 2NY6B 1CDBA 1OP9A 1I8KB 3I3BA 3P0VH 4M03A 1VADB 1D6VH 4G9FA 1M6OA 1BX2B 1MCSA 2ZOLA 2XQYK 3CFKA 5D70H 2HFFA 4Q9QL 5E2WL 3GSWB 5TE6H 3D2UD 2YPKA 3U9PL 4U1HA 1AJ7L 2AABH 1BEYL 5ADOL 1WIUA 2B2XH 1B9ZA 3O45A 5GJTL 5MEPB 5DJDB 4Z0XA 3CSYA 5FYLL 2J5LC 3TO2B 2D3VA 5DR5H 4GKZB 3RUGB 3HI5L 2CKBB 3KPRA 4MSWA 4KXZI 4UT6L 5C9JB 4R6UA 4K23H 3CH8A 3BISA 4JFOB 1RK0B 3N85L 5E7FA 1QKZH 3P0YH 4LHUA 3DVNB 3VXQA 1YNKH 4LCUB 3VI4E 3WO3B 4YIQB 3SE4C 4G6JL 2P46B 2ZUVA 2QR0A 1HXYB 2X89A 4NO5B 3IXTA 1NLDL 4RGNC 5IHBA 1MFDH 1FN4B 1JWSA 4LSUL 4Y16A 5C0AA 2P4AB 4LVNC 2OCFD 4PY8J 5KVEL 3PGDB 1U8NB 2V9QA 3GRWH 5CBEA 1C08A 3CMGA 3Q5TA 4I8DA 1KTLA 3JV6A 4OBSA 3K1DA 1FO0H 4R7NA 2PXYB 3VXNA 1TITA 2VL4A 5HYJA 4I0PD 3V6BR 3QXUA 4D9QE 1RIHL 5CBAB 3S35X 1CFTB 2QQNL 3TLRA 3MRFB 3B9VA 7FABL 5CJOL 4J8RA 4GRWE 1M71A 1G1YA 5J6GB 4ZQKB 5I6XB 25C8L 4LRIC 1E4XI 1HZHL 1Q9KB 4HCRA 1CLOL 1AE6H 2CDEA 2H9GA 2VZOA 4OZGB 2DI8A 1S7QA 2W65B 3D3VD 1H3WM 2ARJQ 4YE4H 3QQ9D 1UXWA 5JOPE 1F45A 1VFOA 5E1HB 4NJAL 3SKJH 1WUNT 1BF2A 5BRZE 5C0AD 5T3XD 3KLHC 4YH6A 3HCVA 4XMLH 3GJEB 5CEXB 5MP6L 1UADC 3SGEI 4MAUH 4MHHG 1XMWA 3B9KA 3H2WA 3H9YA 1DQDH 1G9ML 1YDPA 1C08B 3OJDB 1X4XA 1JI2A 1OARL 3OKOA 1OTUC 2X41A 5FUOH 3FO2A 5KSBB 3RA7H 1GGYA 1YEFH 3BVNB 3LDBB 3VH8A 3TBVB 1YPZA 4HWZB 3E8UH 4QKXB 5E95B 1W72B 3LKOA 3HAEA 3QUMA 1I3RB 3OAZH 1JFQH 2W0KA 3C6LC 1FC2D 2HWZH 4WTZA 3QIUB 3GSOB 3IDIB 4GBXC 4QRRD 1ACYL 5D1QD 3IDUA 3ARVA 5DT1H 2FR4A 2I9LB 1H3PL 3MR9B 4FXGB 5TQ2L 4GMTH 5DO2D 5KOVC 1G6RB 3AU1B 4GS7C 4M9OA 3UBXB 3GSVB 4ERSH 1LGVA 4Z8FL 4U49A 3O6KH 3P3YA 4TOYL 3UTSE 3KYMB 2QADC 4LSSH 2MQ0A 1CT8B 5GS2H 4NRXB 3E3QE 4YZFE 3N1GC 4P0DA 1Y0LA 3RTQD 5CIPA 3OMZA 5HYSG 1Y18B 1MAMH 3D0LB 2E27H 4WEBH 3QRGH 4K7FB 1CICA 5EU4B 3X3GH 4PFEA 4LARH 1LO2L 1OGTA 3RWEA 1ZGLA 1ZLSL 1WBYA 3VFGH 4DVRL 2ZG1A 4DKEH 3H6JA 5T5NG 4U7MA 1QACA 3MYJA 3PQYB 1MFEH 3QHFH 4BZ2H 4G6FD 3OKMA 2HLFC 4M7LL 3GO1H 5SWZD 3V5DB 4X83A 1WIOA 4UINL 2VIRA 1CLCA 3KGRA 4QXGL 2AXFA 1GL4B 3WIIH 3G6AA 1UCBH 4QRSB 4FQXA 2QLVB 1BOGA 4XVSH 3S37L 3WS6A 1EUUA 4OCYL 1CIDA 2QBWA 4HXBL 2XWJA 5ICYB 4GOSA 4QY8B 5F9OL 4P5TC 4LKCA 3OV6A 5I8KL 1YY9C 1QLFA 4R2GD 2PW1A 1C7TA 4X5XA 1D3CA 4QHLA 2EDFA 1MCPL 4YNYA 4C56A 4OFVA 5EOCH 1T0PB 4IOFC 4GKZA 4KDVA 3BPOC 5I2IA 1I4FA 3JBG7 4Q58C 4QRUA 4S11A 5I16A 4JFEE 5D9SB 2W0LA 5ALCL 4H1LG 4RFOH 3T1FB 1EGJL 2ZUQC 3RGHA 2OSLB 4IMLA 5I8OH 1HSAA 4H26B 1QZ1A 3ZTJH 1D5IH 3WFCH 4XCNA 4MZ2A 2GTZB 3U36B 2DYPA 4HLJA 5HYJE 5FO9A 2MTPA 4OD3H 1KYOJ 3ZLQC 3SHSA 2PW1B 4X5XB 4MQXD 1A6ZA 4HEME 3WS6C 3NCYP 4KKLC 3HZKA 1CFNA 3MGOB 2AXGB 3KPLB 1HDMB 2D7QA 4NO3B 3TBYA 3IRPX 2DQDH 3WE6A 1RMFL 4OI8A 2B1AH 3C09B 3EO0A 3F65A 2XG4A 1X7QB 4K9EL 3SDDD 3C9NA 5D5MF 4OF3A 4EOWL 2EH8L 1JGLL 3MACH 1IC4L 5DFTA 4LCWD 4HCRH 4X7DC 1KLUA 3C5SB 2FX9H 5F8QC 3QDMB 2DQDL 1Q72L 4KRNA 2CJUH 3OXSB 4FFYL 5CD5D 4FNLH 3RDTC 1U3HC 5L2KA 3CH1A 5EZIL 3KR3L 1HWGB 5C7XH 1YEKL 2BOBA 1LP9B 5FDYA 4LVNB 3DO3A 4PRPE 3QCTH 2VL5A 1T66C 4X98B 4MD5A 4XC3H 2VDOH 3WS3B 3O9WC 3BPLB 1KC5H 3ARGD 1EHNA 3RKPA 3BKJL 1SHMA 4I0CC 4J4PC 5ID1B 2B0SH 4JO3L 3T1FA 4YHOH 5JDSB 5EU6E 3R4DA 1T1ZB 4HUWA 4NJ9H 4RIRB 5DD3L 43C9A 2X1WL 2X4PA 5I30H 1RZ7L 4LHUG 4JANB 5LGJB 3TBWA 4JHAH 3I6LD 3NMEA 3GRWA 1MHEA 1Q0YL 4P2RB 5AEAA 5D1XB 2MQCA 4QRPB 4M5YL 1I7UB 3CAFA 3L7FA 5SWQA 3MR9A 1QRND 1DQLL 3FB8B 3K2MC 4MJ5A 3CC5B 4PJDB 5C92A 4U7SA 4R4BB 5TE7H 1D6EB 4LIQH 4NKMA 4D3CH 1TENA 3U7YH 4JPKL 2CRMA 5EU6B 1SVCP 3ILPA 2VLKD 4RGOL 2IBZY 4I3SH 2LAAA 3PNWA 3ARGB 1MUJB 2DIBA 5C6TH 4LCCA 1A9BA 4WFFE 4OZFH 4X4XA 3NFSH 4RGNE 5ILTH 3I84A 5ID0A 2OK0H 4M1DL 1C16B 1CVRA 2A6DA 5JHLL 1TJIL 4U1GB 2R1WA 2HTKD 4PLJC 6CGTA 5CEXA 3EOYG 3HI5H 1QPXA 4K2UL 1LP9A 4O9HH 2FD6L 4K8RH 3O4OB 1W0WA 2I60H 4H88L 1VSCA 3WFDH 2DLFL 3QI9B 4Z7UE 3WIIL 4XPTH 1D7FA 3EYOB 2DB8A 3ZTNL 2AJVH 2NY7L 4JKWA 5IMLA 3N1QC 5CS7A 2VZ1A 3FQWB 1OOAA 4LEXL 3RIAF 2A77H 1LD9A 2VLJA 1PYWA 3LS5L 5LQBH 1MLBA 5J12C 1IC5L 3SO3B 1IAOB 2CRIA 4N9OB 3GKZA 5ICZB 1JP5A 1RUKL 4WHYH 3Q6GH 1OCWL 5F7UA 1J1OH 2YEZA 3UTOA 5CMAB 2NYYD 2VYRE 1DLFH 4XNUH 1MELA 4PJHA 4DKAA 5IEHA 3GMLB 3ABZA 4K3EH 4NZRL 5E8OA 3QDGB 5EO1A 4GXUM 4PJFB 4Z7WF 4XXCA 4TUOB 3KPPB 5DJZB 5BZDB 3V0VA 4HS8L 2C3VA 3LN5A 3QQ4A 4WWKB 3IDJA 1IAKB 4L4JA 3RNQA 3RL1A 1NGZA 3EYVA 4L1DA 2EYTA 2ZUUA 1NLBL 3SGJC 2ZCHL 4DKDC 3TN0C 3ZHDA 2PF6A 5L6YL 2XTJE 2FBJH 5E2TL 3VXOA 4Q97A 4M1CC 1Z0NA 2YXMA 1ZE3C 4ONHA 1U93A 4PJBE 4H0GA 4UBDC 4FN0A 3CFCH 3BIKB 2G60L 2NNAB 1PJ9A 4HC1A 3R1GH 3U83A 3VU2A 1T1YB 3V4PL 3ULVL 1TLKA 2AJVL 3KXFB 5F71A 2Z31D 3ZKXB 1JHTB 4PGEA 4JZNA 5GISH 2HVKB 2CKBA 3EBAA 2DQHH 1ZV5A 3O3EA 4JJ5A 2Y9RT 4PRBA 1DFBH 3ZKNC 2X4PB 3WNMA 2H9GB 2WP3O 4G6KH 1I85A 1LQSR 1AFVH 3P4NA 3T0ED 5DZLA 1J8HA 3OG4B 1A6AB 2ZWLT 1N59A 2AQ2A 4JLRB 3FB5B 1F4XL 3DUUA 1J0IA 1UH3A 1E4KA 2ILLA 2VN7A 3LDBC 4GBXA 4R96A 5B21A 4NQXB 1F13A 2DQUL 2YC1B 3RWCB 4X0KB 4KK5C 3MGAA 5JXAL 3PGCB 3C2AH 4Q6IC 3NN8A 1GIGH 1IEHA 3CFEA 1HSBB 2OX5A 1NMAL 1JF5A 4XPFL 5FKPA 2O5ZL 2L4OA 3IJYB 3MBEB 4LPYA 4AL8L 5KSBF 4NRZA 2CR3A 3BP6B 2X4TB 5LXGL 2OJEA 1HSAB 4JVPA 3QPQC 3IT8D 1J8HB 4JPIB 3TIEB 3W0WA 3S4SB 4JFZL 1QBAA 1OSPH 4OZGF 5MERB 4Y8AA 3RBSA 3TWCH 1BD2E 1K9TA 3DJ9A 2Z93B 2LABA 4MQ7B 3QCUH 2P48B 3MBXH 5ESAA 1CD1A 2QQKL 4KJYA 2VO5A 1F6FB 4TULH 1AIFB 3VXPA 4OAWB 1R5VB 3MGTA 2JIXA 3MRLA 1WFOA 5E00B 2FGWL 1QLEL 4OT1L 3CXHJ 5DVNA 3WFEL 1RJZB 4HH8A 1IGIH 1T2QL 3DI2B 5J7CC 1HSBA 3QA3B 4KK5D 3TCLB 4IRSC 2IBZX 3HE7B 5DQDH 1VACB 3TESA 1WBYB 1T0NA 4OJFH 5FYJL 4F7TA 3TVMC 3L3DB 3HB3D 4NJAH 4RA0C 3GSNB 4PJAA 3IS0X 3V52L 1ZKAA 2EDYA 1NCBL 1UACH 4POZD 4QOKD 5MEOA 1A8JH 5IMKA 4F80A 1BLNA 4AH2B 1HIML 5BRZA 3DYOA 3LPWA 2AEPL 1ZA3B 2R4RL 5D6CA 5GRJH 2VLJD 1OAKL 2EIZA 4X8JA 4EDXA 3TT1L 1M4KA 1U58A 2HN7B 1GIGL 4FQ2L 4S1QL 2H2PC 2MKWA 2A6IB 2UZYB 3KXFA 3ZL4H 5HVWA 1RZIB 5B8CC 2FSEA 2JB5H 4PJXE 2P5ED 5EO9A 4C4KO 2X4QB 5TQ0L 3ZDYF 4M48L 3C6LA 4PGCB 2EXYD 4QOKB 2YWZA 2APVA 4JM4H 4JFFA 3G5VB 2DQEH 5DHVA 4BFBD 1JMZA 1AHWC 2HRPL 1WEJL 1XIWB 3NTCH 3OJDA 3OKNB 1Z3GL 2DL2A 4OZHF 1L6ZA 1JI1A 1HXYA 4RX4A 1RHFA 2VLKB 4YBHA 2FR4B 3LS4H 1OAQH 5C0AE 1VDGA 3TYFA 4L8DB 5BRZD 2IALA 3MRNA 3GNMH 3GMQA 3BPOB 4NO0D 5HHNB 3REVA 4NBZB 4DCQA 3ZO0A 4CDGC 3MZTA 3X3FL 3GBML 5LKNA 4G8GE 4LFHD 3I2CH 1OHQA 4HWNA 2VDQH 3UTQB 2DM3A 3RIFF 2NY3B 3ZZ1A 3NCYS 1KELL 1SMAA 4M6OL 2X2YA 5E6IB 2HJLB 4MA7H 4YAQA 3E6HA 2BFVH 3L5JA 4QYOA 5DUPL 1XZ0A 2Y23A 1YEHL 5KSUA 2YPVH 4LDEB 4A6YB 2VXUL 4CN6A 4WI2A 2GIYA 3KPPA 4GH7B 4U0RB 4NQVB 3T0WA 3UC0L 3KXFE 3HNVH 5DTFA 2BOBB 3ELAT 2EXWC 3OAUH 3MODH 4TPRL 1KEGH 3CVIL 1ZEAH 1FDLH 5CJQL 5DI8A 5AZ2H 1ACYH 3D9AH 3SO3C 5J12B 3SDCB 2CUHA 2GAZB 2XKNB 3AS1A 3DVFA 1A7RL 2NY1D 5JZ7C 4PJ7A 5DRZB 2GKIA 2XTJB 3N06B 3SY0A 4AEHH 3KVQA 4Z8FH 3RHWF 3V7AG 5F1NB 1X7QA 5K9QI 4R9HA 4OGXL 3R06B 1EO8L 3B2UD 4NM4H 1D6EA 1KCVH 4XXDA 1NAKH 4C54A 5FUCE 2HJFB 4KRPD 5F72S 3L3DA 1WFUA 3F5WB 5IBUB 4HC1H 1V7ML 3LV3B 2O5YL 4Z7WE 4OLXL 3WNOA 4L3AA 2Y7QB 3ULUH 1UFUA 3VWKB 1ZLUK 2WUBL 2LE9A 4M93B 3TBWB 5D93B 3K7UA 5EOCJ 1C16A 4BELD 3FB7A 2HLAA 3VI3F 1L7TH 4XX1E 2BFVL 1HINH 1PG7X 2D4DA 4E0RB 4P3WA 2OTPA 5DD3H 4FG6D 1DTUA 2EEBA 5I1KH 2HFFB 5D2NC 1S7SB 4YXHL 4G5ZH 2VL5B 3O4LB 3THML 3NACH 3DMMD 1JGEB 1W0VB 2Q1EA 4TQEL 5F8RC 2HH0H 5C0GB 4MAYB 1RURH 4L9LC 2D2OA 2BY2A 5JMOC 1AQDB 5JDJA 2WINA 2HYMA 1RUAL 5L8JB 3S96A 4YQXH 3GMNB 4AENB 2OMBA 4TUJA 4X7EC 4Y16D 4HKBA 2GK0B 3CFBA 5DRWB 3SE3A 2JJTA 2NTFB 1BAFL 4ZFZB 3ZE2E 2D0GA 4N0YH 4YDVA 1XGRB 3TCXA 3MV7B 3L5XL 4OLWL 3W9EA 1FIEA 5AYUH 4H8WL 4DEPC 1FGNH 4P46C 4EN3D 5FYJD 4D9RE 1JGVL 1QBLL 3NCBB 2PTTB 5JDSA 4OD3L 5EC2A 1T5XB 4BQCA 1KLGB 4XNUL 4QRPE 4ZOEA 5A3ID 4PBXA 1INDL 3D0LA 4Z5RA 4YGVA 2UYLA 1S3KL 5I73C 4K3JH 3E6FB 1ZLWK 1MCOL 3HFMH 3MLZH 5LGKA 1T5XA 1Z2KA 4I77H 4UOW0 5ETUA 5HGGS 5DS8B 3H9HB 4Y4HC 1DDHA 1EIBA 3VXRB 3WUWA 5D2LB 4JGJA 5L7XH 3VWKC 2K1MA 3F58H 4YHYC 2D7PA 4M3JA 5JW5B 1RIHH 4EI5D 4G80A 5CD3A 2F15A 1MRFL 1X3DA 4TSAL 3WFCL 3ALPA 3H9SA 2KQNA 2F58H 4XCNB 4J3VA 4ZOAA 2ZCKH 5D1ZD 3O6FD 1A3QA 4XHJC 2OSLA 3VFTA 1KG0A 3B9AA 4KI1A 3NH7H 5JIIA 1H15B 3RWJB 5JIKA 1W8OA 4NOFA 1G6VK 5E9DE 5I16B 2O26U 4YHNA 1CF8L 5F96L 5EUOB 5JXEA 4KGJA 2R2BA 1BMGA 3O8XC 4RGOH 4G42A 3O2WH 3IDJB 4QF1A 4U6YA 3DRTB 1XH3B 4NCC2 4YHNB 1MPAH 4JCMA 1KEGL 1SBSH 1KN2L 5JOFB 3ULUC 1REIA 4XH2A 4XMKL 5D2NE 4KMQA 4DTGH 4LSVL 3QCVL 4M93C 2N7BA 1IAMA 1BF8A 4OI7A 5F89B 1A7NH 1TVHB 4LVOC 2NY0C 3BKCL 1G9NH 4TRPL 5FIEA 1NKOA 1M1SA 4JKLA 4UQ2B 5D6DC 4BJLA 2NY5C 4TN9A 5CINL 5GS1C 1MWAL 1NJ9B 3TBSA 3V6FA 4HZAA 1LD9B 1A4KB 1S7VB 3QCVH 4CVXB 4LKXB 2Q20A 3T2OA 1YUHB 2H32A 1YECL 4LU5H 4UV4L 1WTGT 4OCRL 4LOUC 2DS4A 1PSKH 4MYWB 2C3GA 3OBAA 4S2SA 3S5LG 4HG4K 3SEPA 3VFMA 1NGYB 3WNKA 3FFCA 2YN3A 1P9MA 4R0LB 2RJMA 5GRUH 5F9JA 4X9IA 4ZAKB 1JZ3A 4S1SL 4ONFH 4JFXA 4MJ2A 1E4WH 3NN8B 1MI5B 4JO1L 1IEAB 2Y07H 3K0WA 4JR9H 3TV3L 1GGBH 1VFMA 4RAUA 2P7TB 4RAVB 3BHBB 3BH9B 4HIEB 5IWLC 4JB9H 1ZGLP 1HH9B 1NSNL 2GSGB 2V9RA 2I9TA 2FH8A 1NC4B 1OAXL 4Y5VB 4OF6A 3KPNB 5KN5A 2HKHL 2G60H 3VXQB 3GI9L 2WUCL 5EZLA 1KXTB 3G9VA 1DCLA 3V4PH 32C2A 5E4EC 5IHZA 4MWFB 2VLMD 2CPCA 1FYTD 1PKQB 4X6CB 1U95A 3MRRB 2VDMH 3QXAA 3BOVA 3SE9L 1OVZA 1NBVH 3SDAD 5I74B 4RMWA 4YXKL 3ZHLA 1JPGA 1F42A 5BV7H 3A6CL 4HHAB 4MD4A 1BM3L 3DGGA 4PR5B 4XHQA 3WMSA 2IANB 4U1HB 3UDWC 1UWXK 3QO1A 4DJMA 2VAAA 4G8FB 2WP3T 4KKNA 4LEOB 5FDWB 1NC4A 4PGZA 5FGBA 4QT5A 2VMFA 3VFSB 5FB8B 4Z0BH 5I9QB 2NCMA 2G5BB 1KCLA 1YMHA 2VDRH 4YDKH 5CBAA 3B5HA 4F33A 3PGFH 3BDYL 4JFYB 3EFFB 1FP5A 4EDWL 5BCAA 4JRYB 2F53D 1BQHG 3FFCE 1FYTB 1HWHB 2ZKHL 1FL5A 5D72L 4JN1H 5JPNB 2FD6H 4N0CC 1OP5K 4PGCA 5HHMD 3DOSA 1FVEB 2W9LA 4KHXH 2OLDA 4D0DA 2PETA 1UH2A 1EJOH 3U82B 3KPSA 1ORQA 1J86A 4PJFA 4H20H 4LEXH 5DDHA 5HD8D 4DZBB 4XWGH 3VFPB 1NEUA 4QWWC 5FYLE 5F1IA 1EFXD 4KKBC 5MEOB 5GZND 1KB9J 3MRMB 1LDSA 2E7BA 2ZCKL 5FGCB 4EVNB 1TXKA 4PV8B 3EIFA 4EUPH 3S3SA 5GRJL 3WHE0 3DTXA 2W9DH 4F7EB 5MP6H 1JNLL 5SX5H 1BPVA 3QI9D 2V2WB 3O4OC 1N8ZA 1IKFL 2R1XA 3LAFA 1XGPB 1KNOA 2AERT 1FL5B 3TPUA 1OAQL 1M71B 3QWQB 1ZA6B 2ADIB 1FV1B 3QEUB 3QG6B 5ADPH 3AREA 2AJSH 1GC1L 2VR5A 2YPKB 3G6DH 4NQVA 2H1PL 3T3ME 2NY0D 1T1XB 3KHQA 4FFVC 5E9DD 2V6HA 5HYIA 1TJHL 1ZSDB 1S7TB 2XN9D 5GIRA 3RGVB 3SKMA 1S78C 1S7VA 4YEEA 5E6IA 2I5YH 1MHPH 1TPXB 1YC8A 3JTTA 4LASH 2NW2A 1YNTA 1A9BB 4Z7VB 5KVGL 1DBMH 4NNPL 3SDAA 1TVHA 3O0RL 3RUGF 4YX2H 1QNZL 3MJ9A 1JGDB 2VLLA 1ADQL 1KCUH 1LK3L 4M8QA 5KS9B 4XPBL 2HG5B 1A4JB 3MRNB 1R0AH 4R4BA 3V6ZB 2C3HA 5D70L 4YPJA 2NX5A 2CIKA 4IMKA 5E5MA 4UAOB 3LKQA 4XVUD 4XPFH 4YDJA 3AVEA 5D2LA 3D39E 3VXRA 3WUWB 3LEVL 3A0OA 2N56A 5E8NB 2LTQB 3BXNA 1QBML 4RQQA 3WFBH 2DMCA 2H32H 2YK1L 5I8EB 2YC1A 1OSZA 1O5DT 2FWOA 2PR4L 3TH3T 5C71A 1PG7H 3G5XB 2BCKA 1U9KA 1MCFA 2BNUB 4JY4A 5T3XE 1X5HA 4F2MB 1FORH 2EDWA 4LSRL 4NDMB 3FFCD 1S5IH 1N5AA 4WFHE 4X6FA 5D7IB 1H3XA 1UQSB 3TNNA 4OCWH 3VXTA 4G80B 2XQYG 3GHEL 3P4OA 1CLOH 3WN5A 5FGBC 1J0HA 1BVKB 4Z7NE 2J7LA 4HW6A 3RPIB 3MOAL 4LRNL 5FUZL 4AIXA 4KI5D 1DL7L 1AH1A 5EOQL 1U8QB 5EU3A 1MAML 1KLUB 3C5SA 4PPTA 2WUCH 1BVKA 5DF0A 4Z7OF 5F6IB 2H2SC 1UM5L 3FT4A 2B5IB 5C07A 1F97A 4HIHA 4RX4D 5DRNB 1BIHA 1FSKC 1YPZE 3G5YB 1TJHH 5HI4C 2ZJSL 3GBMH 1SYVA 43CAB 5FOBA 3KS0H 3BQUB 1L4IA 4I0PA 5HJ3A 4OZFA 2EYTB 3C5ZB 1GGUA 4AEIL 3P9MA 2VXTL 3MV7A 1LDPH 1ZT4B 3B9KC 4WHCA 5H94A 1M05A 3U9UB 4DKEL 3VXMB 4UTBH 3VMOA 2QV2A 2O93L 5M95B 4LAQL 1IKNA 4JZOA 5J1AB 2Z35B 4RBPH 1IMHC 2EH7L 4FA8A 3ARDA 4J3WA 1N8ZB 3SDXA 1BJMA 1ED3B 4OGAD 1YJDH 2QSVA 3Q5OA 2AV1A 4WY7L 3KYKL 2C4FU 4OZ4A 1CXHA 4NM8H 2V5SA 2VE6B 3H9HA 5KW9L 3L3HB 4HD9A 2O5ZH 4CNIB 1T1XA 3ZSTA 3VXUD 1Q8MA 2NY3C 3QRGL 3X3GL 4WTXA 2XFXB 1P53A 2EDOA 4YXLL 5HYJB 3LEXB 1I8IA 3VDAA 3JV4A 2VISB 1GZQB 4G9FD 2VDKL 3PQYA 5F9AC 4WNQB 5K9OA 2OI9B 2QQLL 3EYOA 3ZTJG 5C09B 4EUPB 1HILA 2AJSL 2C26A 3S88H 3EO1B 3FQNB 3LPFA 2XA8H 2LVEA 4GXUN 3O6KL 5IKCA 3O3AB 1G7HA 3RJQB 1WGOA 4F9LC 1R24A 4YDLB 1JZ6A 1WAAE 4MD4B 3GMNA 2P8MA 5A43C 4AT6B 3WN5C 3FHQA 4NRYB 2DBLL 4HT1L 3V0WH 1LE9B 3ARGA 2BSRA 2F8XC 5GS0C 1CQKA 1KLFA 3CK0L 1B4RA 4P4KC 1QFPA 1ZMYA 2R2EB 1U3JA 3QUMH 4F7PB 3TH4T 1KACB 2YN5A 4XCFL 5JO5B 1RK1A 3LKOB 1NCWH 1BJ1J 3O3AA 1FRGL 2GTWA 1F3JA 3BKCH 4LSRH 2YHGA 1VCAA 5C7XL 3HTLX 1IGFH 1V8HA 3HS0B 4X99A 5DHVH 4KK9D 3RU8L 1JZ4A 2FHBA 1DUZA 3NIFF 1IQWL 1PG7L 3SKOB 5AAMA 1QD0A 5C09A 4EUPA 1Q72H 1BEYH 4TQEH 4Y5YB 1YDPB 3TT1H 4LRNH 1Q1JH 5FUZH 3HMWH 1P7QB 2FCBA 2R1YA 2XZCH 4HK0B 4S1QH 1LVEA 2R9HD 5HGAA 2ZG3A 1S3KH 5F3HB 3DV4A 1K8DA 3BZDA 4KZDH 2CLZB 3HFML 4MCYB 5I8CA 4CVZB 4XXDB 3IFLH 2OM5A 2VC2L 3UTPD 2DQFB 1INDH 4LSTH 1CE1L 5HI5D 2DJ4A 4YWGL 5JORB 4RAVA 5JPMB 4X8JB 3I50L 3P4OB 4K2UH 3FCTB 1NDGB 5E6YA 1J0ZA 1MPAL 2OS7A 5CWSA 5GGSA 4HKZA 3TZVC 5FYKH 1WTLA 4V1DB 2BC4A 3HAEH 3RVTC 3JV0A 1VESA 5HDLA 1YEEH 5DJ8A 5E8PA 5ICXA 1A6TB 4XPGL 3TJHC 3VGEA 4LHUD 3S36L 4CN1A 1KGCE 2QSTA 1QO3A 4H20L 5GS0H 3CNKA 2NR6D 4RQQB 3LVEA 5HYFA 1GHFL 3ZHKA 3JTSB 4QRQA 4ZUUB 1K4CA 5T1KD 3HMXA 1ULVA 4YNYB 2QJDA 1CU4H 5ID0B 5BO1H 1WK0A 4P23B 4KTYA 5BRZB 3D2UA 4D0CA 4GXVL 3ZDZF 3SDXB 4L3CA 2K3TA 3QQ3A 4ORGB 3T0VA 4KJYB 3QIBB 1F4WL 3RVXD 1PEZA 4PV9A 2CDGB 2L7JA 3U9PH 2VZSA 3MV11 1IL1A 2X1QA 3L5WB 4RZCB 2Y6SD 1D5MB 1DSFL 3FRPA 1NBYA 3CMOL 3FHAA 5DD0L 5IF0B 3UAJC 4PGJA 4TOYH 5C0FA 3ZKSD 2AI0H 4AIZA 5ISZD 5I1JL 4NC1E 3SJVB 2PXYD 2YPLA 3S34L 2DQUH 1FIGL 3DMMC 3V95A 4IRZL 4ZFGL 3EDDA 3Q6GL 3ARED 4G3YL 4F7MB 2HT2D 3QIUC 5MHSE 3S6CA 3QNYB 2QKIB 4NRZB 4FMKA 4X7TA 3QHFL 4BZ2L 3VFRA 3L7EB 4JM2B 1GJIA 3FT4B 5D1QA 4MDJB 2X05A 1UA6L 4OCXL 1S9WB 4ODXA 3KPQB 4I18C 1JNHB 4JR9L 2VDPH 5DWUH 3TV3H 4KMTL 2GJ6B 4JN1L 5EPMB 1NLBH 1CICB 3NFNB 1YEJL 2EIZB 4NPYA 4EDXB 3EFDL 3NA9L 1S9WA 4ODXB 2H2PD 2FB4L 4OLYL 4DQOH 4OLEA 5ETUB 3HNVL 2Y5TB 4XPAH 4XBEH 3T09A 4DGYH 2F5BH 4NBYB 1SY6L 4Z0BL 2RHEA 2VLRD 5J6HA 1HNGA 4ZFFB 3EO0B 1T4KB 3GMPB 3MLXL 4M8QB 2QKIA 1TZIB 2BVQA 1KCSH 3FMGL 3RTQA 3HR5A 4HBCH 1YEJH 2P45B 3LQMA 3UTTA 4MNHA 3VXSB 3U0WL 3T3PF 4OB5H 3VA6A 2GITA 4MDJA 2NXYC 3MROA 1X5YA 5DK3A 4U05A 2EDXA 2Y07L 4NSKA 1YMHB 3TVMD 3ZKND 2DIAA 1IM9D 4WV1A 4ELKB 1NBZA 1MFAH 5C0FB 1YQVH 2PO6C 5F7KC 3CLEH 5H35A 4H26A 3QNYA 4YHPA 3SGKA 4NKDA 4PG9A 5EOQH 4KJQD 2P44B 5EZOL 2BY3A 4KZEH 4UDTB 3D87B 4AENA 4MAYD 1FV1A 1I7ZB 3QEUA 3MXVH 3OB0K 1KJ2B 3V5KA 5I2IB 4KTDL 1LEIB 2OQJA 3VG0H 3WFZA 4N1EA 4Z7VF 4PP1C 2DKSA 1AQDA 3QI9C 3LKRA 3SQOH 4XT1C 1MCLA 5I1JH 1EJ6A 5FM5M 5JHDA 2NXYD 3EDFA 5LQBL 3D0VB 3IETB 1QSEB 4PV8A 1JYVA 2ITDB 1U8KB 5HYJD 1G9NL 5CJOH 5GQBA 4ONHB 4HWEH 3KPMA 3GSQB 4NN6B 5F1IB 1T21B 1YMMA 4D0CB 3O8XA 3SE8H 3U2SB 3I3DA 2X9XA 4HULB 3UXFA 2VSDA 1PYWB 4F15C 5FM8A 1L7IH 4L8SA 5EU5B 3O6MH 3TA3D 3SGDH 4G6FB 1A6WL 4PJFE 2EE3A 2VXVL 4LBEB 25C8H 1UACL 3P30H 4PRHB 3OX8B 5CILH 4JDZB 4C55A 5CJ5A 4KK6C 1KCUL 3RX8A 1ZT1A 1KTRL 1ITCA 4NFCA 1ORSB 1QFWL 3HE6B 4XCYA 2ERJC 5L8LB 1BQLH 4KPHL 3O6ML 4NCDA 1Y0LB 3T0AA 1HHIA 3KPOB 3GSUA 4BM7A 5I15H 2E6QA 4KVCL 4PGBB 3VRJA 4FP8L 3U6RB 3GM0A 4JFPA 1G9MH 3UPAA 2CIIB 4XBPB 3HMXH 4OT1H 1QR4A 4DUVA 3X13A 4X4XB 1YY8A 1KEML 3BT2H 5FYKD 2C1PB 5GGVH 2F54E 2FH6A 5EFIA 4ZAKD 3TNMB 5D5MA 3ARPA 2B2XL 1LEIA 4KJQC 5IW1A 5E24E 1EAJA 4G8GD 3BIAX 4L8CA 5EZLB 1DUZB 3QNZA 1YEFL 5CZXC 1HHGA 3VXMA 3QAZB 4MX7B 3P2TA 2NNAA 4XP6H 2GUOB 4FG6C 4Y4KA 4FFWC 4ONGH 3L7FB 1BQHA 1EH9A 3QFJE 3VG0L 3T77A 5J06A 4ELMB 2OL3A 1A02N 1OGAB 1LILA 4OV5B 1NGXA 2PYEB 5KZCB 3DGGB 4HX1B 2W59A 3T65A 4WU5A 3HPLA 5IHUH 2A83B 4ZNCD 3OKOB 3BE1H 2ZUWA 4FQHB 3RL1B 1TQCC 5CAYB 2FRGP 1LDPL 4N8VB 1U8MA 5IB3B 4F8TA 4P46B 5T1LD 1H8NA 1I8KA 4HH9B 4JO4L 4C83A 4F3FB 3GSRB 4LQ1A 4N0FA 3OKDB 1M7XA 1DQJB 4PJ7F 4EI6B 3K4DA 2PW2A 3BEWB 4PJDA 1JHLH 4L9LA 5FYKE 1BBJB 3C2SA 5DQJB 1FFOB 3RWIA 3VFGL 2HT2C 3MV01 1T20B 4OCSL 3TZVD 3MLXH 5B38B 5MEQB 3PHQA 1RI8A 3D39D 5IEKB 3IJHA 4NRYA 1K5NA 5EC1B 1NJ9A 5EOCL 4NKIH 4UUJB 1X5GA 2P8MB 1HILB 1CICC 1MRCL 4KRLB 1QHOA 4YR6A 1LO4L 1MHHA 3ARWA 1OL0A 4GQ9H 2R23A 4LLDA 4CW1A 1TVDA 4QHUA 1YEDB 3RA7L 4WJ5A 3RAJL 2B1HH 2BP3A 1AI1H 1GZPA 1YYLL 2W9EH 4GW5B 5FO9B 1LHZA 4H1LA 3BXNB 1UCBL 4R7NB 5K9OB 1GCFA 4HUKB 3UTZA 5EIVA 3BKML 5C0IA 1WZKA 3H0TB 3KYKH 4XMLL 3GMOB 4K8RD 3ARFA 3S5LA 3P77A 1G0XA 3D3VE 3FONB 5IV2B 4IMLB 5FOJA 1NBYB 3H42H 3IB4A 1KIRB 1DQMH 2HG5A 4NQTA 1CFVH 3PWNA 4FQIH 4CL7A 2VLLB 2G5RA 2NY4D 4P59L 3LQAC 3MV9D 5CP7A 4KRPB 3QIWD 4PY7B 8FABB 1DVFA 3OHXA 1RK0A 2OI9C 4GRLA 2GCYA 3D48R 4X6DA 4IJ3B 3CCHB 1FLRH 2BNRE 3B2VL 2BVOB 5EUOA 4M00A 1C5BL 1TCRA 5D2LE 4GMTL 3DETC 2A6JA 2X9WA 3QJHA 3H9ZA 3JWOH 1B0RA 4IHOB 3GNML 4WTWA 1P6AB 5DYOA 3UTZB 1RZGA 5F1OB 2ZG2A 3E8UL 2YD3A 2EDQA 2CKBH 2JF1A 4LGPB 3OXSA 3MJ9H 4KKCC 4LRIA 4AJ0A 1F3DH 4DZ8A 4HIIB 1IGCL 3IFOB 1U2HA 3ES6B 2VXSH 2Z8SA 4YDVB 3NCMA 5MENB 3R06A 4XMKH 3EGSA 4HIHB 2ATKB 1CFBA 3P4NB 4J7RA 5IV2A 2NY2D 3D18B 3SDDA 5MENA 5IB3A 1UM5H 1B88A 1VGEH 5DURD 2V7HA 3T0EE 3MJ7A 5D7KD 2ATPB 1X4ZA 5IBLC 4MS8D 5C07D 3FJTA 3FOLB 4JO3H 1OARH 4MAYA 5CZVL 1BBJA 1CGVA 5DJ6B 3S36H 3IDIA 4LP5A 1JGUH 2MCPL 4KQ3H 1R3IL 5MHSD 3GSRA 3BUYA 4N0FB 2JELL 4YBQC 3T4YA 4M6ML 5DMIL 1FNEB 1VGKA 3IFNH 1VKXA 3MNWB 4LIQL 4D3CL 1QSFA 3JZ7A 4WIQA 1DSFH 5HGHA 5GRUL 4TSCH 2M26A 2OMNA 1CTNA 3MJ6A 4WW1A 5E1AA 5F6IC 2CK0L 1WV7T 4HUVA 5KBNC 4E5XA 3I9GH 4HIJA 1MCBA 4JFHD 2UV3A 3RNQB 3STLA 5L2JB 4WI3A 1SJEA 2Z8WC 1JWUA 4X6CA 3QUZD 3MJ8A 1FFOA 5DK0B 4P57A 5GHWL 4LKCB 4BUHA 4HGWB 3STZB 4HFWA 2NZ9D 4DUWA 1R24B 1S7RB 3C5ZD 1I3UA 1QFUH 3KPOA 1F4HA 2VR9A 4NKQB 1Q9OA 3P4MA 2IC2A 2NY7H 3QQ3B 3BN3B 4LCYB 4U1NB 5CLTA 4EUPG 2DJSA 3DUSA 5KJRL 5ICZA 3ULVH 5LWYL 3CSBA 4HG4J 3VH8B 4AMKL 4LPTA 2Z92B 4WI9A 2X1XR 3AS0A 2XKNA 1II4E 4WNQA 5JQHC 2OR7A 2HH0L 4O00A 4NWTL 5HGBB 2EH8H 1HHIB 3LQAH 3JTSA 4ZUUA 4K9EC 4M7LT 1S9YA 4ZOBA 5DJZA 5BZDA 2VOTA 2GUOA 1Z9OA 2D7TH 3WLWC 3GHBH 4O58H 1CL7L 2XKUA 3TP4A 3MX0A 4LF3B 1UWGL 4PS4L 4PJGE 1JN6B 1KJ2L 3F8UB 3NH7L 1FG2A 4U33A 2DLGA 1FVCA 4LKXA 4KV5E 2DWDB 3T2PA 1BQUA 3BEVA 3K1KC 2YRLA 2Z92A 4OKVB 4EI5A 3C2AL 4JGUA 4YPGB 4PJHE 5IBUG 4NHCH 1NMAH 4QTHA 1R3IH 4CUCA 5DJXA 2EZ0C 2LU3A 4PG2C 3K8LA 5I1LB 5J11B 2R8SH 4OUUA 3O2DL 4HJ0C 2IH1A 1JUFA 2GT9B 3U0PB 4Z7QF 5DA0B 3BRDA 4ODWA 5HHPA 4EN3C 4RGND 3PJSB 5IGXH 1WBXB 1P7QA 3OGCB 1AXSA 1AKJA 5DQ9A 1PX4A 5EU5A 1XCTA 1KENH 1N3NB 3MROB 3UZQA 4OZFB 5CP3A 3QCTL 4RNRA 4FTVE 1N64H 2NXZC 2HP4A 3DBXB 3ESUF 3SBWC 1CU4L 3DUSB 1AKJB 1WICA 4HWEL 4NKDB 4PG9B 4YHLH 3INUH 1U95B 1M6OB 3RI5F 1Q0XL 1JYNA 1KJVB 4LCUA 1RULH 4M62H 5LJYH 1U41A 1JPGB 1S7WB 3L3OA 1TVBB 3LD8B 5FUOL 1YC7A 4UNVA 5DGRA 1OTUD 1P4LA 3QH3B 4WU7A 4F57H 2BVQB 4JANA 1UZ6E 1L9NA 1DEEA 3X3FH 1IGTB 2VQTA 3SDDB 3MV8E 4NHCL 1RIVL 1EXUB 3O2WL 4YDKL 1T1ZA 4IRSA 1QLRA 4MNQB 4RA3A 3BEVB 2FZ3A 1SY6H 3QDJA 4F9LA 1IJ9A 1DP0A 1RQ5A 2HKHH 4WFED 3TN0A 4WEUD 3MUGB 4H8WC 1OCWH 2IAMB 4Y5XA 1E4XH 3V6OC 3BO8B 3LKPB 3S7GA 1DVFD 1P6FA 3CH1B 4PB9H 1AGDA 1F11B 4ZG1A 3NAAH 3VGGA 3EHBC 3SE9H 4N0RA 4ZUVA 4M5ZL 5KS9F 4HFUL 4K3DH 4LLUB 3L9RA 2R0ZH 1IM3B 3M17B 4JVUA 1U8OB 3AUVA 3CSPA 3U46A 1D5MA 1HHJB 4S10A 2FB4H 4K07A 1QLRB 1L0XA 2H8PB 3C9NB 5DVLA 3DV6A 4FMFA 3TIDA 1NL0H 1ZS8B 3SJVA 4O2FB 4PJIF 5H8DA 4IRJA 4X7CC 2ITDA 4MJ4A 4P23A 1AD0B 1MWAA 2DQEL 4NQCA 5C0RH 3T04D 5DFWH 1E4WL 3WHE1 5I18H 2BVPB 4GKNB 1SYSB 5EDXA 4FTVB 3JUYA 5ERWB 4K7PX 2Q7NA 1DBBL 2EO9A 1SJVA 1X5KA 3HG1E 1J5OH 4MQSB 4UT7L 3V5HB 3QHZH 4LSQH 2R2CA 4HF5H 2YPLB 5B8CA 4OM0L 1VEOA 5MI0C 4IS6B 1JZ5A 5HPMA 3LHPL 3MOBH 5DR5L 4MA8L 2EZ0D 2X40A 4U6XA 2ZNXA 2FJFB 2VXVH 3KLHD 2LU4A 1N0XL 2DQFA 3TIDB 4MXQC 2AXFB 2ERJB 1PQZB 5A2JH 5C07B 1C5CH 4Z78A 3T0EB 1MVFA 2J5LB 4TYUA 3WXVL 2C5DC 1U8OA 4XRCB 4Q9CA 3S5LB 1EZVX 5EC1A 2MHAB 3T2NL 5JPNA 3GRWL 5D96B 3BYYA 4AK1A 2VR4A 4Y2DD 1XR9B 5E99H 1K2DB 1S7WA 5MENE 1TZGL 5AYUL 5I75C 5A2KH 1RIUH 4LK4A 3VG9C 1H9VA 3BFOA 2X09A 4WWKD 3HUJB 5CIPB 4M1GH 1WAAF 4P2QD 2W91A 1ZEAL 3N0PB 1IZKA 2WM0A 3BPLC 4JY5H 5C0CB 2HT4D 5CP3H 3Q3GB 3WKMH 3V52H 1IGJA 4Y4HB 3NZHH 1AJ7H 5GS3A 2XA8L 5IMOB 1Q9OB 2H6PB 3LN9A 2ICWB 2Y72A 3L3OB 3RX5A 1WT5C 2R4RH 4QGTA 3L5WA 4KGLA 3FZUD 1QRNA 3FB8A 2FEDC 4PV9B 4P46A 2FGZA 4O5LH 4UT7H 4ZSOE 5AD0B 1PY9A 1R3JA 4GJTB 4M1CD 3RWFA 4JDTH 3LIZH 1HEZA 1G9EA 4YFDB 3VDBA 1MEXH 1SEBB 1HI6B 3NGBC 5BVPL 4F15B 3RVVC 5E94B 5B39B 1A3LH 1FZOA 3MMEA 4NQEA 2JTDA 1SBBA 4HLZG 2UUDH 3F6LA 3LRSB 5GGQH 1TNNA 1BFOA 3WS3A 2R0KH 2HRLA 3BRFA 4YHMH 3KJ6H 4GW5A 3EFDH 4ODWB 3HE6A 2FGWH 4PRID 2IG2H 3WFEH 5CGTA 4EBQL 3BH8A 3V2AR 4R97C 1E6JL 4BSWB 3IKCA 3HZYB 2D9QB 5KVFH 3UJIH 4OCWL 2ICCA 3OWEA 4UIKL 4ZTOL 4OCLC 2A6IA 3IDXL 2FLRT 3IDMB 3ARYA 2F54D 2JJVA 1OAXH 1NPUA 4Z76B 3GJFA 2XTJC 5SWZE 2ENSA 3RX7A 4YXLH 1INQB 3RWHB 4EJ1C 3HUJF 3IXTB 4UB0L 1RY7B 3O2DA 1N6QH 3WO4C 4TUKH 1MCKA 3KYNB 4I2XE 2IGFL 4KC3B 4YIQA 1CXKA 4OLZH 3VFPA 2ZJSH 2CLRB 4HGWA 2E27L 4WEBL 1NFIB 4U4BA 5AG8A 5ITFA 4HJJH 3VXNB 1G7PB 1BVLA 4I2XB 1NMCC 3KPSE 2JJWA 4NN7C 3P9MB 5LG1A 2JB5L 3UYOD 3PL6B 1VFAB 2FEEI 3FO1A 4ODHL 1B0RB 2IMNA 4NZUL 3IDYB 4U1SA 3V6OE 2PYEA 3CVIH 4JE4B 4QHKJ 4ODVL 2JCCF 1KG0B 3G6JF 4YHPB 3T77B 4HPOL 2GTWB 2E6PA 3BSZL 4LFHG 2XWTA 3FQRA 3SE4A 3UPCA 2LU7A 5BZWB 2A1WL 3O6FC 1KB9K 2HJLA 2GW5A 3TJHD 3IDXH 3HRPA 4YLQT 4LSSL 2AV1B 2GSIB 4Z9KB 1ETZB 1CXIA 1KT2B 4N0UE 2EYSA 15C8H 1OLLA 1KIPA 1TETH 3PWVB 1RJYB 2RAMA 4JPVL 4GMSL 2ZUTA 3MRRA 4N8CH 4FQXD 1TTUA 4S1DC 1XIWA 3O45B 1P4BH 4X4ZA 3VWJA 3PG2A 2QEJA 3DLQR 1GGTA 3GUTA 1EVUA 3TJEL 1D9KD 2V2XA 3MC0A 3HI1A 1V7NH 1TQCB 2RFXB 4ZXBD 4X6EA 5CUSH 4O02H 3PV6A 4M6OH 1TZGH 5I6XC 3GHBL 4J1UB 1U8PB 3G5ZB 3L95A 1J05A 4HKXB 4NOBA 3RWCA 4CADB 1ZLVK 5C6WH 1IAIL 1UENA 4TVPE 1FNAA 4RMVA 4P2OA 5KS9E 3FO9B 1NC4D 3NFPB 2VERN 2ZKHH 1KFAL 3VGAB 1JL8A 4B53A 2VDOL 1R5IB 4DGIL 4U6HA 3G5XA 5IUSA 3LS4L 4GG6B 1BZQK 1Q1JL 4P99A 5IMKB 2FJGA 4HWUA 1G7JA 4P23C 4G7YH 5FHBH 1U2CA 3I9GL 4FTVA 4GW4A 1XIWC 3GSNA 2DLIA 4I3RL 1HCVA 4HMEA 3SDAB 4MA3B 4XP5H 3ULVF 3SCMD 4JZNB 4YHYB 2DQIH 4PGDB 1BVZA 1XGQA 3VFOB 1ZVSB 4L29B 4OFIA 4UZGA 4IEFB 1BAFH 2HJKA 1UB6B 4LLQB 5A40E 1Z5LB 2VZ3A 4R3SB 1SM3H 3EDJA 4WUUB 4PJCA 2APBA 4LCIL 3ARBB 2J88L 4XVJL 5I19L 4JM2D 1A1OA 1FNGA 3PUCA 3QNXA 2OL3L 2PTVA 4NQCD 4TSCL 3VWJD 4GUPA 3A6OA 1QFUL 1PW3A 2WIIB 3LH2L 2HLAB 1N3NA 4XVTL 2ZNWA 5JIPA 3L5IA 3PIQB 4CU8A 2X5PA 5F97E 3PJSA 4JFED 4PJ8C 4I0PB 1AR1D 1JGLH 3MACL 2VZVA 1H5BA 4FQLL 5T3ZH 3ULSA 5TGBA 4H25B 1RUML 4W70A 5CMAA 4R3SA 1XEDA 1Y6KR 5GRVK 1RURL 3VGBA 1INQA 4KDWA 4K7PL 3DETD 2DM7A 4JRYE 3I6GA 1HHJA 1U8JA 4FZ8H 2F5BL 1MREH 3BGMA 4ZUSA 5E03A 4OLXH 3ZT6A 3PP3K 1K5NB 3P11H 3OKMB 2OTWB 1P7KA 5GSRA 5F1SA