1KTRL

Crystal structure of the anti-his tag antibody 3d5 single-chain fragment (scfv) in complex with a oligohistidine peptide
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
247
structure length
229
Chain Sequence
DILMTQTPSSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPFTFGSGTKLEIKRGGQVQLQQSGPEDVKPGASVKISCKASGYTFTDYYMNWVKQSPGKGLEWIGDINPNNGGTSYNQKFKGRATLTVDKSSSTAYMELRSLTSEDSSVYYCESQSGAYWGQGTTVTVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-his tag antibody 3d5 variable light chain, Peptide link
publication title Crystal structure of the anti-His tag antibody 3D5 single-chain fragment complexed to its antigen.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 61
structure length 229
sequence length 247
ec nomenclature
pdb deposition date 2002-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ktrL00
4NQED 4XPFL 3MGAA 1G1CA 5J11B 4PJFF 4R9HA 4U1SA 4FQJL 2BFVH 4U0RC 2V17L 1C5CH 2L4OA 4OZHE 1JGDA 2KL6A 3LEYL 1E4XL 2FIKA 1KPUA 5LQBL 1QFWM 3VGAB 4L4TD 3NTCL 4G5ZH 3PE9A 1A8JH 1DEDA 3OJ2C 4YHPB 4WRLA 4FQLL 3TT3L 1PY4A 1P4BL 2HT2D 3MNZB 4NN6C 1BZQK 4I2XE 2IF7A 3O6ML 3GIVA 3G04B 3C5ZC 5FGRA 3BIKB 3KJ6H 5DVKA 4H1LG 3BQUA 4CVXA 2UVFA 4G3YL 1I9EA 1K8DA 1CFTB 1T0MB 5CGTA 4KJPC 1FYTE 1CICB 1GJIA 5F9DC 5F89A 5ICZA 1MCQA 4XP9H 4GS7B 1MPAL 1QBLL 3BHBA 3ZKND 5SWZE 5IB5B 1LE9A 4J23A 2VABA 3ZDZE 1E0OB 3JUYA 4NUJB 4RMRA 2ZUYA 4UIKL 4EI5B 1CG9A 3CXDL 3FT3A 4JQIL 1PEZA 5ICXA 1M71A 2FBJH 5HJ3A 2X10A 3U2SA 1HH9B 3KHQA 1B6UA 1PKQA 2B0SH 1DQJB 3HE6B 1FBIL 4JDTL 4OLWL 2EDQA 2K7QA 4FQPA 1A6WH 2YPLE 4MNQB 2XT1B 1G7JA 3HC4L 4KJWC 1CE6B 3ZL4L 5CEZH 4NC0B 1KULA 1J1OL 1PFCA 4NRZB 4GKZB 4MA8H 1NEUA 2CRMA 2GSGB 4BK5A 2IQAB 5DJ2B 3RY6C 5GRUL 4D0BB 2IPTL 4JFHE 3VXUB 1VFMA 3BH8A 1BGXH 1UA6L 3UEZA 3HKFA 4D94A 4N1CA 3QT2A 3MLWL 3D39D 3VD9A 1YEIL 4DEPB 4WWKA 4KK6D 4YHLL 5ACLA 2EEDA 5HDOA 2P1YA 5HHNB 1BD2D 1YPZB 3O3DA 1HQRB 5DD3H 4PLJC 3G5VB 5BW7A 1IAII 1DFBH 1U95B 4OF7A 1AP2B 3VFNA 5DQ9A 2Z8WC 3ZTNL 4LSRH 3IJHA 5DRZA 2Y7QA 2F53A 1L9NA 1TETH 3IDYC 4JRYE 3R0MA 1CFQB 4PBWD 3V2AR 1P5VA 2J4WH 1H3PH 1F4XL 4YDVA 2O61B 1YEHH 4KH2A 4JANA 4WHTA 4NKQB 4NRXA 3TO4C 5KTEH 3FT2B 4HCRA 5EOQL 2A38A 3H9ZA 1ZHKB 2AK1H 5I9QC 4IIQA 5ADOH 3QWRA 1KFAH 3DX8A 1Q9WA 4KQ3H 2EIZA 1U91B 4NDMA 2FEDD 1FQ9C 5E08H 3T4AA 1FL3B 4LDEB 4LQFH 4AT6A 3D2UB 5HHOD 4H1LB 3T3PF 2ZCHH 3NZ8A 4HX1B 3I84A 1I9IH 3O9WA 1LO2L 1NQBA 4K3DL 4L8DB 2OSLB 3RWEA 1JGDB 1OPGL 2XACC 4BKLB 1N4XL 4HH8A 2J6EL 1BFOB 5EOCJ 3L95B 4PJEF 4ERSL 1KN4H 4Z7QE 4OM1L 1VESA 1YEKL 5I0ZA 4BQBA 2VC2H 3TZVA 4HT1L 1CE1H 4TTGA 4HUWA 1BFTA 4L29B 4ZAKD 3C5SB 2AJZA 5D2NC 4Y2OA 4YBQC 3MROA 4JFXA 4BH7A 1I8KB 3RL2A 3BQUB 3BEWB 3MV9B 4CVXB 3TNNB 3MTRA 2YR3A 3HZMA 2ADGA 3T0EC 2IGFL 1KELH 1DQMH 5ICZB 5A40E 4XP5L 5CGYD 4UTAL 1JGLH 1U9KA 3BHBB 5IB1A 4IRJB 4N0CD 2CUHA 4DZ8A 2ADFL 5C7XH 1LE9B 4QNPF 2Y5TA 4OGXH 4PBVC 2R0ZH 1RUML 3FT3B 3MLXH 4ZSOE 1CGSL 2XICA 5ICXB 1C8PA 1M71B 2NY5H 3B9DA 1B6DA 2XTJC 1FNSH 1I1YA 2MWCA 3PWPA 5ALCL 1XGYH 2F8XC 3L5HA 2P47B 1XCTB 3RUGE 1G9MH 3PDDA 1IC1A 3RVTC 1CFVL 3T04D 2A6IA 4UB0L 2ZCLH 3PGDB 1G7JB 1QZ1A 3RX5A 3NCCB 3QDME 4H26A 1A7OH 4J1UB 3RX7A 3C09C 5C2UB 3IFNL 4RISL 4X5XA 2DQFB 4MNGB 5I8OL 1S7UB 1VENA 3BE1H 4O58L 1KJVA 2G60H 3VI3E 3SGEI 5A16A 5ITFB 1ZHBA 3QEQD 5EPMA 4KMQA 2DLGA 2EE3A 3VMOA 4ODWA 4CMMA 2BSRA 4AMKL 1TJHH 2FJGB 4ODUA 4F37F 2YKLH 1ONQA 4JJ5B 4QT5B 1JFQL 3U9UA 1EHAA 1U3JA 3O3BB 4HJJL 3IGAB 2DQTH 3MRGA 4MX7B 4YPJA 4S1SH 4HF5L 3O3DB 4DN3H 2CRIA 1TZIA 4I18B 3ESUF 25C8L 3MRMA 3P4LA 3KYKL 5E9DE 3VXNB 3B9KA 1S9YA 1B0WA 1X4ZA 2RGSA 4NBZB 1RZFH 1RUQH 4TN9A 3TN0D 1N2RB 3HZKA 3JWOC 3SO3C 3KPRD 5DRZB 2C3VB 2NY1D 1X5YA 4X9FA 4YXLH 4W4NA 3CFJA 4KKAC 1GOFA 1WJ3A 3P77A 5H2BA 3V52H 1XF4A 4J6RL 3QCTH 4WEUD 4YDVB 4XNMB 4U3HA 3WDJA 5B21A 2VXUH 3QHZL 4AEHL 5K9KA 5C0CA 3TYFA 2B2XH 3MJ9H 3GSVA 3SCMC 2O5XH 4IIQB 3OL2A 4MB3A 3DX8B 5F70A 4JPIB 4NDMB 1G6RB 2FYYB 4AT6B 1F6AA 3U4EA 3RDTA 4PY7A 4NOBA 1FCGA 1M7IA 3QDHA 1ZA3A 3RWEB 1WCBB 4LSQL 4PJ8A 1NFDB 2GK0A 1OWRM 4KU1A 4Z7OE 1W0VB 5DZOA 4GQ9L 3MOQA 4U49A 3DURA 3TO2A 4X9HA 3OG4B 5FKPB 4G6KH 3NAAL 4N9GB 3H8NA 5GRJH 4HUWB 1ETZA 2UZYB 3CVHA 1WFTA 2GTWA 4YHOL 3RJDA 1IM9B 1T83C 2VNCA 4KKCC 2P5ED 3WIIL 5BJTB 3PWNA 1KJ2A 1OAXH 3ZT5A 4QRPD 2DMKA 4BH7B 3RWDA 1A9BA 2CMRL 1U6AL 4PRBA 4UT6H 2NZ9C 1CLOH 3LEXA 5FUCC 1MQ8A 2Y25A 3HZMB 3SDXE 2ZWLT 2OCFD 4HCRL 1AIFB 1OCWL 1X44A 3CFBA 5TDOA 1BFVH 2VUYA 2JIXD 2ARJB 1R3IL 4DZ8B 1MVFA 3DTXA 4MDJB 3ARED 1A1NB 1HXMA 3L6FB 2PO6D 3RZCC 2Y5TB 4GW1B 3LKOB 1KB5H 2X4UB 4WW1B 1FLTX 5JO5B 2VLKE 3OAYK 3OF6D 1Y6KR 4Z7VA 3BUTA 3PWPB 1MI5E 4RDQG 3FQXA 3MMEB 5GGSA 3OPZH 4LPXA 2V2XB 1QKZH 2AEPH 2HG5B 4F7TB 5AD0B 1MIEL 1QBMH 2X09A 2Y36L 2A77H 1C5BH 3UC0H 4LLMA 3RQ3A 4PRPA 1CICD 1YNKH 2YD9A 3B9AA 5FUZL 3HR5B 5C0FA 5DJ8A 4EQ3A 3FQNB 3QAZB 3RY4A 4XNQA 2R4RL 2VZSA 5KSAD 3WUZA 1GXEA 5A16B 4Y2DC 3U30C 2HFEB 2MSPA 5F7HA 3DVIA 2P24A 4FQHB 3O2DH 4ODWB 3G6AA 4R97C 4ORZC 4ODUB 4HHAB 4DTGH 3D1MC 4NGHL 1AGFA 4XBGB 1ONQB 5C0DA 5BMFH 3FRUA 4PG9B 5K33A 2CSPA 2VXSH 3HE6D 4XMPH 3U9UB 2APFA 1R3HB 1IARB 3SKJL 2L7JA 1GGTA 3I6GA 1P7HL 3MRGB 4Y16B 5C0BA 4XAWL 3EYOB 2EICA 3B9KB 3S35H 4DQOH 4IMLA 4WO4C 5D7LA 1S9YB 5DYOA 2AJUL 5JOEA 3T65A 2R1YA 4S2SB 4MXWL 4URTB 3VFSB 1F6LL 4GAGH 1X5AA 2P7TB 1SEQL 4OKVB 4HSQA 5EN2A 3CFJB 4YK4B 5T3ZH 4GSDH 3K1DA 2YD4A 4P3WA 3H7LA 5GISH 4TRPH 4JPKH 5ITBL 4I0KA 1MCPH 3KPNA 2DM2A 1PW3A 1TQCB 2J12B 3DMMD 3TYFB 1A47A 2DYPB 2CK2A 3O8XC 3IJSB 3LSOB 3PV6B 1H15B 4P9HC 4L1HA 3FB7B 1VACB 3SY0B 5FO8B 1QO3A 3QPXL 4JZJA 1JGUL 2F54B 4F7CB 2A1WL 1QEWA 5J12B 1XIWD 2DKSA 2VQUA 2J8OA 1QD0A 2X4PA 3WJJA 2BVOB 5E95B 1FPTL 4X99A 3S88H 1HHJB 3F12A 3DURB 4ODVH 3W5MA 2NPLX 4PGEB 2DIBA 1DN0B 5IBTL 4U6YB 5D1XC 2O5ZH 5E2UH 1ETZB 1T2XA 1E27B 2GTWB 3NPZB 2NXYB 5IB4B 3PWNB 5DHVH 4ODHH 1FGNL 3MC0A 4XVUD 4I3RH 4ZOBA 1F2QA 3FCTB 3MRQB 4KV5F 2CGRH 3MRKA 1XR9B 1BPVA 4PJ5E 4YH6A 1OARH 5CP7A 3ECBB 3WD5L 3S9DB 3NIGF 1FIGL 4XI5D 1DBMH 1OD9A 2A2QT 3V4PH 4Z7WF 3PQYA 1UVQA 2E3VA 3FB8B 5KJRL 5FXCH 1PZ5A 2EIEA 2PYEA 3WIFB 2EYSA 1L4IA 4HW6A 5DJ0A 1MCNA 2BC4B 5BZDB 4XNUH 1FFOA 2BSSA 2IADB 4OZHF 1DL7L 3HG1E 1PKOA 4ZS7H 3BQUD 3L5IA 4ZDHB 2W9EH 3G9VA 1CDYA 4KRLB 4M6MH 1NDGA 4P4RA 5J6HB 32C2A 4PGBA 3ULUE 3CVHL 4Z78B 1RUPL 3SE3A 5CCKL 2WUCL 3HI1A 2J5LB 4YR6A 2VDQL 4Z7UE 3MUJA 1J88A 1LDPH 1MNUL 2VRAA 3QUMB 1IAOA 4PJCB 3WLBA 2Z93B 1PVHA 3SDAC 1P7QA 3LEVL 3G6AB 1F3DH 2NXZC 3OJVC 5T5FH 2ITCB 3QCUL 4FNLL 1GYAA 3Q5OA 5IBUG 3FRUB 3S34H 4X0KA 4XVSL 5EZJA 5IBLC 4M7ZB 1SYSA 1N6QH 3TEUA 3IRZA 4X98A 1T04B 3K46A 3QJHB 1OSPL 4XX1G 2D4FA 3ARFB 3FT4A 3IKCB 4IMLB 1WT5C 3C08H 3S98A 4X80H 5DYOB 3I75A 4NKMA 1QSFB 4QHUB 2WANA 3CU7A 5ENWA 2E5EA 2R1YB 3T65B 1PG7W 1MQKH 4UUJA 2ZUQC 5HVGB 2AJSL 1QRNB 4CL7A 2X4RA 1X5IA 2O26U 5C07E 1NLDL 5GGSY 1AH1A 3O6FA 2VIRA 1BJ1H 1WLHA 1X5GA 1I8LA 4OD2A 1OHQA 4LEXH 3SE8L 4DW2H 1JNNL 3U1SH 2GI7A 2Z91A 1ZLWK 4YXHL 1XMWA 1G1YA 1QFPA 3MLRL 3ILPB 3MXWH 4G6JH 1BECA 2G5BB 4R8WL 3KPNB 3QIBB 2YPKA 5L8LB 3T08A 2X42A 4WWKD 1P6AB 1GIGH 2I5YL 1QLRB 4DZBB 4TQEH 1JWSB 3VXOA 3RWFB 3V6OA 2Z31B 4XXCC 1CR9H 3G5XA 4XVJL 5GSRB 3LZFL 4PJ9B 1JJUA 1A22B 2HJKB 4FG6C 2UUDH 4R26H 2PTUA 1IBGH 7FABL 2A73A 2GFBB 3ES6B 1I7TB 4Z5RA 1VKXA 2UWEB 2F53D 1LHZA 4HQQH 4P48A 3FO9B 3JVGC 1N59A 4JB9H 3UJJL 1AFVH 3P11L 4E42A 1JYWA 1H5BB 1U8PA 3T3ME 1BEYH 1UADC 4JY4A 1O7VA 2CDGA 1BAFH 5KS9E 4FFYL 5EZLB 2V2WA 4JPWH 2DTMH 3NA9H 5D7KD 4CAGA 1YQVH 3QWRD 3DYPA 1HE7A 1E6JL 3JWDL 1IT9H 5I1JH 5E1AB 3GBNH 2GK2A 2KKQA 4HWUA 4RAVB 5ISZB 3O9WD 5CP7B 1ZLSL 2EYTB 5GGUB 3SJVA 2BXYA 5LWYH 3VXSA 3PQYB 5BS0E 4TPRH 4HWZB 5F97E 3IJYB 1SMOA 3TZVD 2PYEB 3KGRA 1YEJH 2EYSB 2VL5A 5JW5B 4ALAH 2Y5EA 3HUJB 4WDIA 5E8EB 2AEQL 4LLYA 4UV4H 1FFOB 5ID0B 4Q9RL 4L8SC 3OJDA 2Q3AA 43C9A 3GK8H 2VXTL 5TH2B 2NY5C 4LGSB 1AC0A 4NO5B 4MJ6A 1EZVX 1FNAA 5J1AB 5IBUB 4MQSB 3MRNB 1IVLA 4Z7QF 4YDIH 1YJDL 2WW8A 2J8HA 5CKAA 3GJEB 4P46A 1MRCL 3B5TA 2GTZA 1G9MC 4QKXB 3S37H 5I30H 5BRZE 3RRQA 5FO7B 2YWZA 3FOLA 4YGVA 2Q7YA 5EG6C 3O3UN 3AAZB 4OLUH 1LE5A 4HUXB 5FYLD 1QVOB 1IAOB 2GKIA 4I0CC 4K2UH 2XWJB 1OAYH 3BT2L 4WENB 4M7LT 1AGCB 2A6KB 2XY1A 3TCLB 3CMOL 3AM8A 3EHBD 2DQDL 3PWPD 2H8PB 1U8OA 1C12B 3F58L 5H35A 2UV3A 2OTUA 3I3EA 5A2KH 2QBWA 5EB9A 4YPGA 3MRCB 4IDJH 3N1FC 4JQXC 4ZS6D 3C2AL 1DBBL 1UZ6E 3V6FB 4UUJB 5F9WB 4GXVH 2X4RB 1RIUH 3O2VL 1MCCA 1E6OH 4ZO8A 5GS2H 3MRBB 2VIRB 3RUGF 1FG9C 4F2MB 4Z95H 3MBEB 4LMQI 5I1KL 3CXHK 4G8GB 1S3KL 4RFEA 2H3NA 2XNAB 3LQAH 3RA7H 4UTBH 1UM5H 1KXVC 5EIIA 3WEXA 4GRWH 1WTLA 2QADD 3VXOB 3QFJE 4JO1L 4NKOA 3M17A 3M8OL 1RHFA 4JFDE 4OLYL 3CC5A 1OW0A 4EXPX 3VI3F 3VXRA 3N1PC 3B9KD 3HB3C 4R7DA 3X3GL 5IG7B 4XP4L 1NSNL 5HPMA 3BRFA 5L8JB 1W72H 3VFPA 4Y5XC 5IF0A 3C60A 3GNML 2X9WA 3C9NA 2DDQH 4DCQA 2XIDA 4L5FL 2DLTA 4QCIB 1YMHA 4O02L 4Y0GA 3OKOA 1A6ZB 4V1DA 4GAYB 3WFDH 4M43H 1ZMYA 4MAYB 5C0CD 4PG2A 3GSXB 4NFDA 4U05A 4LFHD 3TVMB 4RGOL 4ZG1A 4JFOA 3ARTA 2XPGB 3IU3A 1O5DT 4AIZA 1MCKA 5F7YC 1N7ML 3UBXA 4BZ1H 5EOCH 4PP2A 4DGVH 1NKOA 4N0FA 3RDTD 4M48H 4ZO9A 3KPQA 3UBXI 3UTTB 3SJVB 4PJ8D 4P59L 4YXKL 1RK0A 3QQ4B 5CS7A 4IRZH 2R56H 4UZGA 1JF1A 4G8FB 4DVBA 4ZFFB 3PGFL 5KSVB 5FDWB 3VXUE 2XZQH 3LQZA 5GS1C 4PPTA 4WDIB 1U8QA 3D25A 2NXYD 5L6YL 5E5MB 3OJDB 3UBXG 1J1PL 1GVIA 1JTOA 1SY6H 3ZT7A 2FR4A 3U0WL 4MJ6B 1MRFH 4ZOAA 5SV3A 4Z7OF 1IM3A 3H9YA 4WY7L 1A7QH 1HYSC 5CBEA 2EIBA 1FO0B 1HXYA 3CDGB 1P4IL 3OAZH 1RMFH 2VDLL 5BXFA 4OFIA 3QIWB 4K94H 2H32A 1CZ8H 5DK2A 4YGVB 4ZUWA 3IAPA 5FA4B 4NFCA 3BN3B 4NT6B 5DC0A 1A7BA 3RX8A 3KG5A 2Y06H 3UYRL 1UCTA 1C5CL 1UXSB 1T21B 3EJJX 1AR1C 4IMKC 1F6FB 4JKWA 3SDXF 5LGJA 4KUZL 5EUOA 2YA0A 5C09A 5D7IB 1A2YB 4KRPC 2EKSA 4YHYB 3MJ7A 4G8IA 4HIHB 4M5YH 5GJTH 4X7TA 3GMMB 4YZFF 2QR0A 2AERT 2H2PC 4YPGB 5GGQH 5HGBA 1X4YA 5I8EA 3QO0A 1AQDA 1N0XL 3MR9A 2APVA 4KROC 4YE4H 3REWA 4PRPD 4XBEL 5DMKB 4F15C 1KTDA 4HKBA 1LD9B 4KGJA 4LPUA 1D5MB 1KYOK 4Q0XH 4Q6IC 3V5DA 1DDHB 3STZB 3LKPB 4HGMA 2VQTA 2LTQC 2YD6A 4XP9L 4KZEH 5B39A 4P5KA 4XCCH 4XBPB 4XHQA 4ZD3L 2A9NH 1VADA 2H1PH 4RFEB 3V7MA 3VXQA 1NCAH 4CU6A 4K3GA 4M1CD 3E0GA 1GGBL 4HWBA 4OGYL 1LNUB 4U33A 5E8NA 3VFOB 4IOIA 3FFDA 3TV3L 2R1WA 2DQGL 3IT8D 3HAEH 5J3HC 5E03A 1S7RA 5F6HI 3M17B 3MV9E 4TUKH 1OGTB 5C0BD 5I1CH 5EZOL 4PTUB 1E4WL 5D7LD 1Q9OA 1OLZA 2WZPD 2R0KH 4X9IA 3L3OA 4LCCB 2CDFA 5CBAB 3GHBH 5DMYA 1RZ7H 3EDFA 3K0WA 2ZPKL 4PYGA 2J8UB 3BP7A 2BVTA 4YEEA 5JW3L 5D8JH 4NBYB 5JXEC 4NPYB 4P2RA 5C0NC 3TJHC 3MNWA 2BDNL 3T2QA 3W39A 5J8OA 5ALBL 2Y1VA 4OZGB 1NCWH 5FA3B 3KJ4B 1H3VA 1P2CA 3JTTA 3O3EB 3ME0A 1P7KB 3ROOB 4M00A 1KEMH 4LNRA 4Z8FL 3WKNA 1F4YL 2JJWA 4N0UA 3DETC 1UKQA 4O51B 1MUJB 1BGXL 4JFOB 2RR3A 4QY8B 3HMXA 3IU3B 4AIZB 3L3HA 3OR7A 1JGEA 2WQRA 1TCRB 3RWGB 5DRWA 5L2JA 3UBXB 2ZG2A 3EOBB 3EJZD 4OQ1A 3ARBA 4X5WB 2N56A 1FZOA 5DD3L 3Q1SH 1I3VA 4HS3A 5BV7B 1RK0B 4IRSA 5EFIA 4MNGE 4UIMB 5BZWA 4L9LC 4D0DA 1J0HA 3BAEL 5FCUH 4GBXA 1GHFH 4HMEA 1A7RL 5FKAB 4GJTB 1Y18B 5FYJH 4AENA 3BWAA 4UINH 4HPYH 1MY5A 4NNXA 3LQZB 4YNYA 5AAWA 1MFAL 1U8QB 1T2QL 4YFDB 3TA3A 1IMHC 1IEBB 3D25B 1S7SB 1JHTB 1EH9A 4UNVA 5J13C 3SDCC 5IW3A 5DJCA 1A02N 5E8OB 1WBXA 1YEHL 1QFWH 4HZLB 4XPGH 2QKIA 3BXNA 2ZSVA 3JV6A 1S7QB 2AK1L 1DVFA 1JHLH 4EVNB 1H9VA 1LP9B 1ZOXA 4RGMB 4HS8H 5T5NG 1V3MA 3SQOH 4ZUWB 3MRIA 2FJHB 3IXAB 4ZFGL 2LFGA 2ORBH 5I73B 3EZ8A 1SJXA 3EOYG 5GZND 2ZCHL 5B3NA 1K3IA 3PQYD 4U3CA 4Y4HC 1I9IL 1AGDB 4HUUB 4JVPA 2DLFL 2E27H 2XZZA 2PYED 3J7HA 1RZKH 1IGFH 5EUOB 2D0HA 4OIBA 4TUOA 2Z4QB 3SGDI 3DYMA 2XZAL 1CE1L 4PRHB 1VA9A 2CQVA 2W9DH 1AQDB 3QO0B 2D7QA 1XGTA 5C3TA 4M62L 3WJLC 3TIDA 4Y4KB 4FQIL 5F71A 5D2LF 1CT8A 1J8HB 1A3RH 3O45A 3LRSA 1KB9K 3PL6B 5B4MC 2X7LB 3FL7A 3Q6GH 3MA9H 5DUPH 1NFDE 2AVGA 1R3JA 3WL9A 1DQML 1I1AA 4P5KB 2R4SH 3SPVA 1PEWA 1I1RA 3A6BL 1P7QD 1JK8A 3VXQB 3PWUB 5F7DB 1ZS8A 3FO2A 3G6JE 5IB3B 3MPCA 2Z35B 4OGXL 2ITDA 1KV3A 4IEFB 5ILTL 3QB7C 4EDXB 4M8QA 2R1WB 4JHBA 4HS6B 4Z7UF 5LXGH 4JGJA 3G5YA 2K7PA 5H37G 3EDEA 5DFTA 1DQLH 2EDOA 4NO2B 5DD6B 3H3PH 5GRVL 1QSZA 2CDFB 3EYFA 1CU4L 4M1DL 4ISVB 2ZCLL 4JFEB 2MTPA 4JKMA 2VDML 3O6FD 3AC0A 1L7TH 2VZ3A 3PHOA 4M3KB 1D6VH 1QLFA 2CIIA 3OKKA 5K59E 1NC2B 1P2CB 4YC2B 1DUYB 1U3HC 3CLFH 2G60L 3E1F1 4KPHH 2H41A 1JWMA 4PJFA 4OF8A 2WWMC 1RZJH 1LILA 5FGCB 4GG6B 1WISA 2OP4H 5E5RB 4F33A 3K8LA 2HLFC 1TJHL 3RVUD 1EEUA 3MODH 5LJYH 3Q3GB 1VGKB 3NFPB 3GJFK 4JVWA 5L2JB 1KIRB 1RIHL 3HE7B 3VWJC 3OHXA 5CZXC 4HWBL 3ARBB 5JQHC 4S1SL 1FZOB 4HS3B 4FFWD 1P4LA 1ORSA 4LP4A 1DR9A 5EFIB 4D0DB 5ICYB 4CU8A 1SVCP 1RUQL 3GBMH 3MRHB 5J6GA 3V0WL 4AY0A 1N3NA 1ZVSB 3P4MA 4QHNB 4AENB 3DUHA 5E4EB 1ACYH 1YMMD 5MI0B 5E8DH 5F1OB 1MWAA 1I3GH 3V52L 1IL1A 4HJGA 1MHEA 3NCBB 1Q72H 3ELAT 1D5BA 5IVZA 4FXGA 5LBSH 2QKIB 2FNBA 4JN1H 2ZSVB 3MFFA 3H3KA 4HXAH 4HJ0D 1ADQA 1TIUA 3KWWA 1U41A 1DVFB 4QHKJ 1C08B 3MJ9L 2O5XL 3ZTJG 2X4OB 5JOFB 1HOCB 3T3MF 3SJVD 3MRIB 2B1AL 5F7LB 3HMXL 5KS9F 3WKMH 3VXSD 3QHFH 5SX4I 1EJOH 4L4VB 4C56D 3IF1A 5FM5O 1E4KC 4U1JA 4JHWL 4TSBL 2I26N 4KTEH 4C58B 5JORA 3S7GA 3F5WA 2AXFA 4ZPVB 4M7KL 2IAMA 2PR4H 5MENA 3MOAH 3VXMB 1NLBH 5I1EH 2AABH 2R23B 3H42L 1ND0A 3C5ZA 1L7IH 1JRHH 5JQ6L 1LQSR 3ARRA 4GLRH 4P46D 5JNYA 3MOBH 3O45B 2F54E 1OM3H 3IFLH 3NN8A 3DRQA 4XXDA 4XPBL 1CLCA 1ZTXL 1KN2L 1F58L 3HS0B 3RPIA 5TF1H 1K5NA 5IV2A 5B38G 3VGAC 4DVRH 5HHQB 3UTZA 1FFQA 1GOHA 3QXWA 1NEZA 1ZS8B 5AZEH 5EOTA 2UYLA 3G08B 2PW2A 3DX6A 2J7LA 4KJYB 4NSKA 3LKSA 4P4KB 4MQ7A 3U48A 1ORQB 4ZOEA 4G42B 3R1GL 4M5ZL 4XGZB 3NGBB 1XAUA 5B8CB 4OI9A 4GAFB 1SJHB 2BHYA 3BKML 3QDJA 1T1XA 1QBML 3FONA 1YDPA 3KR3H 4M61B 3KYOB 4JFZL 3QQ3A 1YNKL 1INDL 3LDBC 1U8JB 3VH8A 3CFEA 4PLKD 1NGXA 4XP1H 2C3XA 3DGGA 4TVPL 1QLFB 4XB7A 3REVA 1SM3L 2GYSA 3FFCA 5HHPB 3RY6A 2CLVB 2DN7A 1UZ6F 2FX8H 5E8PA 3HNSH 1AQKH 4HK0B 4PJFB 5GRXG 4LHUA 1CK0L 3FAWA 3O2DL 1JUFA 3E6FB 3BH9A 2ICCA 4DTGL 2MPAL 5BMFL 3P73B 2PF6A 4KK8D 1VFAB 4XMPL 3VXRD 3THMH 3W9DA 4PJEA 3L7FA 1T6VN 5FHBL 4NZDA 4JDVB 3IU4L 4RX4A 1SBSH 5EORL 1EO8L 4UQ3B 5C1MB 1AY1H 3QEGH 3C60D 3MRLB 4JM2A 1UJ3A 5C0AA 3TNMA 3UXFA 4POYA 1YNLH 3S97C 4LHUG 4PJCE 4M7JH 5ANMA 5GIRB 2HFFA 1BQHA 1XF5A 4KY1L 4GRWF 4V1DD 1A6VH 35C8H 1AGEB 5I75B 4ZXBA 5JR1H 5T3ZL 2OQJB 1IL1B 4UU9B 4YUEH 2AK4A 4NNYB 1MCPL 4FXGB 2VLME 3MV7A 1KG0B 1FVDA 1TJIH 1DQQA 4LARH 5E6IC 1Y0LA 2G75A 3TESA 1QSFE 1MJ7L 5H94B 2IMMA 4IS6A 4JO4L 2OR9L 1RHHB 1QRNE 1BQHG 2E6JA 4U0RB 4KJQC 3DRTA 5JW4Q 5I6XC 1QBBA 4K94C 1JN6B 2FO1A 1I1FB 2JCCB 3KPSA 2DICA 3QCVL 3IF1B 3DV6B 4MD0B 4ODVL 4B41A 3FMGL 3F5WB 4OLXH 5E94B 1IGYA 3I6LE 5B38B 4XHJD 3DUSA 2CIKB 4Y5YA 3MLYH 2O5ZL 3C5JB 5E2UL 4NN6B 4K7PH 4OCSH 1AD9B 5D2NA 1EERB 3ROLA 4ODHL 1WWAX 2EC9T 4I3RL 2IBBA 2XY2A 4DN4L 5JNYB 1MWAL 4G9FA 2CGRL 1I85C 3NN8B 5DRXB 5D7SH 4OZ4A 5ETUA 1GAFH 5L7XH 3T0EA 3DRQB 4FTVB 3S37X 1FH5H 2FX9L 3STLA 2UWEE 3QUKA 1K5NB 5DRNA 5DFWH 2D4DA 5DUBB 3UTZB 1FL5B 4FFZH 1FL6A 3V4PL 4LSSH 4XAKD 5EOTB 2D7TH 4MJIA 5C09D 3RGVA 4ZYKB 1C7TA 2R2HA 3I02B 1QFUH 2BK8A 5EU7E 3ARQA 4WV1C 5LGHH 4QYOA 5I16B 1BFSA 4XNUL 2VKWA 5INCB 3RL1A 5HSFA 1BVZA 4J3VA 4WHCA 1CD0A 1AO7B 4K9EH 5HDBE 1KCRL 2LV4A 2XV6B 3QDJB 3ZKSD 3D9AH 3QWQB 1J0YA 4M6ML 4LPYA 3DVFA 2XFXA 4RWYL 1NGWA 4PJGA 2FZ3B 3IDXL 1NGXB 1CD9B 5HI4C 1KGCE 2IBZX 3VJ6B 2X4NA 4Q9BA 4HUVA 1Z2KA 4OCXL 5GHWH 5IT2L 1NH6A 3HUJE 5CIPA 5EU5A 5J9PB 2R2CA 1ZHNB 1IGJB 4LHUB 4WEBH 4Y89A 5KVEH 3WFHB 2APBA 3T8XB 1JUFB 3QO1A 3S34L 2JK5B 3A67H 3VMPA 1DANT 3L7FB 3LKRA 5IEHB 4QF1A 2JELL 5JXAH 4XX1E 3IFOB 3U4AA 5HI3C 3OAUH 6FABL 1RY7B 2IG2H 1HKFA 1BZ9A 5DJXA 3HPJB 3ZE2E 3QIUC 4X80L 1SJVA 1HINH 5C0AB 4P2RD 5D7JD 1MQKL 1XF2B 3ARVA 3MUY1 4KI5E 1F3JA 1BQHB 2OZ4A 5FF6B 4NC1E 4DAGH 3IDYB 1LK3L 2X05A 4A6YH 2OTWA 2YPVH 3BKCH 3B2VH 4H8WH 3PIQB 5INDA 2NY2C 5KOVC 5EU6B 2ESVA 3MXWL 3NH7L 3TO4B 3QZWG 3KNBB 1IAMA 4LKXB 3C8DA 4POZC 5CINH 4JPVL 1HI6B 4KDTA 3FJTA 3ARUA 1DQQB 2A6JA 1F02I 2J1KA 4LLQA 1PY9A 4YGAB 4MA3B 5I9QB 4NM4H 2MQCA 3EBAA 3ARBD 1EO5A 1BM3H 1N6VA 1KBGH 4BM7A 3RBSA 3ARPA 4IRSD 1NC4B 3MLVH 4LKCA 2HLAB 4R26L 1I4FB 4X4XB 4GBXD 1V7NH 4MAUH 1QFHA 1OTTC 3QH3B 4R0LA 2IANE 3CSYA 4G8GE 2VWEE 3TBVA 2QV2A 3DGCR 1MFEH 4WTWA 3TA3D 1BD2E 4YHZL 4S0SD 4P5MB 1HSBA 2FGWL 4GW4A 1T83A 3MGTA 4XNZB 1RZKC 5DHYA 5D2NB 1PBYA 1BEYL 4LCWB 2VDRH 4BZ2H 1BAFL 4RNRB 5E5UB 1DVFD 1EXUB 2DTML 4G9FB 5C6TL 1YQVL 3H9HB 3L3KB 4OCYH 1IT9L 3VE0A 3STLB 3UCRA 2BCKA 4LVHC 2DQUL 3C8HA 3GBNL 4UNUA 1UM4L 3KHOA 4H5SA 4PJ7B 4AL8H 4P2OB 1GZQA 1T5WB 2DQIL 4U1NB 5F3BB 1HWHB 3KLAB 1PX3A 4OQTA 1TJGL 3WDIA 5LWYL 4TPRL 4G6MH 5FO9A 1KEGL 1A6AB 1CXEA 5FFLA 2RFXB 3GSWB 4H25B 4HKZB 4OCNC 5GSVB 1ZANL 4MS8C 2ID5A 4TVPD 5HYQA 4FQ2H 5BQ7A 5DO2D 4CVUA 1AXTH 1RIVH 3MBXL 1DUZA 3GSRB 4R4FL 3N50A 2XFXB 3CU1A 3TF7C 1CI5A 3UTTE 4L4JA 4M02A 3UO1H 5T3XE 3X12A 4WNQB 4ONHA 3C09B 4RCAA 3GUTB 1I1AD 3SO5A 4E41A 4WFEE 3MRRB 4CW1A 3ILQD 2X4NB 2NY4C 4MXQC 3DX7B 3UTSA 3B2UD 5EU5B 2X89A 3AFLA 2Y07L 1FAKT 1X4XA 1OAYL 1BVLA 4BYHA 1M6OB 3VFWB 2HTKC 2V5SA 1CS6A 1H3XA 1NFDF 3LB6C 2XYCA 3QO1B 3BDYH 1D5IL 5CZKA 2QSQA 2CD0A 4XMLH 4JR9H 1RZJC 4XPHH 3OB0K 4PJAB 2YD7A 3QZWB 4JDZA 3G6JF 3U83A 3HLAA 5GJSH 1UB6B 1G9NH 5K9OB 1BZ9B 1H0DB 1NGPL 5DJXB 4U1GC 5HVFB 3RI5K 5IFJB 4Q9QH 5CEXB 4GXVL 1N64H 4RGND 4H0GA 3LMJH 1E6OL 2FX7L 3U7WL 3GSQA 4LOUC 1EBAA 5DD5H 1HHHB 1TENA 1NBZA 1SEBB 1YNTA 1Z0MA 2ESVB 1CFSA 3LQAL 1MJJA 3RA7L 1S8DA 5DMIL 1QSEB 1CDJA 3WXWL 3G5ZA 3T4YB 1TVBB 1PG7H 1HDMA 3KXFB 4RZCA 5JIPA 4YHMH 1OB1A 5K59F 4Z7WA 3SCMB 3K4ZA 3KLHD 3VFTA 2JJVA 2OJEB 2ZOKB 2IH3B 5JMOC 4G7YL 4WFFE 3UJIH 3TPUA 3J8F7 1Z3GH 4LMQE 2OK0H 4Z76A 4R7NA 1AHWC 3L3GB 3RI5F 1FC2D 1FZJA 4OZHA 1S9XB 4YK4C 5I1DA 1J1XL 1U2CA 1QNZL 4Q58C 2DDQL 4MCYA 1KIPA 3L7EB 5D1XA 3HFMH 3OKDB 1T66D 5DHYB 2XWTB 2LU7A 4I2XA 4M43L 3KPRE 4XPFH 2OZ4L 3ZDXE 4ZQKB 3MRDA 2H6PB 3RFZC 1UEMA 4FQJH 4P5TA 5A3ID 5DJ6A 2V17H 3IDGA 2WM0A 4H20L 5J12C 2QSVA 1J5OL 2FHFA 1FYTA 4DGVL 3VE0B 2J8UE 4X7SH 1E4XH 1CFNB 3BP4A 4EXKA 5LQBH 4H5SB 4OZGE 5HGGS 4MMZC 3QUZC 2BXZA 1TPXC 2AJ3A 5SWZA 3RZCB 4OAWA 4IRZL 2R56L 4FQLH 3TT3H 2YN5A 3NCJL 3BZEA 4FQXB 3O6MH 4YHNB 2IAMD 4KZDH 5MEND 3U6RA 2OBGA 3MACL 5IKCA 4RA3A 4K3HA 2XG4A 4FXKA 1BWMA 3BD4A 3X3FL 2MHAA 4G3YH 1WEJL 5IESL 1IJ9A 1LEGA 4I13B 3C5ZD 2B1HL 2Q87A 2IALA 1SY6L 2BMKA 2YEZB 2YPLA 3CIQA 1QBLH 1LEIA 1T20A 4KKBC 4QGYA 4NWTL 2PUQT 1RMFL 1R5IB 4PGCA 3QXDA 3V8OA 5EBGA 1CZ8L 4DFIA 3CXDH 4QRPE 1A7PL 3D69A 1S78C 1CD8A 2A0LC 2X4TA 2ZSWA 4LLVA 4Y2DB 2YSSA 3U30B 1D9KC 4GKSA 4I48A 3SDAA 3GRWA 4NQSA 1FV1A 2ARWA 1FBIH 3V8CA 2CKBB 4JDTH 1I9JL 3SEPA 2P43B 3MNVB 3FO1B 4C4KT 1OTUC 1S7TB 2V2TB 3PWVA 3HC4H 4OQTL 4N0YH 5ELIA 5DURB 3WO3B 1JZ8A 2NY6C 3EYUH 5GGQL 1NCUA 4JDZB 3QDJD 3ZKMC 3ZL4H 1LP9E 1J1OH 2GY7B 4WO4B 3QXAA 2VSDA 4YE4L 3VD4A 4JFFB 2ZJSH 1W0WB 5GRUH 4NKIH 3BSZH 3RVXD 4H0HB 3W81A 4CDHA 1BQLH 1UT9A 5DEFB 3FFCD 3LKNA 2VISA 3B4NA 2C1OA 5DK0A 2HT4C 3GSQB 4JRYA 4CVZA 3O3AB 5AZ2L 4E0RB 3GSUA 4LHUD 4KMLB 4IOSD 1YEIH 2UY6A 1YNTB 4M7ZC 4NZUH 2CUIA 4QRQA 2BNUB 1B88A 1MLBA 5IUSA 2VE6B 3CSGA 3O6LL 5IB2A 3ZLQC 2NNAA 5HD8C 4XXCA 1J8HE 3O8XB 5K9QI 2WIMA 1ZLUK 2CDEA 4X6CB 4ELKA 1CF8H 3ZTNH 2IPKB 4RX4D 3SDDC 3FQTA 4K23L 3MCKA 4R7NB 4JM2D 5GS0L 5JUEH 1EAPB 4N5EC 4X7CC 3GHBL 1RZ7L 5HDLA 1CTNA 1NCBH 3GMLA 1YUHA 1F4XH 1C16B 1RPQA 2EDRA 3WE6A 4ZXBD 2YD1A 5K9QG 4WFHD 5IK3A 1KIPB 5EOQH 4G9DA 5E2VL 3V6ZA 4N90D 4GUPA 4QRSA 2AK4D 2OL3A 3HNVL 3W0WE 1ZXQA 1U3YA 3MV7D 2PETA 5IMOA 1KEML 3MGOB 4BH8A 5C6WH 4PJCF 2WBJC 3V0VA 5CJ5A 5FOBB 1G7LA 4OBSA 5DJ6B 2ZUUA 1LO2H 4K3DH 4P23B 5TE4H 2OTPA 1I8MA 1FYTB 2J6EH 4JFEE 3FB6B 4ERSH 4OM1H 5HHMB 1YEKH 3RIAF 4HFWB 4HT1H 3G6DL 4L3EB 3KPSD 3KLSA 3QXVA 5FCUL 4P9ML 2ICWA 1FFPB 1K8IA 3WFEL 2V7NA 4ZSOA 2KQNA 5FYJL 5D6CA 1A5FL 4UINL 4HPYL 5FGCE 4RSVA 4GG6E 2PYFA 3H9SB 5EU7C 3BW9A 3EIFA 1OF2A 2CLZA 1CXLA 3X13A 1HHIB 4YBQD 2QHRL 4P99A 3CSBA 1MCSA 3RUGA 4G7VL 2QJDA 5D1QA 1OP5H 4G9FD 4UTAH 5GQBA 4XPGL 3T0ED 5E00A 2ADFH 3QDMA 3D48R 2HT2C 3QXDB 3SQOL 1RUMH 3UAJC 1CGSH 1MAKA 2GJ6E 1EX0A 5IGXL 4X83A 2HJFB 5F1IA 1G7MA 4LLVB 5ALCH 4MJID 5DHXB 1BHGA 3RGVD 3SDAB 2XTJD 1A6PA 3QXTA 3BMWA 3U4BH 4X6FA 2NXZB 5J57B 4XP6L 1IGFL 3OXSA 5MHSD 2UWEF 2BY3A 2CO6B 2BSTA 3ZKQD 5F1SA 4UB0H 2CLRA 1EAJA 3FKUS 3BWUC 3ZKNC 4Y4FA 4JQXA 1OWWA 3QJFB 5E9DA 1KCSH 2PXYC 2IQ9H 3ZHDA 2JJSA 3KPMA 2EECA 3CSPA 3QR2A 3QXAB 4M9OA 3FHAA 4RISH 3RHWK 5I8OH 4O58H 3MLZH 1A3RL 5KOMC 4N8PA 1MJ8H 2G2RA 5DUPL 1QR1B 3O4LE 2W60B 4L4VE 4PFEA 4RAUA 3Q0HA 4NC1C 3KYMB 4U6TA 5I1AA 5HDBF 4CVZB 5I18H 1LO5A 4N1HB 4OF0A 2OM5A 3OKEA 5CWSA 5C0RH 4HJJH 3VXME 4APQB 3I50H 4UQ2A 3SDYL 3OXRB 5IQ9B 1ZA6A 2GUOB 1EFQA 4PP1D 3KYKH 4U0QB 5T1KA 3AXLB 1I7RA 3WSQL 4RMWA 5IMMA 4LSDA 3HUJF 3GRWL 4OUOA 3EO0A 1WZKA 4W4OA 5CD3B 1B2WH 4YBLC 3RHWF 3V4VH 3IS0X 3MBEC 4EUPA 4J6RH 4KK6C 2HYMA 1OSZA 3LPGA 1D3CA 3QHZH 3WE6B 2AV1B 4MXVF 3F8UB 3PDOB 1FJ1A 4JFQB 2ESVD 4MA1C 3W9EA 3ZE2F 1RZ8B 1U8HA 1RZIA 3QG7L 4E5XB 1F11B 1GGIH 3TIEA 1A0QL 3F7YA 3V0VB 1L0XA 3LOWA 3VGHA 5DGQA 5DXWA 4P2YA 5JW4M 3N1QC 4EUPG 2OR8A 2Z0BA 5KZCD 5ECJE 4LSQH 4XPTL 1MIML 4KI1A 3VWKA 4GQ9H 5GZOC 3WIHA 3QEHA 4FFVC 1AXSA 2D31A 4XZUB 3ZE0E 3NAAH 1G9EA 2AGJH 4Q2ZB 3V79C 3S96B 1DP0A 2EDJA 5IW1B 3GBML 3I2CH 1ITCA 3MYZA 2W0PA 7CGTA 4ZSOB 4X4YA 3M1BA 2VLKA 4DK6A 5D6CB 1EHLL 4F80A 5HY9A 4KKLD 4MAYC 4KKCD 5SWSB 1MI5A 2CLZB 3T2NH 1U6AH 3BGMB 4I0PB 4L8SB 4LCIH 1REIA 3CPLB 1JVKA 4K7PX 5BVPH 3OKLB 4HCRH 4OCWL 1OCWH 3MLTB 4JN1L 2C1PA 5E00B 1INQA 1R3IH 3ULVE 1MCWM 3I3BA 3SKMB 2OL3L 2BNRB 5FYKU 4HIJB 3VFVA 4LRNL 4OIAA 1G84A 4LRIA 1A9EA 2KZ1B 1SQ2N 2A83A 3QHFL 5I8KH 1WWWX 1EJOL 3U79A 3FOMB 1CTOA 2CO7B 5K93A 4KTEL 5CGYC 2PTTA 1XF3A 2Y36H 4ENEC 4NNPL 2CLRB 3V7AG 3G9AB 1SJEA 1A64A 2CK0H 5LCVH 4U1MA 1X5ZA 3MOAL 4JLRA 1NLBL 5I1EL 3WO4C 5FUZH 4NWUL 4WI9A 5FYKD 5E9DB 4MD5B 3QIWC 3KPMB 2BY0A 1C5DA 3VMNA 3BJ91 4LPCA 1MCOL 3IFLL 4GG8A 4E41D 4CMHC 3WLWC 4Z0XA 2G2RB 4K7FA 2B4CL 5ACZB 2BVPA 5FOJA 1V7ML 2JCCE 4ODBD 3UTSD 4NGHH 2X89D 3U7YH 1LO5B 5TF1L 5TFSL 4ODSL 3VRJA 1UH3A 4PR5A 5KW9L 3SKJH 2EIDA 4YHYC 5FYLH 5GRYA 5AZEL 4F7PB 4OB5L 5GS0D 2Q7NA 3QUXA 4XAWH 4YHKL 4HIXL 4XT1C 5HI5C 5TQ2H 2C5DC 1I7RB 4XWOD 2F5BL 3D0VB 1M7XA 1VEOA 4MXWH 1D5ZB 3HZYA 2VMFA 2D03H 4FTVE 2FLRT 1S7WB 3EDKA 1R6VA 1OGAA 1Z9OA 2EH8H 2EYRB 4LF3A 2VAJA 3AY4C 4YFEA 4Y5XB 3FN9A 3DVNB 4ZUVB 1K6QH 1YN7A 5JXEA 1FFRA 4IHOB 2BVYA 5ITBH 3QQ9C 1YY8B 4YEFA 1X5JA 5I1HH 1HHKB 1P53A 4WW2A 2NYYD 3RPKA 1MAMH 3TN0C 1AQKL 2H9GB 5HYEA 4OFKA 5CJQL 2NY1C 1AO7E 1JGUH 2AV7A 2A1WH 5L9DH 3L9RA 4LAQH 4C57C 2YXFA 4KRNA 4XWGL 3PXJA 3THML 3SDXB 1FPTH 1U2HA 3QULA 4PJ5A 2HT3D 3FO0H 4C83B 2VB5A 3HR6A 1DBAH 3QEHB 4HGWA 4AM0A 1AXSB 3TP4A 3IETB 2VL4A 2DF3A 4L9LA 1Q94B 2ENSA 5IBTH 2DJUA 3INUL 3OKNA 2C4FU 3BPLC 5IM7A 2WIIA 3M1BB 1FGNH 5D1XD 2I9LA 5GS1B 4OIIL 3IDIA 1BZ7A 1A6VL 1DTUA 35C8L 3MA7A 3UROR 1KB5B 4NM8L 4RA0C 1EEYA 3SDCA 3HG1A 4LGPB 4P5TD 2ATPB 3KLDA 1TVHA 4U6XB 3WD5H 1FYTD 3QUYA 4HC1A 1MCDA 1MHPL 1IQDB 2WWKO 4KXZI 3VFVB 2AKRA 3R06A 5F1NB 4WGWB 2DQJH 1BBJB 4Z7UA 5SWZD 3UDWC 1J86A 1MCRA 4L3CA 3ZDXF 5GGRA 3WHE1 1NAMA 4JO3H 2FEEL 1JNJA 1DL7H 2CPCA 2BVQA 4OSUL 2HFGH 2J8UF 3AROA 1XF3B 3QNYA 4KRPB 1SJEB 4I3GA 4U1MB 4OZGF 4JLRB 2EH7L 3AREC 2IH1B 4R2GD 3CVHH 2PO6C 1RUPH 5CCKH 5IW6B 2WUCH 1ZV5A 2YPLD 1J7VR 1KJ2H 1T22B 4KROB 1IGMH 2VDQH 4LNVA 4CNIB 4F15B 4CN6A 1A3LL 4P49A 4Q6IB 5CMAB 1XEDA 5FCSH 4OF3A 4Z0XB 5C07A 2FATL 1F4HA 1FH5L 2LTQB 3D0LA 1RK1B 5IR1A 3SKOA 4Q6YA 2PKDA 3GSNA 2W9LA 3QCUH 4FNLH 1XGUB 4JFHD 3SDAD 2IFGA 1KJ3L 2X70A 4LSVH 4GKOA 2NXZD 4FFZL 2D2OA 4PYHA 4O5LL 2OMBA 4LSSL 3RTQB 2D7TL 2JE8A 4LCWE 1XH3A 1YA5A 5FUOL 2YZ1A 2RAMA 5C2BL 2VZOA 1N8ZB 2HKHL 5KSAC 4ZUSB 1WUNT 4QOKB 2VLJB 4OZIF 2AJSH 3PL6C 5F96H 4LQ1A 4K9EL 3KYAA 4JKLA 3D9AL 5I17B 2VZUA 4PJ7E 2FRGP 5BO1H 1ITBB 4YXHH 3Q6FB 4OCMC 3P9LB 4JRYD 1E4JA 2CUMA 3T77A 3OX8B 1NPUA 4R8WH 5F8RC 3DXAA 4BQ8A 3FTGB 1LP9F 3GJFA 3BDXA 2I5YH 5GHWL 5IMLA 3QA3A 2R1XB 1OTSD 1BOGB 2A74A 4XVJH 5KG9B 2DTSA 4HKXB 4PTTB 3LZFH 4WEBL 3KPOB 5F44A 5FECB 5KS9A 4OM0H 4ZUUA 2CXKA 4NO0A 2AV7B 3BP5B 5DHVB 3IDJB 3L1OL 3V5KB 4UBDC 5JDSB 3SKNB 2CXGA 1ZWIA 1T0NA 4HGWB 1V8HA 4PGJA 5JXAL 3PP3K 2EDXA 2IG2L 4S1DD 3MUHL 1YY9C 3DMMC 3UJJH 1MLCB 1B4JL 4YC2C 2OXGA 2VLLB 2W91A 5BS0A 1KLGB 2WIIB 3IB4A 4D0CA 5D2LB 1Q9LA 1V3LA 2GAZA 4CADB 3DBXA 3EFFB 3MZGB 4DAGL 2I07A 4FFYH 5DF0A 2K3TA 2XN9B 1XIWC 3BJLA 3BKCL 1AXIB 4H8WL 5J13B 3ZYJA 4F9LC 1EEYB 3SDCB 1E6JH 1NBYB 5C0IB 3JWDH 3L5WB 4PJAE 2FWOA 4WTZA 1ZLVK 3SGJA 2KPNA 5CINL 1R24A 5HYJB 1KCLA 3QEUA 1FFNA 4ZTPL 4ZOCA 4NM4L 2ZKHH 5BRZA 1RFDL 4FXLA 3H0TA 1BM3L 3R06B 1KBGL 2YWYA 3QPQD 2QEJA 2W0FA 1WBYA 3WNMA 3MLVL 3RWHA 4DKFL 4MD4A 4HULB 5GGRB 4Y4HB 3O81A 4MAUL 4Q9RH 5F9OL 3IXTA 1MCJA 2VXTH 4WTZG 1E4KA 5EO1A 2BVQB 5C0GB 1WICA 1CGXA 1QSEE 2HMID 1Q9KA 1ZT1A 4QLRA 4NZRL 1YJDH 3KXFE 2HVJB 4XI5C 2ICEB 5D1QD 4MDIB 3GI9H 5D70L 4MQTB 3QDMD 3MO1A 5E2TH 4GG6F 3UTQB 5FB8B 5CHNA 1M05B 4EOWL 2VXVH 3BPOC 3QDGB 3BT2H 3DHMA 2KUTA 3D0LB 1T1ZB 3CMOH 3SKOB 1OP3H 3ARGC 4AL8L 5DA4A 4YFLI 3ULUL 2XG5A 4HC1L 4YHPA 4NHUB 1YEDB 4N68A 4OZFA 3EOAB 3MNZA 1NAKL 4G6ML 3RNKB 1HNGA 3OR6B 1WZ1H 3G04A 1FVCB 3C2AH 1DBBH 2V9TA 4IBLT 4Y4FD 2Q3ZA 3QFJA 4AQ1B 1NAML 4JFDA 4JRWA 1W8NA 5E9DD 1Z5LB 5FUCE 5GGRY 1CFTA 4FQ2L 3O2VH 1HYRC 4HPOL 2M2DA 1AXTL 1J12A 3MXVL 3GGWB 5B3JE 5I1KH 1S3KH 5IB5A 4OZFG 2CJUH 2G5RA 3T77B 3M45A 4X8JA 2IFFL 5GGTA 2XKSA 1U3HB 5T1LB 4P4KC 4JO1H 1HH9A 3M8OH 2A74B 4OLYH 1DQJA 1GZPB 2NY7L 5F8QC 1VEPA 5T1KD 4PRDB 5KS9B 3GSNL 3X3GH 3NFNB 5DVOA 3BDYL 1NSNH 2D7OA 1F3RB 1F3DJ 1UYWL 3PHQB 1LO0H 3HB3D 2D7PA 4JR9L 4XPHL 3VWJB 1NFIA 1EUTA 5IVNA 1CE6A 1T0NB 4L5FH 3AS3A 1JI2A 3VXPB 1G9NL 4XCYA 3SBWA 4ETQB 4NRZA 4GKZA 1A3QA 3PP4H 4O02H 4EEEA 2IQAA 5IFHL 4AZ8A 4Q9QL 2NY0C 5BS0B 4D0CB 5HDQL 1Q9LB 2FSEB 1HSAB 3VXUA 4UT7H 5BW7C 3LMJL 3H2WA 1FORL 4RGOH 2I07B 5L8KB 1BJ1J 5DD5L 4CBPA 1N7MH 3KPPB 1ZK9A 1DBKL 2FWOB 2AXGA 3CH8A 5HHNA 4M6OH 4QTIH 5CJBA 1HQRA 4PB0L 5HGAA 3G5VA 4P59H 4TNVF 3VWKD 3T0BA 1U95A 5CJXC 3PGFH 4U7KA 3UTPE 3W2DL 1Z3GL 2WP3T 1XT5A 2GIYA 4LIQL 2I27N 3RWIB 3V6OE 4NQDB 3RKDC 4NKDB 3UZEA 5L6YH 5I75C 1CFQA 4ELMB 3IXTB 2VLKD 3EYVB 3CCHB 1OAUL 1MI5D 3FT2A 1JYNA 3O9WC 4WY7H 1ZT1B 1H8NA 4MZ3A 3TCXA 3GSOA 5D6DC 3ZE0F 1KOAA 3I85A 2MJWA 5C6PB 1HYSD 4X6CE 3TZVC 1U91A 1YMME 1FL3A 3MO1B 3D2UA 1I85A 2HH0H 4H1LA 1WAAE 4M1GL 5CHNB 4HX1A 4U1LB 5TQ0H 3UYRH 4L8DA 2OSLA 5EU3B 4BKLA 5BVJB 3QNZB 3TH3T 4X7SL 1BFOA 1JNHB 4AG4H 1AJ7H 2X1PA 2MCPL 4BQ6A 3L95A 1JNLL 1CBVH 4KUZH 3NIDF 1U8IB 3VG9B 4YQXL 1AR1D 4WVRA 2VQ1B 3LRGA 4G6FD 2FCBA 3ULVF 4L29A 3VFGL 1FAIH 3RWJB 4F7EB 2EC8A 4OZFB 3C5SA 3I9GL 3NACH 1N0XH 3DROB 5E0QA 4KZDL 2RQ8A 1KENL 2GY5A 4NUGH 4WV1A 4OFVA 4XBEH 1C1EL 3QFJB 1I8KA 4JFDB 3BEWA 3MV9A 2E9IA 3TNNA 4KROD 2Q6WB 1B0GB 3QFDB 4C56E 4GRWB 1ZVYA 1JGVH 3EHBC 5LGKA 4PREB 4IRJA 4ZD3H 5HHME 3LDBB 2DQEH 4F7MA 1RULL 3LV3B 4L3EE 3X11B 3NFSL 2RCSL 4MNHB 3BPCB 1FN4B 1GGBH 3ZSSA 1W72B 2DMBA 4OGYH 4X8JB 4ZS6C 3TV3H 2B7DT 3IFPB 2DQGH 3FZUD 3MRJB 5I71C 3H9SE 3QUXD 5EZOH 1E4WH 4JY5H 4UOJA 5LAXA 3BESR 1XCTA 3HHRB 3JV4B 1CDBA 5C86A 2JCCF 1EFXA 2QQLL 4FRWA 2ADIB 1YEEL 1ED3A 3NMEA 2ZPKH 3BUYA 3PGDA 1NFIB 1OGAD 4N0YL 5JW3H 4GXUN 2QQKH 3EYUL 4J1UA 4L8CB 2BDNH 3TH4T 5ALBH 1A14L 4XCYB 4OFDA 2DQFA 4MNGA 5JZ7D 1S7UA 5JXED 5C0ND 2ZJSL 3TJHD 5DLML 5CEZE 1RJZB 4NKIL 3WS6A 4I5BB 3BSZL 5ITFA 4HWEL 4Z8FH 3SGKC 1F4YH 1JZ6A 1BQLL 4UDUA 1YYLL 4U1KB 4PRNB 2DL9A 2FJGA 1S9VA 4MCZB 1A6TB 3R0NA 2Z92B 1NCDH 4YWGH 4JJ5A 4QT5A 5FGBA 2AQ1A 3DETD 4RBPK 3O3BA 4P2QB 4NZUL 3IGAA 2AXGB 5F6IC 5DJDB 4PJXB 4MX7A 1F97A 2VR9A 5MERB 5GGTL 1NMBL 1B0RB 4I18A 4JG1H 5E6IB 3VXNA 3FN3A 5HGAB 5T1MB 3IS1X 4PJ5D 3BAEH 1UEYA 1R0AH 3NVQA 1A7RH 1N2RA 3DX9B 4QRRB 1CF8L 3VFMB 3JWNC 2C3VA 1QFWI 2AJYH 5KVFH 1MFAH 5JUEL 3STBA 1NCTA 1T2QH 5I6XB 4C4KO 1VFBB 1CXFA 3O6KL 5AG9A 4TUJB 1NCBL 5LG1A 2NZIA 3QI9C 1B3JA 4NYLA 1CL7L 4XNMA 4Y5VC 4K07A 3AMKA 3RDTC 5DSCB 3EO1B 3MV8D 5A2FA 3SDCD 1N5YH 3NCEB 3GSOB 4KDWA 1U8NB 3HG1D 1OAQH 3BI9X 1G7PB 2A9ML 2HFTA 1HZHL 1FNFA 1YQ2A 1U8MB 4JPIA 3T0AA 3ULUD 3QUYD 4ZFGH 1G6RA 2FYYA 2VJXA 5AYUH 1RURH 4GMSL 4I9WE 1CLZL 4NQXB 5TE4L 2DLFH 1WCBA 1NFDA 1UWEH 1W0VA 2B5IC 5D71L 1ACZA 3PJSA 5DMGD 5FKPA 3KS0J 1I9RL 5JLZA 1OP9A 4N9GA 2XZAH 3G6JA 3DO7B 5HYFA 5BJTA 1IM9A 1R3KB 4JREB 4ZMAT 2JJUA 4XNZC 5E6YA 1NGYB 1Y6MR 4M62H 4NQCB 4FQIH 4HKJA 1BIHA 4WV1B 5A2JH 3GI8L 1FP5A 3WNNA 4GQPH 5E2WL 5EIQA 5TPWH 3PXHA 1YZZA 4OJFL 4BSVB 4OV5B 5ESQB 2QL1A 5I76B 5KSBE 1AIFA 3EYSH 3CDCA 2WAHA 5IHBA 2ARJA 5C07D 4P2OC 3A6BH 5SX5K 4YDJB 4MDJA 3IAGC 4F7MB 1A1NA 3L6FA 4K55A 1IC4L 1WC7B 4GW1A 4QGTA 2H32H 2BZDA 1PSKL 3LKOA 5ILTH 3TBWA 2X4UA 4WW1A 4AH2B 3F62A 4F37K 5JO5A 5D72L 1F4WH 5SWSE 2X9YA 4PB9L 5D1ZC 3MMEA 2V2XA 1EGJA 4LLDB 5LAXB 3U4BL 1QOKA 4V2BA 4O2FA 2HG5A 4F7TA 5AD0A 1EFXB 1CU4H 4M1DH 2N7AA 1ED3B 4HLZH 3BUYB 1FRGH 3HR5A 2VDMH 4XAKE 2BNRE 5IEKA 1AD0A 1WF5A 3FQNA 1KCSL 2IQ9L 3QIUB 1UWXK 1Q38A 3MLZL 5D4QA 5L0QC 5HHXH 3CMGA 3K4DA 3DXAD 1MJ8L 2YN3A 2HFEA 5BOPA 3QP3A 2RBLA 4FQHA 4UDUB 4KUCD 4JGMA 1S9VB 4HHAA 4Z7VF 2A6DA 4U6HB 4XBGA 5I18L 1IEAB 1U93B 2NY2B 4PG9A 3HPLB 1GC1L 4PJ7F 2HLFD 1R3HA 5C0RL 1HILA 1RIHH 3WNLA 4NJ9L 4NO0D 3I50L 4Y16A 4HWBH 4G6AD 5IJVB 3EYOA 4PRAB 5F3HA 1Q1JL 2E6QA 3JWDC 3AVEA 4HAFA 4W68A 2SEBB 3RAJL 1X5XA 4S2SA 3U0PB 3V0WH 4WU5B 3VFSA 1DBJL 4N8VG 1B2WL 1AHWA 2P7TA 2VN4A 4OKVA 5BS0D 2P49B 1RSFA 3V4VL 3KAAA 4ETYA 3H3BC 4NYLB 3F7VB 3EJZC 4P3DB 4TSCL 5AUMB 2YRPA 3B6SB 5E56A 4HD9A 1JPTL 5IMKB 2DWEB 2P8MA 2FBOJ 2DJ4A 2DYPA 4EJ1C 3IJSA 3CFCL 3LSOA 3PV6A 2W59A 1H15A 2ZZUT 4ZFZA 1GGIL 3FB7A 1KPRB 1VACA 3SY0A 2E8ZA 2B1AH 1YJDC 5FO8A 3WFBL 3HRZA 3HMXH 3IKKA 2F54A 4F7CA 5BRZD 3FB5B 4QHMB 4X5LA 1RZGB 1A1OB 2BVOA 4G8EB 4LVHB 2YD2A 2P44B 4PJAF 1HHJA 4JHWH 4S0TD 4TSBH 5CUSH 4N8CL 4U7MA 1JRHI 3GO1H 3PJSB 4PGEA 1RQ5A 5JLZB 2QQNL 4GLRI 3QUZA 1DN0A 2Q86B 4M7KH 3UYOD 5JOPE 3PV7A 2AGJL 2OMNA 4U6YA 3G6JB 2YD3A 4LVEA 1E27A 3I2CL 5EC2B 5MEQB 2RB8A 3H42H 4ONFL 5IB4A 4EI6A 4Q9CA 2DM7A 5J0BA 1NMCC 1G7IB 1MF2H 4MVBD 5JQ6H 3BZ4A 4HKJB 4WHDA 4JQVC 3FCTA 3MRQA 3T2NL 4P2CG 5DUML 4LCIL 1QQDA 5F7MC 5BVPL 4XPBH 4PRIB 4QRUB 1XR9A 1ZTXH 1KN2H 1F58H 5D93C 2WMPA 4D9RE 4U31A 1IZKA 3ECBA 3QNXB 3TBYB 1RAMA 5FK9B 1K2DA 2YZ8A 4YZFE 5I66B 2HWZL 2F74B 1JPGB 3FB8A 3TBWB 4FQXC 3D3VB 1G6RL 2NY4B 2XA8L 2DKMA 3WIFA 4LPVA 2BC4A 2X4SA 5BZDA 3R1GH 4M5ZH 2C3HA 5I8KL 4PY8J 15C8L 3GMOB 3M07A 3K2UL 2IADA 1T5XB 5IWLA 1CDIA 5CILL 3EZJB 4DGIH 2IJ0C 3GMNB 3BKMH 4JFDD 4O2FB 4ZDHA 4NO3B 3C8KA 5LCVL 2CK0L 1T7ZA 3V7AE 5J6HA 4JFZH 1J0ZA 4AEIL 4Z78A 1INDH 5IEKB 1AD0B 4RMQA 4MJ4A 3BKJL 4TVPH 2VITB 2HJLB 4U1GB 1SM3H 3JTSB 1F90L 4R4ND 2VLRE 3QUMA 4J3WA 4EI5D 5H37H 4PJCA 2Z93A 1CK0H 4JZNA 4JZOB 4N8VB 5I8CB 5A43C 2A6DB 2ITCA 2MPAH 4QTHA 3U7YL 5DVLA 5B3JF 3L3IA 3N9GH 1HILB 3ABZA 3O6FC 3JZ7A 1T04A 5FYLL 3QJHA 1AC6A 5FHBH 1I8LC 3F65A 4MNQD 3LKQA 3IU4H 3C6LC 2D7MA 2PN5A 1Z9SA 3ARFA 4WI4A 4Q7DA 1Z0NA 5F3HB 1QBAA 3IKCA 5TQ2L 5EORH 1EO8H 5F7NC 1QSFA 4WUUB 1S7VB 4QHUA 3RGHA 1IC7L 5C0JB 3MREA 1FGVL 1QRNA 2D03L 1AHWB 2EH8L 4KY1H 3RVUC 4LHQB 3V6OC 1FNGB 2BOCB 4LCYB 2ARJQ 3BN9C 1K6QL 2R39A 3VXUD 2N7BA 3ILPA 1UZ8B 1WVZA 5HGHA 2G5BA 1IGIL 4Y19E 3QIBA 5T3ZE 5I1HL 1U92B 1T4KB 2P8MB 3LIZL 4FFWC 1QLRA 4DZBA 1JWSA 2V5TA 3RWFA 5T1DH 1MAML 1MJ7H 2Z31A 4Y8AA 4QOKE 1PYWB 4JO4H 2VLJE 2OR9H 5I19L 5GSRA 4PJ9A 4ZFZB 3LD8C 3RY5A 3ZKXC 2HJKA 1QA9B 2AP2A 3HRZB 2P8LB 5DZLA 3GHEH 5L9DL 4LAQL 3MRPB 1R5WB 2NY3B 5KVGH 2GFBA 3ES6A 1I7TA 2UWEA 43CAA 1RUKH 3QCVH 5A1AA 3FO0L 2HTLD 4AEFA 1DBAL 3FMGH 4QRTB 4LASL 3QUZB 4K8RL 1TPXB 3FO9A 3CFDA 4HJ0C 4WJ5B 4NQTA 3D85A 2QLVB 1H5BA 5F9JB 3P4OA 3C6SB 4EI6B 5I2IB 3UZQA 4XVTH 3BZ4B 4DN4H 1HNFA 5EZLA 1MWAH 1G7QB 5AWNL 1QQDB 1VPOL 2Q76B 4P23C 3IDNA 2GSIB 2FX9H 3D2UD 5E1AA 4RAVA 5ISZA 4HUMB 4J3OC 4J8RB 2EYTA 4I77L 2QSCL 5GGUA 2NCMA 1K2DB 1CCZA 1ADQH 3F6IA 1I3RB 1VSCA 2Q20A 4D8PB 4NZTL 4CGTA 4HWZA 2DQJL 1HCVA 3IJYA 2APXA 5D2LE 5SX4H 4X6CF 4TNWK 4P46C 5JW5A 3HUJA 5E8EA 2D0GA 2X4SB 1D9KB 4JO3L 5ID0A 1WAAF 2XN9E 4KTDL 4LLUB 5L2KE 1JWUA 2E9BA 1AKJB 3VDAA 1CIUA 2XKNA 5TH2A 5DDHB 4JRXB 3VCLB 4NO5A 4FABL 3VRLE 2HFGL 1KCRH 3MV9D 1OAKH 4YAQB 5J1AA 2NW2B 3C8KB 3MRNA 4RWYH 4QWWC 3MV01 5CP3A 3V0AC 1UB5B 1ZT7B 5HYJE 2NY6B 3GJEA 1FSKC 3AM8C 3IDXH 2PXYA 1KJ2L 5FO7A 2VXQL 1SYVA 4IRJD 1IGML 4EQ2A 5EDXA 1MELA 1PDKA 3ARDB 3AAZA 4OCXH 5IT2H 3HMWL 4HUXA 5DT1L 5HI4D 1QVOA 1U8KB 2X4QA 2O5YL 5DR5H 1BQUA 5E2JA 2XWJA 4J3SA 1FZKB 1AI1H 3RJQB 4JZNB 3GMRB 1AGCA 2A6KA 3TCLA 1KLFA 4KK5D 5DJZB 4TNWF 1A4KB 4QTHB 2FD6L 2H8PA 1C12A 4GRLC 4X6EB 3L3IB 4LSVL 1BIIB 3GKWL 4KVNL 2E7LA 2UY7A 4XB8A 4J7RA 3MRCA 2PNDA 4L8BA 1EFXD 2JELH 3PWJA 3LKQB 5JA8B 2ATKB 2KBGA 1NGQL 4LLAA 6FABH 2WK2A 3V6FA 1IAKB 3PDGA 3MREB 1XZ0B 3SDDB 3QDGE 4YX2L 5F96L 4JHAL 3LS4H 2R0LH 1LK3H 2AAVA 3MRBA 4F2MA 5CZVL 1R5VA 3MBEA 5BO1L 3EUUA 2IANA 4G8GA 5DS8B 1M7DB 4FQ1L 1P84J 2XNAA 2H26B 2P4AB 3NH7H 3N85L 4DKEH 4APQC 5DWUL 5HGHB 4JPVH 4FQCL 2WBKA 3K80A 4TTDD 2PCPA 1J05B 3CXHJ 4NJAL 3CFKB 3C60C 3BO8B 3QUML 1BBDL 2X6MA 3DIFB 2WBJB 2P8PB 4CN4A 4OM0L 4HK3J 1GOGA 5IG7A 1WZLA 3JUZA 2DD8H 2DWDB 2CR6A 1HIML 43CAB 1CDHA 3F7PC 3O41B 2VDKL 3B8SA 3LN9A 2R69L 1T7YA 4YHZH 5HHVL 2YUXA 2VYRE 3CFDB 4QCIA 1I7UA 2FGWH 3D85B 4PJHE 2R0WL 1A6ZA 3NCMA 4NHCH 4NQEB 2GT9A 4GAYA 3P4OB 1URLA 1TZHA 4MAYA 2JB5L 3BD5A 3GSXA 3TVMA 4WU7A 3FQUB 3P0VH 1JPFB 1MFBL 1XGQA 1X7QB 1HCFX 4MA7L 2XPGA 5C6TH 5DJYA 2OLDA 3IDNB 5EUKB 1II4E 1K4CB 2VZTA 2DQUH 1UM4H 4L4TB 1T0PB 3UTTA 1H3TA 2DQIH 4XHJC 3QQ4A 5DJAB 2ZKHL 4LP5A 4Q97A 1T1YA 1TJGH 1BLNA 4PV8B 4G8FA 1HQ4B 2HP4A 2XTLA 1KEGH 4ZFFA 5KSVA 4QXTA 5FDWA 1DLHA 2R8SH 1KPVA 3C87A 1IM9D 3F7RA 4ONGH 1ZANH 1EK3A 1JWUB 4I0PC 5E5MA 1WK0A 2P45B 2DQHH 4J3UA 2XKNB 1QHOA 2Y6SC 4RMSA 2FHBA 4M7LL 3SN6N 1NL0H 3MYJA 3MBXH 4X4ME 4PJDB 2AJXL 4R4FH 3OWEA 4J4PA 2QHLA 2Q8AL 1FO0A 3CDGA 2M26A 4M6AA 1GL4B 2PXYB 2YD5A 2XRAH 3GI9L 3QIWA 4CN1A 3ARZA 1SYVB 4P3CL 4ZFOA 3D18B 5F7FA 5FA4A 1L0QA 4OV6F 4NT6A 5E2TL 1KTLB 4JE4B 4NQDE 1K9TA 2X4QB 2Y07H 5EU4B 1MFCH 2VXVL 3SKUD 4EN3C 1UXSA 1T21A 1DEEB 4ELME 1I8IA 2F58L 1D5IH 5KSBF 3HTLX 5D7IA 3OKYA 4XNYL 1A2YA 2HTKD 2IBGA 3LB6D 3CX5J 4HIHA 4A6YB 3GMMA 5I1IH 2JF1A 4L8BB 3PWJB 2ZG3A 1WZ1L 3V5HB 4DJMA 1NGPH 4N0RA 1YECH 5DMKA 3SE9H 1LD9A 1D5MA 5MEPB 5TE6L 1DDHA 3STZA 4OI8A 3LKPA 4R90L 4YBLB 2VERN 2R2EA 2XWBB 2FX7H 4PJIB 3U7WH 1EMTH 3WMSA 1R5VB 3MLSL 3D39B 1KYOJ 2IANB 4XBPA 3PG2A 3OJMB 5BCAA 2FECL 2H45A 2MKLC 4LOUD 1BD2B 3S3SA 2CJUL 3NOIA 5DMIH 3WXWH 1LNUA 4PJGE 4NN7B 1J11A 5D96B 3VFOA 4QHLB 5JW4R 2PCPB 4MA1B 4O2CB 5CIPH 2GJZA 5D7JC 4Y16D 1CGTA 5ESAA 1KCUH 5D9SB 1OGTA 4G7YH 4PTUA 2ZP0T 1LEKB 4K8RD 4JGUA 4GRWE 2EEBA 1JZ3A 3E6HB 1XGRB 4D9QE 5E70A 5AG8A 4LCCA 4AJ0A 5CBAA 1LO0L 2EDEA 1CQKA 2J8UA 1J1XH 4NPYA 1QNZH 5F7EL 2E7MA 4J3TA 2HRPL 4OZGA 5FA3A 3ULSB 1TMCB 1JZ2A 4WFGE 3PP4L 4UV7L 1I7UB 4M9PA 3O3EA 3JWOH 1D5XA 1FNHA 1P7KA 3ROOA 3BP6B 2GT9B 5DTFB 1E4XI 1TZHB 4UT7L 2OZ4H 4IRSC 5IJKA 5HHOB 4WU7B 3DOSA 4O51A 1MUJA 1XGQB 4QY8A 2DYPD 4GBXC 1L9MA 3ZYZA 5TJWK 1TCRA 4H20H 3RWGA 5DJYB 1J5OH 4M4PA 3DLQR 3EOBA 2X1OA 2F54D 4M6OL 1I1CA 3TA3C 4X5WA 3KS0H 4QTIL 3P0GB 5IFAH 4M6NL 5EA0H 1XF1A 2HVKB 4UIMA 5CSZB 1K4DA 1T1YB 1BLNB 3NCJH 3BZFB 2PW1A 4XCNB 3AS2A 5FKAA 4B5EA 3QUZD 1Y18A 5GRWA 1KLUB 1UWGH 4QXTB 2CR3A 2IPUG 1DLHB 1UQSA 1CFBA 1KPVB 3MACH 4XMKH 5F7KC 1IEBA 1S7SA 1JHTA 4CUCA 3X3FH 1WEJH 2BVUA 5IESH 1Q0YL 2B1HH 1J18A 1XGPB 1YYML 3PGCB 4K71C 3BFOA 3JV5A 5E8OA 3WS3B 4P2QE 3UPRB 3MYJB 1HHGA 4PJXE 1PQZB 2JIXA 4HZLA 1WWBX 3ARSA 4LAJH 3WO4B 2FLBT 3BIBX 1S7QA 4NWTH 4EVNA 1LP9A 4U7SA 4ZFOB 3TJEL 4QRRE 3HI6L 4UOW0 3BVNA 3IXAA 2FJHA 2B8OT 1A7PH 1NGZB 1PJ9A 4KGLA 2HH0L 3BGAA 4CMHB 5TQ0L 1DSFL 1AGDA 1JIBA 4HUUA 4BFIB 5EBLA 1T89C 1I8IB 5DO2C 1S78D 2MOVA 2A0LD 2ZG1A 1DN2A 3OAYH 4AG4L 1AJ7L 3NPSC 1I9JH 3RU8H 1CBVL 4OUUB 4UNTA 3O4OC 1FNEB 2Z4QA 5T3XL 1F42A 4OQTH 4PRHA 1FAIL 2ZUXA 1NDMB 3NACL 4PD4J 2WP3O 1GGYA 3ILQC 4Y4KA 3ET9F 4HIIB 4NUGL 1J8HA 1ZVHA 4I4WA 3QEQB 1GPOH 3PL6A 1NJ9B 2X7LA 4HUKB 2I9TB 5TE7L 5F72S 4HDIB 2R2EB 1JGVL 3AU1B 1ZHLB 2F19L 5JPMB 5FYKH 3DARA 3DNKA 5AZ2H 4OF6A 3S5LA 3PNWB 2ED8A 2DQEL 1JF6A 3PWUA 5F7DA 5IB3A 5DQJA 2Z35A 3PUCA 4LGRB 3O6LH 3RTQC 4EDXA 5FM5M 2AI0H 4HS6A 4NQCE 4ZPTB 4BELD 3TN0B 1OOAA 2GJZB 3W0WA 3O0RL 5ESAB 3MQIA 2VLMD 4RGNC 4ZNEE 5HD8D 3ARFD 3KPRB 4QXUH 1N5AB 4L9DA 4JY5L 2NY1B 4NO2A 5DD6A 4K23H 3F6LA 4KWUA 5KBNC 1QSFD 2NW3A 5GS0H 4KHTL 1N6UA 1S9WB 2VUOA 3S5LG 1UG9A 1QRND 4QHKI 4ISVA 2YBRB 3CUPA 4JFEA 1MEXH 2QQKL 3KYNB 4ORGB 3B3IB 3LN4B 2IMNA 1MJUH 5JHLL 4LDLB 5E2VH 5GS3A 1NC2A 1DUYA 3BPLB 3KLHC 4AK1A 1D5XB 3HNVH 4NC2B 3LAFA 1BVKB 3QIBD 1IE5A 1KC5L 3T09A 2NX5E 3EYQC 4GG6A 3PWLA 4B0MM 12E8L 4GRMB 2Z31D 4GFTB 3CVIL 3Q3GA 1CYGA 1NCDL 1R3LB 4YWGL 1V05A 1VGKA 3NFPA 2MQ3A 4PJ9D 4JAMB 4OLVH 1KIRA 4ODXB 3HE7A 4X7FC 2X1QA 4JG1L 1WTGT 1T3FA 4X9GA 3G6DH 5ICYA 2P5EB 1K4DB 3BEVA 4P9MH 1R0AL 1T66C 2PW1B 4FQQB 3MRHA 3WFEH 4XCFH 4QRPB 1ZVSA 1MHCB 4QHNA 2GJ6A 1IRAY 1A5FH 1UQSB 2AJYL 5KVFL 2BERA 3D85D 1IGTA 5A3IC 4OZIB 4EIZC 2QHRH 3IDMB 3AB0C 1DQDH 5HVHB 1XFPA 5FYJE 5C08E 3OKMB 1MFNA 4LBEB 1X5LA 4G7VH 1IAIM 4ODTH 1HHGB 3NCYS 1IQWH 2JIXB 1W8OA 3MJ8A 1N5YL 1V3JA 2EZ0D 3AREB 4AIXA 2IC2A 1OAQL 2PO6B 1A4JB 2YOCA 5EBWA 3R8BB 4BSWB 1C08A 1J0KA 3ARYA 2NLJB 5ISZD 2X4OA 5JOFA 1HOCA 4PJBE 2IAMC 1T03L 2DMCA 3BVNB 5IGXH 5HYSB 5AYUL 2C3WA 1RURL 5DZNA 3HC3L 2VOTA 3W11C 5TDNB 3UAJD 1KGCD 5EBLB 1V3KA 3O4LA 4L4VA 4XP6H 1UWEL 3ARGA 4NN5C 3X14A 3CLEH 4ZPVA 5BV7L 1U58B 2I60L 5ADPH 4NQVA 3VXMA 4DUVA 2R23A 4N5UA 4LPTA 1OT1A 4ZUTB 3TBSB 2X5PA 5KSAB 3LS5H 5D5MB 1A1MA 3T0DA 2GCYB 4I4WB 2PXYD 5TPWL 4R4BB 2BHUA 4RQQB 3VFRB 3HS0A 4O4YH 1XR8B 1T1WA 3EYSL 3VRLF 5DD0H 1Y6NR 3S5LB 3KPLA 4KI5D 3KDMB 5HHQA 4YLQT 3HI5H 3IVKA 1TCMA 1P9MA 2GJJA 5DQJB 5HGDB 4JFPB 3SDYH 3G08A 1BQSA 4KFZC 3VFUB 1QHPA 4KJYA 3WSQH 4P4KA 3B8YA 1F4WL 1ORQA 3W0WB 4G42A 4XGZA 2QTEA 2KQMA 3GRWH 1RU9L 3RVXC 2LE9A 4GW5B 5B8CA 1SJHA 4PRIE 3VG0L 2NW3B 2LU4A 4OLZH 4X4ZA 1FRGL 2YRLA 4M61A 3CUPB 3KYOA 1MCEA 4Z77B 3HNTH 3FHQA 1U8JA 4HEPG 5C9JB 1CLYL 1UKTA 1ZSDA 3MBED 2IAND 4G8GD 3DMMB 3A6OA 3K81A 1ZLWH 3D3VE 1KIQA 4WHYH 5HHPA 2AQ3A 4KTYA 5HHXL 1H3WM 2CLVA 1FYHB 3QG7H 4PIRF 4RIRB 4HK0A 5EC1A 2VAAA 2UUDK 2ZOLB 1A0QH 3PWLB 4JM2C 1UJ3C 3E6FA 1XIWB 3P73A 1VGEH 5F7UA 1VFAA 4XPTH 3MJGX 4CKVX 2ZNXA 5FM4A 1MIMH 4JDVA 4PV9A 4ZXBC 3HZVB 2EDDA 1T3FB 4UQ3A 2BNQE 3OMZA 3MRLA 5GZOD 4FZEH 3BEVB 3RVVD 1NANH 4FFVD 2ZNWA 5CJXA 1CDUA 1GRWA 1CWVA 1BMGA 1UENA 5KAQF 1WQVT 1WIUA 5GIRA 2GJ6B 2P5WE 4GKNB 1EHLH 1JP5A 2F15A 4UILH 1IGTB 1AGEA 1TNNA 3VGDA 2R29H 5TF0A 2OQJA 2DOCA 3WXVL 4MAYD 4U1SB 3TVMD 4UU9A 4NNYA 4OCWH 1IGCL 3MJ8B 1KG0A 5D6DA 1GGCL 3K74B 1A6UL 4WUKL 2FIKB 3JXAA 2OL3H 1KPUB 5EBWB 2NTFA 4WUUE 4PJHF 5H94A 4BFGA 4LRNH 1RHHA 4HXBH 3UTTD 4Y5YC 5T3XD 4JM2F 3BPOB 4WFED 4O9HL 3BDBA 1A7NH 2X1WL 3GIVB 4JG0L 3CDYA 1JN6A 3O4LB 1I1FA 2JCCA 3ARGB 3DV6A 4MD0A 5CUSL 3X14B 1K8DB 3GO1L 1T6WA 5E94A 4NNPH 6CGTA 1Z6JT 5B38A 4OKDA 4NQVB 2CIKA 3HRPA 5F89B 3C5JA 4NWUH 3KPTA 4ENED 1F00I 1AD9A 2V9QA 1MF2L 4J4PD 1DLFL 4FHBD 3AMLA 2VABB 4S1QL 4EDWL 1NUGA 1A1MB 1MCOH 1CG9B 2P46B 3QIWD 4JN2A 5DRXA 3RGVC 5GRZA 4BZYA 3GDBA 2B4CH 4FTVA 5HJ3B 3U2SB 3EO9L 1V7MH 1PKQB 1T1WB 3WLWD 3ZYOA 5TFSH 4ODSH 3KPLB 3IVKB 3VG9C 5DUBA 5KW9H 1FL5A 1ZEAL 4OB5H 3O2WL 3UYPA 4MQXC 4ZYKA 4YHKH 4HIXH 3E8UL 3I02A 3I6KA 1L0YA 2F5BH 3LQAC 5I16A 5INCA 3FRPA 5HI5D 4M93C 3K7UA 1AO7A 4ELMF 1OQXA 4DGIL 2X2YA 4O00A 1NMAH 2YA2A 4WFFD 3BH8B 2EDLA 2FZ3A 1ZSDB 4TVSa 2FH8A 4PP1C 4WWKB 3SHSA 3ALPA 3VJ6A 2X41A 1KIQB 4C55A 2NR6D 3QQ9D 2NY0B 2Z8VC 3FRPG 5J9PA 5C3LD 3SGKA 1ZHNA 5EC1B 4FMKA 3VI4F 2VAAB 4CRPA 1IGJA 5CJQH 3WFHA 5JHDE 2OI9B 2GITA 2NTSP 3T8XA 4JRXE 2VR5A 4W70A 4YFLF 3VFNB 5DQ9B 5JIKA 5IVOA 2JK5A 3IJHB 3VW3H 4XWGH 2Y7QB 4OGAC 3N9GL 2F53B 5FGSA 5IROC 1EBPA 4IM8A 2RHEA 1QSVA 3TFKD 5IEHA 4Y1AE 4PV9B 2VDOL 3IFOA 1JPSH 1RUAL 4PJGF 2DB8A 3HPJA 3UJTH 3INUH 1LO3L 3NIFE 4JANB 4NRXB 4OT1L 4WHTB 4M8VA 4KDTC 1XF2A 5IHZA 2J3SA 3RVWD 4OIIH 5FF6A 3P30H 5CLWA 2HA1A 1Q9WB 1H3UA 2EIZB 2W65A 3DI2B 4NM8H 3PIQA 3QI9A 4EUPH 2P42B 5EU6A 3T4AB 4Y5VA 3Q5TA 3TO4A 3EW3B 3NZ8B 3KNBA 5E7FA 3S3PA 4LKXA 3O9WB 1HI6A 1L6XA 3CZJA 3VU2A 4KDVA 4R0LC 2ILLA 2AJVH 3LY6A 5GGVL 4MA3A 1MHPH 5T1DL 2NTFB 5GGVY 4LFHG 3TZVB 1Q0XH 1SHMA 4MLSA 2BSED 3DSFL 2EXWD 1NC4A 2LVEA 2HLAA 4KKLC 2AJZB 1I4FA 4X4XA 3GHEL 3BGFC 3NA4A 4NCDA 5MP6H 3MROB 4JFXB 3QH3A 5HVWA 5KVGL 3DECA 3RL2B 5E99H 1RUKL 3U36A 2H2SC 4OSUH 1IFHH 4K3JL 4WI2A 3WIHH 5IHUL 2MCG1 3ULVL 2ADGB 2DIJA 4P5MA 3N0PB 3OAZK 2EH7H 2ERJC 3WN5C 1HKLL 5IB1B 1KCVH 4LCWA 4D9LH 3LRHA 2CKNA 4XVTL 4UAOC 4RNRA 2AS5M 1A3LH 1EXUA 4JN2B 1JYXA 3H9HA 3L3KA 4FMFA 4OCLC 5FHAL 4F57L 4F9PC 2FATH 1I1YB 4PGZA 5FEBA 4PJ7A 4PJXF 4MB4A 4P2OA 1QP1A 1T5WA 1KJ3H 1T7XA 4U1NA 5F3BA 1ADQL 3T1WA 3CD4A 5DGRA 3KLAA 4O5LH 2DLEA 3VDCA 2A6IB 4JREC 4NQEE 3SE4C 1A6AA 5FUOH 3QISA 3I6KB 5C2BH 4H26B 2RFXA 1AE6H 3GSWA 5I71B 4PRHD 2HKHH 4H25A 4ACPA 1ERNA 5D1ZA 4HKZA 5GSVA 4X5XB 5DC4B 3EOTL 4Y4KD 3VD5A 5EZIL 1J8HD 1KJVB 4AQOA 1KSRA 1OAKL 2COQA 1ZHBB 1QR4A 4LDOB 1BP3B 3GSRA 5EPMB 3PL6D 4L4TE 4CMMB 2BSRB 1ULVA 3QWOA 1JMXA 4WNQA 1TNMA 5GS0C 3GIZL 3GUTA 4NP4L 4XC3L 4GMTH 1FNLA 3MRRA 3ZYIA 2QADB 3DO3A 4XWOC 3DX7A 2VN7A 1KXQE 1TZIB 5DR5L