1KU1A

Crystal structure of the sec7 domain of yeast gea2
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
211
structure length
211
Chain Sequence
GLVPRGSHMDRKTEFIECTNAFNEKPKKGIPMLIEKGFIASDSDKDIAEFLFNNNNRMNKKTIGLLLCHPDKVSLLNEYIRLFDFSGLRVDEAIRILLTKFRLPGESQQIERIIEAFSSAYCENQDYDPSKISDNAEDDISTVQPDADSVFILSYSIIMLNTDLHNPQVKEHMSFEDYSGNLKGCCNHKDFPFWYLDRVYCSIRDKEIVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ARF guanine-nucleotide exchange factor 2
publication title Mechanism of domain closure of Sec7 domains and role in BFA sensitivity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Endocytosis/exocytosis
total genus 74
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01369 Sec7 Sec7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.20 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 1ku1A01
1.10.1000.11 Mainly Alpha Orthogonal Bundle Arf Nucleotide-binding Site Opener; domain 2 Arf Nucleotide-binding Site Opener,domain 2 1ku1A02
4C0AA 4A4PA 1XSZA 4D7QA 2R09A 1RE0B 4OIYA 1KU1A 2R0DA 3LTLA 3SWVA 1R8SE 1XT0B 4JMOA 3L8NA 1BC9A 4Z21A 1S9DE 4L5MA 4JXHA 4C7PA 1PBVA 4JWLA 1R8QE 4JMIA 4D7RA 1R8ME
chains in the Genus database with same CATH superfamily
4C0AA 1DK5A 2VXGA 1AOWA 3ABSA 2R09A 4FQ0C 1AIIA 1HVFA 4MDUA 1YIIA 1R4AE 3AO0A 3LTLA 3SWVA 1BCYA 1HAKA 2IICA 3USYA 1YCNA 2II2A 3ABOA 2XO2A 3ABQA 4MDVA 1M9IA 1UPTB 1XJLA 4D7QA 3ABRA 1BO9A 4EVFA 1KU1A 3TW5A 2R0DA 1ANXA 2IE6A 1G5NA 1S9DE 4HREA 4EVHA 1W7BA 2ZHJA 4JXHA 1ALAA 4JWLA 2HYWA 4JMIA 4D7RA 1R8ME 1DM5A 1AEIA 2IE7A 2ZHIA 1YGMA 2OY9A 4KMUX 1AVRA 2Q4CA 1N00A 2H0KA 1RE0B 4KN7X 4OIYA 1AXNA 1Q8DA 2XO3A 3HJLA 1AVCA 4X9PA 1MCXA 1BC0A 4Q2SA 1XT0B 1C1KA 1R8SE 4JMOA 1BC1A 4Z21A 2ZOCA 3BRXA 1PBVA 1ANWA 2QEZA 1A8AA 1QC7A 3SOHB 1YJ0A 1W45A 2HYVA 1BC3A 1BCWA 1LKVX 4A4PA 1N44A 1AVHA 1XSZA 2H0LA 1HVGA 2RANA 3ANYA 2HSNA 4JK1X 3AJCA 4FHRB 1A8BA 4KN4X 2H0MA 1W3WA 1ANNA 1N41A 3L8NA 1BC9A 4L5MA 3USWA 1N42A 1BCZA 1SAVA 1HM6A 1HVDA 4C7PA 1HVEA 1R8QE 2K6XA 1I4AA 2HYUA
chains in the Genus database with same CATH topology
4C0AA 1LKVX 4A4PA 1XSZA 4D7QA 2HSNA 4KMUX 2R09A 4FQ0C 4JK1X 3AJCA 1RE0B 4KN7X 1KU1A 4OIYA 4FHRB 1Q8DA 2R0DA 3TW5A 3HJLA 4KN4X 3LTLA 3SWVA 1R8SE 1XT0B 4JMOA 3L8NA 1BC9A 4Z21A 1S9DE 4L5MA 3USWA 3USYA 4JXHA 4C7PA 1PBVA 4JWLA 1R8QE 4JMIA 1QC7A 4D7RA 3SOHB 1R8ME 2K6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C0A A;  4A4P A;  1XSZ A;  4D7Q A;  2R09 A;  1RE0 B;  4OIY A;  1KU1 A;  2R0D A;  3LTL A;  3SWV A;  1R8S E;  1XT0 B;  4JMO A;  3L8N A;  1BC9 A;  4Z21 A;  1S9D E;  4L5M A;  4JXH A;  4C7P A;  1PBV A;  4JWL A;  1R8Q E;  4JMI A;  4D7R A;  1R8M E; 
#chains in the Genus database with same CATH topology
 4C0A A;  1DK5 A;  2VXG A;  1AOW A;  3ABS A;  2R09 A;  4FQ0 C;  1AII A;  1HVF A;  4MDU A;  1YII A;  1R4A E;  3AO0 A;  3LTL A;  3SWV A;  1BCY A;  1HAK A;  2IIC A;  3USY A;  1YCN A;  2II2 A;  3ABO A;  2XO2 A;  3ABQ A;  4MDV A;  1M9I A;  1UPT B;  1XJL A;  4D7Q A;  3ABR A;  1BO9 A;  4EVF A;  1KU1 A;  3TW5 A;  2R0D A;  1ANX A;  2IE6 A;  1G5N A;  1S9D E;  4HRE A;  4EVH A;  1W7B A;  2ZHJ A;  4JXH A;  1ALA A;  4JWL A;  2HYW A;  4JMI A;  4D7R A;  1R8M E;  1DM5 A;  1AEI A;  2IE7 A;  2ZHI A;  1YGM A;  2OY9 A;  4KMU X;  1AVR A;  2Q4C A;  1N00 A;  2H0K A;  1RE0 B;  4KN7 X;  4OIY A;  1AXN A;  1Q8D A;  2XO3 A;  3HJL A;  1AVC A;  4X9P A;  1MCX A;  1BC0 A;  4Q2S A;  1XT0 B;  1C1K A;  1R8S E;  4JMO A;  1BC1 A;  4Z21 A;  2ZOC A;  3BRX A;  1PBV A;  1ANW A;  2QEZ A;  1A8A A;  1QC7 A;  3SOH B;  1YJ0 A;  1W45 A;  2HYV A;  1BC3 A;  1BCW A;  1LKV X;  4A4P A;  1N44 A;  1AVH A;  1XSZ A;  2H0L A;  1HVG A;  2RAN A;  3ANY A;  2HSN A;  4JK1 X;  3AJC A;  4FHR B;  1A8B A;  4KN4 X;  2H0M A;  1W3W A;  1ANN A;  1N41 A;  3L8N A;  1BC9 A;  4L5M A;  3USW A;  1N42 A;  1BCZ A;  1SAV A;  1HM6 A;  1HVD A;  4C7P A;  1HVE A;  1R8Q E;  2K6X A;  1I4A A;  2HYU A; 
#chains in the Genus database with same CATH homology
 4C0A A;  1LKV X;  4A4P A;  1XSZ A;  4D7Q A;  2HSN A;  4KMU X;  2R09 A;  4FQ0 C;  4JK1 X;  3AJC A;  1RE0 B;  4KN7 X;  1KU1 A;  4OIY A;  4FHR B;  1Q8D A;  2R0D A;  3TW5 A;  3HJL A;  4KN4 X;  3LTL A;  3SWV A;  1R8S E;  1XT0 B;  4JMO A;  3L8N A;  1BC9 A;  4Z21 A;  1S9D E;  4L5M A;  3USW A;  3USY A;  4JXH A;  4C7P A;  1PBV A;  4JWL A;  1R8Q E;  4JMI A;  1QC7 A;  4D7R A;  3SOH B;  1R8M E;  2K6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...